4FK8A

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264 with bound fad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
254
structure length
247
Chain Sequence
KFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVEGRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
total genus 79
structure length 247
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4fk8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4fk8A02
3VNUA 3OZUA 1AIPA 1YIJB 1QUEA 3OZWA 4Y9RA 2VNKA 3CPWB 2NPFA 5TV2A 4YAOA 3CD6B 1KQSB 1H85A 1VQPB 2QTZA 1FNBA 1ZM2A 3WNCA 1GR1A 3MMPA 3AVYA 3WYAA 3AGQA 3I56B 4PC1A 3U2QA 4ZCLA 3AVVA 4RD1A 2BSAA 2J7KA 1QFZA 1VQLB 4PC7A 3CXCB 3WXMA 1VQ7B 3SJZA 2BVNA 4PC3A 1CQXA 1BX1A 3QSYA 4B47A 1E64A 2YWEA 1E63A 2QN6A 1QUFA 3VMFA 2YWFA 3W5VA 4B43A 4TN1A 2XNCA 2QDXA 1EFTA 4YALA 1JNYA 3CCSB 1BQEA 1IB0A 4B44A 1ZM3A 2QEXB 1DDIA 4K1XA 3MHPA 3W2FA 2BGIA 3ZZTA 2GQFA 4H9GA 3U6BA 1E62A 2XNJA 1QFJA 4AC9A 1FDRA 3G71B 1R5OA 3CCMB 1D1NA 3ZC3A 4RD3A 1R5BA 4TMXA 4RD6A 1S0UA 4YAUA 1ZM4A 1NDHA 3LVBA 1G7TA 1TVCA 2D74A 1QGZA 4DQKA 3W5HA 3LRXA 2PLFA 2C77A 4RD0A 3B8HA 4FK8A 2VYQA 2QTLA 1KK2A 1VQ5B 1AMOA 5JBQA 1GAQA 3QFSA 1D8TA 3WBJA 1BJKA 2YWHA 1Q7YD 3W5UA 1VQOB 3CB4A 1K9MD 1QG0A 1G7CA 3AVWA 2HMAA 4M0LA 4M1KA 1FRNA 3B82A 1YJWB 1M90D 2HDNB 4G1VA 4LBYA 1XB2A 5TR9A 4QFMA 4UAJA 1OB2A 2OTLB 3W2EA 2B7BA 2XEXA 1R5NA 5THXA 5DSZA 1YJNB 4J0QA 1KK1A 1VQ8B 4MYTA 1TLLA 1W35A 1JJ2B 4B3XA 4WQMA 4LBWA 3E1YE 1YJ9B 4P6VF 3CCQB 4NBSA 1KK3A 5H59A 1QH0A 4NCNA 1CNEA 1VQNB 1CNFA 4RD4A 4DQLA 1GO2A 3LO8A 1EWYA 1SM4A 2C78A 2R6HA 1OGIA 3CC4B 4MYUA 4U9UA 3QFTA 2AHOA 1D2EA 1N8RD 1TTTA 1K8AD 1NJID 1KK0A 3AVXA 1QFYA 3MCAA 1OGJA 1F60A 2HCJB 1G7SA 1TUIA 4HE5A 5TY0A 1QX4A 1YI2B 3E20A 3CRZA 3PENA 4FN5A 2PMDA 3J81k 3OZVA 2FX3A 3ES9A 3CCVB 2VNIA 1W34A 3CMEB 2OK8A 1S72B 4Y9UA 1IJEA 1ZM9A 1EP1B 3QFRA 4PC6A 4RCZA 1EFUA 1J9ZA 4AF6A 1KD1D 2EIXA 4LBVA 2VNHA 3ZZUA 1Q86D 1VQ6B 3CCLB 2VZLA 2PIAA 2YWGA 3W2HA 4TMZA 3I1FA 3G4SB 4IW3B 1KJZA 4RJLA 4QHYA 5GV7A 4B48A 1H42A 1WDTA 2DEUA 1GVHA 2QMUA 1JA1A 2VNJA 3VNVA 4BPRA 1KTVA 3JQPA 4TMTA 2RC6A 2B7CA 4Y7CA 1QVGB 1HA3A 2OTJB 3CW2A 1FNMA 1W87A 4R71A 4G5GA 3QE2A 1DG1G 4PC2A 3WBKA 3CCJB 3CCRB 2DETA 2BN4A 4P3YA 2BV3A 2QA4B 3I55B 1EP3B 5FA6A 1N0UA 1GJRA 4ZCMA 4ACAA 3CCUB 5EMNA 3AVUA 4Q7JB 4ZCIA 3P26A 1N0VC 2BMWA 2DERA 3W2IA 4ZGNB 3CC2B 1G7RA 1Q82D 4PGOA 1XE1A 3CMAB 1OB5A 2BPOA 1VQ4B 4FWTA 3OW2B 1JB9A 4N3NA 2X3UA 5KSWB 1DARA 1QGAA 1KC8D 1K73D 4ZGQB 1QGYA 4M2LA 3G6EB 3A1FA 3AGPA 4RD2A 4ZV4A 5AN9A 1QVFB 4ACBA 3FJOA 3B78A 4AF7A 3WNBA 1FNCA 2OK7A 3P27A 1ELOA 1DDGA 1YHQB 3VO1A 2ZITA 3W2GA 4M4SA 1Q81D 5GV8A 4F7DA 1B23P 4M53A 3ZBTA 1U2RA 4HE6A 4B4DA 2EFGA 4EH1A 1EFCA 3JQRA 1F20A 1IJFA 1FRQA 1I7PA 1VQMB 1YITB 3QFCA 1EP2B 2BM1A 1EXMA 3V76A 2BM0A 5HXBA 3FPKA 1UMKA 3ZBUA 4RCYA 4YHBA 1ZUNB 3JQQA 3CCEB 4TMWA 1VQ9B 1W2BB 2E1RA 3U6KA 4LBZA 2GPJA 1GAWA 2BF4A 3OJXA 2CRVA 4C43A 2B5OA 3ZZ0A 4G1BA 1KRHA 3WY9A 4N3GA 4YAWA 2RC5A 1JA0A 1SKQA 3VO2A 2BGJA 1FNDA 3CC7B 4YAFA 1B2RA 2DY1A 2CNDA 3AVTA 1BX0A 3WNDA 2DCUA 5H5JA 3LYUA 4TMVA 1VQKB 1A8PA 4LC0A 4C0SA 1M1KD 3OJWA
chains in the Genus database with same CATH superfamily
3QUTA 1UFQA 2DQ4A 4OU5A 4KSYA 1K66A 2B7LA 4KQJA 2NXWA 3IEUA 3WAGA 1P9OA 2PL3A 2R48A 1DCFA 2PKQO 1WPGA 1TMOA 3I2YX 3HKDB 3M4ZA 3QLVC 1CY0A 1B0PA 3TZ6A 2HTEA 3GGJA 1H2YA 5DLDA 2GH1A 4YIKA 4N41A 3OUZA 2BHLA 4XN3A 2OCGA 1QRSA 3RUEA 3N1UA 1QG6A 3KQQA 5ELMA 2XQJA 3F2VA 3NIBA 3OTWA 1RHMA 3PIIA 3CHYA 3A7DA 1N2ZA 5JR3A 3PEUA 5BMVA 1OH6A 3FWYA 3GZTB 2AG1A 2VPTA 5CVUA 3ZHVA 3GI1A 4CE6A 4EHFA 1UAGA 3MFQA 4YY3B 4PV7A 2E1BA 2CUZA 3L8CA 3I30X 3UUWA 2JRLA 2WA1A 3YASA 3MMPA 3AVYA 2C2HA 4A0QA 1QIHA 4DILA 1THMA 4D0SA 4IXDA 1J4AA 2ZYAA 5FPHA 2BYTA 3NRBA 3I6MA 3JYOA 1RE0A 3X3HA 2X5JO 2FFHA 3R6LA 3WL4A 4NJEA 1ADBA 2C42A 4K3UA 3UA3A 1N9GA 2CNWD 1H94A 1SVNA 1JXMA 2HA6A 3CP8A 4E1BA 3KZOA 1HDYA 2YXPX 3KFXA 5F5LA 1U8YA 2PMEA 1E2UA 1V3UA 1OXBB 2XNDA 2FN4A 2I1VB 3OEYA 3T53B 1CQXA 3PUVA 3PNVA 1M2VA 5TC4A 3EEBA 4PG4A 2J0QA 2Y66A 2AG5A 1ZLYA 4X85A 1L4GA 4IAOA 3TIXB 3A0RB 2YZMA 5A04A 1YTUA 2ZSUA 3IIJA 2X0IA 3NBYC 4AP5A 1M2OB 3UJ7A 3QEJA 3PHCA 2PQMA 3W5VA 2I3GA 1KQFA 2AOTB 6NULA 1TAGA 3IVGA 5FIUA 4RAOA 5I4CA 2OHVA 5DBIA 4DG5A 1PFKA 4HXGA 4DW8A 2ZZFA 4PRZA 1P0MA 2XE7A 3KAPA 2P5YA 3O31A 5BRNA 3KCQA 2ID8A 2EERA 2OXFA 1B0UA 2PHZA 1DTSA 1UFVA 3E5RA 4KQ9A 1JBKA 1GKUB 2Z08A 1T9HA 4H1WA 1IB0A 1ZM3A 3ZV5A 3RH0A 3OLVA 4K1XA 1NC3A 1VB3A 1G1MA 5ALIA 3E58A 2E49A 4V02A 3BSYA 1BMDA 4RV9A 3C5WP 1NL3A 2C00A 4P0PB 3NGXA 5GP1A 3TB4A 3NXKA 4NF2A 1YI8A 2RGGA 2QRKA 4RULA 2ZRBA 3KOWA 3U1TA 1J9GA 2FETA 2P9QA 5FF9A 2ZRFA 3LWBA 3M70A 5EHGA 3FOEC 1PR2A 3EZ6A 2E21A 4U1RA 5H7XA 1BCSA 1S0UA 5DHPA 3AFNA 3WYEA 5GZ3A 1XFDA 2LIVA 4KSBA 4IKPA 1KAGA 3V97A 1TGYA 1R12A 1RRGA 5ARBA 4WFJA 1C30A 2CGEA 4IOJA 4M37A 1XRJA 1Z75A 5TQ0A 2FRVA 3RRBA 3CPSA 3NTQA 4B71A 2NUPA 1YS7A 4QOFA 1NN0A 3OCCA 5IVIA 4BCCA 1EX7A 2YBDA 2W6OA 3NVDA 5AVQA 1XZHA 3VV3A 3CVWA 2CLLB 1P1JA 1RAHA 2FWIA 2D06A 3JY6A 3GR6A 4JBLA 4JX9A 4NYIQ 