4FK8A

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264 with bound fad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
254
structure length
247
Chain Sequence
b'KFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVEGRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 79
structure length 247
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4fk8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4fk8A02
1E64A 5H5JA 3W2GA 3W5UA 3AVTA 4FN5A 1QGYA 3ES9A 4N3GA 5TR9A 4ZCLA 2OK7A 3CMAB 3VNVA 1VQKB 4K1XA 2BSAA 3W2EA 1EFUA 5AN9A 1GO2A 3JQPA 1TUIA 4RD6A 2E1RA 3PENA 1CQXA 3U6BA 2YWHA 4M0LA 2X3UA 3FJOA 3ZC3A 1YI2B 1FNMA 4QFMA 1QH0A 1ZM4A 1DG1G 3CRZA 1AMOA 2R6HA 2PLFA 2GQFA 5HXBA 2C77A 1SM4A 1EFCA 5JBQA 1E63A 5THXA 3CD6B 1YJWB 3P27A 2BGJA 3U6KA 3OW2B 4LBWA 3V76A 4PC3A 1OGIA 4DQLA 2BVNA 3AVUA 4U9UA 3CCQB 1K73D 3QFSA 3LVBA 1K9MD 3W5HA 3VNUA 2YWEA 4C0SA 3QSYA 1KTVA 1QFJA 4M2LA 4RD4A 1QX4A 4TMTA 4ZV4A 1H42A 2YWGA 4RD1A 2BN4A 1F60A 3WBKA 1R5OA 3P26A 5GV8A 3G6EB 1JJ2B 1EXMA 2GPJA 4YAWA 4TMWA 3WBJA 1OGJA 4AC9A 3CCMB 1Q82D 1CNEA 4C43A 1D2EA 4PC1A 2QTZA 3MCAA 2VNKA 1B2RA 1GAWA 4FK8A 1ZM9A 1N0VC 4R71A 3AVYA 3CW2A 1OB5A 4RD2A 1YHQB 1HA3A 1XB2A 5KSWB 1VQ4B 4ZCIA 1W87A 1ZM3A 4B3XA 1W2BB 1A8PA 2BM0A 1QGZA 2OTJB 2NPFA 3LRXA 4YALA 1VQNB 4LBZA 1U2RA 3OZUA 4RCZA 2OTLB 1QFZA 1QFYA 1BX1A 4RCYA 4ZCMA 4ACBA 4ZGNB 2QMUA 3CMEB 2XNJA 1VQMB 5TY0A 4QHYA 3WYAA 1IJEA 3AVWA 3I1FA 1KJZA 4H9GA 4RD0A 3I56B 4AF6A 1I7PA 1UMKA 3OZVA 1W35A 3OJWA 2VNIA 1SKQA 1QVGB 2DETA 3ZZUA 1N8RD 2HCJB 3JQQA 3SJZA 1GAQA 4N3NA 4RD3A 3ZZ0A 4TMVA 3OJXA 1FRQA 3W2HA 1KQSB 2DERA 4YAFA 2VNJA 1FNCA 3ZBUA 4Y9UA 1NJID 1Q81D 1F20A 2HMAA 4LBVA 2B5OA 2XEXA 4ACAA 1R5BA 3ZBTA 1YJ9B 3QE2A 3WXMA 2J7KA 1VQOB 2EFGA 1TLLA 4G5GA 3QFRA 3G4SB 2OK8A 1TVCA 1QVFB 2BM1A 4LC0A 1DARA 2BV3A 1BJKA 2HDNB 4NCNA 1NDHA 3CCLB 1GVHA 3E20A 4YAOA 4MYUA 1S0UA 1BQEA 3W2IA 1B23P 1BX0A 1VQPB 5EMNA 1OB2A 2QTLA 3B78A 1JNYA 4PGOA 1IB0A 2BPOA 3A1FA 4F7DA 1KK3A 3FPKA 4UAJA 4G1BA 4M53A 4MYTA 2DY1A 2VZLA 3OZWA 1S72B 1N0UA 5TV2A 1GR1A 5FA6A 2EIXA 3CXCB 1G7CA 1ELOA 1G7RA 2DEUA 2QN6A 4B43A 3B82A 4NBSA 3CCJB 2ZITA 1Q86D 3ZZTA 3AGQA 1M90D 1KD1D 2B7BA 3VO2A 1KK0A 1H85A 4DQKA 2QEXB 1FNBA 3WNCA 3AVXA 1J9ZA 4P6VF 1FRNA 3VO1A 3CCVB 4TN1A 4G1VA 1VQ6B 4EH1A 3U2QA 3CCEB 3CB4A 4PC6A 4IW3B 4J0QA 1ZM2A 3J81k 4BPRA 3CCUB 3QFCA 1DDGA 4FWTA 4M1KA 4LBYA 1Q7YD 3JQRA 3WNDA 1VQ9B 1R5NA 1G7TA 2PMDA 1VQ7B 1EFTA 1AIPA 1JA1A 2QDXA 3CCSB 4RJLA 3CCRB 2BMWA 3W2FA 1VQ5B 2XNCA 4Y7CA 1YITB 1M1KD 1TTTA 1CNFA 3I55B 4Q7JB 3MHPA 4HE6A 1EP1B 1GJRA 3B8HA 1K8AD 1YIJB 1FNDA 4WQMA 3AGPA 3WY9A 2QA4B 1KRHA 2CNDA 2DCUA 3E1YE 4Y9RA 2B7CA 4YHBA 2C78A 4PC7A 4YAUA 2D74A 1QG0A 3W5VA 4B48A 1EP3B 3QFTA 2VYQA 1W34A 4B44A 3AVVA 4TMXA 1DDIA 3LYUA 3CC7B 1KC8D 1KK1A 1YJNB 1VQLB 4M4SA 1VQ8B 2AHOA 1G7SA 2YWFA 1EP2B 5GV7A 4B4DA 2BGIA 1QUEA 3CPWB 1IJFA 4P3YA 5H59A 1JB9A 3LO8A 3G71B 1ZUNB 3MMPA 1D1NA 4HE5A 2VNHA 1E62A 2RC6A 4TMZA 2PIAA 1QGAA 3WNBA 4ZGQB 4B47A 5DSZA 1EWYA 2BF4A 1KK2A 1D8TA 1XE1A 2FX3A 1FDRA 3VMFA 3CC2B 2RC5A 1JA0A 3CC4B 1WDTA 2CRVA 4AF7A 4PC2A 1QUFA
chains in the Genus database with same CATH superfamily
1RDFA 2IIBA 5E38A 3PGKA 3TD9A 4UU8A 1Z63A 2AFIA 3AP1A 1PJCA 5H3HA 3ONYA 1XCPA 4L1KA 2C9BA 2GDZA 2X15A 3M6AA 3TL3A 4DREA 3AEZA 4A0FA 1O6FA 4G1MB 3F6YA 1EXDA 3WDSA 2W6MA 4LCJA 4F38A 3TPCA 2YMMA 2NZYA 3EFEA 2GEDA 3NBAA 1CUEA 1JVNA 1OX5A 2XODA 3ROQA 4NU0A 5CCEA 2D2VA 1J42A 2ZTHA 3QYJA 2DXIA 1FLAA 4XWGA 1LB1B 4LWOA 4FILA 2O05A 2ZIWB 3GEGA 5CXUA 4RVGA 4ZT6A 4OXQA 3EDQA 2FEOA 5J4KA 3MCVA 2ODQA 3KEMA 2OWDA 1PVOA 2X3UA 3FNRA 4HWSA 5AOAA 1EBBA 5FBRB 3PC6A 5ALVA 2XRZA 1V11A 1I1OA 5AW4A 1IEQA 4LF5B 1T3HA 2IEAA 1FJ2A 3AKZA 4E1AA 2YL2A 2WR8A 1A77A 1SXJE 3K92A 2BUAA 1THTA 4ROTA 3GLFE 1DC8A 2PLFA 1O6CA 1COWD 3F6SA 3H9NA 2IPOA 3I04A 4KE7A 4WKGA 5A3QA 3OIGA 1QP0A 3INYA 1CNMA 1Y3FE 1NFRA 2OCBA 4PVDA 2QRZA 3D6UA 3SKVA 4KO3S 2I78A 5IH7A 3LBAA 3A70A 2H31A 3G5AA 2WSSD 3N86A 1XHFA 4K7JA 6CHYA 2DKFA 3BRQA 3MG9A 3OT5A 1LI4A 1V7ZA 3C8DA 1TIKA 1C9JA 2PWZA 2FW9A 2QDKA 3K16A 4NCXA 1QQ5A 5E2AA 5GPBA 3HYCA 1YIAA 4RH1A 4CIBA 1E1LA 4LJSA 3U0BA 3HJFA 2HA7A 5FL7A 1CQJA 3PX3A 5EPUA 4XWAA 4O1HA 4BWVA 1L5RA 2OHHA 5F9FA 2P2CA 4GMKA 3I72A 1OGIA 3L7DA 5J4YA 2WF6A 3PTLA 3GRFA 3DB1A 3Q7EA 2A3NA 2GZRA 2IUEA 2V7BA 2D1RA 4HPJB 1MAHA 1ORHA 2QD4A 4FFPA 5EZ5A 4YQEA 3WE7A 1J1ZA 4D3ZA 4AKIA 4D8YA 3Q3CA 3EQ8A 3RH0A 2VXCA 3OLZA 5K99A 3QVTA 2XT0A 3VNUA 2WZCA 4MW1A 5FTNA 2YWGA 5B53A 1RLIA 3LDAA 4RF5A 2UYOA 2JKYA 3PQ3A 3VR6H 1EE9A 4OHRA 5JATA 3MWYW 2RE8A 1E66A 4QHSA 1CR6A 4MQFB 5GJBA 3EMKA 1CJTC 1LI7A 3GVHA 4D4IA 3EZ9A 5JFTA 5FOQA 2VZ8A 1BQ3A 3LRPA 3QNUA 4O0LA 4KIGA 5AR1A 1P1BA 1DOHA 3BJMA 3H4TA 3GPLA 3BN3A 2XBLA 1DIOB 3ZE7A 2SCUA 2ZSJA 3R5XA 1NW3A 3V33A 2GZSA 3EXIA 4ZEOA 2VWHA 4XGRA 2ZCVA 4X8MA 1SBYA 1XTKA 4OHBA 4F4UA 1Q7BA 4OXIA 4YV7A 5HFNA 1HDYA 2NZWA 2ZYTX 2HSEA 3PHHA 4IDGA 4TZTA 5AXDA 2NU8A 4AF8A 5BNZA 3ND6A 2OCKA 3FGPA 1YB6A 1R15A 1J06A 1HQYE 2VNSA 1GZ7A 3R0IA 3USZA 2VNKA 3ICVA 2XT6A 3T0IA 4F2DA 