4FK8A

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264 with bound fad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
254
structure length
247
Chain Sequence
KFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVEGRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 79
structure length 247
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4fk8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4fk8A02
2OK7A 1FNDA 1VQLB 2X3UA 1KK3A 2PMDA 4DQLA 1G7SA 4G5GA 3JQPA 3VO2A 3CCLB 3FJOA 1QFJA 3AVVA 1F60A 2BN4A 3V76A 4QHYA 1E62A 3CC7B 3CD6B 3CCEB 5GV7A 2QA4B 4RD0A 1S0UA 2YWHA 3J81k 4TN1A 4RCYA 1QGZA 1JJ2B 2VYQA 3CC4B 3CCVB 4LBYA 1ELOA 1VQKB 3MMPA 4YAOA 5FA6A 1YJWB 2PIAA 1TVCA 1UMKA 2BM0A 2DCUA 1DG1G 1KQSB 1G7RA 1CQXA 4ZV4A 1CNFA 4TMXA 2J7KA 2XEXA 1JA1A 2OTJB 4K1XA 4B44A 4RCZA 1VQ5B 4TMVA 1ZM4A 3OJWA 1N0UA 2BMWA 3CC2B 1OB2A 1S72B 1VQPB 4LBZA 2BPOA 4YHBA 3SJZA 3CPWB 1J9ZA 3ZBTA 3OJXA 1QUEA 2DETA 1GVHA 4H9GA 4B43A 4ZCLA 1QUFA 2AHOA 2B7CA 2C77A 3QFCA 3W2IA 1D8TA 4Q7JB 1EFTA 1HA3A 2BF4A 3A1FA 1EP2B 1QVGB 1M90D 4RD4A 4B48A 2BGJA 2XNJA 4PGOA 1KK2A 2RC5A 4PC3A 3CCJB 2QEXB 4U9UA 1DDIA 1EWYA 3B8HA 4EH1A 3CW2A 3OZUA 2DEUA 3P27A 4P3YA 4FN5A 1DDGA 5TR9A 1BX1A 3E20A 2YWGA 2HCJB 2VNIA 2D74A 1BX0A 1VQ4B 1JB9A 1TTTA 4RD3A 3ES9A 1K73D 2E1RA 3VNVA 4FWTA 4M4SA 1K9MD 2C78A 4PC7A 1CNEA 5GV8A 4YALA 1EFUA 1NDHA 3WNBA 1W34A 1BQEA 1Q82D 3JQQA 1OGJA 2BVNA 1FRNA 2RC6A 1KK1A 4N3NA 1ZM9A 1A8PA 2CNDA 3OW2B 1AIPA 3WNDA 4Y9UA 2VNKA 1VQ6B 3CRZA 4G1BA 3CCSB 3G71B 1H85A 1VQ7B 1B2RA 1R5NA 4YAUA 1VQ9B 1WDTA 3CCRB 3I1FA 3I55B 1YIJB 1OB5A 4BPRA 1KK0A 1QVFB 3WBKA 1TLLA 4DQKA 1DARA 3AVXA 5KSWB 1EFCA 3E1YE 2VZLA 4HE5A 3WNCA 4M2LA 1H42A 1SM4A 1K8AD 5TY0A 3ZZUA 1W2BB 2VNHA 1E64A 1ZUNB 1FNMA 1U2RA 1SKQA 3W5UA 2BM1A 4RJLA 4PC6A 4B4DA 3AGQA 1B23P 3W2EA 2BV3A 3ZC3A 3JQRA 4Y7CA 1FNCA 4C43A 2XNCA 1N8RD 2BGIA 3W2FA 1R5OA 1FDRA 4NBSA 2EFGA 4B3XA 4J0QA 5AN9A 4WQMA 3G6EB 4LBVA 1IB0A 1D2EA 1YHQB 1QFYA 4Y9RA 2QTZA 1VQOB 1R5BA 2EIXA 3W2HA 4IW3B 2NPFA 1GAWA 4RD1A 1YJ9B 2HMAA 4YAWA 1FNBA 1D1NA 1EP3B 4ACBA 3QFRA 3WBJA 1VQMB 1AMOA 3VNUA 3AVUA 3G4SB 4M0LA 3ZZTA 1QFZA 2GPJA 4AF7A 1YITB 1TUIA 1KTVA 1N0VC 3U6KA 4LC0A 2QTLA 2QMUA 1XB2A 4TMWA 1YJNB 1JNYA 2QN6A 1NJID 3ZBUA 4MYTA 3CMAB 3CCQB 4ZCIA 1F20A 1W87A 1GJRA 1QGAA 4C0SA 2HDNB 1G7TA 4RD2A 4UAJA 4B47A 3MHPA 1QGYA 4NCNA 1M1KD 2B5OA 4QFMA 4AF6A 4AC9A 1ZM2A 1ZM3A 3B78A 3OZWA 3CMEB 3CXCB 4F7DA 1YI2B 3B82A 3CB4A 3FPKA 1KC8D 2YWEA 1KRHA 3U2QA 2YWFA 2FX3A 1GAQA 4P6VF 3CCUB 2BSAA 3LO8A 2OK8A 4ACAA 1EP1B 4HE6A 3WYAA 5H59A 3WXMA 4RD6A 5DSZA 3W5VA 5HXBA 2VNJA 3AVTA 3W5HA 3MCAA 2OTLB 1FRQA 1OGIA 3VMFA 4M1KA 3LYUA 5H5JA 4G1VA 3W2GA 2PLFA 1G7CA 3PENA 1I7PA 1GR1A 2R6HA 1QG0A 4YAFA 3WY9A 4TMZA 3AVWA 3LRXA 1VQ8B 5EMNA 3I56B 3QSYA 1E63A 1VQNB 3U6BA 1GO2A 4PC2A 2GQFA 3QFTA 5TV2A 1Q86D 1IJFA 4ZCMA 2DERA 1KD1D 5THXA 1BJKA 1IJEA 1KJZA 4MYUA 1QX4A 3LVBA 1JA0A 1Q81D 2B7BA 3ZZ0A 1Q7YD 4R71A 2DY1A 3VO1A 4ZGNB 4FK8A 4PC1A 5JBQA 3AVYA 1W35A 4M53A 3AGPA 3QE2A 2CRVA 3OZVA 4ZGQB 2QDXA 1XE1A 1QH0A 2ZITA 4TMTA 3P26A 3CCMB 4N3GA 1EXMA 4LBWA 3QFSA
chains in the Genus database with same CATH superfamily
2K2QB 3B70A 2ZCJA 1SKBA 3CO5A 3DMNA 1G7SA 1E69A 1UD6A 4OP7A 3NHWA 4UHCA 5TDHA 4FM9A 1EEXB 5ALKA 4MVJM 4U2FA 1MB2A 3RRXA 2DOKA 5CCBA 1TYCA 4OHUA 4I9NA 4JQZA 4RJIA 4B7CA 3FJOA 4JI1B 1D3AA 4GWKA 2ZWAA 2XNDD 4DNOA 3T0IA 2F1LA 4JVNA 3M3HA 4PO9A 2ZAOA 2AI2A 2DFNA 3X1XA 2A9KA 2V8BA 3OKCA 2W2PA 3EOBI 3NFYA 3NPAA 3TQTA 5K0BA 5LOVF 2QW0X 3PL1A 4XVQA 6ADHA 2EG5A 3PL5A 4IEIA 4QXOA 1GQOA 2D00A 4Z3DA 3VPBA 2NYVA 2ZWMA 3TJMA 2J41A 3B1YA 5EHXA 2H2AA 2Q2QA 4AX8A 1E60A 2AZMA 1QGZA 3LSTA 2COUA 4KFUA 1BA2A 3ONVA 5EC8A 3IEUA 1TC2A 2VUHB 3KE9A 1UDAA 3CCVB 2MYTA 3FTQA 1QHEA 2OGZA 1VGRA 4GU5A 2GK4A 2QPAA 2ZUSA 1Q19A 4HYEA 4MR8A 4B0PA 5CG1A 4EIWA 1XQ9A 5BSGA 3KOUA 4QU9A 1ZJ5A 2O7SA 3DEIA 1PYDA 1T4GA 3FSGA 1RBQA 1L8OA 4TM8A 3K6RA 5EJ4A 5JCJD 2GM5A 5IBQA 3SF8B 1L5WA 1LJ8A 1V6AA 2XCLA 3G1TA 4EFLA 1CK4A 3QWIA 3GVHA 1RXUA 4KJXA 2Z56A 3BXGA 2AX3A 3GRZA 4H4EA 1LA2A 1DO8A 1R9JA 2R7KA 3O9ZA 1ZESA 2QUZA 1S2GA 3E8XA 3NJ8A 4CL0A 4BWGA 3WMFA 2ORED 5ITWA 4DDHA 9GPBA 5DM70 4GX0A 1RIIA 1SUAA 4S0ZA 2X5NA 4LZWA 4RY2A 1RRKA 1SEPA 1ZD2P 4IUBS 4DQVA 4B44A 1YL7A 4DSZA 1ZW6A 3CR7A 1ND5A 1IXZA 1L2TA 1OFIA 1PP4A 1QK5A 2PPVA 3BTUA 3I3OA 2VBCA 3SLRA 3A28A 1JTVA 2AQKA 1TVKA 4JIGA 1Y89A 5JU6A 4IHJA 1O9HA 1L5HA 2AQHA 3OX1A 4GLFA 5IDWA 2ZZFA 1MVLA 3V46A 1OYWA 2NV2B 2A6PA 4Q3LA 1DWUA 3CVXA 4B1FA 2IOHA 1HDCA 2LW7A 1VJGA 1SFRA 2X1VA 3I4CA 4IJKA 4QYWA 4TL9A 3TPCA 1WPRA 5C7IO 2NVWA 2JLXA 2CT8A 1E2HA 4ARCA 3EOAI 1XV5A 4WGFA 1VMEA 2OSVA 3KT0A 2DETA 3VU0A 5BSMA 3VV2A 4B0OA 5A2QA 5J4HA 4CF6A 2PMBA 4EJ0A 2HM7A 4ZCLA 1NMZA 4PIPA 2QBYA 4OGGA 4IGEA 2V65A 2AVNA 4RKQA 2BLNA 4LOKA 2B8EA 3ONFA 2F8LA 3A06A 4D9MA 1VFNA 4QTXA 4EL5A 4RDKA 3QTBA 3KR0A 2CL5A 2WWTA 3N2LA 1EK2A 1GPAA 3QHQA 1EA7A 4OLBA 5DH9A 1QNFA 4L8LA 1GYRA 3H19A 2W11A 3QF4B 1P7VA 3GLFA 5EINA 2JIMA 5JCZA 2FG5A 1E66A 2E18A 2GUWA 3IAEA 3RSQA 3USZA 1OT5A 1I80A 