4PYKA 3ZZNA 2IC5A 1PTJC 1I7LA 4FUQA 4G0XA 4TROA 4TYPA 4AMVA 3D6NB 3IODA 4BKMA 4F2GA 2W6IA 1XNJA 4NBUA 3WLAA 2IV3A 1J9EA 2FSVA 3GGOA 5FTWA 5GY7A 1E5TA 2XECA 3E5NA 3GXBA 3HGQA 4KP7A 1NJ5A 5U4QA 4DYVA 5HSGA 1VE5A 2QRMA 2ZDHA 2ZTLA 3I37X 1GAQA 2FZWA 3BXEA 3FNFA 3KT6A 3SAJA 3WLMA 5ALKA 1DC5A 4BE9A 2FPGA 4J94A 2OLJA 3IBFA 2HDOA 2AYXA 2PQ6A 2Q0QA 3H7IA 5CITA 1PNRA 3LUJA 4E2YA 5A4MS 5KO2A 3PLAE 3R3JA 1P5JA 4NKRA 1CZNA 1JKJA 1XRSB 3O3CA 1NMXA 1D04A 5K1ZA 4QXRA 4B6JA 1PR1A 3WJAA 5LYJB 3U7FB 4BV2A 4G65A 1M90D 4EI7A 5JH7F 3RHZA 3PUIA 3P9YA 5KTYA 6REQB 3ZD6A 2C4HA 2ET6A 2GBGA 3ZE6A 3SJPA 1DAHA 1FVXA 2ZKLA 4WK2B 4YRNA 1HOXA 1Q7CA 4PLVA 4EQZA 3R7BA 4CKCA 2BGNA 4DREA 4FZVA 3ETNA 2W4MA 1FUIA 2NP6A 1TRHA 4JNCA 4DV5B 1AM4D 1B2LA 2GEVA 2XEXA 4JP8A 1M0TA 3HR4A 1YDMA 2GARA 4PSAA 4TV9F 4OB6A 3WDMA 2J6CA 4DOMA 3QEBZ 2PU7A 4ZAYA 1C9KA 5HS4A 4BZQA 1KJYA 1QIJA 1DU4A 4QNMA 4B3TB 3ZWWA 3R40A 4M6WA 1CR2A 2WUGA 3R3HA 5G3YA 1YI0A 1BXKA 3BWYA 1AUPA 3GVPA 4V0QA 4YCNA 3H9UA 3MRVA 3CNBA 4JLUA 4BWVA 5L7TA 1P81A 3WO1A 4DLBA 4YXFA 3BG5A 1ZCJA 4U2FA 4XLHA 1UT5A 1ZN9A 4BN4A 5DM4A 1EK2A 2C9MA 2ZL7A 5LB2A 3QXXA 3DOHA 4WTOA 1IWBB 1W581 3DAYA 2OZVA 3TJMA 4I1OA 1E1LA 3U7IA 4HAOA 1Z68A 3WDKA 1QO0D 2WICA 3M34A 3HUDA 4MUNA 5E8JA 3HDGA 2AQHA 4MMXB 1MU0A 1EFVA 1SK9A 3PHHA 1TF5A 4H3KB 3LO8A 2H57A 4KXXA 2NVUB 3UN1A 2AJLI 3UWPA 5I8WA 2X6TA 2GNOA 4IJ6A 4N0MA 5K0CA 2WMDA 3AV0B 1ODIA 4PG7A 1VIAA 4BZWA 3PFIA 4D9JA 4EIWA 5KJ6A 4A8JC 1UBKS 3RABA 5HIKA 1WKVA 4MEJA 4DEYA 3MGCA 5TGTA 4X06A 3COWA 3BMNA 3GIWA 3RYIA 4JLAA 1P17A 4D96A 3OLCX 2B21A 4JL8A 4NP6A 1W1UA 3QFTA 1DZ3A 4UDOA 1PWHA 2V6FA 4O2BF 1T5EA 2VJLA 3IOEA 3S99A 4Q48A 3TINA 4ATNA 3N05A 4C7XA 1P7PA 1EA5A 1YVRA 2VDPB 4BZXA 3CMMA 2ZSAA 1N6OA 4G09A 4DR4B 4ILKA 3R75A 2M2IA 3I12A 3A1SA 3OZAA 3GVKA 1FQJA 2O3TA 1N92A 1OI2A 3OZCA 1JPNA 2YYSA 4RW0A 4XKJA 1W36D 2UAGA 3TSWA 1TUIA 3QNUA 1JR4A 1EVEA 2XB6A 4JBYA 4QDTA 1LGYA 4OEHA 4OJYA 1NIJA 3ZGYA 1USUA 2W71A 4EGAA 5BVGB 2WD7B 1XF1A 1Z4NA 4FP9A 5U1PA 1QWSA 4K9RA 3TL3A 4CQMB 1G0NA 2H1IA 2RHDA 2VVTA 3EAFA 1C1DB 3N2GA 4TKMA 1MJGA 4JA2A 3GIDA 1P39A 4LDPA 3QM1A 3I5UA 1V0JA 5EMKA 1W6RA 3WMRA 1DWUA 4X44A 1ECPA 2GPTA 3FR8A 1DAMA 1TXGA 4KLAA 1JG3A 3IUQA 3SEZA 3ETCA 3VNBA 3ADKA 2J09A 4Q24A 2HNAA 2I54A 4GMXA 4KXYA 1JEYA 1KFKB 4RY0A 1KP2A 2NUAA 1Z4OA 1U7WA 3C98A 2J9ZB 3QW4B 2BZSA 4PRYA 3RUCA 2PX3A 3T95A 4YCSA 2ZUTA 3FE2A 4Q1VA 2ONJA 4Z4CA 4ZAZA 1WS6A 4PU0A 4BNKA 4Z0NA 4ZP1A 4ER5A 1DO0A 2XE8A 3NBQA 3I6BA 2I34A 3F3SA 2JFXA 1NHGA 4HWTA 3FUXA 4LHYA 1NGSA 3RYCA 3T51B 1WR8A 4WNYA 3I1FA 2VJMA 3BK7A 3G4SB 1ZAYA 1U31A 3ZWYA 4H4DA 5E9AA 1KY3A 4NCKA 4KO8A 2AR0A 2QYOA 2IOQA 2VPXA 1OFUA 1ZH8A 4MQMA 3RIYA 3OMXA 2XIJA 1KVRA 4M9QA 3EIUA 4OBWA 4CMKA 3VPFA 4MWOA 5EJGA 2AOUA 4HWOA 2QI9F 1I6LA 2KMLA 1TC2A 1PW7A 4IIVA 3MILA 5AVYA 4Y9SA 1ZPDA 2RBGA 4H7EA 2W43A 4Y7CA 4R2HA 4BMXA 3ZU5A 5A4AA 2DF8A 4MS1B 3BCSA 4QG7A 2ZKIA 4S04A 1PK8A 1W87A 1YVUA 5TMEA 3EUFA 4XCVA 2XXAA 2IS2A 2P2ZA 3BYZA 2MSNA 3OC6A 1ECJA 3VR6H 3ZHOA 1I7DA 3TUIC 4HYYA 4YMGA 2JVJA 1EGVB 2VKQA 4QVKA 2BSQA 1LU9A 1NQUA 3AV3A 3KSRA 3UWOA 1C3JA 2P9ZA 3EIHA 2F64A 4PZAA 4IYRA 5CXSA 1CB0A 1Z12A 5CHEA 1GKIA 3FAZA 5ALLA 1VHDA 4EVQA 4NNPA 5K51A 1PZGA 1YBAA 2C1ZA 5AUNB 1JG7A 4UUAA 2PYIA 4TTQA 3V80A 1QHEA 4Q4HB 1X87A 2QMYA 1Z16A 4QAQA 5BYAA 3BZBA 2IYYA 4ZCMA 1I8TA 1KO1A 1RWMA 1ZI6A 1ZOLA 2NQ2C 2QRGA 3A1VA 3H2HA 5KJ1A 1Y5IA 3OQJA 2CN1A 1QQAA 3B7GA 4XLLA 3A6EA 1JIKA 5C5CA 1RYHA 4E3ZA 3DTVB 4MUGA 4WFIA 1MG0A 2V0NA 1ZR2A 3P26A 3ZGXA 1GYPA 1MN6A 1TT5B 3QU7A 5SY9A 4DSZA 3K4QA 1VLHA 2WD9A 2PS1A 2WAOA 1XE1A 5BQOA 1UAAA 1QO7A 4R8RA 2IBTA 4E5KA 3L0YA 1SU6A 3DUFB 2UUOA 2PVCA 4E1VA 1S6YA 1VP9A 2QLJA 3A9VA 3FDIA 2WZNA 4M1MA 1N5DA 3AIIA 3NUGA 4I5EA 3GUVA 5KSWB 3NHZA 4FS8A 1KDTA 2I9KA 1AXEA 3N7TA 4JELA 4BRUA 1S7CA 5CA0F 1MEOA 2HJHA 3OIUA 4PM4A 3DEYX 2H5JA 3A1CA 5JTTA 4CVNA 1Z5GA 4RY9A 1LI4A 2VPIA 2VZEA 1YTLA 3T3PB 3BRSA 5D5QA 4RD2A 1NJ6A 4EKGA 5F4OA 2Q41A 4ACBA 4P1VA 2GAAA 2H2DA 3B78A 1CY4A 1HLGA 4Y67A 3KL9A 4AF7A 3K0KA 5FPPA 2VNAA 2NQ8A 4FGZA 3M1AA 4NK5A 2AZDA 4O2AF 3B1FA 1TO1E 2H9YA 4F21A 4RIGA 3L0CA 4C29A 2IQIA 4QUZA 3EQ8A 3TXAA 4EO7A 1D2NA 2ZJ4A 4GVXA 4AJLA 4G9GA 2PXCA 3ICEA 5C51B 2J30A 3GJRA 3P20A 1JBQA 1TU0A 1G8SA 2XA2A 4L8WB 2ZS9A 2EJVA 3C7CB 1K8RA 2E82A 3G82C 2REBA 4IGAA 4LEIA 4P4SB 5DTEA 4FM9A 3W3AD 5C81A 3WGVA 3GFGA 1MOPA 2WIKA 1T15A 4PWYA 1A9ZA 4M8NE 4RMGA 2LRHA 3T9FA 1QYRA 3ZBPA 4AWAA 5C7OO 5CFRA 1YS6A 4JLNA 5TVGA 1P77A 1YB6A 3RARA 1R64A 2X6YA 2B83A 4QX6A 3RVMA 2OMEA 3T8YA 1Y3AA 3OO0A 3FZGA 1W48A 1XKTA 4H27A 3IQFA 5DCLA 3JQEA 5KI6A 5IWCA 2B8JA 3CMCO 3MJRA 4JQOA 2X0DA 1NVTA 1OXMA 2ARKA 2F00A 2O2XA 2CV2A 3NI2A 1NE2A 4IDOA 4F0JA 1BE0A 5AVVA 2C5LA 1JDBB 3NHAA 4IL5A 5DYIA 3QLVA 2GF0A 1KO8A 2X2OA 4DMLA 3CX4A 3K5WA 1L7VC 2NXJA 3BDAA 5JNRA 4DA9A 4V1CB 2OO7A 2QZ9A 4LRWA 3EDQA 5K3FA 3ZI4A 3FYDA 4M36A 2BGLA 2NO9A 1CY1A 1UT6A 1Z4LA 2IU6A 3A4YA 4UCFA 1CHNA 2QJWA 3TE6A 1ETUA 4LISA 4JB0A 1IG0A 2ZQZA 3KUCA 2WJAA 4MB2A 3GJQA 3U49A 1GAWA 1UD6A 3ETDA 4CRWB 1WKBA 3OJXA 3OQ6A 3VZCA 4ETMA 