2BM8A 4KW7A 1XC7A 3ZCXA 4PFQA 2WJAA 2XIJA 2ZSFA 4JUBA 5H82A 4B2YA 5F35A 4N3AA 3IX7A 2ET6A 4QQ8A 4Z4CA 1OCEA 2JAOA 2D5CA 3NJRA 1KOFA 1R37A 2HMTA 4HFMA 1TTHA 3HBFA 4DM7A 3TD6A 5HG0A 2D9RA 1S4MA 2VDKB 4PBSA 2QORA 3I0MA 4KR0A 2WD9A 1R6UA 4HH1A 1WM1A 3OMLA 4QTZA 1U63A 3W5DA 1ZM3A 1PD1A 3LA8A 3SZUA 4NK4A 4S1VA 3C8UA 2P6NA 2OCIA 5B2FA 2CBGA 2NVWA 3DA8A 1JIJA 2I3GA 3S8MA 3TJRA 1A2KC 1PF7E 1SGWA 1UBCA 2P40A 1EHYA 2QG9A 5TMBA 3EN0A 4JNCA 1TUBB 4WKPA 4H7DA 5JD4A 3DOUA 4AT1A 4U2KA 3H5LA 4B3MB 5FI5A 3BSSA 4Y98A 1QTIA 1BX1A 1IMJA 1R0XA 4E30A 1WCIA 1IONA 5AVUA 1K6MA 5BSXA 3ADOA 2J6BA 2LCFA 1PQPA 2PUVA 3QXJA 4G5XA 2JA1A 1T24A 1I1HA 3L1HA 1VQMB 1UBLS 3WYAA 4LJ6A 1SCAA 2HNKA 4Y3UA 1GPUA 2LZJA 1IWBB 3B52X 2X8AA 1QIGA 3P9XA 4ZVKA 4KWHA 2WWYA 4TL9A 2A92A 5JXHA 5AHKA 3SBEA 5AJYA 5TVKA 3OZVA 3FBTA 5L3SB 2ZT7A 3PGVA 3FR7A 3FTQA 1LGYA 4UAUA 4OQFA 5JH7A 3PQ7A 4KIUA 4LCEA 2GAJA 2EGHA 2BBSA 4E88A 4HT3B 4MKRA 4GZ6A 2C84A 1EWKA 2KPOA 2QP9X 4UDXX 4ZVVA 3T1NA 5JCOC 3T99A 1XK6A 1EVKA 2JK1A 4MP6A 1GR0A 2IXTA 1GA1A 1BOFA 3JALA 4DR1B 2IF0A 4JLUA 4PYOA 4UZSA 3PNKA 1MHPA 4CHGA 3DBLA 3T53B 2A1UA 3JZIA 2W83A 3Q3EA 3GNQA 4JUDX 4JUIA 3OPVA 4HKTA 4L7VA 1OPRA 2I3DA 1FMLA 4JQYA 4TMVA 1VLZA 2E48A 4BFCA 3PG5A 1L5ZA 3T0FA 3GFVA 1JRLA 4NNOA 1HYBA 1NF8A 3WQHA 2AS0A 3OJXA 2C9YA 3L6CA 3ZLVA 3O8BA 4YR9A 2C5EA 3R24A 1UIMA 1GUBA 1PWXA 2P4EA 3MTBA 1F4LA 3AF2A 1Z74A 4DMUB 2CVOA 2Q7OE 2CVHA 3SG0A 1O7JA 3KKMA 3W1EA 1KS9A 3DLHA 2ZU0C 1SVMA 2G83A 2CC2A 2I7TA 2Y66A 4LN1A 4BBAA 3I0ZA 4KXUA 4P98A 4ZKDA 2O8CB 4M1SA 1YKFA 2P35A 5BQXA 3BD8A 1PL7A 3CXUA 5HGXA 3VYUB 5KTSA 2QLBA 4BIIA 1K75A 3O8OA 4Y9UA 1TW3A 2PQ6A 1AO0A 1T4CA 5DEIA 1G38A 1R3UA 4HLCA 1UD4A 5K4AA 3WGUA 1WKCA 1S01A 1K27A 5EZYB 1N1MA 1UFVA 2GTHA 4TN5A 3WAJA 2Q9CA 2XMDA 3JZMA 1C2YA 1GNRA 2VYFA 2Z8ZA 2BR3A 4N8DA 2CVPA 2P8JA 3U1TA 5TIIA 1SBZA 5K0BA 4HV4A 3P32A 1G1MA 1IRIA 3WLPA 1H1TA 2F9FA 3OE7D 4L4UA 4RTQA 2YN2A 3BBPA 5SICE 1HQKA 4K6MA 5GOZA 3SC4A 3KWMA 4DAEA 1WWKA 2BMDA 2VP3A 3MWDA 2QG4A 1DAEA 4C5AA 2ZWIA 1NXPA 1U7PA 4X1YB 3NI2A 4O2RA 3UCEA 1VHQA 2YIMA 3PKIA 3U7EB 4GBGA 4R3UC 3MMSA 2YFKA 3W06A 1G55A 1JR3D 1K7XB 3PA6A 4TQ9A 1COWA 2I34A 1CLUA 3OHSX 3OZIA 4LHVA 4AUEA 1OYOA 4JOSA 1G64A 3ZW8A 2YR0A 4PLWA 2C4KA 1Z0IA 4IYRA 5J4LA 3OAAD 5KVCA 4C7OB 5D85A 3VDNB 4C1NA 3U49A 5A3SA 5THQA 2FETA 1L5NA 2WSSA 1GPMA 1WOMA 2G4LA 2P5YA 2PLAA 4Z99A 1N77A 4YAOA 2VDUE 1FFHA 4MVJP 3D6VA 2D0PB 2Z3WA 2QVZX 3T56B 1JNXX 2GD0A 2GT1A 2AD5A 4OPOA 2OT3B 3AOEA 4DA6A 1WL8A 1UBHS 3CKLA 5EGSA 3VVCA 1US8A 3PU6A 3QXSA 1TYAE 2R2AA 4Q15A 2FXVA 4WK2B 5DNEA 5ALDA 3CWQA 4P7GA 5AI5A 5T7BA 1OOEA 2QTTA 3GG2A 4B3HA 4MVJM 1B3BA 2R87A 1PJ6A 2XD9A 4PV7A 4M1TA 1YMQA 4JL5A 2QF7A 2ZGVA 1MQ8B 3T3IA 3PHGA 4RY0A 1Y81A 2XE8A 4M0PA 4MKZA 4YS6A 4J3NA 1JEOA 2HWXA 2REQA 3S2FA 1NKVA 2VSQA 1ONSA 5AOBA 4GKVA 4IVQA 4WCFB 3T5GA 3HCOA 1YTLA 1RXVA 3LHIA 3WP0A 4DLTA 4BU0A 1RP7A 1T4DA 1DXOA 5AVTA 2GTPA 4BO4A 3S8YA 2AG8A 4ZMBA 3DE3X 3LQKA 1P62B 1UDBA 1ZK1A 4JC8A 2CVFA 4P8RA 4QV2A 2JGEA 3DFZA 4XLLA 4FYWA 2F1HA 4RY9A 1QFXA 3OF5A 4PM4A 1NVEA 2XVYA 4E6PA 3A8IA 2OB1A 4NABA 4CLDA 1T9ZA 2W7TA 4PIPA 2PG3A 3NHZA 5DE3A 1T4GA 2GCOB 4NS1A 1NN0A 2RGWA 3BJRA 4YMUA 2ISCA 4TT3D 1M90D 1RWPA 5CX1A 1JT2A 5ALRA 3CUVA 3I2GA 2CL7X 3X2FA 3ZJTA 4GOKA 1MF7A 3KOMA 4Z6KA 1GUYA 4OJNA 1DUSA 3IC5A 4Q3NA 2LKDA 2AFRA 3HUUA 1YJ5A 4EATA 2CCKA 1FNBA 3VUEA 1IVYA 3NTRA 4ZOCA 1Z68A 4ZANA 2BEKA 1UXKA 2E18A 2XUAA 4XOIA 1QORA 4F04A 1FUUA 4XA8A 2YVKA 3OZCA 3H9JA 5EIBD 2M5SA 1B8VA 3D4OA 5NULA 1T5BA 1XWWA 1DV2A 2BSQA 1AJEA 4Q34A 3IHTA 5IAEA 5JAOA 1H6DA 1LQTA 4XWTA 1KVUA 1IBSA 4JDPA 1P5RA 3G9TA 1LF5A 5ULLA 1XNJA 1FDVA 3CPEA 4ZJYA 5BWNA 2OD7A 2G4VA 1HPLA 4IW3B 2OD9A 2Q3HA 1VPDA 3Q1KA 1L5GB 2ZZGA 3GRZA 3AIKA 4CIDA 3A1EA 4C78A 2CXOA 2YHBA 4Q3KA 3GGOA 4DJTA 1DDGA 3UATA 1QYIA 3EUEA 2QVXX 3OM8A 3RSQA 3WMWA 1DE0A 3PYXA 4U2DA 3IV6A 4HEJA 4E07A 2FMKA 3RGGA 4UDYX 1WMBA 4BNNA 3OCVA 3HVKA 2VFAA 2N75A 3MSXA 4PO8A 1N2EA 1GKKA 2NYUA 4DMCA 3HMQA 2VHCA 4YLYA 3IQIX 4KAFA 1VSTA 4OSEA 1A2BA 5LBUA 1LW7A 4R4JA 4TM7A 4NOJA 5SYNA 1YQQA 1RAHA 4HBGA 5K3OA 3JQ7B 4F97A 2PT9A 2NTYC 4GLJA 1YGYA 2CXSA 1GCGA 4ODIA 3QOYA 4ZVLA 3ZH2A 3RVNA 1OH8A 1L5MA 4DUYB 3UCXA 1FCJA 2GA8A 1HDXA 3B5IA 5D51S 4BZWA 4C0KA 1Z4LA 3CEMA 3MHPA 2FCRA 2E7ZA 1PG5A 1WPGA 4L02A 3M83A 3C1TA 1GJRA 4RTRA 4CEIB 2DLCX 3OEYA 2ZJ4A 1PN3A 3I83A 3LYLA 4O2AB 1SIBE 4F56A 1WY5A 1IUNA 4U02A 1PWZA 2ZBFA 4FW9A 2AOTB 1R4NA 2AX3A 5ITZB 1KRHA 1IU9A 4DK1A 3CSDA 3GDWA 1KO5A 4NONA 3WFIA 1NXWA 3LTNC 3JV7A 4JXXA 1UP6A 2L18A 2DWUA 3E0QA 3V2UA 3QI2A 3NW9A 2C4NA 4K6KA 2ICAA 4L75A 2BZ1A 4F93B 1M0SA 3U0VA 1EVIA 1CZOA 3WHPA 4Z4TA 1E9RA 1CUGA 4ARAA 2VYQA 3QIVA 5AM3A 8ADHA 1Y7HA 1YWGO 3QVGA 4RKQA 1MU0A 3L0DA 4DRZA 4QDKA 3UNXA 2FRVA 4YRCA 2FUG6 1E6UA 1XRLA 3LA6A 3QUAA 4QDOA 5BR1A 5JWOA 3IQZA 3ML1A 4D46A 1SR8A 2XUFA 3K70B 4ZHQA 4G8JA 1KRWA 2ISQA 2WTAA 1ODTC 3BFPA 3MINB 3UF0A 4KPGA 4GSYA 1Z25A 4ZTZB 3F46A 3FX2A 1LY1A 3RS7A 1P6QA 1NFFA 3CKMA 4HDSB 5C5DA 3T9AA 3IPXA 1Y8QA 1SK9A 2BGIA 4EO9A 1VL0A 1V8ZA 1ZRSA 3B89A 4J0FA 