4FKDA

Identification of the activator binding residues in the second cysteine-rich regulatory domain of protein kinase c theta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C theta type
publication title Identification of the Activator Binding Residues in the Second Cysteine-Rich Regulatory Domain of Protein Kinase C Theta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4fkdA01
2ORVA 4L9MA 2QPOA 2E73A 1W4RA 2B8TA 2J87A 2J9RA 2ORWA 3UEYA 3E2IA 2UZ3A 1XX6A 2FNFX 4UXIA 3CXLA 4FKDA 1XA6A 4UXJA 3UEJA 2ROWA 5FUWA 2VRWB 1R79A 1KBFA 2DB6A 1TBOA 1PTQA 2ELIA 4B6DA 3UGDA 5FUYA 3UGLA 3UFFA 1RFHA 1KBEA 3BJIA 1XBTA 1FARA 2YUUA 3UGIA 1PTRA 5FUVA 2JA1A 2ENZA 1TBNA 2WVJA 2QQ0A 2QQEA 3KY9A 4UXHA 5FUXA 1FAQA 1Y8FA 2ENNA 2GVIA
chains in the Genus database with same CATH superfamily
1TBRR 5CCMA 1W3SA 1LR9A 1R0RI 2NU3I 5CCLA 2OZUA 1W4RA 3E2IA 3FSYA 2KMPA 1TBQR 4FKDA 1CT2I 2NU1I 2OD1A 2VRWB 4WP4A 1HJAI 1Y1CA 2E5RA 2V1CC 2V53A 2OU2A 2XRCA 2KCXA 4OVOA 2NU4I 1SGYI 3FSXA 2QQDA 3TJQA 3TO9A 1Z7KB 1LR8A 5J8FA 2KMRA 1HPTA 3OL0A 1U5KA 3FC3A 2NU0I 3TOAA 1SGNI 2ENZA 1TBNA 2WVJA 2QQ0A 3KY9A 4UXHA 4E1RA 3MEKA 4HGUA 1FYBA 1HEVA 3QTLD 1MJBA 1BMOA 1CGII 1OMTA 2LEOA 2B8TA 2J87A 5EX0A 3TOBA 1YU6C 1ULMA 3PDNA 3UEYA 2GIVA 1P9ZA 1PJUA 2JXDA 2OVOA 1TURA 3E59A 4AMLA 1XX6A 2DIPA 2FNFX 4UXIA 2X3TA 1Y1BA 3R5CA 3R5DA 4UXJA 3SEKC 3UEJA 2QQCA 5FUWA 5HQ8A 4JCVE 1R79A 2WGCA 1KBFA 3GOXA 2X52A 2Y0MA 1KMAA 3R5AA 1Y8FA 2KMOA 2WCYA 2SGEI 3D00A 4B6DA 5E3QA 5DAEA 1H0ZA 2M5XA 4E1PA 3UGLA 2W0TA 3SGBI 1UHAA 1K7UA 1RFHA 3BJIA 1MJAA 2YUUA 1TIHA 1VDDA 1SGDI 3B4VC 1YTPA 1SGQI 1OVOA 5E3RA 1SGEI 3RU0A 1NUBA 1WKXA 2QQEA 3VDUA 2B0UC 2A20A 2ENNA 2GVIA 2GKTI 4SGBI 3UOEA 2N71A 2ORVA 1FY7A 2QPOA 2N1AB 2SGFI 2E73A 1OMUA 2ORWA 2J9RA 1PCEA 3TO6A 2GKRI 1SGRI 2SGPI 2UZ3A 1ULNA 3CXLA 1ULKA 1XA6A 2ODDA 2ROWA 4A24A 2SGDI 2KMQA 2N17A 1OYVI 2JW6A 5E3PA 1X74A 2RC4A 3OVOA 2L7XA 1WGTA 3QWPA 7WGAA 3UGDA 2BUSA 2NU2I 2PQ8A 1P9GA 1WGCA 2SGQI 9WGAA 3TO7A 1CT0I 3OXGA 3OXLA 1XBTA 2N52A 3UGIA 2CWFA 1PTRA 2P6AC 2JA1A 1SGPI 3SGQI 1X4SA 2DKVA 2LB7A 5HI7A 2L8EA 2V1CA 3VE5A 3OXFA 1FAQA 1V1IA 2F3CI 5J8CA 1UVFA 3QAHA 3VDPA 4L9MA 5JHWC 1DS2I 1N13A 1Z2IA 3R5BA 1IW4A 5EX3A 1IY5A 2YQPA 1M8CA 1CHOI 1DS3I 2CWGA 1LR7A 2ARPF 1CT4I 1UVGA 4MPIA 4DNCA 1MT1A 2LUYA 2CWHA 1WTJA 4GI3C 1V1HA 2DB6A 1TBOA 2JYYA 1PTQA 1Q9BA 2CJSC 2ELIA 2RIJA 1TGSI 1HDLA 1CGJI 2GKVA 1K7VA 1K7TA 2JZMA 1CE3A 5FUYA 1IY6A 3UFFA 1KBEA 1AN1I 2K9HA 1FARA 1UUCA 1BUSA 1TOTA 5FUVA 3HH2C 1M8BA 1S20A 1MJ9A 1TUSA 2ERWA 5FUXA 1PPFI 1NXUA 1CSOI 2UVOA