4R3NA 2AOUB 3FVTA 1XLVA 2J07A 1CUWA 1XA3A 3DWEX 1SQSA 2VHTA 3LE8A 1PL8A 3KSMA 3WWEA 2CLEB 1ZGZA 3OSUA 4EFKA 3VSEA 3VO2A 5IJZA 4LYGA 3ZWXA 3QU9A 4AICA 2PE3A 5KWEA 2JJMA 4TGLA 1THGA 3GCDA 5EWMB 4FGUA 3WKEA 1CLUA 1UBTS 3HJAA 4I7EA 3RRNA 3HXOA 1B2RA 4PAAA 1NLUA 3IBTA 3ZLJA 5CYFA 1O77A 2PUJA 3H8WA 2A5FA 1D2MA 2PEZA 1VZ2A 4Q9NA 3MS7A 2GO1A 4PGHA 4TMVA 4Q3NA 3FYUB 4UTVA 3N0TA 5ABPA 2UDPA 1GZ7A 2Y05A 7YASA 2O8BB 5KTMA 4JP5A 5HZKA 5GM1A 5AKZA 2SKEA 2W90A 1K5HA 1XP5A 2WJYA 1SXJC 3HB7A 5GAJA 3RS2A 1F8UA 3UXHA 1V4VA 4Q3EA 1VDMA 3ICVA 3OZUA 1C9EA 2Q6OA 1YIJB 1H2BA 5THKA 2WTUA 2OL4A 1FYEA 1HWYA 3MOIA 1NF8A 1JJAA 5E9JA 5C32A 1RHRA 3M5DA 2DUMA 2B0CA 4ZTZB 4XRRA 3TWOA 2Q6KA 3DAHA 3IUNA 5LYYA 1NHWA 2GR9A 2Z09A 3LSYA 4N0PA 3MEQA 2WD7A 3K1ZA 4PZ9A 2A35A 3HA2A 5F51A 3SC4A 4C4SA 3CZ4A 1EK1A 2Q9CA 4RGYA 2Z1NA 3G68A 5B12A 3THXB 5BUQA 4ZMRA 2A5DA 1JTVA 3ZS9A 1OXVA 3SE7A 3RSLA 5EZYF 4WFQA 2C7RA 1O97D 4WT7A 1GQSA 1RXIA 2FCRA 4AN0A 2UYOA 1KSJA 2YOGA 4I14A 2PJRA 1TM5E 5JATA 2ERCA 1KQOA 4F3YA 3G2QA 1JWAB 2ADMA 2EFYA 2F1RA 4ZCTA 3AGQA 1X2EA 3HBFA 2AN5A 1SBHA 4V0KA 2O8EA 4LJ7A 1XZCA 1GRVA 2XVZA 2GCEA 5G3ZA 4ITVA 1ESCA 3RT7A 2CHFA 4AKIA 1D9XA 2Q3CA 4NMHA 1X39A 2IP4A 2YWJA 3CS3A 4FINA 2VATA 2IUTA 1GHTA 2FQQA 2PGJA 5JAOA 2VHZA 5EE1A 4KMOA 2IU3A 4DBZA 5DEOA 4CI9A 2O8CA 2AW3A 4IILA 1HVXA 1O94C 1G8GA 2C54A 4U7TB 2FUEA 3V1TC 3SY8A 1TC1A 1XYYA 1OXTA 1YB2A 1YJ5A 2DQYA 4TM7A 2HA5A 1XDGA 4L3VA 4QUAA 3OP1A 2VDOB 3EUWA 2ZSFA 1E64A 2IKSA 5CM9C 5FL7A 3EZFA 1W4LA 4JLJA 3VMFA 1C1XA 1M10A 1P4RA 3PNOA 3BFJA 1FLVA 4YEDA 3N86A 4AN4A 5I9BA 5EHQA 3KTAA 2WWHA 3FAKA 4PHGA 4QZVA 1W88A 3RC1A 5BSHA 4HK4A 1QTIA 2QKYA 2ZBVA 3D7MA 3U7EB 3B70A 4IDFA 1WCYA 2UVPA 4C78A 2QTRA 2IW3A 2HWYA 4FSHA 4KBFA 1GXSA 1N2BA 3RJZA 4CHTA 3RC8A 4AZSA 1P1HA 1DDIA 1J22A 3MFYA 4JOQA 3SQDA 1D6MA 1NMYA 1E2NA 2Y2UA 1MEJA 3W2FA 3HADA 2CJYA 3ORSA 3WBFA 3NHBA 1DS6A 3T7EA 3H8VA 4H9GA 3VPDA 4V0MA 2A8YA 4WKPA 1FFDA 4H08A 3IR7A 4TWRA 4AC9A 2FJUA 5JAMA 5K8UA 3JD2A 3V8NA 3CCMB 3PEEA 3K92A 2BEJA 3LWDA 2OP1A 1HORA 2XEDA 1VCMA 2DUWA 4X8OA 1DRWA 1WUYA 2WZQA 4P7JA 4PW0A 2B1RA 4ZT2A 3KDPA 4RD6A 3PQ4A 4Z4FA 4QGBA 1WB6A 4DLKA 2E89A 4FMDF 1ZM4A 1WOSA 6REQA 1QRTA 3ZHZA 1PFQA 1SCUB 1XWIA 1QP7A 3KQTA 4H2DA 2ZS8A 3RFVA 1ZIDA 3QVLA 4XUEA 1QLJA 4YPFA 1L8OA 1YZYA 2GLUA 2O5VA 4ARUA 1UIMA 2DQSA 3CZMA 5F1OA 2QG4A 3NUQA 2XWSA 1AKQA 2YC4C 2W2VA 4YEJA 4HYTA 4P25A 1FDSA 2BP7B 5AW3A 6ABPA 2GEUA 2OTCA 1I6MA 2FHPA 2ZIWB 4G5HA 1KDPA 3W8RA 3OETA 2ZTVA 1P74A 1DFIA 3MGKA 4N5HX 4YA6A 9MHTA 4FGWA 1KBZA 3LY7A 1HE5A 3G8AA 1E1MA 1WY5A 2PZJA 3PUKA 3C7AA 3CNQS 3QKWA 2Z1DA 1ZD1A 4FPXA 4IV8A 3V1YA 4BKUA 4F1KA 1M6VB 4ML3A 5EERA 3CESA 1AMOA 1GNPA 1GZ3A 2IIVA 1E1NA 3QEOA 1ULHA 1XVTA 2CL0X 4MPRA 4EWLA 2CV0A 1A2BA 2Y0BA 1VJTA 1SUCA 1ZJZA 4U7JA 4ZVQA 4QM6A 5JDIA 1M67A 2FU5C 2CXPA 4I1UA 4XFKA 3QOFA 3VJKA 4OG2A 5SZIA 2ZJ3A 4M1KA 5BRJA 3NH9A 1KZ7B 4IJ5A 4NU6A 3V1UA 1ZJWA 2X1MA 4HFRA 3QX3A 2OYRA 3IDOA 2FEKA 3KZNA 5J5AA 1UADA 4MHSA 1VPDA 3TTWA 1RXWA 4QSHA 1YQGA 1Y89A 2B9VA 4YJFB 1CDZA 2ZFUA 4XLAA 1F6BA 1UPAA 1V16A 2EFEB 3EZYA 4FGKA 3H4MA 3V55A 4F9FA 1H9AA 2K2WA 1W2HA 1Y8RB 2RHRA 2VXYA 521PA 2HMWA 2FPWA 3SXPA 1MR3F 1F3LA 2EJBA 4HAWA 5AW5A 2C4NA 4QQNA 4UBIA 2GPYA 3VNQA 2XRZA 2XCTB 4KKXB 2VF8A 4KPEC 1ZEMA 4YS6A 2D9RA 1J6UA 3FOBA 5EP1A 3VZBA 3LHKA 1Z83A 4MYTA 1E5XA 3B6MA 2XVYA 4Z53A 2W2OA 2HQRA 4K2HA 7ABPA 1ONSA 3QVJA 4EHBA 3FSJX 4OQQA 4DABA 2C59A 3H18A 1XZEA 1P3Y1 4DR7B 4KQIA 1M8FA 1VGRA 1G3RA 2QM3A 2C2WA 2XODA 3QA9A 1KHHA 4QNNA 1J8VA 4BAUA 2VP9A 1ONNA 5JRZA 1L5RA 2IPMA 3TTXA 1WZCA 2P2YA 5DASA 4D5EA 1NVXQ 5HNKA 1X0VA 3GBSA 1Y8CA 2EP8A 1T1EA 4LFCB 4UU8A 1JH9A 2UUBB 1GPDG 3NTXA 3Q6RA 1M2VB 1XWFA 2IHNA 1XVLA 3NEAA 4DIDA 4C2TA 4GMFA 3PUYA 4I50B 4C05A 4NU8X 1SGWA 3T5GA 5J9FA 2I65A 1E6KA 2VN8A 2XYVA 2IK8A 4L07A 1UXIA 1YJCA 2H18A 3MINA 1V3TA 4F2PA 4DNTB 4IDBA 4ZHQB 3HUTA 1N5LA 4ISBA 3PE4A 5JYCA 1GNQA 2JH3A 3O92A 5MHTA 2IV2X 3FMGA 5C1OA 3DO5A 4G4SP 1R0CA 3HDYA 5IMBA 1KK0A 3AVXA 3LVRE 2GOYA 4RBNA 3RT1A 4C3OB 3M4JA 5HQ3A 5I7SA 2W83A 3MCAA 4Y2YA 1DKPA 4UPEA 2A9OA 3H5AA 3Q3IA 1M66A 3QQPA 4UEQA 4XX0A 5HMLA 5K0SA 4L7VA 5TRTA 3MWGA 4LJLA 5A3RA 1UZMA 2P91A 4Z9BA 4XDYA 4HT3B 3I28A 3A2KA 2YMMA 2B2CA 2OD7A 5DLQC 2VAPA 4OAQA 4BX2A 4D79A 4HQLA 5CB0A 1ZMOA 3GG9A 4PZCA 1P2BA 4M1SA 4L0DA 1C7QA 5HDQA 4TYYA 4CM3A 3B13B 2P27A 2GCPA 4W9MC 3C7KA 1OXSC 4O59O 1RZ3A 4MRRA 2ATVA 3TJRA 3OOEA 4ZAWA 1KC1A 3VSBA 1JYSA 4CMGA 4D4MA 3GJ0A 3DQQA 3NWOA 1DJPA 3I9V1 4GNRA 4QWMA 1EP1B 1IUOA 1SHJA 4CFYA 3ADCA 1VECA 1HDCA 2D0OB 2NZJA 1ZH6A 3DKPA 3EIFA 4KV7A 4BB6A 4CTNA 2D1YA 3P19A 3GJSA 3FVRA 4I9HA 2B5WA 2WM8A 4X8LA 3TLYA 4C22A 1N8KA 1ZGAA 4U7HA 5AM1A 2F4NA 2XNHA 1CUUA 4JITA 3EWIA 2QXTA 3KQOA 2ZZEA 2WJHA 3P5BA 4PGMA 2NX2A 4HGRA 4M0UA 3VKUA 1YR8A 4BO5A 2L82A 2HPHA 3KZKA 1HETA 2G88A 2J9GA 4JKYA 2DHEA 1E43A 5A71A 1BGVA 5DGCA 5JZSA 1WBDA 4RJLA 1WHSA 1UWCA 3ACBA 1V8DA 5K3AA 2WW8A 4YDSA 5EZYA 4EJ2A 3JD4A 3U56A 1AO3A 2G5CA 2PLNA 1OB0A 4D0GA 4RV5A 2V0GA 2ANBA 3L1UA 1VHOA 1NQVA 3R41A 1V41E 4MINA 1SWWA 3NDPA 1UBUS 