5BR8B 5IDWA 4FR2A 3EVTA 3KQSA 2QQGA 3D1LA 1MBZA 1I7DA 2ZKLA 1QG2A 2NV2B 4GW3A 5ICEA 3H1EA 4ZIRB 4LZAA 3IERA 4V3BA 2FEKA 3KJEA 4C5CA 3VJRA 2D0IA 2R97A 4WMLA 5DWQA 3DHVA 2EVWX 5DU2A 3WRWA 4U7JA 3OE7A 3ZV7A 4PTZA 4ZAFA 1E4VA 3IELA 2Q7XA 3QA9A 1PR1A 3WLQA 2R60A 1PYOA 2J9YB 2HRQA 2B3DA 5HE8A 5JRJA 3MAGA 4FT4A 1M0EA 1JIQA 3CR8A 3PFNA 5IMSA 3HZZA 1CS0A 3LT5A 1D1SA 3GMIA 3HU1A 4PZ9A 1IZZA 4WJZA 3RK4A 2NUAA 1ISRA 2R5WA 4YAKA 3T1YB 1JR3A 3GJZA 4XM2A 3H0CA 2FG5A 1QAOA 1EKXA 2GCEA 3HGMA 4PQEA 4ZC1A 3PNSA 4K9SA 1IOLA 3L8FA 1CEQA 1TW2A 1ZNYA 4ABYA 3WYFA 3DTVB 2CRVA 3OAAA 1JQKA 2JGDB 2YYYA 3NIBA 3PUIA 4J75A 5KAPA 1GUDA 4TZ0A 1XK7A 3TQRA 2P68A 3PDUA 4XVRA 5IC5A 4DZZA 1ZQ9A 4MGEA 2F3SA 1YDEA 2A5LA 2J5KA 3EXEB 5L4NA 3HCPA 3UAXA 3CONA 4NVRA 2QTMA 4HMQA 4B3GA 1U90A 2CFSA 1TCUA 4MWCA 4R9RA 3DEIA 4XEHA 1YRLA 5CT5A 3SAJA 2DFPA 2VTEA 1A50B 3LPNA 2DLNA 2ABWA 3B38A 4H0FA 4XCQA 1AMNA 3FDIA 1MO6A 3IQGX 2NTNA 1ESMA 1RABA 2RDMA 1ISJA 2WVJA 5HIJA 1NMEA 1I6MA 4P4NA 3OF3A 1UPCA 3U4HA 1VLOA 3EW7A 3AV3A 1OX4B 3LQ4A 4CJXA 4BIMA 2O1SA 3ZC3A 4NZPA 1QGUB 3A9UA 4EJSA 3AFGA 2G1AA 3KEWA 3BFKA 3TGLA 2P9JA 5B1DA 2GN1A 3PXCX 5IDVA 4UMDA 1UAYA 4QPNA 4JOBA 2QTGA 1SJ9A 3EEQA 5JZBA 1XU7A 2RHRA 1RZUA 2ZE8A 3CRMA 2LWIA 3PFIA 1JBKA 1YBHA 2AB0A 2LVBA 4IVPA 4OJTA 4KOAA 3JQ6A 3QOXA 2WF8A 5AKXA 3GW8A 3RE1A 1Z29A 4OFZA 4CDRA 2CF5A 5LU9A 4NE2A 3GVCA 4AMVA 3SHOA 3BB3A 4EAAA 3CD6B 4E5UA 1NIJA 1NYQA 2IEYA 2XOXA 4FNAA 4HTFA 4INOA 2ZS8A 3TIFA 4MCAA 5JD6A 3LWDA 2PV0A 1A9PA 2JFGA 5DLEA 3IO3A 5HBRA 2VHVA 3KWFA 3OOCA 2GEBA 3U4MA 3G5UA 2OHVA 3B1YA 4TT3A 1I7SB 2BBOA 4PZZA 5PNTA 4IICA 4MDEA 2QZ9A 5DCLA 2G04A 4PC3A 3K09C 4MQEA 5KHLB 2EX0A 3W9UA 1UBOS 1RKBA 3C4VA 2I4MA 4H7IA 4KKVA 1WP6A 1A9OA 2OBSA 1IATA 1Z4JA 1EMDA 3BC1A 3BULA 4BJ3A 4KNYA 4F21A 1UPUA 3GYBA 1AV6A 4BMSA 5F2NA 1T8YA 5JY6A 4HAXA 3TEMA 3QFSA 3NOQA 3U48A 1EGVB 1IJKA 3AR9A 1ZCAA 3IBYA 4Q6WA 2RJOA 4E70A 1U4NA 2AOUA 1MIHA 2QAIA 1M7HA 4DNQA 1QX4A 1JT9A 4PLGA 2ATXA 3QX7A 2EP5A 4BO7A 4WJLA 1IBKB 2QQFA 3WGGA 2EHDA 4HQRA 5EP3A 1JJ2B 4TPKA 3T9EA 3Q8LA 1XMVA 2P9FA 4L8YA 2WFZA 1XQVA 2YYZA 3WGLA 3ZCQA 1E5XA 1N9ZA 3IJEB 1JR3E 1Z83A 3KZVA 4GOOD 3U9LA 1AGYA 3SF8B 1P7YA 3SSOA 3KBOA 4G6ZA 3ZGVA 3NHPA 2OMEA 3LV8A 1CR4A 1XTUA 1XTBA 1UPAA 1ZRNA 3SZMA 1LEHA 3CCCA 1PZEA 3FVWA 4F06A 4RIGA 2R00C 5K6AA 3SIPA 3V8EA 2QRVA 3NX4A 1DXQA 3DWEX 4CLRA 3UUWA 1D5WA 3IE2A 1EE1A 4YMGA 1BH2A 1SHLA 3A28A 2BMFA 3DOJA 1PAUA 1ZOLA 4MAFA 3CEAA 1OBVA 1D6SA 2YS6A 3FYUA 1M2KA 4J43A 4EKNB 2FKAA 2H29A 2J08A 3CMMA 1Z37A 4WUVA 3U4GA 5AXBA 2WPNA 5TQJA 1XU4A 3GOHA 4K3VA 3E7XA 3N2IA 1C30A 4C1BA 3QZUA 5FUWA 2E4UA 1Q2UA 1OB5A 1QRAA 1RM5A 4RMNA 5EKDA 3DV0B 4FFBB 3ZDEA 1W1WA 3ZDRA 3NNSA 3NPAA 1DOAA 2ZEJA 4J1TC 4R41A 2X8JA 5EN4A 2IKQA 3MTQA 3O8DA 4O2AF 2AUMA 5CYFA 4B7AA 1ORIA 1Y8RA 3HK2A 3ETNA 1VPWA 2O2EA 3EAGA 2OY0A 4EI2A 4QDZA 3FF1A 4HB0A 1EUCA 5E8JA 4DJ5X 5GOTA 4V1CA 4JQOA 3W78A 3BWDD 4J6EA 1QGZA 4BGVA 2Y05A 3AVQA 4JYZA 2SNIE 1AXRA 1EI9A 2HQSA 1H5UA 3GD7A 4DS3A 2BFCB 5CEJA 2C7OA 1VE6A 4RCZA 4NBVA 3PSHA 1F2UA 1SC9A 4XXHA 1RWWA 3COJA 1N32B 1JH8A 2YOHA 2BIFA 3E05A 3CP8A 5D01A 1WV0A 3RFVA 4YK7A 3TW8A 4ZGNB 1NT2A 3OUZA 4BX9A 3WV4A 5CFMA 1EESA 3KU4A 1JH9A 3NBFA 1XZNA 3IRVA 3CH4B 4CV2A 1M9NA 3TK1A 3FW1A 3C15C 1WNTA 1YAHA 2BE9A 1Q2XA 3AWIA 3OX3A 3O4FA 1U31A 4G01B 4RZSA 4RYDA 3IT3A 2IXDA 3INRA 2JIPA 4H9GA 2J5QA 3VKUA 2DJ5A 1GKLA 3PFCA 4B3RB 1I7PA 3TDNA 2DOKA 3PNMA 3K9HA 1KYQA 1P9WA 3K1TA 5B64A 2YFQA 2CXHA 1QYVA 2VIIA 3B60A 1H0KA 3F6BX 4FOTA 5KKCA 2ZW9A 5DCWA 2Q3BA 2BAGA 1SUDA 4V24A 4LOKA 3VO8A 4QBHA 1GNVA 2JGFA 1JJVA 3A6FA 5DI3B 1PTKA 1NA5A 2C3UA 2RGDA 3EIEA 2XHEA 3H1FA 1DS6A 4JLWA 5DMXA 2DQSA 4ZVMA 5A1TA 1K5GA 3HUTA 4O2BF 1HNZB 1TF2A 4UUNA 2X5XA 4H7KA 2VSFA 5FUYA 1YOBA 1HEYA 2V7EA 3FWHA 3LPAA 4BNZA 3P9SA 3CNEA 4MEBA 2GHRA 3L46A 2IP2A 4YJHB 3ICOA 3QMVA 3E5HA 2EGUA 5C5IA 4KACA 3SHQA 3FDJA 2XNDD 2Z5GA 1G5FA 2BI8A 3OFKA 2IBMA 2PL9A 4LQLA 5KYXB 2H7VA 1O94C 4QELA 4CVNA 2ZUWA 1QH8B 1XRQA 1Y37A 1Z5PA 2FR8C 4NH0A 5KYYA 1DVRA 2Q3EA 5DV9A 1OW3B 1HFJA 4ITRC 5H9WA 5H81A 2O5EA 3BMCA 1XZEA 4LHXA 2FQ1A 1AZTA 2YY6A 2Z1MA 5DRYA 2A0UA 4B34A 3WLKX 4AY4A 1L7MA 2FFAA 2B5OA 1IIBA 1M67A 4EQ6B 1KOGA 1U0JA 1P7PA 3VHRA 2JHCA 2ZIXA 1G5HA 1PS9A 1X9IA 2CHEA 1EXNA 3QE2A 2V1UA 4OLAA 5JNRA 1XLWA 1AUPA 4WN9B 2Z57A 4AY2A 3SVTA 4CMBA 1CYDA 3VAAA 1ZA1A 4EKDA 3ZDAA 3OTWA 4TWIA 1TLLA 2XZOA 4D26A 2RH8A 3HL4A 4WE3A 5K2OA 3RIGA 5AW5A 2X5JO 3JRWA 1MG0A 1FS5A 1L4LA 2NN3C 3CZ4A 3VU0A 1WDLA 4WWVA 4D7AA 1SIUA 2PRSA 2YV2A 4EJ0A 5K01A 4LI3X 3LGAA 2PKQP 2IV3A 1JSZA 3KR9A 3PC7A 4N5MA 5JMOA 3UAVA 2WMOB 1JG2A 5KWJA 1DBSA 1FEZA 4BNJA 2R3SA 4G7WA 1UD8A 4W9NA 3ZN2A 5EVJA 1A1SA 1J0EA 2DT5A 2JAHA 2NVUB 1DKQA 3WAGA 4ZO6A 2IY9A 4X1IA 3SQXA 1E3MA 4BV3A 2ZXIA 16PKA 3N5CA 2W98A 2BP7B 3MJRA 3UGQA 4EFKA 1LFDB 2ZYIA 2R66A 3UWPA 3VO9A 3CVUA 3T4EA 3OX2A 3PXDA 5CFOA 4FMDB 1RR6A 2JAPA 4MB0A 5BO5A 4IEEA 3VR6A 3NWBA 3DLAA 3WGQA 1JSCA 6NULA 3KXDA 4M8NE 1M1YB 4TRJA 1F7VA 5DBIA 1LBIA 3L82B 2IXGA 5YASA 3LBYA 2FFBA 3R3YA 3SNKA 2W5UA 4XYBA 1NWHA 2AUTA 4EYQA 