2LVBA 3DOIA 4N47A 1YX2A 3KKMA 3O8BA 1R0XA 4LRQA 4LSZA 5JS6A 4IH4A 2GOYA 4BMYA 1QYCA 5C0OE 4DCCA 1ZK2A 1PGQA 3K0CA 2OYCA 1MW8X 2O14A 4PC3A 1S2IA 3A8IA 3BCFA 3CCJB 2WM2A 3IUPA 4GOXA 4LOAA 3ZXYA 4F8JA 3P32A 2ORWA 1U9IA 4WXHA 3EY9A 1HTTA 3KSMA 5TRTA 3YASA 5KKCA 3VYVA 4UTNA 2YJ6A 4FJ0A 3WDSA 2JJ1D 5LA6A 2B0JA 3MJCA 1DIHA 4UEKA 4PNPA 4NS4A 1FU4A 3RJTA 1QPZA 5I5EA 5CLLA 3SDBA 2RHBA 4IH1A 1PN3A 2DPGA 5JNUA 1QRTA 4J1TC 3A0RB 3G0HA 1MC4A 3QY9A 2JFBA 3LQ2A 5JVDA 5HM8A 2IGTA 1Z2DA 2VZEA 4RK6A 5ADVA 3CPXA 2EDAA 5DRYA 1J33A 2GN6A 2J0VA 1BG6A 3CP8A 1PWZA 1Z17A 2IOQA 2Y1FA 4IL5A 4NU6A 3GUZA 3IGFA 4WTOA 2DSNA 2WU1A 4QOEA 2DB3A 1N07A 2C9CA 3WKDA 5F4BA 4JC8A 3WRWA 3SAJA 1D5CA 3F98A 9ATCA 3AIMA 4MKIA 3F7OA 4Q1FA 4M4SA 1EESA 2FVGA 3QLVC 2H1HA 1IDN1 1VSTA 4JLVA 4Q4CA 5DOZA 1ISIA 4WH0A 4MRPA 3UMCA 3GIWA 2PXHA 3WICA 5L8VA 4CLOB 1KYZA 3VQTA 4WKOA 2R2AA 1V4BA 1RMQA 3JQQA 1GVNB 4D0GA 1Z26A 3U37A 1S4QA 3ZZ1A 3FYUC 1R9MA 2QNBA 2H2DA 4BTLA 3TR5A 3ABQB 1I10A 1QP8A 3L02A 1UEXC 5L6LB 3EYAA 2NXCA 2PVSA 1OWMA 1BH2A 2ZJBA 1OTXA 1WX1A 3EYWA 2OB1A 3BQMB 1HOTA 2HSGA 5GZ1A 5JZBA 1MX3A 4WXEA 3CE9A 3A6KA 3DD5A 3LDFA 3OEHD 4Y9UA 2R8OA 2C99A 1MO3A 5TIIA 2L69A 2IU3A 3FF4A 5IXYA 4HLUA 1PJTA 1GEGA 3GLVA 3K1AA 4RIEA 5KSZA 5IYQA 2LNDA 2C0CA 3DWGA 2YFYA 2AF3C 2QXUA 2C88A 3FTDA 2I1QA 5THKA 4WAUA 1MTZA 1VCMA 2CLCX 4Y2SA 4EMBA 4HH3C 5GOTA 1JDBC 4C04A 2C7OA 5LDHA 4G2TA 4QTZA 5IVDA 1H8EA 5T57A 2VOEA 3HDYA 1AGPA 1JMKC 4DR4B 1XO1A 3E05A 3L5KA 1DBIA 3KFVA 1TU3A 2FMTA 4GICA 4O2AB 5K09A 3W5IA 4DV5B 1H69A 4XUCA 1JEJA 3ROZA 2QI9F 4FDUA 1K3UB 1EXDA 2JHAA 2X77A 3GFPA 2PGLA 1SIBE 4ECEA 4YUVA 3DQQA 2H00A 2BHLA 5AJZA 4JGBA 1BRMA 4YYEA 3C85A 4BLPA 4YP7A 4ZO4A 5CFQA 3TOZA 3ZNNA 2PWBA 3BE8A 4XB1A 1VLOA 6YASA 3NTLA 4HH4A 4KO4S 1W2BB 1I2DA 1BHO1 1R8YA 2FN7A 1DEKA 1NVMB 2GHTA 4IF6A 4NEQA 5ALUA 3URKA 4JOSA 4RTMA 4UBOA 3ZDCA 3W5UA 4UMEA 1QH1B 5F9FA 1X38A 2B35A 4E2WA 5FOUA 1O9BA 1Z8DA 3R2JA 5AM0A 3Q72A 1Y3IA 4PHTA 3TTVA 3AF6A 3UG7A 3WADA 3FCCA 4J7UA 2JFZA 3E0QA 4ZT3A 3EGCA 2WSIA 4PBSA 4QGAA 1V1RA 3LXXA 3SXUA 3SYNA 1V71A 4ARBA 1YZKA 1HSZA 2HGZA 3C16C 4OGFA 5IP5A 1G21A 1PE0A 4CHTA 1TEHA 3WLMA 4RKWA 4AG5A 1R5OA 3D6MA 1YUMA 2AEJA 1QHSA 2MDTA 3TNYA 4AZVA 4NBSA 1MJFA 4C14A 5JDIC 1YFJA 2LKCA 3A26A 3RREA 3GZ4A 2DH5A 3N2KB 4QZVA 2RGCA 2ZI4A 3K9CA 4ZWNA 4KRYA 2IOFK 3IQGX 3ROEA 4EQ6B 2MYNA 4G0WA 2PV7A 4KBGA 5BWBA 3CEHA 1GAJA 2ZAMA 4HNUA 4I14A 2ESRA 3Q8WA 3ABIA 3AONB 1LSOA 3C3KA 1LTQA 1NJ2A 3NBMA 4G86A 5F76A 1Z0AA 1VSBA 2GBCA 4V24A 1ND6A 5C46F 2F67A 4PANA 1AUVA 1P5FA 1XQXA 5BOVA 4PZPA 2YWCA 3NYWA 1AK1A 2FHSA 3SFVA 4H1TA 4HWOA 2AXEA 2FRDC 2XKBA 1RADA 1ORIA 3KOMA 3TFOA 3PNKA 4X61A 4AJIA 1PYOA 1V5FA 5KYYA 5ISMA 4GWLA 1GTVA 2GQ0A 1GPWB 3VNQA 2OESA 2BFEB 2OFXA 1YH3A 1UF9A 2GSDA 2PFKA 5CYFA 1MO6A 1I8DA 2P5YA 1SBQA 2WMDA 3JPWA 4PSUA 4WOBA 2V6FA 2QD5A 4RABA 4KKVA 2ZI5A 2R8RA 1I18A 3TJRA 3DLHA 5EZQA 1ZH6A 1VKZA 5REQB 3LKBA 3ZE0B 3FWHA 1IPFA 1RDFA 2HA7A 2JFXA 1TUIA 4C01A 1FQWA 5GVSA 4QVJA 2XUAA 4RAQA 1AK9A 3H2HA 4HG2A 1GXSB 3V4FA 3ACDA 5U4XA 4DG8A 3ZV7A 4N41A 2J9GA 1UZMA 4O4IB 3BY1A 2FQQA 4TMYA 4XYEA 4D6PA 4LC0A 2QTLA 3TD9A 4D25A 3ICWA 1Y5LA 4G0XA 2HU7A 2EP5A 4EMTA 1CHNA 3ZZNA 5DNUA 4S1NA 2CV1A 2YQZA 2OC9A 1T1EA 2BTQA 2E4WA 2VZ0A 3AFHA 1YTLA 4OQZA 4TSKA 3PEWA 3LUAA 4B3MB 3OVMA 3HRKA 1A7UA 1V9CA 4MPDA 1IRXA 1IQUA 2FFHA 4U8HA 3NNSA 4NDZA 2VKTA 5DTRA 3G2JA 4E5MA 1QAMA 4E5PA 4QUZA 1K6XA 1EUQA 4ZCIA 1ES9A 3D0RA 3DV0B 3DZDA 3FHLA 1VJCA 4IIVA 4A6PA 1OI3A 1WU7A 2N9UA 3GCGA 3OJCA 3OWHA 1U2GC 4OSOA 3TQCA 4UREA 5KOHB 3IKMB 1NWCA 2QX9A 5HS6A 4Q4JA 5JJ5A 4J16A 4KVAA 2X15A 1ABEA 3OE5A 3ESQA 3WGQA 1HYQA 2D2IA 2HY7A 3PG5A 2GX6A 2Q3JA 4P7JA 3RUIA 3EVZA 4UKDA 1PYGA 3LLVA 2Q2WA 4ALNA 5BW8A 1CUYA 4Q9DA 4CM1A 1EI9A 2R7NA 4RA9B 5G2OA 4RHUA 5P21A 2XWSA 4DSUA 1NOKA 1I4TD 1ZM2A 3ND9A 2XUZA 3FZGA 4DAOA 3IDAA 1B4DA 2G04A 2MMCA 4B81A 3UFXB 1DZIA 4XDYA 3C74A 3ZHUA 4ND3A 3HFGA 2E4VA 3V32A 1TZ2A 1BHQ1 1BEZA 3CPEA 4LTDA 1NSTA 2P6NA 2QD3A 3HH8A 5JAZA 1P4RA 2W8BA 1CHDA 1OKKD 2ZJ3A 2X0RA 4S1WA 4XKVA 2ZREA 3G17A 3MJTA 1LTKA 1NBME 4P4LA 4R8MA 3EGDA 5EMLA 4C06A 2C2BA 1HL7A 1QO9A 1LPOA 3ZIAA 1MX9A 3GFBA 2VFAA 4KWHA 1O0SA 5F5NA 3W5BA 4O1IA 1YZTA 2ZR9A 4O1MA 4B46A 2QR2A 1SVSA 1W0KA 4IV8A 1E5LA 1IHOA 1WRBA 4GPZA 2HHJA 3CCCA 2AOUA 1SXJA 4HDNA 3RS9A 4MUEA 5GP1A 2IITA 1F48A 3HP4A 2YW2A 4LJ9A 1ZK0A 1J70A 1OH8A 3EZGA 4GKKB 4BKUA 2VNJA 3DYIA 4NQRA 1UBSB 4W9NA 1WEHA 1Y3DE 1G2IA 3OLQA 5LP6C 3VR5A 1MXFA 4PHGA 1TZJA 2FPKA 2VTBB 4XI9A 4UUBA 1T4BA 1UBNA 1X8LA 1US8A 3HU1A 4B3RB 4OMCA 2C9BA 3IOEA 1SEVA 4U4AA 1XWFA 3OH8A 5JLJA 5KIAA 3HTXA 1VCOA 1EJ0A 2BM9A 4LRTB 2XLCA 3AI3A 5D5QA 3GLGB 3GP8A 1R0KA 4TLBA 4QDZA 3PJGA 2XH8A 5C37A 4HTFB 4JENA 1RWWA 2ECOA 4C2AA 4C7MA 2WV9A 1UDBA 4ZKEA 4NH0A 2P6OA 3IDZA 2IEGA 4RS3A 4Z4EA 4AJ4A 5ESRA 1KI3A 1XTKA 3TQIA 1QHFA 1YL6A 5DNDA 4B73A 5BR4A 5KEIA 4QUHA 4LEIA 2JFYA 4FEEA 2G40A 4IOJA 3T7KA 3WK9A 1ORDA 1E63A 1C7FA 3CLUC 4J0HA 1R00A 1RACA 4KIJA 4FHZA 4PGFA 3WGIA 3U6BA 4WLNA 1Y1TA 4GXTA 3ZQ4A 4JYCA 3WJ2A 1U3DA 3MUEA 4XFDA 4BFTA 