1Y5MA 4OQPA 3MQ4A 1OH5A 3ISTA 3IPRA 4TMTA 2C3YA 2P79A 3BGDA 2RC6A 4UDYX 4JODA 2V5AA 2ZVPX 3DMNA 4BGEA 2NT4A 3HCCA 1X14A 1H2RS 2V3VA 3ZY6A 4O4IF 5LBTA 1QG2A 1TEXA 1HYGA 2Y1LA 4B33A 5JCZA 3AR9A 4JEIA 1N78A 1VLYA 2J7PD 2WDZA 5FTKA 3WGIA 1SBIA 4TS9A 1KF0A 1XC7A 1EXDA 4R7GA 3QYAA 4G0YA 4D3XA 5H9VA 4CKWA 3WBKA 1ULSA 4M0MA 4N0QA 3UT6A 4WE3A 2ZUFA 3SBXA 2XWQA 4GRDA 5F4JA 4I4TB 3C1TA 4HDCA 3VU9A 2JCSA 2BKLA 3IEPA 2KYRA 4HFJA 1YQ9A 4XONA 3PDIA 3H1PA 4PNZA 1KI7A 4LHEA 3V4VB 3DZBA 4H7KA 2Q8QA 3G0GA 4J3NA 1V5VA 4EABA 4B6SA 5F3DA 2F1LA 3DUWA 4M1EA 5I9TA 1N0UA 3TPZA 3CLVA 2BFOA 1JWBB 1DZIA 1NDUA 1L9KA 5EZSA 2WSIA 2OZKA 1R0KA 2BT4A 3PGLA 3AVUA 2DGDA 3QVWA 4H3HB 4BO2A 4NEGA 3ROKA 4DZZA 1TQ2A 5H82A 1W75A 2EW2A 2Z4SA 4JL5A 3T1OA 3H84A 3BIOA 3CWCA 3O8OA 3LKVA 4EF6A 2KPOA 3OCVA 2ZI6A 3FY4A 4JSTA 4O0MA 2BMWA 3GLSA 4OIMA 3VU8A 3VYUB 3W2IA 5BR1A 2J3QA 2P0YA 3LPLA 1U3VA 1X7WA 3TQHA 2OC4A 4QEKA 1Z6YA 5HWSA 4QYIA 1IM8A 3VKGA 5AXBA 3VYWA 3I05A 3UHOA 1L7DA 3AJ9A 2A2ZA 1PD1A 4YN3A 3NRCA 4II3A 5DTMA 3G2KA 5E6RA 5K6RA 2Y0DA 1RZRA 3ORRA 2ZIFA 4IQFA 4N3NA 5IAGA 3U16A 1G8YA 4QEZA 3GGPA 4ENRA 1V1MA 4JUFA 1O7JA 1BGXT 3PVDA 4ABYA 1WIWA 2EFCB 3AUAA 4WN3A 3ZV3A 4AZ3B 4YAEA 3ENNA 4KN8A 3ZH2A 3PYLA 3W7BA 1UDBA 2EJTA 4DDMA 2CLDX 4RHFA 3ON5A 5IDXA 2CE2X 1JLLB 1ID1A 2Q8PA 3P9XA 4PFSA 5IT9A 3DE2X 1QBGA 5A02A 4DA7A 3B53X 4RORA 3RSQA 4H1HA 2V0CA 4RMJA 2W2KB 1SVOA 2O1EA 3A3KA 5HJEA 3QENA 3WNBA 4ITRC 4BO7A 5KU1A 3T4EA 1U81A 2VJAA 1NBAA 3DGFC 3IPCA 3LNTA 4G63A 4N9QA 1R27A 3T94A 5FPKA 2A9FA 3BD8A 5JYEA 1GAJA 1VMEA 1YHQB 2NACA 2FP3A 3I64A 1O4VA 4HDMA 4NNOA 1EUQA 2P2LA 3LQYA 2TMDA 3QUQA 4OGLA 5KWJA 4W1SA 3RUHA 3O4VA 1FMCA 5F2KA 2Y0CA 4RU1A 3S7ZA 3VR0A 2HC9A 3DLCA 3PP8A 1N2EA 2FFAA 4WZBA 1RIFA 2J9FB 4MV0A 4JJ6A 5CLQA 3SYKA 3UMBA 3CX8A 4CM9A 2IGBA 3G7SA 4NDNE 1EHCA 1PJ4A 2Q28A 2Z8XA 5B2FA 3WHPA 2HQSA 2OOSA 1ZP6A 4KWEA 1A4XA 3KJFA 5AVWA 1UBSB 4CMBA 2GAJA 4QQRA 4B6FA 2ZT8A 3OE4A 2VTBB 1FDUA 5DM0A 8OHMA 1JAHA 3QFCA 1TUBB 2CYCA 4XOPA 2QX7A 3EN0A 2ZYGA 1ECFA 2H00A 2PA0A 2PWYA 1P5RA 1B6RA 2H16A 1TMKA 4J7UA 4G0MA 1VPLA 2M6SA 2BM0A 5D3MA 3H2YA 3U7RA 2O05A 3O8CA 4D3ZA 2RB4A 1VFNA 3N0XA 3FDJA 1YLOA 4HEHA 1RQLA 2YZGA 2AX4A 4G0PA 1A7UA 2VF7A 4PLHA 4RELA 5CA0A 3T5TA 3HVHA 1DKNA 1NN5A 1MIOB 3PEVA 2QROA 4MKXA 3KETA 2FWAA 1Q7GA 1X7GA 4NV1A 3U13A 1D0VA 5IAOA 4BGIA 4JP2A 1TQDA 2QSUA 2A3RA 1FFEA 1ZJ4A 2OAQ1 2R87A 1NZFA 2ZRCA 2KHZA 13PKA 1WUTA 3FSGA 4ZODA 5AKYA 5DNUA 2JKYA 4XA8A 5E3IA 2XD4A 4D9EA 1XELA 4KUEA 4HNGA 3ZHSA 4ZIRA 5CLFA 3ADBA 4BFWA 5LQUA 1T4BA 1XX6A 1C30B 4V0RA 5IZCA 3K71B 3H87A 1J8FA 3CUSA 1SHKA 2GN0A 1B1AA 3K0CA 1QAQA 3SHVA 1RKVA 2VHJA 1Y81A 4BDSA 5HJ7A 1UMDA 2HA0A 1SZPA 4LOIA 1SBTA 3VYVA 4ND7A 5CHYA 2OXRA 2IH4A 4B3GA 4YCMA 3W0LB 4YX9A 1QANA 3KFLA 4MVJD 2C7GA 1JQ5A 2IHYA 1TFRA 3CLSC 3Q3HA 5HEKA 4GQBA 1O94A 1JHDA 2WVGA 1CJCA 4QFBA 2AMFA 1W2GA 3CC7B 2E6UX 3DMGA 2VQ6A 8MHTA 3A8IA 2YN2A 1MJHA 2OHIA 2ZUDA 3G59A 3TIIA 3H16A 3OH8A 1KJ9A 4WOKA 4BYMA 2E6KA 2ACWA 3MOGA 2P0EA 2XAUA 3UFBA 4EKEA 4QJIA 4CEIA 2VTKA 3NLLA 1C4KA 1I2DA 3ETJA 2ZJBA 1KMIY 4RDIA 2A9PA 3RY8A 4NCHA 3FW1A 1NFFA 2N47A 4I50F 4JC0A 2AYYA 3TQQA 3D8SA 4NH0A 4C5BA 5AMXA 1VKRA 1DLJA 1ECBA 2CYBA 2HJSA 2ZG6A 2GA8A 5AHXA 4BMZA 1JFTA 1P61B 4KO4S 4LX0A 2G06A 3PZRA 4HGZA 1FP1D 3AFIA 3O74A 3LT1A 4JLMA 2L19A 2VTDA 4HEQA 4RF5A 3WFZA 3HK2A 1AB5A 1KQNA 2NO7A 3MERA 1VA4A 2IYRA 3ADPA 4IIJB 5MFZA 2CHVA 2OUKA 3OICA 3OG9A 1EGMB 5CGQB 1S4MA 1IZ9A 4ZWNA 1U2PA 5SZJA 3H4IA 1JPJA 2EJCA 4MR9A 2GF2A 5EKUA 1NRJB 2AFIE 1N9GB 1U8UA 1WSAA 1NU6A 2FSUA 4QRHA 3TD6A 4AXBA 3L7LA 2ZQYA 2O59A 3QXJA 4H7DA 2PX6A 1U1FA 4A0HA 2PYZA 3QEMA 1G5QA 1V39A 1R8JA 2Q9BA 2HLPA 3E7FA 1ES9A 4L8JA 5ICSA 2AFIB 4MS4B 4JEHA 2B2NA 4C6RA 4Y2SA 2QGNA 3OPXA 1FRFS 1Y42X 4N7BA 3N8DA 2O2CA 5G1NA 1JTFA 3V4ZA 2EBWA 5TQ2B 3AVVA 3P9CA 4HNHA 5GGXA 1DG9A 3IAM1 4DLXA 1L5HA 2W6ID 4E88A 1MIOA 1IYZA 1T4MA 1OKKD 9LDTA 4PC7A 1WETA 1SQFA 2BKAA 1C4XA 1TPYA 2YOHA 1E4VA 1QOQB 3OIGA 2WK1A 1WTCA 2O0HA 1VLOA 2BVNA 3RRFA 4JXJA 2B3DA 1NVMB 3O38A 3VXKA 2C0QA 3VOSA 1U94A 3SG0A 1OAAA 1S1MA 4KYTA 5G41A 1UFOA 3NG1A 3PUJA 3WGOA 3WOVA 2F1JA 4M54A 4E21A 4B45A 5CA1B 5HKBA 3LPAA 3FOWA 3BOSA 3H9EO 4KG7A 5AM4A 2CDCA 4P4TA 1T2FA 4M38A 3REFA 4PYIA 4EY5A 1M0WA 4YR7A 2I6TA 1RPTA 1EJ6A 2F48A 3T5BA 3PUWA 2NSHA 2WTNA 3O47A 4YHHB 1ZISA 1YULA 4YUAA 4PHHA 2QYTA 2G7ZA 2EEPA 3GNSA 2HCTA 3Q0IA 4HLNA 2QEXB 3DDNA 3D26A 4JNKA 1XEFA 4IZ6A 3WLIA 4CF5A 1C0KA 3S4YA 1HM5A 4EVIA 3BSSA 1RTTA 3QWAA 1YA6A 3EWSA 5T6BA 1E6MA 1OXUA 2Z2KA 4JJKA 4DLRA 2RGWA 3FF1A 1CZHA 3K2EA 3EISA 2QNIA 1HZEA 3GQBA 2GYYA 2AN4A 2F67A 2HJGA 2ZXFA 4P0TA 5JD5A 5CBPA 1UJ4A 4FOLA 1A7AA 1DIHA 2FAXA 1AQ6A 3GB9A 3RUDA 1F38A 3AW8A 3HQ4O 1B0ZA 4MHOA 1SZCA 4RZUA 5DIFA 4P82A 5IM4A 1VM6A 3EIOA 3TSZA 1QHNA 2D2XA 1L5NA 2AMLA 1BO6A 4GPTA 2Q0XA 1DAKA 3ZGNA 2BEKA 5FKJA 2P75A 4MQLA 4N3CA 3BJZA 3ZJVA 4RS4A 3U3OA 2SCUB 1Z0AA 4I9NA 2QU7A 2QMZA 2XUDA 3MB8A 4ROTA 5EIXA 2WKRA 1YIAA 4NATA 3TLAA 1E8NA 1XEWX 2VLIA 3LUGA 1K3TA 1KAOA 2BFFB 3PUZA 3W8FA 5KOIA 2JCYA 1JDPA 1DJNA 2RCNA 3TSYA 