chains in the Genus database with same CATH topology
1TBRR 5CCMA 1W3SA 1LR9A 1R0RI 2NU3I 5CCLA 1W4RA 3E2IA 2KMPA 1TBQR 4FKDA 1CT2I 2NU1I 2OD1A 2VRWB 1HJAI 1Y1CA 2E5RA 2V1CC 2V53A 2XRCA 2KCXA 4OVOA 2NU4I 1SGYI 2QQDA 3TJQA 1Z7KB 1LR8A 2KMRA 1HPTA 3OL0A 1U5KA 3FC3A 2NU0I 1SGNI 2ENZA 1TBNA 2WVJA 2QQ0A 3KY9A 4UXHA 4E1RA 3MEKA 4HGUA 1FYBA 3QTLD 1BMOA 1CGII 1OMTA 2LEOA 2B8TA 2J87A 5EX0A 3UEYA 1YU6C 3PDNA 2JXDA 1PJUA 2OVOA 1TURA 3E59A 1XX6A 2DIPA 2FNFX 4UXIA 1Y1BA 4UXJA 3SEKC 3UEJA 2QQCA 5FUWA 5HQ8A 4JCVE 1R79A 1KBFA 3GOXA 1KMAA 2KMOA 2WCYA 2SGEI 3D00A 4B6DA 5DAEA 1H0ZA 2M5XA 4E1PA 3UGLA 2W0TA 3SGBI 1RFHA 3BJIA 2YUUA 1TIHA 1VDDA 1SGDI 3B4VC 1YTPA 1SGQI 1OVOA 1SGEI 3RU0A 1NUBA 2QQEA 3VDUA 2B0UC 2A20A 2ENNA 2GVIA 2GKTI 4SGBI 2N71A 2ORVA 2QPOA 2N1AB 2SGFI 2E73A 1OMUA 2ORWA 2J9RA 1PCEA 2GKRI 1SGRI 2SGPI 2UZ3A 3CXLA 1XA6A 2ODDA 2ROWA 4A24A 2SGDI 2KMQA 2N17A 1OYVI 2JW6A 1X74A 3OVOA 2L7XA 3QWPA 3UGDA 2BUSA 2NU2I 2SGQI 1CT0I 3OXGA 3OXLA 1XBTA 2N52A 3UGIA 1PTRA 2P6AC 2JA1A 1SGPI 3SGQI 1X4SA 5HI7A 2L8EA 2V1CA 3VE5A 3OXFA 1FAQA 1V1IA 2F3CI 1UVFA 3VDPA 4L9MA 5JHWC 1DS2I 1N13A 1IY5A 1IW4A 5EX3A 2YQPA 1M8CA 1CHOI 1DS3I 1LR7A 2ARPF 1CT4I 1UVGA 1MT1A 2LUYA 4GI3C 1V1HA 2DB6A 1TBOA 2JYYA 1PTQA 2CJSC 2ELIA 1TGSI 1HDLA 1CGJI 2GKVA 2JZMA 1CE3A 1IY6A 5FUYA 3UFFA 1KBEA 1AN1I 2K9HA 1FARA 1UUCA 1BUSA 1TOTA 5FUVA 3HH2C 1M8BA 1TUSA 2ERWA 5FUXA 1PPFI 1Y8FA 1CSOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ORV A;  4L9M A;  2QPO A;  2E73 A;  1W4R A;  2B8T A;  2J87 A;  2J9R A;  2ORW A;  3UEY A;  3E2I A;  2UZ3 A;  1XX6 A;  2FNF X;  4UXI A;  3CXL A;  4FKD A;  1XA6 A;  4UXJ A;  3UEJ A;  2ROW A;  5FUW A;  2VRW B;  1R79 A;  1KBF A;  2DB6 A;  1TBO A;  1PTQ A;  2ELI A;  4B6D A;  3UGD A;  5FUY A;  3UGL A;  3UFF A;  1RFH A;  1KBE A;  3BJI A;  1XBT A;  1FAR A;  2YUU A;  3UGI A;  1PTR A;  5FUV A;  2JA1 A;  2ENZ A;  1TBN A;  2WVJ A;  2QQ0 A;  2QQE A;  3KY9 A;  4UXH A;  5FUX A;  1FAQ A;  1Y8F A;  2ENN A;  2GVI A; 
#chains in the Genus database with same CATH topology