3U4AA 2CFSA 3AHDA 2EARA 4EG7A 5C5IA 3O7WA 3QX8A 3OTQA 3PRKE 3BIXA 3WS7A 1DIBA 2CFIA 3SHOA 1J39A 3TG2A 2RCNA 2W9XA 3KYIB 2R44A 1MOSA 1IJFA 4KR6A 4LNHA 1H3EA 3NCTA 4ARVA 3L79A 3T3GA 3EXEB 3WR5A 1DB3A 1EHYA 3I4LA 4N18A 3QE4A 5J59A 3L4BC 2O8BA 1A4IA 4KOAA 4WACA 2W2XA 1GM5A 2PZJA 1E3ZA 4FYVA 1QZ3A 1TW2A 2ZFUA 1DI0A 4RIIA 3AHGA 3MCVA 2J9FA 4B6PA 3UKOA 2BKXA 2DBQA 3E9DA 4MV3A 3MJVA 1YHNA 3AHJA 4FEAA 3I9FA 1XA0A 4OMFG 1QVWA 4OUDB 2G9UA 4B3GA 1JHOA 1KI9A 5EE5B 1I0IA 2DBRA 2FCRA 2PUHA 3ZHCA 4BFSA 3WRXC 4ZO8A 3R9XA 1DRUA 5HKKD 1CIPA 4BZWA 5FWXB 4RJKA 3NG1A 4LGVA 2WKQA 2XGOA 5A4JA 1UBHS 2V7UA 2PIDA 3CMCO 1CUHA 3BK1A 3IVRA 4Q34A 4BNDA 5JEDA 3I39X 2WQ7A 4X07A 3AUUA 4EPXA 4XRGA 2WBLC 3DVSX 5HK8A 1PFGA 2ICAA 2MR6A 1WZEA 2O05A 3NWEA 4XIJA 2VPYA 3V7YA 8OHMA 3U7QA 4URXR 3BCDA 3LBHA 3EEYA 2O54A 5KHOC 3LECA 3T7DA 1YKFA 3A36A 3PDUA 3R76A 2HV8A 5TPWA 2P0AA 3FI0A 5DMHA 4UBNA 4O2AF 2Z5VA 2OK7A 5JY6A 4UU1A 4Q5IA 4C6TB 2IX3A 3AC0A 5E9AA 3WGVA 1RJFA 2HAEA 4E21A 5J3JA 2V5AA 3T52A 3SKYA 4C7OA 6LDHA 5K3SA 5ALEA 3TUJC 1JJIA 4WKPA 4ZAZA 1K9SA 1IBSA 3X43A 1WXQA 2HWKA 4YRJA 3F6SA 2DLCX 1QFJA 3LY9A 2Y0CA 1GEEA 4LYJA 4PYOA 3U7IA 4D02A 5A4KA 4JROA 3ZGYA 1DKQA 1LDGA 1CWUA 1DKNA 1YC5A 3DZKA 3K9LA 1U3WA 4LZZA 4XDGA 4ZQIA 1HNXB 3SF0A 3O75A 1MAHA 1L4KA 1O89A 2C0QA 1K28D 1Q7RA 3BGOS 3OM8A 4UXHA 2YWHA 1RHUA 2X9QA 2OYRA 4DV2B 4PFKA 1NBEA 4Z8YA 3PFBA 1RPJA 1FS6A 1HRDA 4IZHA 4B3HA 2EEZA 4WECA 4WJLA 4OPMA 2YHSA 3N8DA 3L7NA 4L74A 1UPBA 4RF3A 4TL8A 1JR3D 3HEMA 3R3HA 1ZMRA 3BT7A 5CX4A 3REQA 2W2TA 5EZYF 2CSXA 2WMNB 3PHGA 3UUEA 5KVCA 2PX5A 1PHPA 2CV2A 2Q3MA 1D4ZA 3SZLA 1L5SA 1PWEA 1XZHA 2IZOA 5ES4B 1XMOB 3SC3A 1QHXA 3QXJA 4DCMA 4Y6OA 1DEAA 3DUFA 5HHTA 1HMYA 3KKZA 5LQNA 1TVCA 1H3NA 2OORA 4H6PA 4QOGA 1U0FA 2QAIA 2GZMA 1Z5NA 3G85A 4DUYB 4JT8A 3MT8A 1K7XB 1M1YE 5T8KA 3KO8A 3HABA 2ZSKA 1PNOA 4YJKA 4UAGA 3GBPA 2VNAA 4NF2A 3KTAA 3I6BA 5I9TA 3IAS1 4BLTA 4PLVA 5I7EA 4RHCA 1B16A 2W2MA 1UANA 2ZPAA 5KKAA 4QQ8A 1VQ5B 1QIIA 1XXHA 4OSPA 4M1WA 1KMHB 4LJRA 1LSUA 3M6VA 4GC5A 4YEDA 4PZ0A 1OYYA 1P77A 3NP9A 3THYB 2ZYDA 3BPSA 2D2VA 4DMMA 1B8NA 1U3FA 2OAQ1 1N7JA 3BMNB 4Z9YA 3WAKA 4G2NA 1CRPA 4WK6A 1H1LA 3IDFA 5HQ3B 3OKPA 1GTJ1 1G5FA 1O03A 1Z2PX 4ENSA 4MQUA 1VLLA 2QOEA 3RTEA 3SI7A 5IXSA 3OCUA 2A86A 2VL7A 1U81A 4LDZA 4B43A 3GGJA 4ZCTA 2XA1A 4NECA 5ITSA 2BBWA 3AY7A 1VIYA 5CFOA 2UZ1A 3STVA 1GA1A 1LPNA 3R7FA 3K1JA 2NTVA 3D8RA 1AQIA 1LVGA 4IQ8A 5CIWA 4CIVA 2ACWA 5D87A 4J90A 4O4IF 1MAVA 3AKDA 4XARA 3VSEA 2RH9B 2QF7A 4BLQA 3DZBA 4RDJA 4B48A 2WJ4A 1HDIA 2G6TA 3KQOA 1P3DA 4UE3S 4BE9A 5E3IA 4Q7MB 1FFBA 4HEA6 4LHZA 3LXRA 4FHDA 4BASA 1TF2A 4HN9A 5KDDA 2A9RA 4EBFA 3I73A 1LKZA 4IXNA 2CL0X 3T35A 2PR2A 2QEXB 4B09A 2QVCA 4PSVA 4C89A 1RQNA 4BP9A 2HRQA 3E9QA 2P27A 3BC1A 4EKNB 3LPDA 4REMA 3TSCA 5T3UA 1QRRA 2IYYA 3KEQA 4FOTA 2KS6A 2YHIB 3A9WA 2POQX 3G2NA 1GPH1 2JI7A 2CY0A 1TJPB 3FYSA 3I8XA 5CG2A 2AJCA 1A96A 1G6KA 1I9GA 3JD4A 3MOSA 3B1KA 4ZMSA 5HZMA 1C9DB 4J7CA 1Y9DA 2JA2A 3EQZA 3VPSA 3TVTA 1GGVA 3AOEC 2PT6A 3HL0A 3HK2A 4MUBA 3HCCA 3O4VA 1L1EA 1PJCA 2O50A 4XTRA 2D74A 2AXPA 4H3SA 2IZ0A 4J94A 4EG1A 4IIGA 2BDUA 3UW1A 1CZOA 4BAGA 2VWQA 3KZ1E 1O5TA 4M0UA 2R66A 3REOA 3KB8A 3V42A 3AWDA 4R68A 3S28A 2PYIA 2BFCB 2BEWA 4GI3A 1PFVA 1YASA 1W5FA 2C78A 1EZZA 1M6VA 3WL6A 4O5AA 3ET4A 4HRXA 4E5NA 3K15A 3CTAA 1VI6A 3FOWA 4B6EA 1FDUA 4Z4IA 5TT0A 1W5BA 1JHXA 1N6OA 3QBVA 5I9NA 1JPJA 2ZBQA 2EP7A 1Q82D 2XRZA 3HA5A 1SUCA 3OD1A 5JAUA 4FTWA 3K0BA 4X1IB 1HE1C 1XZAA 1O95A 5BVHA 4LWOA 1Z63A 5KYWA 4R7TA 5EXEA 4AECA 5B2FA 3K6SA 4JN6B 1ZDMA 1D2NA 1NBOA 4AS2A 3R7WB 2H9AA 4RZQA 4LHXA 1Z07A 2RAPA 4MCJA 1IY1A 1P74A 1LC3A 3DMGA 2Z2YA 2VNKA 1J0XO 4I99A 3AP3A 4Z4FA 1G0OA 4ZQFA 2FB9A 4Q3DA 5EGNA 3SEFA 4OH1A 4Z9AA 1AH2A 1AGNA 2B98A 4D0NA 5CIQA 2UZAA 2GB4A 4EX7A 3DJFA 5KCZA 3I0MA 1JQLB 3U4HA 1WDTA 1K97A 3QW2A 4BNTA 3BIJA 3WIUA 5HZAA 5DK6A 5FWDA 4JUBA 1NUTA 3LC0A 4F2PA 2I55A 2OP1A 3J81A 4ZALA 4DB2A 3H5IA 4JYZA 4HEA1 4R1NA 2WA1A 3NAQA 4DQKA 1RVDA 2W7TA 4L0MA 5HTKA 4JI2B 4PHCA 4XZ3A 5K3FA 1MABB 2HPHA 2NSJA 4N3AA 3TIXB 1OHHA 5EWMA 3BK7A 4P08A 1A9ZA 3I5MA 4DABA 2I4OA 4ZQEA 1Y8AA 1R6TA 1N32B 4PIMA 3KBOA 3IMCA 1NFQA 2VZLA 3MERA 4IRUB 4CLDA 3LGAA 2TMKA 2VYNA 3BZBA 2Q9UA 2BIFA 4RXTA 4YELA 4KNVA 3IA2A 3MA0A 4S1OA 1LUAA 3ND7A 5DHTA 2PO7A 3ZDYB 4F9GA 4H4CA 1OIWA 4XVCA 3I2YX 4N12A 5B4VA 1VSUA 4OPVA 5H9VA 5IM4A 3D2AA 4O33A 4Y6QA 4LRXA 4WDRA 5K0ZA 3EF0A 5FOQA 1AKEA 2L19A 2TYSB 2YV5A 3R40A 3V1YA 3UT5B 2WHQA 1YFKA 2R6AA 3OJOA 2WWWA 3AY3A 3DBHA 2H4XA 2BV3A 2SCUB 1GFZA 2QXYA 2C8KA 2MSEB 1HXHA 2PX0A 4PYJA 4M9ZA 1BZYA 1CR0A 4HJXA 4DTCA 1FNCA 4YA6A 1QVAA 1MTOA 1XZKA 3WK4A 1Y9JA 1VIAA 3LDAA 2YZMA 4CETA 3KQMA 4GWGA 3SEZA 2O20A 1L5ZA 4E11A 3UGTA 2J67A 2OWEA 2DC1A 3E5RA 2D1TA 4M1SA 4N8EA 3ROXA 1U2TA 2VDQB 1YK1A 2PH3A 3DTVB 2WTMA 4FZJA 5LP1A 2ZTSA 4YAIA 5K0CA 4B85A 2VK8A 1CTQA 5CFMA 3Q6MA 3QVJA 3UPTA 4WLVA 1FS5A 4G0NA 4BCDA 1HE3A 1VKRA 1F0NA 2WM8A 3PVSA 4I1UA 4OQ4A 5M5BA 1MRZA 4AJLA 4N54A 3FUXA 3V6LA 3TNLA 2GBFA 1JHPA 3L2OB 4UDNA 1T26A 1M2OA 1LNQA 2FWPA 3PHHA 1SJ9A 4GQIA 1NAIA 