4BWYA 1F1JA 1V1RB 2BR3A 1FJHA 2Z1MA 1ACMA 4KQWA 3QX9A 4XB1A 1GV0A 3VTZA 3ENVA 3IJEB 5K3BA 4EKDA 5K8LA 3KR2A 3SU8A 5BN5A 5KIAA 3DVLA 3C8HA 1YHYA 7GPBA 4DCOA 1L4HA 4WBNF 3AO0B 1MPTA 4E12A 4MR7B 3D0RA 4KN9S 3QFSA 3G85A 1U5BA 4Y2UA 2CXXA 3KVOA 4XYGA 5DGTA 1PJ6A 4Q47A 4KSCA 3SQMA 3UXYA 5CFQA 2M98A 4KR9A 1QZZA 5K8CA 2IZ1A 4PXSA 5IT0A 4CLEA 4LCBA 1N2CB 4J90A 2PH1A 3KHUA 4KC0A 2FP4A 3ZLVA 4P2NA 3GMTA 3NCTA 4AVZA 1LV7A 1MX9A 4B3RB 3LPMA 3NHMA 4O8ZA 5ENDA 2Q1UA 3AVPA 4MI1A 2D7DA 2H11A 3L7AA 4UPDA 5EKDA 1CUHA 3EB9A 1N8NA 1MH1A 4WK4B 2C9ZA 4WK0B 3PFKA 4EY4A 2J4CA 3WLTA 1F8XA 3GMIA 3N7AA 4HDSB 1UOOA 5DXFA 2R1TB 1TJNA 1E9CA 2AGVA 3OCUA 1A7KA 2ZU6A 4RH0A 2C92A 3SDSA 5C8YA 2XCIA 4DPKA 1C29B 3MAGA 4P6YA 2EWVA 3BJMA 4F9EA 3O03A 4BP8A 3F2IA 4XOTA 2ZSDA 3C5EA 2O3RA 2XHZA 4JJFA 1FDOA 3Q87B 1E18A 5DMXA 2A57A 2ZLBA 5AM0A 2BFFA 1ZD2P 5IT4A 1GUDA 2YWDA 1D07A 3DEKA 1MT3A 3PB3A 1OX4B 4JJ4A 4LCEA 1Z62A 4J91A 4BTVA 1X9HA 1UEIA 3HKCB 1U0TA 3WLKX 1OI7A 2ZBUA 3A1EA 3LCJA 4P3KA 1EWTA 3HU2A 3HABA 3OZGA 1OWOA 4DQ0A 9GPBA 3F78A 1PDWA 2F8LA 1RM3A 3ITKA 1GL3A 2VJNA 2D62A 3I52A 3D5EA 3GA5A 1P6XA 3LL7A 3N2KB 3GXOA 3N6XA 3HN6A 2X58A 3DH0A 4DR6B 3EA5A 1USGA 4U4AA 4ZJUA 2XUPA 3MTEA 3U9SA 5KAMA 3L7YA 3LGAA 3L43A 4GPD1 1QV9A 1NVUQ 1XTUA 2RFLA 1KVSA 3GNTA 3EXG1 4H0CA 1XZMA 1P2VA 3GRYA 4YJGB 5DTJA 1X2BA 4RTOA 2G6BA 1P5FA 1EWYA 3MZ0A 2BW0A 1NJFA 3KSBC 5LMNB 3GUUA 3SX4A 3AKEA 4KDEA 2OKGA 1E96A 2O1SA 4PNPA 2V55B 1D4OA 1D03A 4FHFA 3SPXA 2YRWA 3SXUA 3O8QA 4ZANA 3D3EA 1B76A 1BNCA 1NW3A 2Z5FA 5CFLA 2WG0A 3HJFA 1H8ED 1JDZA 1NTOA 1JG2A 1RMYA 4GZMA 4CT5A 1WLSA 5I48A 3UVEA 2KLBA 2IYEA 2CVHA 1TTTA 3L0IB 4YJ2B 3CZ5A 1K8AD 2CUTA 3S7TA 1L5ZA 2ODAA 3EGXA 3MW8A 1KPHA 1IZYA 3HS3A 3A1WA 4KQ2A 2PK3A 2DR0A 4XM1A 3CN9A 3H9JA 4ARSA 1ZRMA 4RKFA 2Z9BA 4LNHA 4I4NA 4IHAA 4D41A 4ZDJA 3WL8A 1NBHA 2Q0HA 3G0OA 3RD5A 3G2OA 3K16A 4MCJA 3NBFA 2QGFA 4XLTA 4B31A 1DQPA 2C7PA 2MSLA 2I99A 4MVJE 5KKAA 5AVXA 4OUKX 5LQAA 2FW1A 5FNZA 3R9KA 2BGUA 4Z4VA 3V8QA 3EXHB 5JFOA 3OZSA 1V37A 2F8TA 3AJ8A 4O2BB 3A1DA 4KQHA 5B4TA 1XNQB 3IQZA 3FPHA 3HO1A 4LYFA 4OGKA 4GLBA 4UATA 1H2EA 2CD9A 4HYEA 2R86A 4ZVTA 2ID7A 1BVUA 4ZK6A 1W5BA 4R1SA 2AFIA 2PQ2A 2W2LD 4MS4A 1C7EA 1JECA 4N65A 4EG6A 1O6CA 4F2HA 1XUOA 4KJZA 3KWFA 3MJCA 1Z88A 2AR9A 3EDMA 5CLIA 4CUKA 3NORA 3ZPNA 1VBMA 1JAXA 3JALB 4LBVA 2UZ0A 3L0OA 3MINB 3VDNB 3MUNA 5ECDA 1AUOA 4IIHA 3FPEA 1DC4A 1P8AA 4BVFA 5WRFA 1DQZA 1SRQA 3MS4A 4CM4A 4RDXA 1BKSB 5IUJC 1NQ5A 2BMDA 4NEHB 1GRRA 4WD3A 4QLOA 5ULLA 3J81A 2F4VB 5IW8A 4BJ1A 2A67A 5GZ1A 5KTNA 2A33A 1ZCBA 3DHWC 1BZYA 2NN3C 4EMUA 2JLRA 4B48A 3B3GA 1DX9A 2GAFA 3G0CA 5FAXA 2FRXA 4DV3B 2PJDA 4UARA 5BV0A 1G55A 2FFRA 1SN7A 4F4DA 3VNVA 4OTZA 3UAXA 1YDGA 2WUDA 3GRFA 4JGIA 5JSFA 3HXMA 3DAFA 2JIBA 3HNPA 3UB4A 1KTVA 1GILA 4S05A 1A5SB 2Y1GA 3HA5A 3I6YA 1JJ7A 1UKAA 1ZJ5A 1JZQA 1PWXA 3H3JA 3LDHA 3ROGA 3P2JA 5M04A 1UKYA 1BXRA 1ZH4A 2X9VA 3AR2A 3M49A 1F6DA 3T12A 3ONDA 4Z2AA 1ZNQO 1WSVA 2RI6A 2V7XA 5FLKA 1RSZA 2CMGA 4TOIA 3RW9A 1JALA 5HZGA 4NHEA 3HPRA 1DAPA 1BHQ1 1MO3A 4ND1A 1B42A 2V7QD 3AFOA 1R8XA 2IKQA 4NCJA 4RA6A 2YCLA 3TB6A 3PC3A 4CU2A 3V4OA 4P31A 1P0FA 3CCJB 3CCRB 2DAPA 4XVCA 3MMNA 1U8TA 3L4BC 3E23A 4P3YA 5FBKA 4A82A 3K6SA 1TUEA 5JAUA 4U2EA 4F4HA 4S35A 1QM5A 3AKZA 3DBRA 3L6OO 2W6NA 2YV3A 2ZTNA 2UYYA 2DR2A 2CBXA 3SBDA 4DMUB 5AFSA 2WINI 1BMFA 1HDEA 1NMEA 4RM2A 4WLUA 1Z5PA 1IY9A 2JGNA 1NW5A 2HSDA 1NXXA 2ATIA 3I2JA 3IUJA 2GZMA 1M1UA 5DHTA 5DRTA 3B7PA 4ZIRB 3LYHA 2WF5A 3VDMA 1NW8A 2VHYA 1L5HB 1Y3CE 1NUSA 3IQDB 3M6XA 1GSIA 4K6KA 4CIYA 4MV6A 1Q83A 1N0VC 3TDMA 3H1FA 4Z3KA 2IEGA 4F12A 4ZCRA 3UJBA 2QD3A 5L6MB 1ZMRA 4P7KA 4PGOA 1ENZA 1OKKA 5CA0B 1XPUA 1YH3A 3HKBA 1ZVMA 4UOQA 1OQAA 2OM2A 4QYXA 3TZKA 3HKEB 3UAGA 4YRQA 4R98A 3GRPA 5AVUA 3TAXA 3QBDA 4INPA 2LCFA 4ZHSA 4HFNA 1XA0A 4XD7A 2YVKA 1DIAA 3SOZA 5ALTA 4CKZA 1Q19A 3N76A 1EP9A 4R83A 3GFFA 3S2FA 4V1CI 2JLZA 4B3SB 1XZQA 3OSZA 1C3VA 1OYVA 4EPVA 5HS6A 4Z0TA 3CF4G 5BSFA 2Q3LA 2R8YA 3EOBI 4TZKA 1VMIA 3NM5A 5T57A 1G8HA 3LDAA 1Y3IA 1KDVA 3RKUA 4XCXA 2ZANA 1G5IA 1T3LA 3RSOA 3GFVA 3OWHA 1JR3D 5IZCC 1GPMA 2DJ5A 1PG5A 2XIQA 2PFKA 3K0CC 1I4TD 1FNCA 2RKBA 3RVKA 2PS3A 4MGHA 1KDYA 5BXQC 1VJ5A 1DBWA 1Y6QA 2XRFA 1MRSA 4YP0A 3TL6A 1VMKA 2OZLA 3QF7A 4EBBA 4E2XA 2OV3A 4HP8A 1GDTA 4G5FA 3CJQA 2VG8A 1O6FA 2F3PA 3R0VA 4KHZA 4HDKA 3VYSB 1EQ2A 1FXSA 1SHZA 1ORDA 1SUDA 4PO1A 5FOXA 1XAJA 4YQZA 3V7NA 4F84A 5A3QA 2JZNA 1VPWA 2ZZMA 2EKZA 1ZD8A 1E3TA 4NDAA 4W9NA 1FFXB 3K6RA 4AAYA 5IT5A 1D0IA 5ALOA 1SXQA 1JG1A 1TRKA 3ZLTA 1QH8B 4FXPA 1LQTA 2JFOA 5DI3A 3O4FA 4HGYA 1ST2A 4M46A 4DKXA 3FPGA 5ALFA 2OZEA 1XCOA 4F6RB 5E7JA 3WADA 2XADA 4ARCA 4KE7A 2JIDA 3NBMA 5FJIA 1TZBA 4RENA 3CVVA 2P35A 4E4TA 3GDFA 2PZGA 2OA0A 1JU4A 2AD5A 2ZYRA 5DLPA 1V7QA 2QR3A 2VP4A 1LRKA 5THQA 5GINE 4FW8A 1D4AA 3T3OA 3D1VA 3ZQKA 4NLLA 1V5EA 2C9YA 2OSBA 4AIIA 2ZL5A 4LXIA 3VZSA 1QKJA 3EJWA 2YYAA 3GNLA 3BRCA 1UCFA 2O5CA 3CEHA 4BJ6A 5K0BA 4AFNA 1AMUA 2ZULA 4I1SA 2DPLA 2V4ZA 4FCWA 3T7TA 4HLDA 5FWDA 1HYEA 1XZGA 3A6ZA 2CVQA 3HY4A 2Q4BA 4P53A 4UUMA 4ZCSA 3WIEA 3F9CA 