 1TBR R;  5CCM A;  1W3S A;  1LR9 A;  1R0R I;  2NU3 I;  5CCL A;  2OZU A;  1W4R A;  3E2I A;  3FSY A;  2KMP A;  1TBQ R;  4FKD A;  1CT2 I;  2NU1 I;  2OD1 A;  2VRW B;  4WP4 A;  1HJA I;  1Y1C A;  2E5R A;  2V1C C;  2V53 A;  2OU2 A;  2XRC A;  2KCX A;  4OVO A;  2NU4 I;  1SGY I;  3FSX A;  2QQD A;  3TJQ A;  3TO9 A;  1Z7K B;  1LR8 A;  5J8F A;  2KMR A;  1HPT A;  3OL0 A;  1U5K A;  3FC3 A;  2NU0 I;  3TOA A;  1SGN I;  2ENZ A;  1TBN A;  2WVJ A;  2QQ0 A;  3KY9 A;  4UXH A;  4E1R A;  3MEK A;  4HGU A;  1FYB A;  1HEV A;  3QTL D;  1MJB A;  1BMO A;  1CGI I;  1OMT A;  2LEO A;  2B8T A;  2J87 A;  5EX0 A;  3TOB A;  1YU6 C;  1ULM A;  3PDN A;  3UEY A;  2GIV A;  1P9Z A;  1PJU A;  2JXD A;  2OVO A;  1TUR A;  3E59 A;  4AML A;  1XX6 A;  2DIP A;  2FNF X;  4UXI A;  2X3T A;  1Y1B A;  3R5C A;  3R5D A;  4UXJ A;  3SEK C;  3UEJ A;  2QQC A;  5FUW A;  5HQ8 A;  4JCV E;  1R79 A;  2WGC A;  1KBF A;  3GOX A;  2X52 A;  2Y0M A;  1KMA A;  3R5A A;  1Y8F A;  2KMO A;  2WCY A;  2SGE I;  3D00 A;  4B6D A;  5E3Q A;  5DAE A;  1H0Z A;  2M5X A;  4E1P A;  3UGL A;  2W0T A;  3SGB I;  1UHA A;  1K7U A;  1RFH A;  3BJI A;  1MJA A;  2YUU A;  1TIH A;  1VDD A;  1SGD I;  3B4V C;  1YTP A;  1SGQ I;  1OVO A;  5E3R A;  1SGE I;  3RU0 A;  1NUB A;  1WKX A;  2QQE A;  3VDU A;  2B0U C;  2A20 A;  2ENN A;  2GVI A;  2GKT I;  4SGB I;  3UOE A;  2N71 A;  2ORV A;  1FY7 A;  2QPO A;  2N1A B;  2SGF I;  2E73 A;  1OMU A;  2ORW A;  2J9R A;  1PCE A;  3TO6 A;  2GKR I;  1SGR I;  2SGP I;  2UZ3 A;  1ULN A;  3CXL A;  1ULK A;  1XA6 A;  2ODD A;  2ROW A;  4A24 A;  2SGD I;  2KMQ A;  2N17 A;  1OYV I;  2JW6 A;  5E3P A;  1X74 A;  2RC4 A;  3OVO A;  2L7X A;  1WGT A;  3QWP A;  7WGA A;  3UGD A;  2BUS A;  2NU2 I;  2PQ8 A;  1P9G A;  1WGC A;  2SGQ I;  9WGA A;  3TO7 A;  1CT0 I;  3OXG A;  3OXL A;  1XBT A;  2N52 A;  3UGI A;  2CWF A;  1PTR A;  2P6A C;  2JA1 A;  1SGP I;  3SGQ I;  1X4S A;  2DKV A;  2LB7 A;  5HI7 A;  2L8E A;  2V1C A;  3VE5 A;  3OXF A;  1FAQ A;  1V1I A;  2F3C I;  5J8C A;  1UVF A;  3QAH A;  3VDP A;  4L9M A;  5JHW C;  1DS2 I;  1N13 A;  1Z2I A;  3R5B A;  1IW4 A;  5EX3 A;  1IY5 A;  2YQP A;  1M8C A;  1CHO I;  1DS3 I;  2CWG A;  1LR7 A;  2ARP F;  1CT4 I;  1UVG A;  4MPI A;  4DNC A;  1MT1 A;  2LUY A;  2CWH A;  1WTJ A;  4GI3 C;  1V1H A;  2DB6 A;  1TBO A;  2JYY A;  1PTQ A;  1Q9B A;  2CJS C;  2ELI A;  2RIJ A;  1TGS I;  1HDL A;  1CGJ I;  2GKV A;  1K7V A;  1K7T A;  2JZM A;  1CE3 A;  5FUY A;  1IY6 A;  3UFF A;  1KBE A;  1AN1 I;  2K9H A;  1FAR A;  1UUC A;  1BUS A;  1TOT A;  5FUV A;  3HH2 C;  1M8B A;  1S20 A;  1MJ9 A;  1TUS A;  2ERW A;  5FUX A;  1PPF I;  1NXU A;  1CSO I;  2UVO A; 