5JQGF 2UAGA 2ZI3A 1I5EA 3W9SA 3DLBA 2JLRA 3HJUA 1QJ4A 4EGCB 4MI3A 1WPCA 1E8MA 3QU7A 4YRMA 3CKKA 1NKVA 3AV3A 4EO7A 4CXMA 3F4BA 3L5OA 1GZ3A 2A1TR 1A9XB 4IXTA 1SKYB 2PL3A 3BRWA 4UE6A 5EYPA 1EUCB 4HWKA 5LQAA 2ZWVA 3WWOA 1P5JA 1W19A 5A6SA 2QXTA 1NJ5A 4KQ2A 2IWRA 3PEYA 1HYGA 1PWXA 3B12A 3NH6A 1R4MB 1TPYA 2P3LA 4RY8A 3MILA 5AJWA 2EZTA 2ZUCA 3RO7A 3HJAA 6AT1A 5GADl 1GZ7A 1HYEA 3G8YA 4YRSA 5ALDA 5DP2A 2NUAB 5EIAA 1PL6A 3ZG6A 4LYGA 1PGPA 3BDAA 1XOIA 2APJA 3AM3A 3NIFB 4KDFA 1U31A 3D9QX 4KP7A 4CMAA 3M1AA 2RBKA 3ETCA 2C3OA 1VQ1A 2O8DA 1Z5UA 5FPHA 3VM6A 1X8XA 2ZVPX 4DXDA 4K9RA 5BYBA 1XCBA 1SZJG 4ALIA 2ZTLA 3DCNA 3LCRA 5JMOA 4EUHA 2IXTA 1GLGA 1TM4E 2PRIA 2VPTA 3BNWA 4QV2A 2HQBA 2ZYVX 3KUUA 3TMAA 1JNYA 1FLAA 3M2TA 4J3NA 2O2YA 2DR2A 1CUXA 5IYZB 4AY2A 4L07A 4QT4A 4ZOBA 1DJMA 3ILSA 1E2MA 2GRUA 5F4ZA 4MROA 2H08A 3TBFA 3ML1A 1BH6A 2FU5C 3CXUA 3FD8A 3BMCA 3A1PA 1UPTA 4GPTA 2VHVA 4DMFA 3V2HA 4DA6A 4TSFA 4OREX 5EE0A 1K89A 4ZYVA 1NZFA 3EK2A 1LBHA 3OIVA 4OMUA 2PZFA 5DRTA 3VJKA 5KOJA 2KVOA 3CGGA 3GYGA 1VP3A 2PTGA 2NO4A 4AO6A 3ZY2A 3LHIA 3N2YA 3UWKA 3IUJA 2A3NA 3E7WA 1PHRA 5HPYB 1Z6YA 4XFJA 1VLHA 3DMPA 4OI0A 3KR2A 3CG4A 1N0WA 5IM5A 1P4GA 5AVQA 3MF4A 1DQZA 1K66A 1KYXA 4NZZA 1HY3A 5ELMA 2Z98A 4IIUA 2G0NA 4MKFA 2ZVQX 4Q9LA 3CXCB 1QKIA 4DLVA 1I0LA 1QS0A 3B8EA 2FWAA 3L0PA 1IFXA 3B82A 3MGCA 3K96A 1L7RA 1WVMA 2QMZA 3NDIA 4JBXA 1YRYE 1UD8A 3IQDB 3TEJA 3OZCA 1JHYA 1N9GB 2X6YA 3Q5GA 4EHBA 3FHJA 1UBGA 2CVPA 3DKVA 3U3DA 2Q21A 4IG9A 4ES6A 2AG5A 2YWFA 4N40A 5BNFA 1AK2A 1PNVA 3PCRB 4NPCA 4C4RA 3MGBA 3B6ZA 1QTQA 1C4OA 5K0EA 2R96A 5JPIA 3RKUA 3H3FA 1YA4A 4ASUA 1WSRA 3THXB 2IPMA 3ZDXB 3GEGA 5EUBA 3U13A 2ZAGA 1XEXB 3IPYA 4DEXA 3SEAA 4X7FA 3EZ2A 1VI5A 2QRLA 5FI3A 1T2VA 1EKXA 2C42A 1K4KA 2R1TA 3L07A 1GQYA 5FWYB 2PMEA 5HXBA 3SS7X 2G7ZA 3OIYA 4BZZA 1HO3A 4NE2A 3WGJA 5D51S 1J99A 1PSWA 4QYIB 4AJHA 2P2DA 1PJ4A 1P72A 2BKLA 4DCNA 1PLJA 3QUSA 3RFCA 4Y6RA 1BGVA 2H8KA 3EG9B 4JMPA 3ASUA 4IPTA 3VR6H 1QHHA 4URFA 5KWSA 1ZN8A 1H5QA 1G3QA 2V7EA 1O6FA 3GMIA 3H16A 2J4FA 1FF9A 3B3QA 3NASA 4US0R 1VMAA 4YRFA 3PQ6A 3C43A 4RCVA 4TKVA 2IODA 3PENA 3W3AD 3F9IA 2V3WA 2HQSA 2R68A 3MGGA 5BN1A 3RNLA 1EDZA 2EJVA 3X2FA 5A04A 2PFGA 3RVBA 2CWDA 4WBXC 3WY9A 2FRVA 4IOMA 5EJIA 2GD1O 2G67A 1I4WA 2II6A 5EMNA 3NC0C 3IR6A 3PXAA 2P7HA 3WL7A 5I8WA 2ZI9A 1P6QA 3DEJA 4YT8A 5E6RB 1GO2A 1EFLA 1PVDA 1CUEA 1HZZC 1UWCA 4ZI7B 1U1GA 2XIJA 4FZ5A 3BB4A 4TT3A 1J0EA 1PJAA 1Z5WA 4G3XA 2D1QA 3TZ6A 1QZZA 2PN1A 1NX6A 2ANCA 5AW9A 121PA 4G0MA 1Z36A 4XKWA 1ZU4A 3M8KA 3P2MA 4HAIA 4U7PB 3RS3A 3NDBB 2UXCB 4JSRA 2O5RA 3TZCA 3VBCA 3CNNA 3KVNA 2ZTMA 1Z0UA 5FL3A 4D9CA 5BWLA 1KD1D 4ZO9A 2ZRJA 2XR1A 4KTVE 2JBHA 1FBNA 4JK3A 1KJZA 4TYPA 1X0XA 3WMGA 4DRZA 1OXVA 1R6AA 4A1FA 5JCPA 2WYVA 4M8LA 3OTWA 1LLFA 3S8YA 4D5EA 3O3CA 3DE3X 3O2SB 2O57A 1Z88A 4R71A 2BE7A 4QFBA 3EARA 3UZUA 4X66B 3FPEA 4NJOA 4M1ZA 1WW2A 2WZQA 3H7IA 2XVAA 1B15A 2VHQA 2CLHB 4FYPA 4MKHA 4WOJA 5FQNA 4B4WA 3WJAA 1RC1A 1KYVA 1U4SA 4G0UA 3BHJA 4LE0A 3WLKX 2H9IA 2HSWA 4E2FA 3NCHA 2AOVA 1MG5A 1JMVA 4HGZA 4ND8B 5K4HA 4D4KA 1QZUA 1XPUA 2QUKA 3RG8A 5LQCA 4MAAA 4DDMA 3OT4A 1X1BA 3C3AA 3VDNB 3WYDA 5GZ6A 2HSDA 2Q4RA 5ES3A 5A0TA 2BCJQ 4WXYB 1NWHA 1E7WA 1JKJB 1L9KA 4NMHA 2C3UA 2HEIA 2O3SA 4GMXA 1LB1B 521PA 2BUCA 1X86B 3IP1A 1KYWA 2NQTA 3HU5A 1IE3A 1SZCA 2DWOA 2YX1A 3BKWA 1PG5A 2AN4A 3FRIA 3NTQA 3C6ZA 3K0HA 3MFYA 4MLZA 1CZUA 3UJBA 4FSHA 2X3UA 1E6MA 4Y2XA 2NLOA 4B3JA 5B3LA 4EF5A 3OFVA 2GZDA 2OV2A 4EBBA 4TWJA 1XZCA 1XDZA 1JSRA 2TSYB 5JXHA 3PXXA 1Z6TA 3SZGA 2ZJZA 3ZVNA 4A8JB 4HTAA 2ZLBA 1P19A 5FWAA 2IEZA 2J7PA 3ISVA 1DPFA 4R98A 1N8SA 2I91A 3PNYA 3MUNA 1OX5A 2ZBRA 3HUDA 4RY0A 4V0ME 3TAHA 1E2NA 1WXXA 1W46A 1OLSB 1SCUB 3CRQA 3FUVA 1LDEA 2XOKA 5K0JA 4KYTA 2I6QA 3HS3A 2B99A 4OHOA 1A8IA 2CEKA 2DKOA 3HBJA 3MJRA 3LXUX 3MRTA 2CNKA 1MMFB 4HUJA 4JP8A 3GYBA 4Q03A 2Y2VA 4AMBA 4DA4A 3OZSA 4US1R 2P6PA 1ECFA 2WOOA 3H2JA 5DM1A 1JLMA 1PGOA 4D82A 1JJAA 3DDNA 2XYRA 3CF4A 3QPAA 4Z1MD 2IIBA 2P3OA 3CX6A 3DYBA 2QGFA 5A5DA 2IP2A 1OVMA 2FQYA 4YDQA 4OK3A 2XYPA 3NV7A 3CYFA 2PX8A 5JC1A 1DAPA 1UEIA 4EK9A 5JLAA 3HHEA 4HGQA 5DHPA 1XRJA 1SHTX 1THZA 1EP9A 2PJUA 3NORA 4LS3A 4ZV9A 3KEMA 3B38A 2C0PA 1XAJA 1K06A 1E7YA 2QL7A 3NBAA 4BNXA 3HI6A 4Z4ZA 4AN0A 1CNFA 1OFVA 1TFRA 2WILA 2ZB8A 5I47A 5L40A 1D2HA 4DC0A 2WWXA 1N6RA 4FYMA 4KKTA 1WS6A 5A06A 2OTJB 1T8SA 4ZYWA 4X1YA 3C3XA 1UQUA 5FLEX 2YKGA 3B9BA 2UUPA 1ZY2A 5F1YA 3FAKA 2K87A 2R8YA 1PLLA 5DSXA 4HZUA 2V4ZA 3GLHA 4Q9AA 1ZUWA 1F3OA 4MR7B 2M9MA 4S12A 4JP2A 2OQ2A 2X8AA 2D9RA 3H1AA 3MGAA 3GUYA 5BQXA 4EPYA 2A7QA 1U9IC 2D5LA 1C9YA 5KDOA 5AUNB 3BXPA 3PFHA 3CTPA 1ZR2A 2ST1A 1JDJA 3CPWB 5ALWA 2WIGA 3L4KA 1C1DB 2QT9A 1H6AA 3DLCA 1C8KA 4H27A 4YLEA 3WKBA 4JLJA 3NC4A 1EFVA 4EFMA 3ICEA 3QELA 3RSOA 4X20B 3TCNA 1JWAB 1Q22A 1TA9A 2G3YA 3VKVA 3RIXA 4R5HA 3KWLA 2XKKA 3DFIA 4GKAA 3NHKA 2YIVX 1G41A 4OEHA 5J4KA 3V8EA 1XD8A 2GAOA 1JTEA 4RESA 5A03A 5TLSA 3BIWA 4B9AA 5KOYA 1FP4B 1X92A 4H3VA 3DE0X 4HYYA 2G7MC 4A82A 2CVOA 1J8FA 3L7KA 5EIWA 3LCJA 1EXVA 4DUGA 3HKCA 3H94A 5H1YA 3F1LA 2J0UA 4EGAA 2F1JA 