3L07A 5H4GA 5IDVA 1PE0A 5KX5A 1MUUA 2XI4A 5HIJA 4YREA 5DYNA 3V8BA 3ZNNA 4PEVA 4YT2A 3TW0A 3ID6C 4NPCA 4U3JB 2IPLA 3BX1A 2JIQA 1TYDE 3DJYA 1WP4A 2B5OA 2DFNA 2UVQA 1JLSA 3K96A 3IUSA 3V9AA 3U4MA 4Z0HO 3VDQA 3MD9A 4BB5A 4I4CA 4O4LA 3RRZA 4XYLA 1LDNA 3DBHB 3EPHA 2CEAA 4I4TA 5AP9A 1VYHA 3DS8A 3P0IA 5I7UA 1CJUC 5EHNA 5GVRA 3P94A 4FE3A 1OFTA 2ZRQA 3O9MA 1PVVA 2JCVA 2OESA 3EDCA 1X1CA 3PZBA 3JQGA 3AVTA 4N49A 4DR5B 4GXRA 1USWA 1JUDA 2XYHA 4NULA 3NFRA 5F7JA 5F4MA 3B85A 5TMPA 2BOVA 4X61A 3V8MA 2NU8B 4EMBA 1HH4A 5E6UB 2X2EA 3X43A 3GUYA 3OTQA 5C4MA 2CE7A 2DSNA 1Z0IA 2XQIA 4L15A 5IZ4A 2NIPA 3JVIA 2X22A 4RIIA 4MW5A 4C0KA 7REQB 1MOZA 3BSFA 1ENYA 2IXGA 2YV1A 4NZMA 2Y1OA 1MQ8B 2ZETA 5AVKA 1QUEA 5FHRA 4L0MA 3WS7A 3WNVA 4D9CA 4RGQA 4X0CA 1UC8A 4OOVA 3GGCA 4KNVA 3WLJA 1BTOA 2XX3A 4EHAA 2OWDA 4L8FA 1CUSA 3L77A 4PFQA 5K9ZA 2C5HA 3CPWB 3WZMA 2NPFA 3ZWPA 4NWIA 5DHAA 4YAOA 3EUEA 4BFXA 3RNOA 4PYRA 3FVQA 2QMHA 2G4VA 4P92A 3KJZA 3OP4A 2PAFA 3HG7A 4G37A 1SQ0A 3HM2A 4R8VA 1ZXBA 2PUWA 1QE3A 1JHMA 3BGVA 4FZ3A 4M8LA 2NTYC 3C74A 2F59A 4JXXA 1JEDA 2WIFA 3LBFA 2ZAOA 1Z4MA 1YZKA 1FDVA 2VBUA 2LZ0A 2XYQA 4AG6A 5BMOA 1RZRD 4D1YA 2JGMA 1WL8A 3FNGA 3W6NA 2GCOB 3AEXA 2AOXA 3BJRA 3O8OB 2PT5A 2ZWIA 3X2EA 2VJQA 2QE7A 2J7KA 3CCCA 4DHEA 2CLIB 1HZZC 2XKAA 1U63A 5DYGA 3K09C 1KJWA 2G40A 4LS3A 2DPXA 3Q5GA 4M0DA 3UOWA 1KQGA 4DR3B 2QD5A 1VQ7B 4KO3S 5JALA 5LIPA 1YA8A 3O21A 4WZZA 1G18A 3WLFA 5M3BA 3INGA 4EELA 1Z4PX 3KAJA 4PPNA 4CDGA 1ACJA 2A9RA 2WHPA 5DBHX 4BMYA 5C8XA 2C5BA 3GV0A 1YK0A 5JS2A 1M75A 4TRRA 2HF7A 5BV7A 4XPZA 2JHFA 2QLTA 3AM5A 4EKIA 2JHCA 4X64B 1I18A 4O0LA 4PF1A 4U8GA 1VG0B 3B3FA 1V9CA 1QUFA 3QX8A 4FYHA 4UM8B 5DX8A 1W47A 2ZXIA 1CS0B 1PUJA 3JQCA 3MBIA 2C3MA 4WMLA 1H9BA 1BQ4A 3SF8B 2Y1DA 4HUQA 2QDXA 1XD9A 2X0NA 1IHUA 1CYDA 4X90A 5K0LA 3FA2A 5ALGA 4EG4A 4AI6A 4YCJA 3KSZO 1GTL1 2FPUA 2GCIA 1PUIA 2CBZA 4GPBA 3R9WA 2P9TA 1E0SA 2JF0A 3DLPX 1CR6A 2FVGA 4FR2A 4GUAA 4Q7LA 1T2CA 1YCFA 2EZ4A 4RVCA 4A15A 1H05A 2V31A 1SUPA 5CVVA 4EUHA 4F3NA 4IP0A 1K2VN 2W0MA 2GJ9A 2A5LA 3G2PA 4XIGS 5DOVA 1WW3A 5ALDA 1XQ1A 2A5JA 2PH5A 1OZ0A 5BSWA 3B52X 2ZROA 3A2LA 3LK7A 4F4JA 4LJYA 4ROSA 3WHIA 1TU3A 2QX4A 4COOA 4CM8B 2NTJA 3B36A 4DV4B 1MCZA 4PX2A 4RC9A 3PTLA 1FSSA 1EAMA 4X3OA 1TD1A 4EUNA 2JL1A 1E9FA 1P62B 2NYAA 1S01A 3EWAA 2XZOA 1D09A 1GT6A 2COUA 3KLMX 3TOCA 4A7PA 1E1YA 121PA 1C3OA 1FQKA 4X97A 3L5OA 4URXR 3R77A 2OGTA 4AJEA 4NU0A 4BVAA 1B8UA 5JTUA 1OMOA 1P2GA 1R8SA 2CXNA 2LDXA 2PD6A 2E4ZA 1RHUA 2WJJA 1BS1A 1JFLA 4EYKA 4RLFA 3RSHA 1MTOA 1W5TA 3DZGA 3F5SA 3HCBA 3CP2A 1R8QA 2VUUA 3K9WA 1NVBA 4IS2A 3F9IA 5LXTF 2ZCJA 2Q9AA 1MC4A 3TDKA 5B3JA 5EPUA 1IDN1 2GKSA 2QN7A 2GJKA 5CTAA 2EVWX 1L4LA 2ZJ6A 5AO9A 4DLWA 4LF5B 4HTFB 4ETNA 1FLDA 1N3BA 3FHJA 5TJHA 1E2BA 2BFDA 5F9MA 2I22A 2WAAA 4IJMA 1JLMA 4ZRMA 2I3AA 2XQFA 4MYSA 3VKVA 1Z36A 3EBLA 1A9YA 1BHSA 1N3LA 3WA7A 1SIOA 3AVOA 3LX6A 1CWUA 1TM3E 1QH1B 4JK3A 2QE6A 5BVHB 4OYHA 1ZMTA 5AT1A 3IJ5A 1E2MA 4QBFA 4C4RA 1X1TA 1ZCZA 2AEMA 1LPAB 1VJGA 3UK6A 1WUHS 4D9FA 1PWYE 3C3XA 4KQ1A 4ZMSA 4TXHA 3ILHA 1O0CA 3GF4A 3QU4A 5J47A 4HX5A 4Q4HA 4F85A 1ZUHA 2H7CA 1LX6A 3OFVA 3PC7A 2HDNB 1Y1SA 4QOJA 2FZKA 4MK4A 4EPXA 1K4KA 3EH1A 3W8DA 1RJ9A 1MGPA 2XTMA 2OFOA 1MEEA 3CINA 1KMHA 4K3VA 3HVKA 2MHCA 4O1IA 1GRQA 3ABQB 4FNGA 3TAHA 3GPBA 3ITDA 4LXXA 4DCGA 1Q91A 3BCRA 1AVTA 2VZ0A 4KREA 3DPSA 1S2DA 2I7XA 4JOCA 2L2QA 1P0CA 4OI0A 4ESEA 1JIIA 4BIMA 1KEEB 4YBRA 3H2JA 4LXYA 1D5CA 4J29A 3ILYA 4JDUA 4ZJYA 1DUVG 2BFEB 1SEVA 4EI2A 1WXQA 4A2QA 4ZGWA 5B1DA 1UQTA 1TLLA 1HY3A 2HCBA 3IBCA 4CV3A 5EFOA 2VHWA 3C8MA 1RMTA 2O7QA 1R6BX 3THYA 2X9QA 5LM3A 2I67A 1B41A 4CTKA 3GZNB 2MJLA 3ANLA 5IM4F 1SNYA 5I9LA 4PS1A 2IYFA 1EVIA 4NCNA 1M7HA 1REQA 3E8MA 2NQTA 1YCGA 2A92A 3KXIA 5L7YA 4EG0A 3ZTYA 4BL5A 1I0LA 1PTJA 1ODKA 5GJWC 1VQNB 1Z8DA 2DY0A 2N3ZA 1KZ9A 4H31A 2OB1A 1S96A 2E2WA 1CE8B 2J4DA 1S9DA 2OG1A 2FG5A 1ZH0A 4KLZA 3URMA 2FDCA 1CTQA 1R5JA 1UKZA 2I6FA 3HI6A 4JT8A 1I4WA 3LVQE 2P0AA 1VKHA 4KMSA 4RE5A 2X40A 3A58B 3EG9B 3LLCA 3K2IA 5T64A 3COPA 5LDDC 2V96A 4IF6A 6YASA 5LP6B 3USCS 1OLXB 2WRZA 1Y80A 1Z6PA 2VEDA 3BMCB 5JUWA 1NP3A 5M34A 1LBEA 1FJXA 1TM4E 1L5VA 3CWZA 2H51A 2ZZGA 3VOTA 1CQPA 1TZJA 2HWWA 1Y63A 1W88B 1UBOS 3EMVA 3M5PA 1P9RA 1Q1EA 4QD3A 4RVGA 4DB4A 2QVYX 2ZTHA 3AT1A 1P1RA 4WA7A 4RQUA 1DEOA 1FVHA 3JQ8A 4JA0A 1BD3A 1PJSA 1WORA 3OE7A 2EZUA 5SZKB 4ALNA 5CIYA 1OLSB 2NYUA 3PK0A 1K3UB 5K8IA 1AHPA 5TY0A 5TGDA 2HXGA 1XPOA 1MB0A 2ZCVA 3CPJB 3KYDA 4Y6QA 3N2GB 3DBRB 1L7NA 5IBQA 5TS2A 2P6OA 2YBEA 3HO6A 4NZOA 2Z57A 3B2EA 3L4BA 1L7AA 3QWBA 2HBYA 3ZDEA 5EAIA 1EK5A 1RCTE 4I8DA 4POOA 4ALMA 1VHWA 1U0JA 2ASVA 2DFTA 1YACA 1SA0B 3ELYA 3JARA 1J0EA 2ATCA 3INRA 3KPYA 2H1WA 3T7JA 3TLCA 1BH6A 4G4GA 4E51A 4W5TA 1CJKC 4IIJA 1QWOA 2QSJA 1COZA 3BJEA 4G1EB 1IZZA 2LE0A 3O4HA 5I9NA 1JFFA 2YHSA 1FX1A 3V4RA 1U6KA 5CXUA 1R00A 2ZB8A 4KN6A 1NI3A 3WGYA 1Z22A 2EQBA 1GNLA 2XMPA 3ZX4A 4YASA 4NX2A 5D8DA 1JKIA 3L8DA 1K6MA 4IPTA 3CA8A 1SULA 4IIGA 1PR3A 5TXGA 3X1WA 4DSUA 5K05A 3ZVMA 2ZI9A 4AKHA 1WQ1R 4V3BA 3IIKA 4XW2A 4JLPA 4IIBA 2DTDA 4TT3D 1Y9ZA 5DHRA 