#chains in the Genus database with same CATH homology
 1TBR R;  5CCM A;  1W3S A;  1LR9 A;  1R0R I;  2NU3 I;  5CCL A;  1W4R A;  3E2I A;  2KMP A;  1TBQ R;  4FKD A;  1CT2 I;  2NU1 I;  2OD1 A;  2VRW B;  1HJA I;  1Y1C A;  2E5R A;  2V1C C;  2V53 A;  2XRC A;  2KCX A;  4OVO A;  2NU4 I;  1SGY I;  2QQD A;  3TJQ A;  1Z7K B;  1LR8 A;  2KMR A;  1HPT A;  3OL0 A;  1U5K A;  3FC3 A;  2NU0 I;  1SGN I;  2ENZ A;  1TBN A;  2WVJ A;  2QQ0 A;  3KY9 A;  4UXH A;  4E1R A;  3MEK A;  4HGU A;  1FYB A;  3QTL D;  1BMO A;  1CGI I;  1OMT A;  2LEO A;  2B8T A;  2J87 A;  5EX0 A;  3UEY A;  1YU6 C;  3PDN A;  2JXD A;  1PJU A;  2OVO A;  1TUR A;  3E59 A;  1XX6 A;  2DIP A;  2FNF X;  4UXI A;  1Y1B A;  4UXJ A;  3SEK C;  3UEJ A;  2QQC A;  5FUW A;  5HQ8 A;  4JCV E;  1R79 A;  1KBF A;  3GOX A;  1KMA A;  2KMO A;  2WCY A;  2SGE I;  3D00 A;  4B6D A;  5DAE A;  1H0Z A;  2M5X A;  4E1P A;  3UGL A;  2W0T A;  3SGB I;  1RFH A;  3BJI A;  2YUU A;  1TIH A;  1VDD A;  1SGD I;  3B4V C;  1YTP A;  1SGQ I;  1OVO A;  1SGE I;  3RU0 A;  1NUB A;  2QQE A;  3VDU A;  2B0U C;  2A20 A;  2ENN A;  2GVI A;  2GKT I;  4SGB I;  2N71 A;  2ORV A;  2QPO A;  2N1A B;  2SGF I;  2E73 A;  1OMU A;  2ORW A;  2J9R A;  1PCE A;  2GKR I;  1SGR I;  2SGP I;  2UZ3 A;  3CXL A;  1XA6 A;  2ODD A;  2ROW A;  4A24 A;  2SGD I;  2KMQ A;  2N17 A;  1OYV I;  2JW6 A;  1X74 A;  3OVO A;  2L7X A;  3QWP A;  3UGD A;  2BUS A;  2NU2 I;  2SGQ I;  1CT0 I;  3OXG A;  3OXL A;  1XBT A;  2N52 A;  3UGI A;  1PTR A;  2P6A C;  2JA1 A;  1SGP I;  3SGQ I;  1X4S A;  5HI7 A;  2L8E A;  2V1C A;  3VE5 A;  3OXF A;  1FAQ A;  1V1I A;  2F3C I;  1UVF A;  3VDP A;  4L9M A;  5JHW C;  1DS2 I;  1N13 A;  1IY5 A;  1IW4 A;  5EX3 A;  2YQP A;  1M8C A;  1CHO I;  1DS3 I;  1LR7 A;  2ARP F;  1CT4 I;  1UVG A;  1MT1 A;  2LUY A;  4GI3 C;  1V1H A;  2DB6 A;  1TBO A;  2JYY A;  1PTQ A;  2CJS C;  2ELI A;  1TGS I;  1HDL A;  1CGJ I;  2GKV A;  2JZM A;  1CE3 A;  1IY6 A;  5FUY A;  3UFF A;  1KBE A;  1AN1 I;  2K9H A;  1FAR A;  1UUC A;  1BUS A;  1TOT A;  5FUV A;  3HH2 C;  1M8B A;  1TUS A;  2ERW A;  5FUX A;  1PPF I;  1Y8F A;  1CSO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...