3EFHA 1WV0A 2B1GA 3PKIA 2JGIA 3QE3A 4O0LA 2WPDD 5IYZF 4ZOEA 3SC2B 3IXMA 2DKNA 5FXMA 3BEDA 3GDHA 1PS0A 1JSZA 1GDDA 1U0LA 1VMIA 2OGWA 4LNUB 4LV8B 5AI6A 3HWWA 4TTVA 2PUCA 5A89A 2FSVA 1PQUA 5F5XA 1N1DA 1X3LA 2V45A 3K9HA 1DJNA 4IDNA 1I24A 3NIWA 1Z4OA 1P7WA 2BR4A 5LLDA 3J7AC 1XQ1A 3WQZA 1RI4A 2HHHB 3OMLA 3TG8A 4BOYA 1V25A 1PRYA 4FR5A 3BF8A 3SEQA 1PK8A 1DX4A 5HVNA 1GGEA 1WIWA 1U5AA 4N4AA 4TTRA 2O8FB 3SEJA 2Q1YA 3VC2A 4RV9A 5ILOA 1WCIB 3TLXA 4PRYA 4YX9A 1VJ0A 2DEUA 2IDMA 3VU3A 1JVNA 1YIOA 2ZWOA 4OBXA 4B2LA 4P3YA 3EPLA 4AZTA 2D5AA 4RZ2A 1YQ9A 1VI2A 3O8NA 4O4HB 3TW0A 2XV1A 4CM7A 1BU5A 2V0GA 1ZH0A 4JUFA 3WQQA 1RQ7A 1EQAA 2C4NA 2YN0A 3BE4A 4AW9A 4OQPA 4H08A 2FZGA 4IYRA 5KNCA 2DLDA 1DJOA 1GPMA 1DIOB 2I1VB 3ZUGA 1M0WA 3OCJA 2GVNA 4MQ4A 5COQA 4S05A 1F12A 2WYOA 3BOSA 3ZGXA 4P0QB 1XNQB 1OOEA 5TC4A 5JZSA 1FXUA 4Z8XA 3QIVA 4M6WA 2GFQA 4CDMA 5J5AA 1A9RA 3D1JA 2VG8A 3L8YA 5EKDA 5CLFA 1SBTA 4EFNA 2HDWA 2C7QA 1LC0A 2Z1NA 1EFPB 2XUOA 5F2KA 5ADUS 1SC3A 3FSEA 2QSUA 4MUKA 5BNZA 2H5IA 3UCXA 4QUKA 2ODNA 2AW5A 5KSOA 4BFVA 1GUFA 5CK5A 5MN4A 3F78A 5L4NA 3L84A 3OCYA 5CT6A 4WCVA 2LD4A 2QZJA 4DIOA 2C61A 4L75A 1E2UA 1I14A 3QUCA 3GRVA 4NDAA 4OQEA 5E9QA 1T0JB 2EX4A 1KQ3A 3RABA 2YJNA 2P2NA 1RU3A 1M0SA 2QLBA 4K9DA 5H80A 2R47A 3OTGA 2VRBA 5CPBA 5FUQA 4WXMA 1GZDA 5KBYA 2FTKE 2IPNA 2ZRIA 5BSYA 3ABOB 3PGMA 3U4QB 4OI1A 2GD0A 5CNJA 1L4FA 3B6EA 3O91A 3ZDRA 4ZIRB 4R5MA 3A10A 3VPHA 1PDVA 4RETA 5L9AA 2O5VA 4W82A 8LDHA 2AI3A 2OCYC 2VJAA 1JAYA 4GEGA 4WERA 1Y1KE 2AE1A 3B5IA 3G5MA 2PGIA 1O58A 2XT0A 2YH2A 3IHTA 3VU1A 1B00A 4BB9A 4R8LA 1W73A 2IZ7A 4C7VA 3LQEA 1BRTA 2O48X 1LU9A 2G0TA 3IVCA 3QPCA 3W4KA 4LDRA 3KNZA 4EG0A 1XRSB 2W2LA 4I1VA 2JHFA 4LOHA 3SMVA 3TLKA 3UH1A 4QYMA 1QGED 3H8SA 1E61A 2P9BA 1QXSA 4EEXA 4ZI7F 3IVXA 4MAFA 2PSFA 4E5VA 3UJ9A 5F21A 3LWBA 2CMDA 4A1OA 3DFKA 2Y05A 2V9ZA 2OPHA 1OPRA 4KQJA 2F3QA 4EF4A 1ZA2A 3O21A 1K8AD 3PKJA 1JQEA 1Z7EA 3L7DA 4NMXB 2XDWA 4AZ0A 4DJJA 1Q14A 5CFLA 5JD6A 5MN5A 3UO8B 1BXRA 4P38A 4CM8A 1DCKA 2L82A 4BVAA 2QV7A 1PZMA 4TYNA 3X1JA 2AFIE 2Y71A 4CM6A 3K3PA 4YV7A 2GF9A 2IS1A 3UG6A 1NVEA 4QRDA 5IK2D 1I1HA 4RU1A 5FUXA 2R2GA 4ND7A 5CLIA 3U44B 2VAPA 5DI9A 1HZJA 2JI9A 1U4NA 5JPCA 1NX9A 4LF4B 2ZYTX 2VP9A 3AJ8A 5AM5A 3I6MA 4MRSA 1NVXQ 4KYVA 2ALJA 1VFPA 2VQDA 4J0QA 2PZ8A 1K4MA 1VLVA 1ZSYA 3E35A 3E84A 4FBLA 4BDTA 1EWQA 1T36B 1S89A 4ARUA 2O07A 1DGQA 3TZKA 3NJ4A 2YXNA 3CUEF 1Q20A 1YU6A 2IOFA 5EJ5A 4Y9RA 3A3GA 1ECCA 1IHXA 1TZKA 5ICCA 1SXIA 4HQ6A 3VSCA 2P9QA 4TMFA 1GCAA 4X5OA 4HWPA 2WMYA 2Z95A 1OBCA 3W3ZB 1ESZA 1CUDA 4LHSA 1RYBA 3VTFA 1NF9A 1TF5A 2FPXA 2V6MA 3D4BA 1K7YA 1GAWA 3D2BA 1UWLA 4GEKA 4P5PA 4IIJA 1E1MA 2I4IA 3AUKA 3BG5A 1P2BA 3MWJA 3Q3JB 4O2BA 2IEBA 5BMVB 4GLOA 3B53X 4IRXA 3GOHA 3D54D 4FMCB 3BSFA 4YUZA 5KJ6A 2MSKA 4ZPXA 5U4QA 1KXJA 1S8NA 1AKMA 1C7IA 1TMYA 2HLPA 1KMCA 3G02A 3NTUA 1UFQA 1W4RA 2OGTA 3DP7A 2GBIA 1D07A 3EZNA 5IUNC 2GBGA 3KZCA 5FLYA 3WFIA 4H7FA 5JYEA 4Z4RA 3OY2A 4DG5A 3LWZA 4GVLA 3OJ0A 1VDZA 4EI9A 3CLVA 3INTA 3ZZTA 1ZL0A 1G4UR 1RIFA 1K7EB 2R6CA 1ZD5A 4RPJA 5E0KB 5LXTF 5L95A 3UBMA 1LEHA 3G05A 4AULA 1T0HB 3EC1A 3NONA 3PC8C 1P1JA 5F12A 3I76A 2FPIA 4FJ2A 4J0FA 4R3NA 3C98A 1N0VC 3RTGA 3U9SA 1QDUA 4P81A 1AS2A 1DIGA 5J9FA 1Z83A 4JX8A 3H8VA 2FWIA 4I5DA 1EWTA 5EWLB 5BT9A 1I6LA 4B83A 2Y1LA 3MYYA 5C8ZA 3CN7A 5MF6A 1IM2A 2VT3A 1M1XB 5KYUA 3BE5A 3I9MA 3IEPA 1X8KA 1BN6A 2ZULA 1W4AA 4KAXA 3SVLA 4Y1RB 4WJKB 1VE6A 2XQFA 4OFZA 3P1JA 2AFIB 3BMQA 1M1YA 1Z38A 2NU7B 4RENA 1G55A 1HURA 1JHVA 4QYTA 3FNEA 4H7JA 1K6EA 5DGIA 2V3CC 4NPHA 4JH0A 5FO0A 2BFNA 1QGAA 4BQSA 3ELDA 3BXZA 5FPYA 3W5DA 3DXXA 3N9IA 1THTA 4KWTA 2WWHA 4W5TA 5ELXA 3C48A 3DZ8A 3MHPA 1U1CA 3O83A 5SYNA 1ZQ9A 1Z6QA 3DBRA 3OCVA 4MEAA 4K9SA 4X94A 1JSLA 4CG2A 1VHLA 2DR3A 5CVEA 4B2PA 1W30A 1KAEA 2RGNA 4EM6A 2IYWA 5JASA 4RSGA 1COWD 3GFOA 3KJGA 5EHQA 4ED9A 5B4UA 2D13A 3OZWA 3VZPA 2AUTA 1E4EB 3F9CA 3UC5A 3MHTA 1U6IA 1XFAA 2OCGA 2HIHA 1H0RA 3QPDA 4Z4CA 2HNKA 2YJZA 3PHBE 4WX2B 4Q1EA 3HDGA 2IYRA 2QVLA 4HFJA 1MZPA 3LGSA 3GMTA 1N3BA 2A5YB 3RF7A 1YOBA 1ZI6A 1GZUA 2I67A 4F12A 2JD0A 2IU6A 4Q9JA 4IDGA 1XYGA 4AQDA 4YO7A 3FETA 4JUAA 2O3TA 2Q5QA 4AY5A 3MQ2A 3R41A 1WDLA 4CZ2A 4FFMA 1IVSA 4PX5A 1Z7BA 5H02A 1KFCB 1PFWA 3A14A 2F90A 2JFOA 3EW9A 3H8WA 1KEVA 4Q3NA 3ROKA 1G8PA 3DPSA 3ADKA 3KQYA 4Y2JA 2C84A 4GOND 3U5TA 1J0DA 2H4ZA 5IFKA 2MSWA 1OWNA 3MCWA 1ZVKA 4WESA 4JLAA 3K71B 2J4CA 1O96A 4MW0A 3C8DA 4GBED 3EZFA 3LCMA 4CKEB 1WNTA 1R8SA 1KHTA 3W5HA 1CV2A 2WYRA 1RHMA 1HE4A 2RBEA 2QRPA 2B69A 3E81A 3GF4A 3LOQA 4FFVA 3LLUA 1E79D 1ZWKA 2GTIA 1CG6A 2YJ5A 3KLMX 4OO3A 1ZZGA 1V0JA 2GHRA 5AKYA 3BJZA 5TGZA 2ATIA 2UZIR 4BFYA 4DCJA 1FSPA 1MJNA 2Q5HA 3GLIB 1ID1A 2WE8A 1MCZA 4FKMA 3CLTD 5DX1A 5SY6A 1QLHA 2D59A 2I6FA 1R6VA 2JLVA 2CXNA 2CXPA 2GZHA 2J6BA 2QB5A 4DR1B 4HR7A 3IP8A 3L6OO 1P7CA 3T7JA 2OFWA 2XUQA 1Z0JA 3LT2A 4IF4A 3IT2A 1N6KA 4G9EA 3N6VA 1IUNA 4MWTA 4O6VA 5CR9A 2BFFB 4ZQHA 3DBLA 4O4HF 4YCDA 5EQFA 1ZVJA 1C7QA 1EINA 1NQVA 3KLOA 1HFJA 4YJGB 2IWHA 3T99A 1E3JA 2BDTA 3I05A 3OIUA 3LQ6A 4YPFA 3RWOA 4Z7NB 1ZJYA 4YCAA 4H77A 4Q1AA 4S04A 