4C07A 2WZCA 1WEHA 3JYQA 4URVR 4FQ5A 3OTHA 2FPPB 2F9MA 2Z58A 5BURA 5GONF 1D1QA 3E9RA 4UAUA 5CW1A 2PTHA 4DV0B 1HLFA 2GX6A 3BPSA 3HDQA 1JJBA 1VLLA 2FUG1 5BSXA 3GP3A 3LF1A 2C0CA 3ASTA 5IF9A 2YQ5A 2G5PA 1WABA 2CZCA 3MA0A 2YX1A 1WKCA 1GKKA 2YWRA 4FMCB 3PA1A 4GPEA 2GRJA 3TFWA 1F2DA 3DOOA 3PRHA 4F96A 1BOFA 5JCOC 1KFBB 2WZBA 3OF2A 4LTMA 1GU7A 3TL2A 3IP1A 1O4WA 2JC3A 3KPWA 5FO0A 2AUNA 4G1UC 2QG9A 4M9XA 4W5QA 4XWOA 3G2JA 1QE5A 4XQFA 3LZCA 5DTIA 2R8ZA 4R41A 4XQCA 4OLBA 4R2JA 2OBYA 5L7WA 4BX9A 4OM8A 3AMVA 3GJXC 1OGYA 1GXSB 5DH9A 5ES3A 3T99A 3NDRA 4QJ3A 4YCCA 4TKLA 1EHYA 1C3XA 3RAGA 2YIDA 3DCNA 4MCAA 4QHTA 1BU8A 3QYFA 3AIKA 1R6AA 3QE2A 3H6HA 4PG6A 3RTEA 1I3CA 3UENA 1U0SY 4YRGA 4RPBA 4HOYA 4INZA 1XFAA 2DWPA 1SUEA 2GO7A 4PPYA 2JJ8A 5ALVA 3IPYA 4M9RA 1MJNA 1KYVA 3DPIA 3FFXA 4UNIA 1DHTA 4MTLA 2F1MA 2R2AA 2AW5A 3ADOA 1T6ZA 1E99A 3GGSA 3TIGA 3UAWA 2EF0A 4FFNA 4BO3A 4DLTA 1H5NA 1ZWKA 2DBQA 4FKZA 1RR6A 4XGQA 4Y1RA 2FEMA 3VHRA 3MUOA 3WC4A 1LFAA 2NSLA 5FL7D 1SHTX 2FPPA 2HK8A 2WM3A 3E4CA 1RYNA 1SUFA 5JQGF 4EEKA 3D1JA 1TLFA 5EI5A 1RJFA 3KOXA 5IMSA 2BZGA 2WJ6A 2Y4NA 3IVAA 4C9BA 1XQYA 1P2FA 2VDLB 4M8IA 3O91A 2O06A 1D6NA 3IAXA 4KXMA 2J5XA 1NQXA 2UZIR 5HILA 4XSVA 1G7RA 1Q82D 3E4DA 4IXMA 3TKYA 3HCAA 3VSDA 4EEXA 5AM2A 2OCIA 2VPPA 3KD3A 2D1SA 5D85A 3UHJA 4JJEA 4FOTA 5KQPA 5TMBA 4LYYA 3GLRA 2PRYA 4BQOA 5LKRA 4FYMA 2VYFA 1PL6A 3C6MA 4CKBB 4RNCA 1YU6A 1JB9A 3BC1A 2PUAA 4M98A 4Z7QB 1M6WA 4JJGA 3VR4A 3R9XB 2R751 2I33A 3C8DA 1QGUA 3D3JA 5B7QA 4GX5A 1PDOA 3EGCA 4ZGQB 2Y0PA 3O90A 1QGYA 4M2LA 3F5DA 4E5VA 3A3NA 2B30A 4M1ZA 4Z99A 1S3SA 1MB4A 3OM9A 3IE0A 4OO3A 3OQNA 2I8CA 2WAYA 1U7TA 1JLKA 4IVQA 2CWDA 4ZT7A 1J97A 2BGMA 4PPGA 1Y5NA 3ONUA 1ZZEA 2WF6A 5CFNA 3O2QB 1AKRA 2BMAA 2H7YA 2PUTA 3IX7A 1HPLA 3AUYA 1Y98A 2DTEA 3JQ9A 1IUKA 4Y98A 1PQWA 1CCWA 3FGZA 3CRVA 4OQZA 4BNGA 2XSZD 1DQYA 3ABZA 1R0LA 1Y9DA 3WRVA 1PSWA 1Q81D 4JB2A 1RHQA 2H48A 4W8GA 4Y0VA 1VE9A 5FA5A 4ENQA 2QY9A 2GVNA 3HM9A 3GPDG 4JBWA 4GXTA 4F7DA 2B4QA 5J2UB 2DVMA 1JQ3A 3ASRA 4Y6OA 2R96A 1YZGA 1OWMA 2YY5A 3EASA 1FYWA 2DBYA 2ZIGA 4LECA 3LCVB 4L73A 5IDYA 3W78A 3OIVA 1J7KA 4RPKA 2HAEA 2F17A 3LX5A 4N12A 4QECA 5BPHA 2WPDA 1GEGA 2WSLA 5AXCA 1JG6A 2G70A 3A2MA 4PXAA 3G9QA 3QBEA 2ZL6A 1F20A 3BIJA 1IJFA 1U7UA 3LUKA 4JLOA 2FP4B 4XEUA 3IKLA 4MTCA 4L5CA 3IBGA 1PJCA 4Q3KA 1TM7E 5JXHA 1ZL2A 2OM6A 5FFNA 5C8ZA 3TPCA 3MPOA 4TX1A 1U2ZA 2ZT7A 1HQCA 2ABWA 4TLLB 4BQFA 3RFCA 1UM9B 5HE8A 1V43A 4NABA 4PXYA 4QICA 3TD9A 3GELA 4KQKA 1Y7TA 3NPAA 5DM2A 2AK2A 5BN5B 2D7JA 2VOJA 4JYZA 3R7DA 2D3WA 1STOA 4AZWA 1JDTA 2QM7A 4WGFA 1ABBA 3FRJA 4KRFA 1Y0BA 1FFSA 5FEUA 4J76A 3ZUGA 3IKVA 4QYMA 2UYHA 2IXAA 4KL8S 4ENVA 5KHAA 4MUBA 3PLNA 4L22A 1AQYA 1FW8A 1XRQA 2Z30A 2J41A 4TXJA 3MYRA 1P9WA 2E1RA 3CE6A 1A7JA 1ZVJA 4ARVA 2VAXA 4D98A 5FT9A 4D74A 3BQJA 3CLTD 1JIUA 1ZOIA 3PU6A 4IS3A 4OY3A 3ILVA 3N9IA 4UZSA 5DXJA 4YCLA 4DWJA 4NENB 4TLDA 2B6NA 4KBYA 4KQCA 4RVSA 2REOA 4FIZA 2C9CA 1SK8A 1L3IA 2OORA 3HU5A 4OK5A 4DCVA 4E7PA 4KOEC 5K03A 1BS2A 4HH4A 5D2CA 1HZZA 2HW8A 4WZLA 2VUTA 3F73A 4HCJA 3K09A 2WZPP 3VC2A 2BEUB 3QV1A 2V7PA 4F71A 3KWJA 1K6JA 3LQKA 2OD9A 2ZIXA 2PZ8A 5HRCA 1NXSA 3ANNA 3ZKWB 3ZXXA 4DDWA 2RJ3A 3C3PA 3MJDA 4DJ5X 3K0SA 1X42A 3EULA 3KG2A 1JTEA 3N2IA 1HT2E 1RWWA 1QK5A 4NMXB 4GL2A 1RNLA 2GN2A 1BWSA 4YAFA 4HDNB 1QCYA 5JANA 4ABTA 4NZ9A 3P9ZA 1TKRA 1Q1QA 4QOSA 5BSMA 4GSKA 4KKUA 3BQNB 1P7WA 4JAVC 2ETXA 3QPDA 3Q2KA 4L9SA 4JHXA 5J58A 1E20A 1PT5A 1EGAA 2FF7A 5A3SA 3OQIA 3DXYA 5K0JA 2MTBA 1N6RA 5BQFA 4HUJA 3T5AA 1TKCA 3E9QA 4B74A 4D0LB 4J2TA 2JLBA 3PVZA 4RY8A 3F4BA 1ZU4A 2B1JA 2FY8A 1RHJA 3B1YA 4FW9A 4U00A 4W99A 3IXLA 3A4VA 5IJAA 1DB3A 1KVUA 2X9LA 1FFBA 1GGEA 2D1QA 2H1VA 2ZB3A 3PDCA 4FHEA 4U7PB 3DEFA 1Z5WA 1ZW1A 2K2QB 2JBHA 3LHFA 3OX4A 2Y27A 5I7RA 2F8SA 1NQAO 3QPUA 4MYDA 4N0DA 4PIMA 4CM8A 3CF2A 4AO8A 3EDYA 3TSCA 3SQLA 4B7CA 3WGKA 2RHMA 1H3NA 2Y67A 3B2QA 1S02A 3D3KA 1RWBA 2CWWA 3PGKA 5F35A 1UFKA 2R7LA 4H7IA 3ZVLA 4IWXA 1WPRA 3ZJ5A 5IYWA 2EEZA 2HRBA 2YXNA 2BFWA 1DL5A 4NYIR 4JIMA 1YL6A 2X9NA 4RZ2A 1XU9A 2XTNA 2ZB2A 2ZWVA 5K8JB 2IEAA 4KYIB 3I58A 4RHUA 4UEKA 3FSEA 3UANA 4JT2A 3ZWQA 2P1RA 2XR1A 3MJHA 1KDOA 2GCNA 1U7PA 4BB0A 3P2EA 3MQ2A 5FUMA 1P1IA 4GZ3A 4L4SA 4HVAA 5FPSA 2OFXA 3UIEA 2ISCA 2P7HA 4PCLA 4RXTA 4YRMA 3EZ2A 4K9MA 1YO6A 4I1YA 4K6HA 5BV1A 5JAIA 4D26A 1CUBA 4UU1A 4NFYA 2YIVX 3QXGA 4Z4GA 4HN4B 3INTA 3UOGA 2XBMA 3H8SA 5CVDA 1T9ZA 2NOAA 2CNNA 1A9SA 5CFPA 3B60A 3BXZA 4Y2HA 1B93A 5DSXA 3IQGX 3UWMA 1OPXA 1A8UA 2HU8A 1ZKDA 4I1VA 1JNXX 3KQSA 1NB0A 1RWVA 4IVPA 1E63A 3G0IA 5HPYB 2YR0A 4WJZA 4Z1OA 2XQGA 2WWGA 4ZTUB 1Z35A 2WB2A 3BQMB 2WY2D 3S2EA 2FX5A 1IATA 4XR4A 3HC7A 3G05A 1IN5A 1AURA 1GD1O 3QZUA 3C4QA 1YIDA 4DEVA 3NAZA 4ZI7A 1EBUA 3BE8A 3LQQA 3GUHA 4O6VA 4RSRA 4DBLE 2W6JD 5HKKA 1VXOA 2YIMA 3GFOA 1BGWA 3LPDA 4E5UA 1SXJA 3AX6A 4NICA 2XJ4A 1P4AA 4RETA 4ZO7A 2HEIA 1VJ1A 3W5IA 4A27A 4E7OA 4B9EA 2VRWA 2OCDA 2GQFA 1T9BA 1HQKA 2FE1A 1YCHA 4FDTA 4I9FA 4Q02A 3AB7A 1N06A 4IDGA 2I76A 3O2JA 3SYLA 2G76A 4JJAA 1KP9A 3QLEA 1QU3A 1QTQA 3FSRA 3GUZA 4QBIA 2A4KA 2D3NA 2UKDA 1D1NA 