4ER7A 4JI4B 1QDUA 1I01A 2ZTVA 3DFIA 5T6BA 2LCQA 3VU9A 3UC5A 3F6EX 4YN3A 3H8SA 2ZYHA 2WYUA 1DX4A 3MBOA 1ZIYA 3T7IA 1L5LA 2W58A 3ECSA 1NPDA 1P2DA 4HNHA 1AG9A 4XYLA 3AIOA 3U4QB 3FFTA 1PDVA 3D8NA 2Y1FA 4XDYA 5GONB 3VC2A 2EOAA 4C3OB 5F7ZA 2BHLA 1USUA 1JHRA 1O54A 1FYXA 2GCNA 4H0CA 1JS1X 5LA6B 4CDMA 2VUIB 5KTMA 2H92A 1XOIA 3INTA 3S68A 4EHNA 4PCAA 1P0CA 3NOXA 4RWEA 3THXB 1L5YA 2PXAA 3AUXA 2WTEA 4QBTA 2ZRFA 5DT2A 1XA4A 1ZH0A 3BXGA 3KD3A 4RK5A 4Y2UA 2B35A 4GR9A 2QK4A 4ID3A 3WO1A 4B87A 1E99A 1YASA 1KH3A 1UADA 3N2LA 1Y1TA 4LS3A 5CT4A 1TCVA 3ZWDA 2OBLA 2JVIA 4MKXA 4QG7A 4CW7A 3BWEA 2LNDA 2W70A 2CUZA 4WOPA 3FPPA 1YL5A 4MOWA 1HDRA 5EMLA 2ZROA 4GP9A 3LVQE 3TL6A 5EEGA 1RHJA 4DJFC 2Q4BA 4ZAXA 2X6YA 1N57A 3CM0A 2K5UA 1U6KA 1MC1A 4OJQA 4NCIA 5TLSA 5IUJC 4ZVOA 7GPBA 2BFBA 2VHQA 3QXCA 3AVXA 4HDRB 4G97A 4L22A 4I36A 3O0DA 1XFAA 5HMMA 1UJ2A 2QM3A 4MQLA 3RUCA 1FRNA 2XVXA 1GHTA 3HDVA 3EOBI 4O2BA 3ZWAA 2C2BA 3PICA 3VHQA 1QH1B 5KC9A 4RY8A 4HQOA 3ICWA 2X6RA 4LXYA 1SVUA 5CB4F 2YNMC 3P2IA 4AG3A 1D4ZA 5KWEA 4Q7KA 2ATVA 3ETHA 3SICE 2ODTX 4LJAA 3EGCA 4NULA 3VKFA 3O7MA 3ZDZB 4I1PA 2FMTA 1NZFA 1PR4A 2YHUA 3CLRC 3QKTA 5J63A 2AN3A 4DWOA 5C8ZA 3HJHA 4UE3S 1EXVA 1XLTC 2G3YA 1ZAYA 1NJFA 1WXIA 3JPWA 4TRRA 4TXMA 3GMDA 1E59A 5KQRA 2CD9A 5FX2A 2A86A 3OJ0A 4LVNA 4BMNA 4HZIA 3IHLA 5C1OA 1VQ9B 1IDN1 2ZLBA 1PJAA 1UP4A 1YBAA 1N2SA 2H9AA 2HMWA 2OV4A 8AT1A 4XWOA 2CMFA 2BWJA 4MUXA 4V2UA 2PLNA 1G20B 1RWVA 3S1SA 2PMWB 1LVHA 3GXOA 5DYYA 1TLFA 4QYXA 1Y4DE 1T36B 1J24A 1KFBB 1YZNA 3MGGA 1UKVY 3ASRA 4RLZA 1NYRA 1ADJA 5A0TA 3EFBA 3TMKA 4X90A 1WVGA 2ZSDA 4KMOA 1ENYA 2J3LA 2HLDA 3MFQA 2V8BA 1R4AA 1V39A 1VMIA 1XROA 4K9RA 3N0RA 4NWIA 2XWSA 3IO5A 2H3EA 1GFSA 1N2JA 2J41A 1SBNE 3HS3A 2QA4B 2BMJA 3RYCA 3RAPR 1IN8A 1IZ0A 1XTQA 2H1RA 2QZSA 1M2NA 2ZAOA 3GAFA 1H65A 1SG9A 3IUBA 3B1WA 3Q7RA 4CIVA 2RGRA 5AO9A 2YZMA 3ASYA 2WIFA 5JAUA 3DVLA 2DKOA 2D6FA 2XIQA 1Q9SA 1UC5B 3GLQA 5CW2A 2ZIAA 1JPVA 1S2NA 1ZISA 2BDUA 1ICIA 3EY4A 4HXEB 1DHTA 2GCIA 2VQ6A 1W47A 1F4VA 2RGNA 1Q11A 2RIPA 4HDKB 4QGFA 2GBLC 3J80A 3CU5A 1OY1A 4N0MA 3EHEA 1M2OB 3UUEA 1Q12A 3KWJA 3OMXA 2WYWA 5CT9A 4X3CA 3K0AA 1VKNA 5L3ZA 5TQ0A 4LXUA 3AF5A 2I7VA 4RNDB 1CIVA 3QEMB 2IHVA 2WWIA 1T2AA 1TF7A 2WFLB 3THWB 1ZD1A 5BRAA 4D3FA 3RF6A 1D0IA 1NHGA 2XNDA 1AXEA 2CLFB 3LPCA 4Q3DA 1UJMA 3TIIA 5E7JA 5HW0A 1DWPA 3F96A 4TRMA 1M7BA 4DNOA 1YJNB 3K72B 4KYUA 4DSAA 3ZCRA 5LKRA 1JU3A 3Q39A 3HKBB 1TKBA 4MWOA 2IYXA 4UU1A 1O87A 4QUHA 3QX3A 4GLLA 2YWJA 4HQLA 4GO1A 4BN0A 4CTNA 4PRKA 3C24A 4UHHA 5H0IA 3BXHA 4MHOA 2D5IA 1SPXA 3FETA 3TG8A 3MJCA 3Q7IA 4ZZ2A 4A3SA 2AI1A 3M2TA 4PWYA 3G9XA 5TT0A 1N6KA 3DO6A 1EWRA 4BGUA 2C2GA 2J3EA 2P77A 1C1HA 2ZTMA 3F9IA 3ZWYA 4EF4A 2PTGA 1OBCA 2X41A 3EVEA 4LXQA 2VNHA 4JKOA 5LQUA 5I9IA 3I5XA 3PNVA 4A26A 4Z5XA 4MH0R 2NYRA 3KLOA 3ZE1B 3M6IA 4R8SA 2MYUA 1BA2A 4KJXA 5CT6A 4D44A 1OWMA 1QRRA 4GBMA 4BMOB 1KZLA 2BF4A 3EPLA 4JB2A 3AUFA 1BE0A 5EINA 1PR0A 2H5LA 2O2GA 2Q1UA 3PRHA 3RPEA 4DT1B 3TZKA 3WJ1A 3U16A 1XE1A 4DLZA 3JD3A 5KOHA 5KOIA 4DIEA 4HVLA 1NI4A 2OENG 1CB0A 2I4NA 3MCWA 4J2OA 4V0MA 5EQTA 1XU9A 1XWIA 4FKBA 2LV8A 5FORA 3T3MB 2MMCA 3E3AA 4CI9A 5DLDA 4X07A 4ZU1X 4A8JA 2ZUFA 3A7DA 4OH7A 3M3PA 2COEA 3WQZA 3I2FA 4N3GA 1JMVA 1M6EX 1SULA 3FPBA 4FOPA 1Z0AA 3WWPA 1K08A 2C5LA 1T9AA 2V5UA 5CB4A 2XITA 1OLXB 3PB3A 4K1XA 2A8YA 2P6UA 2Y1EA 3I1YA 4FMDF 3SR0A 4C9BA 4DMGA 1UOPA 4ZAVA 1WW3A 4HNGA 4D9NA 3RTCA 8MHTA 2LIPA 2GOYA 1QHYA 5C35A 3AFOA 2OD2A 5JXIA 1TD1A 2DQ4A 3OHMA 2NSYA 1Q16A 2GESA 2LD4A 4G1UC 4QASA 1II0A 1N5DA 4ITUA 4KO1S 4I46A 4ZP1A 2W6CX 2JI6A 3L07A 5FADA 5K4GA 2N1MA 3PI7A 1X92A 1WS6A 1CQPA 5G41A 1AN9A 2OOSA 3MUFA 4BX2A 4CXMA 3VPHA 3MLAA 5BUQA 2F90A 1HZZA 5D7NA 4U0JA 1VL1A 2PD4A 1A5AB 1FNMA 4QFMA 1Z08A 2J5BA 3I9JA 4MIOA 5GONF 3VR5D 1ZD4A 2IV7A 5I48A 3A36A 4XVCA 1Y9ZA 1T3LA 2O2SA 4M7PA 3FNFA 3AR8A 1I5RA 5LA6F 4PAWA 3T3DA 4D4JA 4GYKA 4EZIA 4OUDA 3PJEA 1LF0A 4EECA 4QOFA 4CGYA 4KB5A 2H4JA 1CZKA 3L7IA 4HOYA 4BJ1A 3QE3A 5I4KA 1PBTA 4JVOA 4EG7A 1YJWB 3C8ZA 2R7LA 2ZJ3A 3PRJA 4GDMA 4PO9A 4BLPA 4DC0A 3ZE2B 1OGYA 1FU4A 2BGJA 1GPYA 1W4BA 2WWTA 4R7ZA 5IAKA 4B17A 1DWOA 4WL0A 3OW2B 3R6TA 1TMGE 4ZDWA 2RHHA 5DJ5A 2GM4A 3V76A 4DA0A 4R2XA 4EY3A 2J07A 4KKUA 4U39A 1E69A 4D02A 5A7FA 5IC6A 1C7ZA 4MLCA 2ZXUA 3PYMA 3MWEB 5A5EA 3U7HB 2D06A 2FRDC 2GYYA 3F3SA 1F2TB 3A4NA 1K6XA 1ZMRA 4G23A 3VYVA 1O95C 3AERA 2OG2A 5H16A 3VBCA 2C5AA 3TEFA 3TQOA 3N05A 4XJVA 3W5HA 1T8WA 3RC2A 1KTVA 1O8CA 1U1DA 1UIRA 3KPJA 3GEHA 1RVV1 3D8UA 1AD2A 3T5CA 1BKYA 4UMVA 5FNVB 3TVYA 4EITA 1JI3A 2XXAA 4BNDB 5JJLA 1PNOA 1ZOPA 2X8WA 1TB4A 1WZUA 4FYXA 2QX8A 3DZGA 2JBAA 5HOEA 2QGGA 1EXMA 2H5IA 4RTPA 3SY8A 4Q47A 3OM9A 2K4MA 2LZ0A 2IZOA 4DA9A 4ADSG 1XPRA 1WKBA 4RHTA 3CPSA 2ZP1A 3O03A 4JSTA 5C8XA 3KPWA 1QH8A 4V0ME 3ZS8A 5E3HA 2FSPA 1YC5A 3HYSA 1VDMA 1JHXA 1E1KA 1DT5A 4ZTBA 1YH3A 1QGED 2GFIA 1EGQA 3DCNA 5KYVA 2AYZA 4U0KA 3IHWA 3Q0EA 1T29A 2IYRA 2YJ3A 4JKYA 4KO4S 2PWAA 1J5EB 3ADCA 1FSPA 4BBZA 3PE3A 5G1PA 4M1ZA 3L1JA 1JWLA 2B1RA 1TQ4A 2H54A 1P2VA 2H1FA 2YVAA 4PZDA 4ATNA 1XTRA 1ACLA 2CZQA 3GAAA 2Y6VA 