3THSA 3IJRA 4G85A 3AKZA 3ST7A 4LJKA 4LXYA 1YZVA 4PC2A 3ED1A 1XBTA 2BJVA 3DV9A 3C3EA 2QORA 1TM5E 5AI0A 2OFFA 3SE7A 2WU0A 1OXUA 1PW5A 2YRXA 3NO4A 5DBGA 4S2EA 2G9QA 4WLOA 3QYAA 2J6IA 1NBWB 1NQWA 4HDMB 4IDFA 5FBHA 2DERA 4CEJB 4HBZA 1P5RA 2VI5A 1JWBB 5K01A 2EGUA 4BTVA 1QCDA 2WIKA 1FZTA 3WB1A 3L9WA 4BVLA 3ANXA 4MYUA 1N1EA 2FJPA 4NG5A 4UULA 5FPKA 3R0IA 1H9BA 2GTPA 4XQFA 5J3OA 1RM4A 3I83A 3U9LA 4B6FA 4GLJA 3I2IA 1DKUA 2RI6A 2QKYA 3PHIA 4UBLA 3HB1A 3AERB 1ABFA 2OECA 3FDZB 2DTXA 3IP7A 4F21A 1OX6A 3CW8X 1L1QA 1YRLA 2ZRPA 2X0KA 2VPXA 2ZTHA 3C24A 1W36B 3WQHA 4UCQA 4RTQA 4RPLA 3PRHA 3VJLA 3EDYA 3VVLA 7MHTA 3GPCA 2I0FA 4XVRA 3JY6A 4DBLC 4UFOA 4GR4A 2AXQA 1S01A 2XQIA 3UMVA 1G6HA 3EMVA 3GIRA 5D3KA 4NBLA 5ALPA 1A9XA 2OO5C 2FK7A 2QR5A 1WD5A 3HHPA 2NP6A 1PKEA 3DXYA 2PE5A 4WXPA 3GDGA 3RRZA 4U7DA 2M1ZA 3IJEB 1GCOA 1PS9A 5FULA 1C8LA 4QOJA 3UB4A 1U9YA 4TMTA 2X41A 2WZNA 4XIFA 3ISTA 3TTUA 4N39A 4Z4YA 1GPLA 1P91A 4IO0A 4R3UC 1BW9A 4AAYA 2W83A 2CNOA 4OU5A 1VQLB 2RH5A 4MHOA 3WL3A 2DTDA 1Q15A 1VL0A 1BXKA 1XNGA 4I6JA 4M7WA 2W6ZA 4JI8B 3H87A 3SG0A 4JYBA 3BILA 2D2FA 3PEFA 4HZGA 5DNAA 1GUYA 5KCMA 4XEHA 1Q3TA 4DLLA 1H6CA 4XB2A 3HVJA 3WP1B 1R16A 3LWNA 3ONDA 4TUYB 5L4SA 1F38A 2EFHB 4HUQA 2YXLA 3OIGA 1GFSA 3Q6QA 4RD0A 1VG8A 3HNOA 3FGPA 1THMA 3ANMA 4I4TA 1TM3E 4L4RA 4DV0B 1EAMA 2GTHA 3NAMA 1WWKA 2UDPA 1JX6A 1QMPA 4BQIA 4FLFA 2KPOA 4RSMA 3TZHA 4RCYA 1QGDA 4D80A 4WFQA 4I5IA 4J4HA 3GD5A 5LYJB 4GW3A 4XYMA 5DOVA 1OBHA 4TZ0A 4RF2A 1ELOA 2C1ZA 1LQ2A 3EVGA 3TRKA 4JJ7A 4EVIA 2POCA 5FBKA 1O94A 3OCXA 2NUBA 1O8BA 5LFAA 2R25B 4LRUA 2Y1GA 1S2NA 3ED5A 2G1PA 3OZAA 1P60A 5GQSA 3V55A 4QFCA 2PIAA 4L0CA 3VKFA 1K2WA 2BEKA 1L7MA 4JIMA 2WPNA 3ZQKA 4CTKA 5CYGA 1GADO 4L0DA 4ZTZB 1PZHA 1DG1G 1KQSB 1IY0A 5F51A 3MINB 1TKCA 3CZRA 3ZHZA 4MW6A 1PEAA 1E4OA 2UVDA 4LNAA 4P4SB 4K9KA 4OP2A 3ROQA 2A59A 4MGYR 1QOZA 5K3BA 3MTBA 4O8CA 3GLGE 1ZKDA 7ADHA 3PGLA 1XEWX 1QAQA 4I55B 2J85A 2VLBA 2J7KA 1ZMXA 2B94A 1TT7A 3H2GA 4K1XA 4XORA 4ZZIA 2O23A 7AT1A 3ITKA 1MAUA 3UYLA 4U2KA 1AMNA 3EIHA 3QZUA 3TGWA 4D9FA 2PSDA 3SBDA 3FMGA 5AXBA 5BMVF 2XB6A 1KH3A 5LZ5A 3W5JA 3M0EA 4IDCA 5TEVA 3T1VA 4FMCF 1OFTA 2JRCA 4Z2AA 2JG3A 2QI9C 1Z0FA 2NX2A 2TMYA 3L6UA 1E3QA 3E27A 2I7TA 4QX6A 2HA2A 4RKFA 1X15A 3MGKA 1RI1A 4J29A 1WL8A 1YNOA 4OXXA 1NYLA 1VE5A 3TQHA 1XRRA 2VDWA 2W5UA 5DBFA 4XWAA 3VNAA 2AVDA 4K3UA 1F2DA 4JB8A 1V6CA 3OCWA 10MHA 2I54A 1ZH8A 4LQCA 5FEMA 2ZSFA 3A7DA 3BSWA 2A94A 1ZI9A 4K6MA 2YFKA 3EGVA 2FUEA 2OBXA 2X2PA 2JFVA 2AHOA 3B13B 3MRVA 4ARZA 4CMKA 1E0AA 3ASVA 2RHMA 1ZH4A 5EPEA 5LSAA 3U7EB 1LLUA 1LTHR 4AZSA 1TFUA 2BF4A 1Q12A 3QTTA 4MVJG 5HFAA 3UKJA 5C4MA 3F47A 3OZGA 5TQ2A 4WASA 1M90D 4RD4A 3NDJA 3FDIA 5KNLA 3OPVA 2BWJA 2IFTA 3DGEC 4D4JA 4EGFA 1G9SA 4NZOA 1QRUA 2ILTA 2COKA 1WULS 2FSSA 3T7EA 1CX9B 1THGA 3DDHA 4G0OA 5BVGA 2GI4A 1NZDA 1M6YA 3R09A 3OURA 1KP9A 1RI3A 4HQFA 4ZAYA 4C9BA 2QZZA 3GA7A 3KYDA 1I13A 3D6TB 5TF4A 2B30A 2R86A 3V8PA 4K0KB 3DTYA 4DMRA 1DHRA 2BHTA 2WG0A 3E53A 2C59A 4GI7A 5E6RA 2XTMA 4JOCA 1XZQA 4BO6A 6GPBA 2P69A 1E2KA 4X95A 1DTWA 4HPWA 3ET5A 3SSAA 4YJ3A 3OLXA 4JBNA 2DXIA 1ZIDA 4MEBA 2QQ0A 2VYCA 4UW9A 5JXWA 3O93A 3SSNA 2M6SA 3VO9A 3QITA 4XX0B 3BDIA 2I9KA 3E20A 4BMOB 2I4MA 3EZLA 1XJ5A 4OVKA 3AH8A 2J5XA 2IL1A 5JAHA 1YXMA 1B42A 1YL5A 3TB4A 5CTJA 2YY6A 1OAOC 1ZGZA 3L4EA 4RA6A 1P1CA 3WTBA 2VDLB 1AT1A 2AN3A 2D3NA 3VNVA 3HPQA 5JFOA 4MJ7A 3WKAA 5ETJA 2VUSA 1QP7A 3IMEA 1HEUA 1FX0A 4GP9A 3OOYA 4ZGGA 1ADCA 3H5AA 3VOSA 3U3RA 4NXNB 2E2WA 1DINA 3LQKA 1WXGA 4NCXA 2BBOA 1USVA 2QVBA 4KTTE 4RKRA 1CY8A 3LF1A 4UM9D 4YRRA 3VR4H 3WKEA 1TEZA 1G2OA 4OBWA 1FRVA 1K6JA 5EZ5A 3AFGA 1WTHD 1ZGCA 3EVEA 1OGJA 3ESCA 5DBOA 2P5SA 1P33A 4ZYYA 4ZHQB 4ATNA 9MHTA 4PYNA 3T9AA 4BC1A 2E82A 3VZDA 3OCZA 1MQ9A 1OIVA 5AICA 3IV7A 4LXXA 2GCGA 4B7XA 4C29A 4G1FA 4RL4A 2J3KA 2IUYA 1CZLA 1TPZA 3PDIA 1UJMA 4IM7A 4D74A 3AB8A 4HC4A 2W0MA 2GBLC 1QLJA 3NRBA 3H4IA 4KQGA 4OM7A 2H1WA 5FPTA 4E70A 5J4VA 4YCCA 1ZD3A 4HNGA 2P8SA 1C9KA 1NATA 2EG9A 3ZHSA 4BN4A 1JFTA 4XGQA 4MVXA 4B34A 4CT0A 3QJYA 1VQ9B 3H42B 1M66A 1DELA 3GA5A 3GRCA 1Q2XA 3H4VA 3PTLA 2ZUDA 1Y80A 4KKXB 1HDGO 4A8JA 1J09A 1FXWF 1X7WB 3E9RA 4AZ3B 1EB8A 3AM1A 1C30A 1VL6A 3DULA 1SULA 4M46A 4EVQA 2UU9B 1JG1A 4DLXA 1M2VB 2IXAA 5F9HA 2FE1A 2VWGA 4MWZA 2D54A 3D4IA 1NQAO 2X5XA 3TOVA 3OW7A 5KREA 3IPCA 3HFRA 3OEWA 3T1YB 2RI0A 2O2GA 1I30A 4OI2A 1JAHA 3KZNA 3P0HA 5IASA 1ZD4A 1E1NA 3BGWA 4G1EB 1TF7A 2YICA 4ROTA 1N92A 3MWEB 3RAGA 3T4EA 3S6JA 2IBSA 4RQUA 1LV8A 3DZGA 4OHVA 2FR8A 2DOGA 5EJAA 3QVVA 1H9AA 4P34A 3DLAA 2WHPA 4Q1CA 1BKYA 3UVEA 1ULBA 3PFFA 3T6KA 1QYVA 3N7TA 4PC6A 2ZQ5A 3K1TA 4CIAA 4JB3A 2DPHA 4MS1A 2BM8A 1O5IA 4LIPD 3RS5A 4BNKA 3SVTA 1FVFA 3HCEA 3QKRA 1UT8A 3SFTA 1GQ2A 2ZQYA 1JTFA 5E6SA 3RKSA 3CT4A 3L4JA 4BV9A 5E1OA 2JCGA 4QPNA 4XONA 2GZ1A 4C43A 1CD5A 5EG5A 2E1BA 1PZGA 4NLLA 1G0NA 1D1SA 3DM9B 3GAZA 5FO1A 4FDAA 1LQUA 3OSUA 4WE3A 5HZHA 3RIHA 5B30A 2QZSA 3M4YA 4M8SA 1JS1X 2B8WA 3CLSD 2LIVA 5AN9A 2WHRA 1SRRA 2HFJA 1GRNA 3M6WA 3OZDA 3PC6A 4OFWA 5EIFA 4E5SA 3PDCA 1X74A 2Y77A 1U0SY 3RR2A 5FBQB 3ZBPA 1RE1A 