2FVXA 2FMFA 2CYAA 3I8SA 4L02A 3UJ8A 4F5ZA 5CVJA 1V6AA 5ALSA 3GUCA 3BAFA 1KI6A 1MB9A 4KXFB 4AIRA 5J2UF 4R9RA 4ALJA 1I1OA 4AF8A 1GIAA 1KBOA 2BHTA 2EKBA 1YNSA 5DGHA 3V1MA 3DFMA 2F2TA 1N2OA 4QGFA 1AK9A 1Q3KA 1DXOA 1L6IA 4CF7A 2HDWA 2Q62A 1JKFA 3GLIB 4HXYA 4BLRA 5AVSA 5JMWA 4OOSA 4OD0A 5I9SA 2Y68A 4DQKA 3VAYA 2D59A 3NYIA 3NDBB 1G17A 4GW3A 2QGGA 3N2LA 1Y7HA 1ULAA 4RF3A 1NRWA 2D54A 3IH5A 1SG6A 1HFJA 4FK8A 2WABA 3OUTA 5FWXA 1P7CA 1QVVA 1U4OA 2EQAA 3WFIA 3H6KA 4MV3A 2WMNB 5AK3A 1UZLA 2QTVB 1ORWA 5CYPA 2C97A 4BX8A 2A0YA 3GPIA 5A89A 1TCCA 1PNTA 3CXRA 3OIFA 2P3MA 1QSGA 1JHUA 3JTEA 4HRAA 4P3IA 4ZRDA 5LMCA 4MLDA 2CNLA 2R62A 3ZWDA 1SFRA 1GQOA 1JSCA 3L7NA 3IHKA 1J99A 3A3YA 1CZLA 3TQIA 4EW1A 1Y6FA 3TNFA 5JYDA 1FRNA 2M1ZA 2WLSA 3NC1C 1ZN2A 4F4CA 3AHDA 2R0QC 5JMPA 4TLMB 2JW5A 3G79A 1X1BA 1CUIA 1P6QA 3EODA 3HCDA 4OLJA 4Y6RA 5CUQA 3TMAA 2WIGA 3LSTA 4MDYA 4F97A 1DIRA 3AF6A 1CQIB 2C8JA 4URHA 3FUTA 3FVWA 1G20A 3ZQUA 1MGOA 1RZVA 4XRGA 2CV1A 3WL7A 4HDMB 4IWYA 5ILOA 1GNRA 1OFIA 2AFVA 3AR4A 5KQGA 1GARA 3Q3AA 4B6GA 2P4EA 3MJVA 4NYJR 4TTSA 4MJXA 4DIFA 3EX7C 1VPEA 3C15C 1YS2X 2PT9A 4PLTA 3H9BA 4MUJA 4HRYA 1YE5A 5EPEA 3UNXA 2NUPB 3LQ4A 4QTXA 4MUHA 1TCUA 3S2UA 2K4MA 3AEUB 4PRLA 1GPAA 1SG0A 5REQA 2QVBA 4HG2A 4MW2A 1DC8A 3V7WA 4D5GA 2HR1A 4UUPA 4V39A 4F6RA 5F7OA 5H59A 4GPIB 2WTXA 1GEEA 3H4VA 3IO5A 4CZ2A 1J5XA 3C6QA 3FNBA 3FKSD 1QU2A 6LDHA 2RONA 2R6R1 4JVMA 1G8AA 2WWRA 5REQB 4EG3A 1WLYA 1OAOC 4A0SA 2O50A 2ZJOA 3K2QA 1Q57A 2X86A 5IVPA 1V3VA 1QOZA 3BK2A 1ZVVA 4KR3A 1RBZA 3A11A 3IALA 4FMBB 1JDBC 1IU9A 4ZVPA 3DD5A 2ZP1A 1X8LA 4D4LA 3NPMA 1Q0RA 1J8YF 4Q19A 4G0QA 1QZXA 2PWZA 3L7KA 4B3FX 4GKBA 5JCOA 4K6OA 4A23A 1KMQA 2AHOA 1D2EA 4XB2A 1ODJA 1TEZA 2N1MA 4NARA 4YMIA 1DC7A 4BS9A 5AHWA 1ZHFA 3D8BA 2JRCA 4F6LA 2M1XA 3CNHA 1QR6A 3C3KA 4L2IA 3TXYA 4B83A 4AMUA 3QHQA 1AGPA 1LK0A 2BD0A 4LQLA 3VR6D 2QL5A 3DF7A 5ISMA 2WKSA 3ET4A 5HUJA 2GQ0A 4WBNA 4HE5A 5E1OA 3V1NA 2Q6TA 2WU1A 3U40A 5AUOB 1E3XA 2HCFA 4J07A 3LT5A 4P9NA 1LTKA 4GUDA 1SXIA 1DWPA 1OBVA 2RARA 2J3KA 3A27A 4X7CA 3CCVB 2VNIA 5ADUS 2IUEA 3KIPA 4MUKA 4N01A 4YJ2F 4YMLA 3HL0A 1NLFA 5LUAA 1OSNA 3FHLA 3KVVA 3T1NA 1ISGA 1CY8A 4YFYA 1SEPA 1GFWA 5L53A 2PMWB 3FPSA 5AD1A 1B73A 1YZ3A 1YA4A 1H66A 4WRRA 3I9OA 4PC6A 4GDMA 3TSOA 1I3KA 2ZREA 3RC7A 1RYZA 2Q3DA 3EZLA 4KPYA 1V48A 4YNBA 4R2MA 2VNHA 3PI7A 2OVBA 4IH1A 4KMRA 1PNQA 2DM6A 5DX1A 4YELA 1FFYA 2BZ1A 4QDUA 2IHBA 3M83A 5HCIA 5AKHA 1JYFA 3IHWA 1MA3A 2GSDA 4L4XA 1XL1A 3SLKA 8LDHA 3UB2A 4CYMA 4MWCA 3EFEA 4HC4A 4RH1A 4IW3B 2B1IA 5BQ3A 3AI3A 1M7GA 4R9NA 4LHVA 4GBED 4DT1B 1X1EA 1NN1A 3GLFB 3AQ4A 4NZPA 4NK4A 4X8IA 1EFDN 1WDTA 3THWB 1YQTA 3EBOA 3R24A 4RLHA 5DO9A 2MMCA 4Z7NB 2GNAA 3D54D 3Q7QA 3RFFA 1U99A 4TMFA 4CUJA 3CH5A 1H0HA 2GILA 3GARA 4R5HA 4YRIA 3QH4A 3V2IA 1TM1E 2C98A 2B7CA 2H2GA 3RK0A 4MLPA 3FTNA 5DCYA 4FHDA 2IEIA 5DNEA 5JADA 3RRMA 3T1YB 1YVPA 2GDJA 2VQDA 1CK4A 1U3FA 1VE6A 4I46A 1AO0A 5G1OA 3BZWA 4BKPA 2BI4A 4QVIA 4MAAA 2Y6VA 3I0MA 4B84A 2QV7A 5C3UA 4H1VA 1GGKA 2OMKA 3JQ9C 3HZZA 4IOMA 4OXRA 4ZI7B 1H4TA 3M6IA 2NGRA 4QDXA 4B81A 2RH8A 1WXWA 2VH1A 1Y1LA 2E48A 4P33A 5SYNA 4X84A 5EIBD 4H16A 4ZVMA 4OX9Y 4LJKA 1C7IA 5FTJA 1RRMA 2D0DA 3WO0A 4QDOA 3E9EA 4Y1GA 4DC9A 5IJ9B 2V7WA 2QLMA 4YJDA 3DNPA 4E14A 2JJQA 4LOAA 1CT9A 1ISJA 1BYIA 4HDAA 5DBFA 5JCXA 3KR9A 1HE2A 4B2IA 2AC2A 2FZ4A 2I8LA 3REQA 5IXSA 3HRHA 4XX0B 4CF3A 2IZOA 1Z2CA 3Q9NA 4N8EA 4YRBA 5AIBA 3NETA 1Z25A 2NZ8A 4KPGA 4UREA 2AQKA 1G2PA 1WRBA 4A03A 2Q3EA 3CRMA 3Q6NA 4CIXA 4Q9HA 4YMVA 3UJDA 1KIMA 2OCLA 1E1CA 3HU1A 1MHPA 3CVOA 1NULA 4ZHQA 4RM3A 2F55A 1B14A 4BFVA 1R1DA 3Q98A 2BR4A 5G4LA 3HCFA 4EW2A 1A1VA 3RTBA 1WSDA 4A3SA 1AJEA 4WL0A 5B4VA 3D81A 3I4LA 3NDIA 1ARZA 1P1FA 3PHLA 1X94A 3BA6A 4GBGA 4L57A 3EVEA 4YLEA 5GQSA 1WOMA 3CZQA 1QHXA 2C1EA 4X92A 2JGDA 3CN7A 2W2XA 3EXHA 3SKXA 3ZXYA 2WPDD 2X8WA 3NV7A 1W52X 2J6IA 3A6FA 4IIUA 1BA3A 1HFEL 1SWVA 4E2FA 5K8TA 1OYWA 4JI6B 1GTMA 1NUHA 3K6KA 4QC2A 2FSHA 3SYMA 3U7HB 1SD5A 3T3NA 1ZYUA 3U4HA 3UBTA 1GZVA 2VJOA 5AN9A 4FFMA 1IWOA 2RHTA 3E1SA 3O7MA 1P7VA 2VUIB 3HA3A 1KKLA 5K3CA 3BB3A 4YAGA 4RPGA 3KQUA 4EDFA 3MJFA 2OORC 3T06B 1ND5A 4HQ6A 2BGWA 2G04A 3P4UA 4CEJA 4TQUS 1EWQA 3T61A 4LYAA 3ESDA 4AX8A 1E66A 1T3SA 1EE2A 2AUMA 3FJYA 2VBGA 2W2TA 3H3FA 4X8MA 5IYRA 1D1TA 3IESA 5GV8A 3L02A 1VDZA 3T52A 2Z6VA 2ZIEA 1A4IA 4HEA6 4NZNA 4TTVA 1C0IA 3LZ6A 1VJSA 1VBNA 3GN1A 4YLYA 2HHHB 1YB5A 2CLKB 1XJQA 1JHXA 1Q11A 4KR0A 1G6HA 1VHQA 4UHDA 1AQIA 4NAUA 3WMEA 3MTQA 3DBIA 5AQEA 1NUQA 5F1YA 5IHXA 5J1SB 4KYVA 3JQAB 3N5KA 2R4TA 4BLWA 5HZMA 1U0OC 2VYND 3I6IA 4AD8A 2HA3A 3LDGA 2ONKA 2YV5A 2BUCA 4ND8A 5ANRB 5FRDA 3P52A 2XLCA 1EI9A 1V7CA 1V8OA 5BV2P 1VQMB 1NBWB 2MR5A 1QGUB 4HF7A 4W8HA 4FDUA 3T5PA 3PQEA 5EIEA 2ZJ5A 3ONWA 5IARA 4UFPA 1N7IA 5A7FA 2A1IA 3QP9A 3I04M 4QPJC 4BQSA 4GMGA 1GDHA 4QFDA 4E5YA 5L8VA 1J20A 4L9RA 1FUKA 1GLNA 3Q3EA 1QKIA 4NBLA 4WBSA 4ETIA 3G0HA 3ZLBA 1FY2A 4MUFA 1C14A 5BSKA 1ZUNB 2WJPA 4S2UA 1BW9A 2ZB7A 5CVCA 1T8TA 4TQ9A 2O7SA 5HKAA 4UVIA 1PKXA 2M9MA 4XJXA 4ZVRA 4UOEA 4Z5XA 4XN0A 1J39A 3G9XA 3PLRA 1JEAA 3PQ7A 1COWA