4L51A 3CT4A 1I0ZA 3M81A 2VPZA 1PTJC 4DLRA 1G41A 5EFZA 5CDYA 2Q3CA 3EE6A 4FUTA 1IOZA 1FVXA 4MPRA 4OHFA 4WN9A 1DQRA 4DUGD 3QMMA 4MR8A 3LC7O 4D8VA 3UJHA 2F67A 4JL8A 4EY7A 2P3LA 1A4RA 4MWDA 4JC5A 3AVYA 4MYDA 3RRNA 1SC4A 2WY2D 2FPSA 3C1OA 1J99A 5DZSA 1QONA 4FYPA 2A1IA 4JR1A 5JCZA 5DRTA 1U3VA 1ZZGA 1XDDA 1N3IA 4Q93A 3EDCA 5B4TA 2V54A 1XMIA 3KUXA 5IXSA 3PX7A 1JECA 5F4OA 5IVPA 5IM4A 4L76A 3ADPA 4MGIR 5C31A 3K73O 1ODKA 5JZVA 1RYHA 2K2QB 4K6HA 5D6NA 2PMEA 4G0NA 1CY1A 2BRUA 4N47A 4BQEA 1QX3A 1Q7GA 2C83A 4JJ8A 4NP6A 3ZJVA 5KCMA 1T2EA 3AR2A 1PLJA 2C0QA 2O2HA 4H7FA 1IH8A 3OZUA 1YCFA 5CCXA 1AU9A 5K3BA 1JILA 4WZAB 5DCUA 3R4CA 4CR6A 4CZ2A 1ONBA 3VR1A 2OTLB 5BYKA 1U2TA 1KZ7B 4QBKA 3X2SA 1ID8A 3GDHA 4FYYA 4TL6A 1L5VA 1HRDA 3N6RA 4LF8B 4MIYA 4EPTA 3OM0A 3CWCA 3G8AA 4B8YA 3R44A 5E1DA 4MDYA 1OMOA 5JECA 4EOGA 5L3QB 4BKQA 1RXIA 3GT4A 3PNQA 1AZWA 1X9GA 2QLLA 4KQCA 5H1YA 1C7RA 4J0JA 1SN7A 2XUZA 3LZDA 3OIVA 5T64A 4AJ1A 5JYCA 1UMKA 1XI2A 2ODBA 3O82A 2PS0A 3E3NA 3ZE9A 4YIHA 1PJSA 1KXJA 1U0RA 1CETA 1E7WA 3QF7A 3L5KA 1YZQA 3OVMA 4OKSA 1JI0A 4L4RA 4R2LA 2FZEA 4RSRA 5G53C 5LZ7A 3T12A 4EB6A 3GNLA 4A2CA 3HE3A 1VOTA 1BLIA 2E85A 1T1IA 2V3VA 3JTEA 4H6WA 3M0EA 3LPLA 3K2BA 3D6HA 4QOGA 2B6HA 2H11A 2HA6A 2XTZA 3L7YA 1POXA 4N3NA 2XLBA 2A59A 1OILA 4RE5A 2XQIA 3WLIA 4BVEA 2GZMA 1FX1A 4IHQA 3WC4A 3S2YA 2UYHA 3ZQ4A 1OH6A 1RM0A 5IASA 3PPXA 1CTQA 2D2FA 5M5BA 1P4JA 3RU2A 1TA9A 1NVKA 3URKA 4ER0A 8ABPA 5BWMA 4BY9E 1DAOA 1HE1C 2OORA 3ACCA 4FX5A 4N7BA 2XDWA 5FDFA 1IZYA 4WH0A 3VDRA 4E5YA 2NSLA 3H9GA 3KJHA 1R4MA 3SYRA 1PK7A 2Y0DA 1HDZA 1J0AA 5DB4A 1BMQA 4CPDA 3QVUA 1PR3A 5CXSA 1C29B 4P2BA 1YZ3A 3FPLA 1BKDR 1SXIA 1FOEB 3IAXA 4I4TF 4N6NA 1R0RE 3B53X 3ESDA 3P0RA 3PQ4A 4IDPA 1S8OA 3MT0A 4FHFA 4PHCA 2TYSB 1XNRB 4S35A 5LVAA 4XWWA 4FVTA 4HGPA 3EUWA 1OFTA 4F11A 1YA4A 4NJEA 3VISA 3UMGA 5IT0A 1E3WB 3RT9A 1MNAA 3FUWA 3ODPA 4OK6A 1VQOB 1QTQA 1XRSB 1DL5A 2X6WA 4G41A 1I0LA 3A0RB 2CT8A 5ITVA 3L7BA 4YCAA 2XF8A 5CFLA 1Z7EA 1X1TA 2QY9A 4G4IA 4H4EA 1QHSA 2B61A 2VCYA 1SZJG 2XCOA 2FN7A 4I5FA 2Y0PA 4N82A 1FS6A 1TVCA 2JGKA 3QK7A 1Z6AA 4JQCA 2VYCA 1PR9A 2HO5A 3VR5A 5CITA 3LLVA 3LPDA 2IEIA 2TECE 1Z36A 3REFA 4MB2A 3D7NA 3WK9A 1XJQA 5ER6A 1OT3A 2J8ZA 3DL2A 4MPDA 2W6JD 4EUEA 1D2CA 1GDHA 3AKCA 4GSKA 2YVQA 3WRVA 2VUTA 3TCXB 1N34B 5TRDA 1ZLXA 3SIWA 3CCLB 4HSGA 4HXYA 2OSBA 4K6GA 4B7XA 2GBFA 2HLNA 1UC8A 4WCDA 4BNTA 1BQEA 1VKJA 3JU3A 5KHOC 3AR5A 1BX0A 4Q1FA 1E2DA 4IGKA 4QOEA 1XVAA 1ZL0A 2HRBA 1YRAA 2E4VA 1B76A 4Y2SA 5JCOA 5J5VA 2PPLA 3MAJA 4H6VA 1BZYA 1IB0A 3IT0A 1Q0LA 5U1PA 3ZGXA 3QVJA 2FP4A 2POCA 1R9GA 4G56A 2YDXA 3QEAZ 1C3OB 2BPOA 1SAYA 3EH1A 3PDWA 5J9FA 3RTGA 4EPRA 1G2PA 2QAGC 4Q48A 3OPMA 5KTNA 3E2MA 4RK4A 5E4FA 2EQBA 1I1QB 1I3LA 1UT8A 2DWCA 4JLDA 1V25A 3WGJA 5TGZA 3ZXUB 1M6NA 4Z4EA 3KAQA 4YA6A 1CUCA 1L6RA 1JLLB 2WZPP 1NLUA 3M6XA 4MUMA 2M6LA 4AS3A 1QZTA 4JODA 1QLHA 4LYFA 4AYTA 1PHPA 1W1IA 2GPNA 3NRJA 5FNVF 2QBYA 3AY0A 3O4GA 4XSHA 5KWSA 1H9CA 1M1XB 3W1WA 2XDQB 3N2ZB 4ER3A 3B36A 3QU4A 1VSUA 4W5NA 1Z0JA 1VMDA 4H4CA 1I5OA 3JD1A 4F6RB 4II7A 3CTAA 3O1JC 4R2WA 5DYTA 4BZZA 4NPAA 1N2CB 2QN6A 2OBNA 4K6OA 4RDIA 4JP8A 5AKLA 1QVWA 3MT8A 3WDMA 4KH0A 3U26A 1CJCA 2OVBA 3MYRA 1KWKA 2V6GA 1T0UA 4QSHA 4I1UA 1LU9A 2PBRA 1EJBA 4N01A 2XVMA 4A10A 2XJ4A 4DSNA 4DYHA 1WW8A 1NNEA 1KAEA 1Y7IA 2C9ZA 2W2KB 3W5CA 4GLBA 1RT9A 4Z9YA 1JL3A 2FOXA 3OFND 3QFHA 1W2WB 3EMVA 3K0FA 3RB8A 4Z54A 1G1AA 4DMHA 5FP0A 5EJGA 4PYNA 1I24A 5BR4A 4HI0E 2KB0A 3O8NA 3GZNA 2EGGA 3ZDQA 4DUGA 3KKPA 4JU8A 4A2WA 3A4LA 2ZI5A 3A6HA 4ZYVA 2GNPA 1DJNA 1PR5A 3CCVB 1YFZA 2QRJA 5KSYA 3THRA 2C04A 2RGCA 4HRAA 1AURA 1GGMA 1OTYA 2Y2VA 2B0JA 3DL7A 4S04A 1ZNZA 5JT1A 1XCJA 3U2QA 3MUNA 3EQ9A 2QNIA 4Q9JA 4DT1A 1JMYA 1TVMA 1USWA 3NHJA 1DRJA 4BPRA 2KI5A 1E3TA 1JN0A 2X86A 3N3AC 4AJ9A 1WG8A 2NV0A 2ON6A 1WHSA 1EUDA 3DLTA 5DTEA 3RD5A 3T7AA 5SV2A 5KINB 4M1KA 4IINA 2X13A 1F1BA 1JJIA 3UVEA 4OTZA 2IZ5A 3L43A 4JBLA 3WNDA 2Z6AA 3WWCA 5TQ2A 3IVXA 2BT4A 1KYWA 1O57A 1ZGGA 2FRXA 2JVJA 2AZDA 3MBKA 3ORSA 4I4TA 2NT4A 2FFJA 4I6GA 2HPZA 3AM3A 4KN5A 2CK3D 1RYBA 2JFQA 2WHQA 1ZK2A 3FCAA 4QEKA 3F47A 4QOJA 5LJIA 4K0KB 1FFWA 3C8MA 4BAGA 3W2FA 4F3NA 1QE5A 5JSQA 3VKWA 1NUSA 1V6SA 2F43A 1JYSA 3NBYC 3QUSA 4KXWA 4TKVB 1GEEA 4J7UA 4KWTA 1X1QA 3P4UA 2PL1A 3UHFA 3HPQA 3R6LA 3UAOA 4B6RA 1LPAB 1SUSA 4LYAA 2FWAA 1U2PA 4MCHA 3O4HA 3TFWA 4G8DA 5IRCD 4H1UA 4DCSA 1WZNA 4KQFA 1A88A 5CURA 1I1NA 2DFVA 4ZO4A 3RARA 3A3GA 3JVVA 4QJ5A 1PDOA 5T6MA 2AG6A 4UHEA 1EJ6A 1W93A 1N7HA 2O1EA 3ENVA 3F3MA 1NM5A 2J6CA 1FFYA 1FC0A 3KLPX 2DCUA 4RHFA 5I7FA 5J2TB 3LBNA 4HLUA 1J0CA 4FHCA 3W8EA 3JQ9A 1H3EA 1SOAA 5DW3A 3W7VA 2O4UX 3M1LA 3N2GB 1E77A 1HLPA 1U9JA 3G2KA 5I7HA 1ZI6A 1K98A 2AJCA 4RGVA 1XVIA 5KQMA 2HRRA 2NACA 4B71A 2GJKA 1JEDA 2EP8A 4PSCA 4JYPA 3S3TA 3ED1A 3G0CA 4IL5A 4N65A 1X7HA 5FBLB 1R16A 1WP4A 5FV7A 1CHNA 2XNSA 4KR7A 1OVGA 3KOUA 3MTEA 3QFTA 2GXSA 1GYRA 1UCFA 2D2IA 1RI3A 3S0JA 4R8VA 1K3UB 3MRSA 4G09A 3RVDA 1P2TA 1ZJ6A 2YJTD 2J1LA 3S55A 2R65A 4B80A 3GIRA 2FOIA 1E3QA 4B75A 4F1WA 1PYDA 3DYVA 2W2NA 3EGOA 1DT3A 1E3LA 1P2UA 