3R3WA 4IMPA 4D6XA 3FOZA 5I5GA 2QTZA 1GPYA 1RXYA 5LUBA 3QUAA 4Y2UA 2QY9A 2Z09A 2Y1WA 2D3TA 2ZKIA 1AURA 1SQ0A 3VJRA 1LK7A 3OM1A 3U3KA 1Y48E 3GH3A 4GVXA 4L50A 2GAAA 2HCRA 1TAQA 4MYHA 3MQFA 1Z73A 4WDQA 2GGSA 1JW9B 2CJYA 4P7BA 4RY9A 2IZ5A 3AJEA 4FIDA 2G9NA 3Q7EA 2G1JA 4M3NA 4HSGA 2QMQA 2QRQA 2Q46A 2Q5OA 3DWFA 4J3FA 3WLFA 4M9XA 4AYWA 4LKRA 1MB9A 4QGFA 1E58A 1AG9A 3T9DA 2YUIA 1YV9A 2JASA 1X39A 3KJQA 3SHVA 3U4MA 4MRNA 3B89A 1ZHOA 2JLUA 4TUYF 1WXHA 2ACEA 3D1LA 2ZWIA 3CS3A 4BO0A 4KVZA 1JHRA 1Z9BA 3QX7A 4MCAA 5JRZA 4WZTA 4UTOA 4X8MA 2RD2A 1USWA 4XLFA 1A9PA 5T64A 2LPMA 3ANLA 4V0MA 3MPUA 3SC2A 3I9KA 4EA8A 3NKVA 2PYDA 3C15C 4UUPA 3RVDA 2ZJ4A 4X84A 3UJHA 4OLAA 1U1DA 2PZBA 4M1TA 3MBOA 4ZANA 1K8ZB 2LBPA 3FMFA 1G6OA 5F78A 4B31A 3P2IA 1WW8A 2O2IA 3ETDA 4L57A 2V7TA 4GGPA 4B71A 1NW6A 4F4IA 1X42A 3UMRA 4DCOA 3PFIA 3HU2A 5K2OA 2WSSD 2Z9DA 3DCJA 1QC5A 1P2VA 1T8PA 2Y1DA 1OXXK 2VP3A 4KGVA 2H2HA 4EFDA 4YRGA 1G8KA 1ZU5A 1UBEA 2V54A 4CL2A 1A50B 4FFLA 4ZGWA 3B5EA 4XGNA 3AG5A 1CCWA 4IJ5A 5EERA 4I55F 1SPXA 4C22A 4BKRA 1VYTA 4MPRA 1R3UA 3CVUA 2HDNB 1DX6A 2NZUG 4Y2YA 2JKYA 4DCVA 3KV1A 2XDAA 4WWVA 3BRSA 3WLAA 4L0QA 1LSJA 1NTRA 1XWWA 2WABA 4P84A 1AE1A 2I3ZA 4UC0A 2M6RA 5FOVA 1GFIA 3LMKA 5IZCA 4UHBA 1R3DA 3I2KA 3K0AA 3R24A 2ZOSA 2EFJA 3GJRA 4FGKA 4MARA 3FJ1A 4A03A 3HKDB 2Z30A 5K8VA 2B2XA 2CNWA 1Y4SA 1HTWA 3BWCA 3C87A 4LYEA 3CZ4A 4J1QA 1KBOA 1U2ZA 3KSUA 1Y7HA 4L3OA 4BVEA 3BL8A 1YJXA 4JI3B 1IHPA 3K4HA 3ZJUA 4YTEA 2EX0A 1YR3A 3JARA 3O8QA 4WBNF 1D9ZA 3C3DA 5JXGA 3WK6A 3LX4A 3ZU4A 2PQ6A 1AV6A 2KLBA 2X23A 4MUAA 1NXWA 3R7BA 1YAHA 5ALOA 3F97A 2E3JA 1YVRA 3QQPA 4HYQA 5AESA 2GKOA 2Q2VA 4Y2VA 3NIBA 3DFMA 1LI7A 4WY8A 5KNDA 2DT8A 2RHOA 1X7XB 3IO3A 3U4QA 3MAJA 2H1IA 1FQKA 3OPYI 1JKIA 2F1IA 2F3UA 4G84A 5GJWC 4O3MA 2CJXA 3G0GA 3K9FC 1HE2A 1WXWA 1ZN2A 4YACA 4I81A 3RSFA 2P9EA 4X44A 5DSZA 4ZCRA 4WXRA 4EJMA 3W4IA 1GP2A 4N03A 4XGRA 4DLTA 4JD5A 2PX2A 1XZDA 3GQBB 4GLBA 3UT0A 3OQ6A 421PA 2VJLA 3OE7D 2XUFA 3QSGA 5JJKA 5I9IA 1RYFA 2G9ZA 4NZ9A 3TIVA 2QMOA 1XGKA 3T7CA 2NZJA 3VAYA 3L7IA 1J06A 4M1KA 1E3WB 2UYOA 3OCCA 2DP4E 4PGGA 1ESNA 1HE8B 1KAOA 3BIFA 4KV9A 3UK1A 4G1VA 2B5VA 3UK6A 3R0XA 2W37A 3AF5A 2D3LA 2ZJOA 1YVPA 2PLFA 3MWLA 3NTVA 1QHIA 3PC4A 3K0EA 4QTUB 1DP4A 1SQFA 4B32A 5I8PA 4GQAA 4OOVA 1GL9B 3IVAA 2FEKA 4MINA 2OXIA 2YVUA 1BGWA 3GARA 3GJQA 3W06A 3PF9A 2C7GA 2WZPP 4ICIA 1MV8A 5HUQA 4INZA 3C6MA 2X76A 5L3SB 1PZXA 4PLGA 5K8UA 1II8A 2XWBF 4Q4HA 2RK6A 2QK4A 1Q50A 1UPFA 1P5HA 3ANSA 3TLGA 4X3PA 5BV8A 1EVLA 3HKBA 2QAGA 1DUIA 5HFNA 4D44A 1JI3A 2GCPA 3BERA 2QROA 4O02B 1F1BA 1XIVA 2VDRB 4TSRA 4UMFA 1I6MA 5D3MA 4CMEA 4HAWA 5B1YA 1U9CA 1JFLA 3ZN2A 1Z06A 2YQ4A 2W2VA 4G5YA 1UMBB 2X14A 4IDOA 4XLEA 2CLIB 4BE7B 1TO2E 3OC6A 1YKGA 1ZCZA 3PWSA 1CQJB 1KI6A 2OXTA 3B2NA 2C5FA 3HYRA 4MUIA 5H83A 5F1OA 4ZEXA 3FNGA 4C30A 2FQWA 3NLLA 4CG3A 1R6UA 2XSZD 1VHOA 3HBNA 3HSSA 3TCKA 1Q7YD 1SC1A 4TV8B 3RC1A 4ZHQF 5CA0B 3EQ8A 5A3QA 4IWYA 4Q01A 2QE6A 5LWQA 3LDUA 2NUPA 2OLEA 3VO1A 5BNTA 1MB0A 1XZFA 4LYFA 4EB0A 3OQHA 3CRW1 1Y33E 2EW8A 4OHWA 3EZYA 4XYBA 5JCJA 3SZMA 2O2XA 2GN9A 3NHPA 4N6OA 3IQWA 3MC1A 4X45A 3N59A 1VLQA 2YBEA 3PQ3A 4WNYA 5BT8A 4LV6A 4FYWA 3NBUA 1E1CB 2C5LA 3ENZA 1TYBE 1Z74A 1JBEA 2JCYA 3K73O 3SU8A 3EEOA 1DIRA 4JBLA 2ZCUA 2BBTA 2JGDA 1EM8A 4R01A 2IS4A 1UKYA 2EBUA 4HDKB 2WIFA 4A6DA 2NXEA 5J43A 4A5OA 1DT5A 2UYYA 4RMIA 1QH0A 2KX7A 4R1PA 2E9SA 1KEUA 1FFSA 1XZ8A 3N7AA 2X4DA 3SM3A 4KQ9A 3AO0B 2Q50A 4Z49A 3L4SO 3EGXB 3SSMA 3KKOA 3GUUA 3PUHA 3O84A 3JQ9A 3WA7A 3OQMA 4G97A 2X4IA 3RVPA 4AP6A 4DNQA 1T3LA 2XCOA 4EZEA 4G5GA 2ZRFA 3JQPA 1MA0A 3R5JA 2CJFA 4KIFA 2LR0A 4OL9A 4WOCA 3RARA 3TPFA 1Y98A 3D4PA 1JLKA 3U48A 2O3RA 3LO5A 2IF2A 3OM9A 1E62A 1HT1E 2GEUA 2HTFA 1FE8A 1TCBA 2YOHA 3PQ4A 2VBVA 3KWJA 4M0PA 5KTYA 2Y66A 4FFBA 5CM8B 2ZM6B 1DBQA 4G24A 2IBTA 1B76A 1VPLA 2BFWA 5G3ZA 3WGYA 1MX5A 2VBFA 1L4LA 2HJWA 3QPUA 4G5XA 3BCUA 4R8RA 3ZS9A 5LN1A 2ADFA 1C3OA 4N7BA 2P8JA 3S68A 2BTEA 4O4LB 3G2IA 2AFIA 5JNTA 3FAZA 5E6TA 4GXRA 3Q5DA 3AKCA 4J6FA 5LZ9A 5FA6A 1POXA 5IJWA 2QX8A 4TRNA 2ONKA 4FVTA 1E2PA 4JEUA 4LVCA 3WGUA 2VN8A 2GPBA 4FX5A 4EQZA 2VJIA 4F1KA 4UPEA 2A33A 4OXYA 1P2GA 5CA1F 4PG6A 2A9FA 2YVKA 1Z0KA 5A0FA 1HTBA 4CCAA 2ZIXB 1M5RA 2BFMA 3LV8A 1YR7A 4ZZ3A 2CFCA 5SYMA 3JD2A 3GFRA 2X1HA 4TZKA 3RHTA 2OB2A 2ZYWX 5HQJA 1J8YF 1RJ9B 4NWIA 4RCZA 1X1QA 1W9MA 1ZCJA 3OD5A 1NYQA 4WKNA 4B8WA 4LC9A 4TV8F 1XRPA 1ZM4A 2IDJA 4H0NA 4D42A 4F9EA 2BMWA 1RBMA 3H05A 3ZDFA 4MCHA 2W2KB 4C7BA 3HM9A 1DZ3A 4EKEA 2HPVA 4MVJP 5EE3A 3A1NA 4ZMBA 3Q7SA 2J9XB 4RJJA 5T3YA 5C52B 1HF3A 3I5UA 3L8GA 4LMRA 1T5LA 1STOA 5ALXA 3WOHA 4F2HA 2BEVB 3ZTWA 4HP8A 5FNVA 1G63A 3AVOA 2VBIA 3ZIUA 1L5NA 1BTOA 3UIEA 1YB2A 1KAQA 2QN2A 3JAWA 1GVHA 4OA5A 3PRJA 1TK2A 3BDVA 1Y0YA 3S70A 3UMBA 1J49A 3CRRA 3EH2A 4QPPA 4CFZA 2CD7A 3FMPB 3CR3C 5KI6A 4FXOA 4Q7JB 3HVIA 2I78A 3CZ9A 2B9VA 4ISCA 3RAPR 4UNNA 1GSIA 4DREA 3EASA 4EGJA 5JRDS 4YMWA 3TKAA 4AF8A 1UP4A 5E1BA 2ODWA 4O08A 3WHKA 2XNJA 1JDSA 1PJSA 3R7DA 4NARA 5HE9A 1F8XA 1J4AA 4P4GA 1TYZA 4AO7A 5BW5A 4OB8A 1T0BA 4PAAA 3N0WA 1CSEE 2ZR8A 