1QVVA 5E7IA 3MAAC 1YVUA 1X38A 2CMHA 3HY6A 4JQZA 4TS3A 3W8RA 4UREA 1A9YA 1AKUA 2NYVA 5AQEA 1LI5A 1W48A 5IEBA 4FWIB 4L5BA 3SS9X 1IQRA 1YCGA 5EJ8A 1I7LA 2Z58A 3B5JA 4BC0A 2ZZQA 1IJFA 3QU9A 5HPYB 3IMGA 4GPD1 1C7QA 2JD0A 3D4IA 1UJ5A 3FPHA 4RJKA 3R3ZA 4XLHA 1A4UA 4FCCA 4KQ6A 3WV5A 4WZKA 4BMXA 1U1GA 3UO8B 4CMIB 1JKMA 2QI9F 3LUFA 3KVVA 4HE5A 2LE0A 1EVQA 1R18A 2HREA 3DE5X 5BN5B 2HHHB 4RETA 1N0IA 2VA9A 4KMRA 1ZU4A 3RANA 4OMFG 1U9IC 4TMZA 3RADC 1M8GA 5DASA 4A8TA 3VJLA 2CVZA 3HKEA 4JI3B 3L0YA 1Q1QA 5A6VA 5KNCD 3JATB 4LRSB 4G9EA 1FDOA 3QWBA 4FGUA 2XECA 5ABPA 4X44A 3MF4A 1T13A 3K1AB 2UVPA 1LWOA 4YFYA 1EVZA 1JA0A 3QVSA 3OF2A 3CC4B 1LCIA 4AJ2A 2W6JA 5KJEA 3I8XA 1BW9B 1E64A 5CTAA 4BMZA 1S8FA 2CNNA 3W5UA 5DXJA 1EBFA 1HYGA 3G0BA 5IFKA 4RK1A 4V0KA 1M34B 4IJQA 3ISVA 1UWVA 3HZOA 3ORHA 4US0R 4AN4A 5TR9A 3LDHA 2PH1A 4Y8VA 4DBZA 2V0CA 4ARIA 1T8PA 1EIWA 2RHOA 2YWCA 4DPMA 1IPEA 1CXZA 2CHGA 5C3MA 2VPPA 4CG2A 4XFDA 4B3IA 1N2BA 3DDWA 3DR3A 1DRUA 4IUCS 4CEJB 5EG5A 4UZEA 1D7OA 4LYJA 3WK8A 2CL5A 4QULA 3BKWA 4B7CA 5G0SA 4Z4SA 1TUIA 1RWKA 1W75A 2L19A 3AKYA 4G36A 4S2EA 5LBIA 2XRFA 4J0EA 5LB2A 4CL2A 4RSHA 3IDZA 4LX8A 4BYGA 3PX2A 3PDIA 3OPQA 1OLSA 4JJ4A 2VDWB 2F7SA 1RI2A 4QYIA 5J1TB 1ZPDA 2QMQA 3BUSA 1G0NA 3P4XA 1Y3IA 3GELA 2O2XA 1DBIA 4GLOA 1Y0RA 4X7FA 3TGPA 1RWNA 3FSEA 3A4MA 3GFTA 4MUEA 2X0DA 5IPFA 4GRDA 2V5VA 2JLAA 1RAIA 2RKOA 1NVFA 1P0IA 4GWKA 1TCAA 2PD3A 1A2OA 3O26A 5EE3A 2J9FB 1DCKA 2FSSA 3M3DA 5D5HA 3I3OA 4QOHA 2X42A 2ZI6A 3KOOA 4Q4HA 1Q5PA 3R5HA 2EWVA 3R8FA 1FFCA 1U0TA 1ZQ1A 1GGVA 1SQGA 1Z5ZA 4HWRA 4EIWA 4E1BA 3N5KA 1DIGA 5TRTA 1YQTA 2VJLA 3HXKA 4NLLA 3RHZA 2ZB2A 1FUKA 1RP1A 1TZBA 1F9EA 3CSUA 4QAQA 4URFA 4KFTA 3SDSA 4ZDIA 3TTYA 3KX2A 2MMGA 3FB1A 2ZBVA 2E4WA 3OFNA 1MGOA 3D6MA 4JT8A 4LRTB 3G8DA 2IV2X 4N5DA 4NNPA 5JLJA 2VI5A 2NZVG 1FP6A 2HNAA 2HSGA 4LQ4A 1KQNA 3KQNA 5BQ5A 3K9NA 1G8PA 4DQLA 1GLVA 5AVOA 3CCQB 2ZIZA 2QP3A 3V7NA 2GAFA 3OESA 1VCNA 4LQCA 1I6LA 4AJJA 4EVSA 3ONWA 2B5WA 3SS7X 2V45A 3FOZA 3KD2A 3QSYA 1G3RA 3C39A 4TVKA 3BA1A 2PUWA 3KFXA 3PT5A 4TMTA 4B45A 1O94D 1DBWA 5FLKA 2VJKA 2G9VA 5DM1A 2GN4A 2KWIA 2PR2A 3DPSA 2G08A 4HLQB 2AMYA 3TIXB 3V48A 4I55F 3ZIUA 4XD7D 4G9GA 2JHAA 3A04A 3O75A 3EOZA 4KUHA 4M1YA 4KYVA 2OAP1 3GGJA 2JKVA 4AC9A 3BGIA 1T5HX 3IUNA 4F9GA 1PKEA 2ZI3A 2PS1A 1X1BA 4KQHA 1XJWA 4PHGA 4G89A 4NYMQ 5GM1A 3A2MA 3JS5A 4IH1A 2ZB7A 5KVSA 3LY5A 1FP1D 3CRW1 3R20A 3F7OA 1Y5IA 4Q1DA 2CK3A 3VAZA 1P7WA 4IDOA 5C0OE 3RVOA 1LQ2A 4QDJA 2I7CA 2OCYC 2XGMA 3NONA 3MRXA 5SY9A 4B0PA 5ES3A 2GCGA 5BOSB 3V8PA 5FWYB 2Q6VA 1PV1A 4JA0A 3VAYA 1YZHA 3ENNA 1KKMA 2FAXA 1BDMA 5K8UA 2MSCB 2GNAA 3L8YA 4YP5A 2R25B 4MHSA 1QPGA 2WDZA 2Q0SA 3G68A 2UYQA 3B3QA 2DPLA 2PY6A 2XCLA 1YHQB 4IY1A 2HCRA 2FEWB 4DQDA 4OA8A 3H2GA 5DTJA 1LS6A 1QCDA 3JYPA 4OQEA 2XWQA 1KMCA 3BIJA 2CDAA 3V4OA 3PVDA 1PW7A 4ZJUA 2VDRB 4WA8A 2Z4SA 3B1VA 3WFJA 1SCQA 3RC9A 5J2TF 4TKUA 5FWXB 4B3XA 1RAAA 1JQAA 4NEQA 4O02B 2EG5A 2ZS7A 3ASQA 3G5LA 2X0FA 3IAM1 3K9CA 4N7JA 4P38A 2D59A 3ST7A 4HJRA 4DY6A 3A6JA 2VJMB 5JAIA 2JJ8A 5IHPA 4GKAA 2D00A 1BD4A 2XOEA 1QNFA 3AUUA 3H3FA 4RFSB 5CEFA 1ECGA 1N0HA 4HDNB 4OM8A 4YGYA 3QW4B 2EATA 5U4QA 2E6UX 4YONB 2NU7A 5JRZA 4NYMR 2O8BA 2ZJOA 4JT9A 5HQJA 1QFYA 4PONA 5J4VA 1DINA 1IN4A 4C0WA 4ZCMA 4O0MA 4BNIA 2G4CA 1K63A 5DNDA 1OWLA 1YJAA 1ZD9A 3VH4A 2KX7A 3UQZA 2O8FA 1TA4A 5CH3A 4CMHA 5H8WA 4O5OA 4BV2A 4MJXA 3FMIA 4GP6A 2OPHA 4JL6A 5CAEB 2DFNA 1GN9A 2L2QA 2QQEA 3OZEA 4QUZA 5FAKA 1DAMA 3B85A 5JIBA 6REQA 2FYTA 1Q22A 2Q4RA 1R8SA 3H1AA 2VBSA 3KKZA 4FGSA 3REGA 2EERA 5FEMA 4M3NA 2VBIA 2A9JA 4JMPA 2VBCA 1ORWA 1RHUA 3G8CA 1R50A 2WUWE 3A1VA 3PFHA 3ENZA 2NO0A 3SEFA 2HJHA 3LOQA 4KODA 3FJYA 1U0BB 1JV2B 5JUWA 2HZBA 1GPDG 2NGRA 3EIUA 1CB7A 2QN3A 2VAWA 2QN9A 3QEBZ 1J56A 4JT4A 2ATIA 3LL7A 4M7OA 1TT5B 1EGHA 1FS4A 3CX3A 1Q6YA 5L40A 3CF4A 5ALGA 1AGNA 1DIBA 2JH3A 3LX6A 5KNCA 4QDTA 1THGA 1RQLA 4XIJA 4A2QA 1FJXA 3EBPA 1ML4A 4U6NA 3ZWBA 1TAUA 4YRGA 2A1TS 1WB9A 1J7JA 3CF2A 2FVXA 2IP4A 1NW9B 3EUAA 2WJVA 2JJQA 3BXXA 4NECA 4IF6A 2XUKA 1JJBA 4EM6A 1E3IA 1XMOB 1TYCA 1B8UA 4OJYA 4J1TA 1FUIA 5KWIA 2BGMA 3RQIA 4OHPA 3K8YA 1TMYA 4UOQA 3RS0A 5ADVA 2QN2A 2DFDA 1MVLA 121PA 1M1ZA 2OE2A 1TM1E 3TXYA 3QYFA 1MRZA 1A7AA 1BX3A 4XKVA 4ISBA 1L4UA 4NFYA 2VTVA 4QXQA 5LM3A 1BXRB 1YJ9B 2Q4TA 2QR5A 3DDUA 1PFUA 3IQHX 4I55A 5A9RA 3A2KA 1JQ5A 3AZPA 5GP1A 4OXYA 1ONNA 1P3JA 4BBJA 5JZSA 4IOLA 4P35A 1Y82A 2DMRA 2JFHA 8LDHA 2Z6QA 2WSLA 1F4PA 3LC1O 1U9YA 3R40A 5FYDA 3ZWQA 4KQIA 3WK7A 2VQ3A 1SQ6A 3BHIA 4P3NA 4KI7A 3FROA 1YUBA 2ONJA 1NOKA 4YB8A 5BSVA 4EVRA 2N3ZA 4MJ3A 3M5WA 3HSKA 1WX1A 4RUKA 3VKVA 1DAHA 4FEEA 4JH0A 5T41A 1U0SY 5KYNA 3ELYA 3EXG2 2EL7A 1M10A 4HPWA 1K9VF 2A4KA 2ZB4A 1EBUA 3D3JA 3U5TA 2BV3A 1LRKA 1ZK4A 4OQ4A 2VBTA 2PZEA 1WRBA 3EY9A 3RYIA 2XMRA 1SUIA 1YACA 2LW7A 3BEDA 2HDNB 2PGJA 3NVMB 5EWMB 4HN2A 4URUR 4DV3B 3EVAA 3IUPA 4A5SA 4XLEA 4JASB 3EF1A 1S0UA 2XUPA 3T7SA 2FJUA 2XBUA 2WT8A 3RBXA 2EZ9A 4PLPA 3P9QA 4WSOA 5ALWA 1RW4A 1NAHA 2GHQA 3ED5A 1L4KA 1GPJA 1YKGA 4TS9A 4XLFA 3EGXA 2R2GA 4G0QA 1MX9A 2QUKA 3RRZA 3N2KB 5I5EA 3BK7A 3EGDB 2I8CA 1DJMA 5J2TA 4WLUA 2CHQA 4MW5A 4FEGA 1J0XO 2GYWA 2DBRA 1OH5A 1PD0A 2GF2A 1ZGZA 5B57C 1PCXA 3AXTA 4TLLB 1HX7A 5ESRA 1DMRA 2XZDA 4EGCB 2CYAA 2P4SA 1ZN2A 3U5ZB 4M49A 2QRNA 1VL2A 3R7LA 1VSBA 1H0SA 1M5TA 1UT6A 2N1BA 3UOAB 4BASA 3PUVA 1O94A 2CHUA 2QN1A 4MR7A 5INTA 2V7UA 1UEJA 1N2CE 5FKJA 4DAOA 3R7SA 1RKXA 2FR8A 1IHPA 1ICEA 3UMVA 4CKCA 3DT8A 5K0CA 4KQ9A 1N9GA 2VAXA 3GWGA 4XD7A 2K87A 3GRUA 1RLUA 1RPTA 1OASA 1XXHA 1TMKA 3DXFA 3S7ZA 1Y3AA 1X9HA 1E3ZA 1A82A 3EA5A 1BO6A 3EXHB 3NASA 1GCIA 5K0ZA 1X1SA 3B82A 3JY6A 5LU8A 2RH4A 1T8SA 2HFKA 1M2VA 5HKKD 5K8VA 2PX5A 3CCJB 5GINE 3O7WA 3EWIA 2C2KA 4KPUA 4RH0A 4D41A 4ZJPA 1K7EB 4JX8A 4BATA 2YQ5A 3JARB 1HH4A 4WFQA 1R64A 4JR2A 2A30A 1MEJA 1RXCA 4M1OA 1NQWA 1AVTA 1N08A 1C2TA 1MDBA 1MO4A 4CDNA 1H85A 4NK5A 5KUTA 2C7PA 3WNCA 1P18A 2W8BB 1M2FA 2ZVPX 1C3LA 3LQ2A 3NH9A 1DB3A 3PWZA 1Z15A 1PKXA 1ADYA 3EGWA 4RCVA 4Z3DA 4Q02A 2BC9A 5H4HA 3RSOA 2XTNA 4NMHA 3ANTA 1IN1A 3SJBA 2R5FA 1NNUA 2QA5A 3K0BA 3D26A 1CP3A 4EY5A 3I9V6 4IUYA 4QGHA 3HNOA 1TCBA 1QO9A 5LP6B 2IDJA 5AVWA 2RHTA 3F5SA 2SHKA 4D6PA 3NVDA 2OTCA 2IU0A 2DTEA 3ROPA 5DTQA 3J81k 4KQJA 2XXBA 3T15A 1W44A 3K4HA 3DB2A 2WU0A 3G2LA 2C82A 3MC1A 2RBKA 4UAVA 1HDGO 4K9DA 1M76A 2GZ2A 1V48A 5CYPA 3MS2A 3NU1A 5AKGA 3H19A 2IIQA 3ONFA 5KJ6A 5A0VA 1PT7A 3OBIA 2I76A 1NLFA 2QLFA 3G17A 3LHFA 3V80A 1ADGA 2P5UA 5DHQA 3I2KA 5D00A 2CNBA 1IBLB 2VYND 3GDGA 1QG4A 4XQFA 1NXVA 1W52X 3KYBA 4HRYA 4R2IA 4XH9B 3UENA 1OREA 4BQRA 3P9YA 4BXOB 3N59A 2XZLA 1P6XA 3JVEA 1H3NA 2QLMA 4JWKA 4J0IA 4OXXA 5C5CA 2F3QA 3QTBA 1C81A 4KXFB 1IRXA 2A4MA 4E94A 1RJWA 4Z0PA 2QUZA 1YUMA 4XSGA 2JFUA 3O8RA 3OJFA 1Y9AA 2CUTA 3QE0A 3E9NA 1PZGA 2GN0A 1KR2A 3MTJA 4POAA 5UKDA 3UYKA 1I3KA 1CDEA 4O1MA 3O8QB 1LBSA 1VYVA 1Y1PA 2JIMA 2W2XA 3CLUD 5G1NA 5C4IA 3KSBC 1ZU5A 3LAWA 4XGQA 3GVLA 3K9LA 1T9KA 3A37A 3RIMA 3MTAA 4GT1A 3JYHA 3P7MA 3OTGA 5CHEA 1AQJA 2Q2NA 1Z7BA 1N7JA 1Z56C 2O50A 1NGSA 2XB9A 4OQDA 4UBOA 2P9EA 1FRZA 1XKLA 3AG6A 3K96A 3OCUA 2X9LA 3U9TA 1MP0A 5CDTA 3V8VA 4LFBB 2G8NA 1C0KA 3PQDA 5BN4B 1XXHE 3F4KA 4PX9A 4JYAB 1XL0A 3SOPA 4X8LA 4DZTA 4C4AA 5LZ2A 1W9MA 1YS7A 1VGQA 3OJLA 1TVKA 3BE4A 4GP7A 5D1NA 3TNYA 2NLOA 3DKIA 3QU5A 4GWGA 4OK3A 4B7UA 4RZUA 4TMXA 1IQPA 3A3OA 4GPZA 3FIJA 4WXRA 2BUBA 2WFAA 1WXEA 2IZ6A 4FNGA 3PNYA 4HUQB 4MROA 5DYWA 5EIAA 1SCNE 2GSWA 1E6KA 1XVUA 5B3KA 3EPHA 3VHXA 2O8DA 3AVPA 3IDFA 5CFZA 1TZMA 1ORDA 4FLFA 5JAQA 1HL3A 1PJRA 3Q7TA 4IDAA 5K3CA 3OD1A 4GG1A 4P33A 3W4IA 4KQXA 1PUJA 2PGNA 4BAUA 1BE6A 5LD2B 4G2NA 5JMTA 1S02A 2XWJI 1DG3A 1BA3A 3EZFA 1L8XA 3CJQA 3X44A 4CWAA 3P71T 3H84A 1XLTA 2IHNA 1Q0UA 1J07A 1X80A 5HE9A 1L5HA 4AG6A 2IH4A 4Z9BA 4J3FA 1LDYA 2QU7A 4OYLA 4BP8A 2IS1A 5CX4A 2QQ5A 1UJ4A 3QPBA 2WAYA 4G8CA 4L4XA 3L6UA 5IVIA 4H3KB 1EK0A 4F84A 4JQSA 3UWSA 5JNSA 1MFZA 2NPOA 1TZJA 4KXXA 1CR2A 4LDPA 4WVFA 4DCVA 2Z2IA 1KOJA 4ZEXA 1Q92A 3ONUA 4YUAA 5JZMA 4H15A 1R1DA 3KDPA 2FH5B 2X4IA 1UD6A 3DWFA 3MRVA 1RI4A 1RWMA 3A1TA 4WXMA 1LD3A 4C4PA 4CV3A 3NJ8A 2IA5A 2GBIA 3EG9B 3DXXA 4TSFD 3WWOA 3EAQA 1I0IA 3PLRA 4F8YA 4BZPA 4EBFA 1YNOA 2PMKA 2I9PA 2FX2A 1G8AA 2GJ9A 4NG4A 1V7CA 3EQ6A 1YVPA 2WM9B 4DCUA 5B6JA 2C8JA 5EKXA 4B2LA 5FWAA 4WBNF 5JSZB 1R66A 4A0HA 1J0BA 1WULS 2DOGA 4B73A 3W8NA 4LE2A 4B3FX 3ZI0A 3OZRA 4KX5A 4NL4H 3ICEA 2VCEA 2IDMA 1E79D 1H2XA 4NPCA 1QIHA 2PL3A 3L04A 3TFQA 1TTQB 5IJ0B 2M1ZA 4XLZA 4A2PA 3WO0A 1MR3F 1WOOA 3EOAI 3DZFA 4MMYB 1U6IA 3EZ2A 4WZBB 4FJ1A 4CIWA 5FEUA 4ZZ1A 3AJEA 2XQGA 5FH9A 4TOIA 4KBFA 4ARZB 3R9WA 4BN5A 1X7ZA 3D7SA 2ZVDA 2PZLA 4M0KA 2IX3A 1T9CA 3FMPB 4ZYYA 1XAJA 2CV0A 4RTSA 2G80A 3ZTTA 4C01A 3Q1LA 3DONA 1VLHA 3N7AA 4MUGA 2NUPA 4TWJA 1TC1A 4EG8A 1YU9A 4LTDA 4BO2A 5HFJA 3FMVA 4MO9A 1ZM4A 3OLVA 2GLUA 1XRNA 1KO1A 4OMDA 1AHNA 3SYTA 1ULZA 3IIKA 4IZHA 2V6FA 5EESA 3W8DA 5DN6D 3OZSA 2D2EA 3I61A 1OLUA 4W1PA 4UUOA 1GZ3A 1VYTA 4OGLA 3C5VA 7AT1A 3LY7A 1HE8B 1Z7YA 4INPA 1GCAA 2QTBA 3TQIA 4B81A 1R6DA 5JJKA 2WHEA 1P80A 3M1YA 3MJEA 3MOGA 2RONA 4NJMA 1CU1A 5EXXA 1LDBA 5HKKA 1PRYA 4ZO7A 2CCJA 2OP1A 2UVQA 1FXUA 4ENSA 1NULA 1T1SA 4PPFA 3A1DA 4WY8A 4ARVA 2CLDX 2G72A 2OB2A 3VPSA 3WFZA 2J87A 3CNOA 1UK8A 1CZNA 2H2DA 4LYDA 4WNCA 3V9AA 3KEFA 4MSUA 4IJUA 3E23A 4UATA 3VSBA 3FPSA 4PWZA 4GI3A 5K0NA 1LH0A 4CTJA 1XTSA 4YT4A 4DV4B 5IT4A 2BVNA 4V03A 1OV4A 2W2OA 3HO8A 3A8TA 1C50A 1UQRA 4X7RA 3TXXA 3UC9A 4DHWA 2WJ6A 2Y2UA 2E49A 4FQ5A 2ANBA 3QXXA 4S2UA 1WMFA 1GGEA 3EHDA 5IMBA 2QRKA 1ABBA 1OXKB 5KNDH 4M2LA 1EDBA 2OKGA 3WGNA 1A98A 2OLJA 5DK4A 2CMGA 4ALIA 2VJQA 3OZ7A 2X76A 4U2GA 3PGA1 1UDAA 1VP3A 4XD2A 4AKTA 5LP6F 3U4QA 2Y1OA 2CJWA 1FA9A 3EARA 3ENQA 4EX7A 5JHHB 3DVRX 4TXNA 3M5CA 1KI3A 4MI1A 1DBQA 1GA6A 2QYSA 4S1WA 3U4AA 2QLNA 4IBOA 1DOZA 3NALA 3ERCA 4ZXPA 1NASA 3FKSD 1ZNWA 2IYPA 5FL3A 2Y1LA 1SXGA 3GY0A 2W42A 1R10A 2ORWA 2ZB3A 2OM6A 4FI3C 4OPMA 2M32A 1J8YF 5KQPA 2PMFA 1CNEA 1K92A 1Z26A 2NPIA 2HK8A 3R7WB 2YJ4A 3TLJA 2VYNA 1L7VC 3OQMA 1F6BA 3I4FA 1D2EA 4OK5A 2OBTA 2A5FA 1VE3A 5DX0A 3UK0A 4QDUA 4B32A 2EARA 2R1VB 2DPHA 4WKNA 1EDOA 2AF4C 3LCUA 4G5QA 5FV4A 1LBHA 1ZVVA 1FFXA 2FPKA 3M8KA 3GPIA 4GKJB 3BFJA 3I2IA 4UAGA 