1I9CA 1PJQA 4I5GA 3GP3A 2BFFA 4U7GA 4EPVA 1N34B 4JP3A 5FL7D 1EQUA 5HKAA 4JEHA 2H4HA 1OI4A 3CRMA 3FBGA 4X63A 1VBNA 3ONWA 1HOXA 5KYXA 2P4HX 2WAXA 1JNXX 2V8OA 3MIZA 1DDIA 5JOQA 4R54A 1RBYA 3MAAC 3OEYA 1JHDA 4OAQA 4B3CA 2ZB4A 1OZAA 5L53A 4PXSA 3UJPA 3CW2A 1XDWA 4F93B 1QR6A 2BMEA 3OZUA 4MXDA 4U7HA 2GCEA 2GO7A 2XQGA 4CDGA 4S1VA 4IXWA 2JHCA 3E2PA 2H7XA 2WJIA 1NQOA 2M2IA 2HCJB 1W29A 2XLBA 1N36B 3NE5B 1CYDA 1GTSA 3JQFC 2XZLA 1WXIA 5TEWA 4MYRA 3ZZMA 1I5OA 2IKSA 2CK3D 3EGOA 4J0GA 3R7SA 5IUJC 3GUHA 5F98A 5BWOA 1K73D 1NG1A 3A8KA 3LA6A 1MIOB 5ALHA 3W0LB 3RH0A 4FHCA 4BGUA 4RHEA 4CFYA 1QNLA 3L6RA 2GXQA 2J31A 2W43A 4HEHA 3R74A 3STYA 2VRWA 5ABPA 2O8CB 4X71A 4G56A 1G8GA 4REQA 1OZFA 1WKBA 5A9SA 1ZCAA 3CZQA 4N0DA 4C05A 2FSIA 5L4LA 1G8FA 5KQSA 1WZ2A 3H5OA 3GO4A 3SBXA 2OAP1 2HCTA 3U7RA 4MVJD 2J32A 2P2YA 5IC5A 4B82A 4A6EA 2QYHA 4V0SA 1YB4A 3BFPA 2IUFA 2VYVD 4HQRA 1AZTA 1NAHA 1C5KA 1NOJA 4DJDC 1I2BA 3A6DA 5AM3A 1H05A 2V03A 1I4OA 1KORA 1F51E 1U0TA 3B5JA 3QEMB 1Y42X 2IHUA 4H3KB 3A9UA 4A92A 1C3XA 4NNJA 1DJPA 1RAAA 2I33A 3L1HA 2IVZA 4CU5A 3KALA 3UA4A 2CNDA 4IR7A 5IAEA 3Q9SA 4FCVA 5FOXA 4G81A 4J43A 1WLSA 3ENNA 3A32A 4J0EA 2WUDA 5BURA 4L73A 1M67A 3BXFA 2Z6BD 4N0EA 5AMXA 2WFAA 3CRZA 3IALA 1AMUA 2Y99A 3L8DA 2ZUWA 3KTFA 3N86A 4V2UA 1R6DA 2AYYA 1H85A 1YDWA 3GJ6A 3OT1B 4D92A 4EJSA 3DLIA 3VR2D 3PXCX 3RHSA 3CLUD 5F3DA 4UM8B 4EG3A 4IG4A 5DISB 5CURA 4GLLA 3QH4A 1CLUA 1GUAA 5J2UF 4GYKA 4EYOA 2XZOA 3DAHA 4ZI3A 2Y9PB 1KPIA 2B21A 3R3JA 3PZRA 5LQMA 3BUSA 5E1MA 5KINB 3UXHA 1SCKA 1SK9A 1UM8A 3CIOA 3QOFA 5BSTA 2W6JA 1FYVA 1ZG3A 2X8JA 4UDXX 3KSAC 4EEZA 3BWMA 1J8QA 1EFCA 4R6WA 5CB4B 2GNAA 1HLFA 4V02A 4E33A 1TQ6A 4PQRA 3AIKA 3DOUA 3OEED 1F6DA 1GGHA 2YJTD 2WVGA 1WHTB 4L85A 4P7GA 5HWSA 3UMJA 1L8AA 3D8UA 4GXQA 1E64A 4PO8A 4ZC8A 3VZCA 2PE3A 4DV1B 1EGQA 3Q7RA 4DDKA 1WKVA 4BN0A 4UTPA 2Q4OA 1H66A 4R2MA 3GOQA 5ICFA 3SJCA 1YZYA 3GVCA 4N0QA 1PJ5A 1C4KA 1B43A 4J07A 2IW3A 4WCFB 2HYDA 1FCJA 5HF8A 4CM9D 3R6KA 2ZT5A 2B4YA 3H0KA 5IX8A 4I5FA 7GPBA 4N49A 1N8RD 1AOXA 3BBLA 3K8YA 2RAVA 4KK3A 4ZD6A 5LYYA 3VVCA 5UKDA 4I8XA 4OXRA 4RTSA 3W2FA 3PBKA 4UUNA 5EZYA 1FDRA 2NV0A 3ROMA 4U2GA 1KR2A 2Q4BA 3HP7A 2ZB2A 2HBZA 4TTJA 1I4LD 2OFPA 3CJTA 1POWA 4ZCPA 4L08A 1P17A 4F4FA 2RH4A 3HDJA 4NKRA 4JA2A 1C9MA 2QYOA 2X22A 4F2WA 4PICA 4YIHA 1RC8A 3D7SA 2VSYA 4DA0A 1XQYA 2P6MA 3LT4A 1KPHA 4KRFA 4FYJA 4GI1A 2P11A 3OMWA 5F4MA 2OZLA 4IW3B 1U6JA 1YBAA 3A31A 1IOZA 4LECA 2AR9A 1OBOA 4NOJA 4OB7A 3LUGA 4RD1A 3VC1A 1BWSA 4FFNA 3FNIA 4A2PA 2WDZA 3ICCA 2CZGA 4YCBA 1NLUA 4TQGA 5CEEA 4HFMA 3WGLA 3LY8A 5JSZB 4J0KA 1PKXA 4OXIA 4YC7A 4BVKA 2J3IA 2J5RA 2NVBA 3W7BA 3ILHA 2ZS7A 5IYWA 4QL3A 2WJPA 1TUGA 3A6JA 1A8QA 1I7SB 5TS3A 2FSHA 2B37A 1RP7A 2VT7A 1JAXA 3GGGA 4BO5A 3EWNA 2QYSA 3U4DA 2V7PA 3Q9UA 3ZJYA 4YONB 1G8JA 3QVUA 4E22A 3TSOA 1UQTA 4CW7A 4F9TA 2QUAA 3R5KA 3U3JA 5HGJA 3RVQA 1HWYA 1YITB 4G0YA 4IFIA 2Y0DA 5DT9A 1VL2A 5TSDA 3IRUA 1OKKA 3RVOA 2XCQA 4N3CA 4E4RA 1G98A 2IJGX 4FXPA 2YQ5A 4IOLA 3JR3A 2P3MA 4O4LF 2D62A 4OGKA 4TLEA 5J5VA 2W42A 2F8SA 3I9V6 1L6IA 3TL6A 5JXIA 1YB1A 1H4QA 1JJBA 4R7ZA 2WNSA 2NV6A 2JAQA 1XB2A 1Y1SA 1INLA 1W5AA 2F2TA 4IDEA 2AJ8A 1S3FA 2CUNA 2PMFA 2ONJA 4M1EA 4MNTA 1J25A 2HX1A 4HNHA 1XZEA 1QQAA 2QN6A 1REQB 2R7LA 4KQWA 2WLTA 4H0CA 3KKNA 3KVRA 4JU9A 4NV0A 1I3CA 3S2GA 5EUMA 5EJ6A 1J0CA 1CVIA 2I3GA 3GJ7A 3CA8A 4DMLA 3ND6A 4MI9A 4DLNA 1CUSA 3REFA 4U6NA 1OFGA 4X1KB 4WKBA 4X92A 2QZ4A 3Q3AA 3FCUB 4GZMA 1H1TA 4JOQA 4FE3A 4CF3A 2K4MA 4IFBA 3FCAA 3I92A 1OXSC 5A3RA 2PUFA 5EJ9A 2NMVA 4UAJA 5DWVA 4DJFC 1U28C 3L8FA 1U0BB 1PJZA 3ITNA 3WO0A 2A14A 4XIGS 1YCHA 4PINA 3L6BA 3AKYA 2F4NA 2Q7XA 4IX9A 1CUWA 1V1MB 4G5HA 3TM5A 3ZIDA 4TRMA 3LE8A 4AF6A 4DCUA 1NLYA 2VJOA 2NO0A 4CT5A 4YXWD 5AK0A 1ZCBA 2GASA 3FB4A 4Z3OA 1PEYA 2IOYA 3RWBA 4RX1A 1YI2B 4ALMA 1SU4A 3HBMA 4B6QA 2YJGA 1D03A 3HKEB 1UC4B 3WFZA 4LXUA 2O9JA 4XCVA 1O0CA 1JF8A 1NRXA 2YXEA 4MVJF 2HXGA 2J3MA 3ZOZA 4KHZA 4RLQA 1X80B 2QE7A 1WDKA 4DN6A 4HNAA 4RXMA 4I0WB 4HYTA 3KR1A 3OF3A 2XZPA 2OVFA 2WSBA 3E1SA 1AHIA 1FRZA 2EOAA 3ND5A 4HXYA 2BSQA 2I76A 4OG2A 1S3GA 4ACAA 1N6NA 1R18A 2NGRA 2XUIA 1SG9A 2YRWA 4OKNA 1CRLA 3LFUA 2Y93A 1KDRA 2FVYA 4OP3A 3R77A 3WMWA 3A6EA 3MWDA 4BV2A 3RRYA 4ZDKA 2JBAA 1XCOA 4POAA 3G2PA 4R1SA 3U9TA 1V8PA 1L8LA 3IV6A 2IYUA 3R0JA 4C5CA 1JYSA 1LWOA 1IUKA 4RVUA 3SP1A 1F7VA 3FR8A 4H6XA 5CLHA 2F1MA 1MENA 3AVTA 3P5SA 3CEPB 1KYYA 5ALGA 1T9DA 4AMZA 2OTLB 4ZV7A 1Z4LA 4G9BA 2JJ2D 3LTEA 2BGGA 3KPVA 5HKKA 3OOCA 1S2DA 1T4DA 1UBJS 1X77A 4XDZA 2JZNA 1NQ5A 3ISXA 3ZI4A 1BFDA 5IABA 5H7XA 1XZPA 2AMJA 5FUYA 3WSWA 4EUNA 1KI8A 3UQYS 1ZL2A 2G4CA 2Q9CA 4G0PA 2OCDA 2BZGA 3SKVA 1L5FA 2EKPA 3GJ0A 1TW3A 4MUXA 2MINA 1PUJA 3I9V1 1Y3FE 3MWEA 4QU5A 3TI9A 1VRCA 2AOXA 1G18A 3SM9A 1OAKA 1COZA 1XLTA 2ADMA 3AR8A 3LL4A 5HUHA 2BBSA 4ZOAA 1H0SA 4F3NA 1UIMA 4TRJA 4L8FA 4PYRA 4QDXA 3NX4A 2VCEA 1Y1RA 2A0XA 2XA2A 1J9GA 1AQ6A 4LJ4A 1UPCA 1P9RA 3CPHA 4FYXA 3RYFA 1WNFA 4NNPA 4EHNA 3KSBC 2IY8A 4FWIB 2ODTX 2NUTA 1NJGA 3D81A 2ASEA 4D79A 3KKLA 5HNKA 3M4ZA 3VU9A 2GUGA 3BZUA 1ZD9A 4X7CA 5CHEA 5HF9A 4KPGA 5HTOA