2I4TA 4BFVA 3C7TA 3ZXYA 1QV9A 1AC5A 3EFOB 4WY2A 4RKYA 2ID4A 1ZS9A 1IM2A 1I33A 2QX7A 1DKRA 1IXZA 1TJPB 3KJXA 3WZMA 1K6IA 5CTJA 4D0RA 2CF4A 4EB8A 4ZI2A 1QQAA 5JNVA 3NHRA 1FE8A 3FRJA 3PFWO 3WSVA 4RV9A 5JWRA 1G6HA 2H1VA 3KPYA 3OURA 4EGFA 2E5FA 4WBNA 3AFMA 2FPOA 2J45A 3SC2A 2PZKA 1DAGA 5A2QA 1ATIA 4LF6B 5IP5A 1EGMB 1PZHA 2CUKA 1UEIA 3CEPB 2KBFA 5J43A 3H65A 4LSMA 2FRDA 2Q7DA 4C6TB 4WLVA 4BE9A 1I94B 2PKCA 5E0KB 2O1WA 3MWLA 4QUAA 3OIYA 2Y1DA 3IPAA 4RCYA 5KNLA 4CQMB 3D5TA 3CUYA 5A71A 4GF5A 4REQA 2IPLA 3ZHBA 2PZJA 3HH8A 2Y1GA 4RLQA 1U8EA 2IE0A 2WMDA 3HHPA 4Z53A 3AETB 2GNOA 3DQZA 2R6JA 1IQ0A 3MCUA 1IJEA 3IMCA 1SXJC 4M60A 4WBSA 2V7VA 1NKTA 3NEAA 3RWMB 2XXJA 1B93A 3I1FA 1N6IA 3DE4X 4RD0A 1JEQA 1EK1A 3WK6A 2Z98A 2ZXFA 4RDHA 2O6LA 2C9MA 3HNPA 3CR7A 2PWYA 4C4YA 1W35A 1E2FA 2IZ7A 5DSTA 3GDFA 4ETIA 2VNIA 2W2VA 1EVJA 1KDYA 1MMFB 5F5LA 4IJMA 3ADDA 2QRQA 3AJ8A 1P7ZA 3ZZUA 5TARA 3F6RA 1JHUA 1ZI9A 2W6ZA 3EZNA 3NEPX 1Z4KA 5CUQA 2HCJB 3ZD7A 3UMJA 2R7MA 2NV4A 4F45A 3GT0A 2X19A 4RACA 1K2WA 1DTWB 3LHKA 4LOLA 2I7DA 3GC6A 5LBTA 2YJ6A 1GDTA 4P53A 1JG3A 3RBZA 4IS3A 5KCZA 5HP4A 2GA9A 2B7LA 2H18A 4I0WB 3I6YA 3VMMA 1FRQA 4TSFA 3W2HA 1V1MA 2FWNA 3LNTA 1P2BA 3Q8XB 2HL6A 2OZLB 5CXXA 4DYDA 3DLBA 1P0PA 4YPOA 3CZRA 1V7PC 3A6PC 4MW0A 4ETMA 2PH7A 2FVGA 1RADA 3D3EA 1Q0SA 3VH2A 2ADFA 2N9UA 2ZUCA 4I50B 4RW0A 1OXBB 3R1IA 1RCUA 4X24A 3U7RA 2HU8A 4AKEA 1QOZA 1P81A 1T6BY 1Z39A 4ISCA 1LKZA 2N0SA 3E8XA 1M6YA 1TGVA 3FTPA 1PFYA 1XFDA 5DDIP 3S4YA 1Z4MA 1E9FA 1Y1LA 3UT5B 4CF3A 3UY4A 1H8ED 3DMTA 4BMDA 3A7EA 2IUSA 4KQ1A 4RTNA 3D8HA 2VH5R 1G42A 3SBDA 3H5WA 1CJUC 4AYWA 1V47A 4N9WA 1FLNA 2WW8A 3HP4A 4RZHA 2GBPA 4CL8A 1X42A 4GPTA 1XKTA 4O59O 4HDCA 4JIGA 5K3SA 2J9XB 2ZTSA 1LRJA 1QKIA 1AHHA 4YJGA 1QIKA 4BVKA 5I9NA 3L0ZA 3VXKA 5BSWA 2F59A 4RKRA 4GFDA 2CVQA 3TLYA 3DVAB 2AI3A 6ABPA 1H05A 2IEGA 7ABPA 1EGAA 4P4TA 1Z5WA 3JAKA 2HJGA 2YUTA 1ZX1A 5EJ4A 1JXMA 2WM2A 5BNFA 4YR7A 5DN6A 4LC0A 1NRWA 4BKPA 1QRUA 4PN7A 3W79A 3PJRA 4UCQA 2H1LA 4N8EA 1J49A 1EH5A 4JROA 5K8TA 4OBEA 3OWHA 4BAZA 4HXGA 5F7JA 4I1VA 3PS9A 1KEWA 3B5EA 1C8BA 2A0FA 4I99A 2YCLA 3KKQA 1CBUA 3W2IA 4JLMA 5F21A 3BTSA 1KQGA 4GRIA 3GAZA 4D9EA 1VQPB 4WGFA 3Q2KA 1UBMS 1FTSA 4U3JB 2GM9A 2R1UA 4FX2A 4TL8A 5C4MA 4L6AA 2Z8YM 4YH1A 3V9PA 1DC6A 1HUQA 3PWTA 4PO3X 3K9WA 4YMSA 4XTRA 3KYCA 3WL5A 3A05A 3PUHA 2VP2A 1JU9A 4MQ4A 3X3HA 5BN3B 4LECA 5SYAA 2C4WA 1SHTX 3PHBE 1GSIA 4X0EA 3K9FC 1PG0A 3ZJYA 2QVYX 4Y67A 4YJFB 2HIHA 4RHYA 2O48X 5LNK6 1WU8A 3OZWA 4O2LA 3CLKA 3NYIA 5G0VA 1CSEE 1CULC 2IHBA 4Q3CA 4TUYF 1IBMB 4PAGA 1FLVA 2ZXEA 3G0GA 3HB9A 3I01M 3KHKA 2H4WA 3NYQA 4AJNA 2QMZA 1NP7A 5BT9A 3TFOA 4OHKA 4WAUA 4P7JA 4YRFA 1ZM7A 1E92A 3LVFO 3KJFA 2JJYA 4ZI5A 1GG2A 4JFAA 1FP7A 1G8KA 1XD8A 1M54A 2XNKA 3FRHA 2ZS9A 1A2QA 5ENZA 3OTOB 1ZJYA 2R84A 3HCFA 4QREA 4OHOA 3X1JA 2WTBA 4J9UE 1G7RA 1X1AA 2QUBA 2QL9A 4RVHA 2VQEB 1U98A 1VE1A 2IYZA 3D8RA 4GKKB 3FKSA 1JR2A 3HJNA 2GN2A 1G2OA 1KGDA 1ND6A 1RXEA 3QOFA 4PF1A 4WACA 2GRJA 3RSFA 2WLTA 4F12A 4PG8A 2WJIA 2ZWPA 1SKBA 2AQHA 3C3KA 5CDGA 4BE7B 5HKOA 2QM0A 1ARZA 1V35A 3K9QO 3ZK7A 4YUXA 5GZ3A 1RC8A 3DAPA 2NADA 3LL4A 5T4HA 4KSBA 3AG5A 3N8HA 2B7BA 1RIFA 2GEFA 2OP0A 4O6VA 2G9UA 4MJLA 4Q19A 4BB9A 4ZCTA 1PJ5A 1TM4E 2Q1SA 2XW6A 5JFOA 2QEXB 1D5CA 3OOWA 4TV8B 1KE2A 4LW8A 4KR6A 5CH5A 1U2GA 2G9QA 2JGIA 1U0LA 4C29A 4WGGA 4ZMSA 3FDZA 1WOYA 2GJRA 4A6PA 2PRKA 3DYIA 4I9HA 5AXCA 3SSAA 3A3KA 3REOA 1M66A 4TN1A 4G1VA 2JH8A 3V00A 3GA0A 4EH1A 1WHTB 5AMXA 1MAAA 2FDRA 2H5JA 4UM5A 5D84A 1M1NA 1BAPA 2OGUA 1WCV1 4H1TA 3KU1A 3RM3A 3ZD6A 5F51A 1NE7A 1EJ0A 3QM1A 2B4KA 3C6YA 3QP9A 5AM1A 4D8TA 2L17A 3AESB 2A78A 2FPPB 4ES6A 4X66B 3K31A 2KMLA 1XUOA 1PLKA 3BFVA 1AUVA 4QLBA 4FWTA 1E43A 1KGSA 2DGDA 3KL4A 3M6VA 3MLEA 4L9RA 1U7HA 2FW0A 4WD3A 4WN3A 4XDHA 1A8SA 4F4DA 3BXPA 2XTMA 1JFVA 4PLCA 4FMPA 4TTQA 3WQQA 1Z82A 3LG2A 2WKQA 4R31A 1A8HA 3VFDA 2PE3A 4AY6A 1XQBA 3CNNA 1SKAA 1VQ7B 2WZBA 1NBWB 2O3JA 2PX2A 2Q6TA 2QDXA 2VHZA 3QHPA 5I4BA 1WD7A 4HNQA 2CV2A 2BELA 3DOIA 2JAUA 3EDRA 3LSYA 3O38A 3WNVA 4GZ5A 4X1KB 1WMAA 3IBGA 5AJXA 2P2SA 2DYKA 3V4SA 2O8BB 1SHJA 1ZJZA 1BFUA 4WZBA 3TD2A 1QCYA 3I55B 2Q5EA 1M3SA 1OA0A 1WB4A 2GD1O 4FIZA 1QC5B 5JNTA 4LNUA 3F3KA 4PIMA 4PZAA 4B3TB 4HE6A 1U0EA 2JLXA 3DNMA 1INLA 3R9XB 1SA0B 1MOPA 4UD2A 5HF9A 3OE5A 4QPCA 3ZU6A 5EGNA 3RIXA 3WP1B 5BPFA 2QJRA 2YASA 2XCQA 4I9UA 2F9MA 3SX0A 3V5NA 3E1YE 4HL6A 4DJJA 1U3CA 1VJ0A 4PANA 2OBRA 5DWDA 5LR6A 3TECE 2RBGA 13PKA 4MMZB 4W5TA 1NVXQ 1JDSA 3BRCA 5E6UB 3ZK9A 3KHUA 4K0RA 1VYUA 1TXGA 2BDTA 3MWGA 5CLLA 2CD7A 3SJ7A 4AZ0B 2ZCUA 1AQNA 2X5KO 2JFBA 1AF7A 1AB5A 5EMMA 4FFWA 2A1TR 2IGBA 1IAVA 3ASTA 4BFTA 3BQMB 4NKRA 2FA9A 2GH1A 3C0KA 4KGXA 3C45A 5K0TA 4Q9IA 3I0NA 1UOQA 3C85A 4I1IA 2WWHA 4M36A 1K7FB 2P1DA 4TQUS 3PA2A 1H2WA 4DV5B 2C2YA 4B6JA 3GJTA 1K86A 1O1YA 4QQRA 3VV2A 5A5DA 1G5QA 1ST3A 1A9XA 1C1DB 1NMXA 1EB9A 1WUKS 3DDYA 2O2JA 3VNSA 1XMSA 2RK6A 4CNBA 2HF8A 1AO3A 1UDWA 1GQYA 3R3WA 4NZOA 3GBPA 4TUYA 3TPZA 4PEVA 2YXPX 4I14A 3RRBA 1C8VB 4IOMA 3OQNA 2PRYA 3THWA 2ES4A 4IOJA 1W2HA 2HXYA 4ZCQA 2Z9DA 1FYDA 3VQTA 4IIVA