4FKDA

Identification of the activator binding residues in the second cysteine-rich regulatory domain of protein kinase c theta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Activator Binding Residues in the Second Cysteine-Rich Regulatory Domain of Protein Kinase C Theta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Protein kinase C theta type
total genus 11
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4fkdA01
5FUVA 1XA6A 1TBNA 1RFHA 3UEYA 4B6DA 2B8TA 1KBFA 2ENNA 3UGDA 2ENZA 2ROWA 1PTQA 2J9RA 2VRWB 3KY9A 2ELIA 2WVJA 3UGIA 2JA1A 2FNFX 4UXJA 5FUXA 3BJIA 2UZ3A 4L9MA 1TBOA 1FAQA 2QQ0A 1XBTA 2ORWA 5FUYA 3UEJA 2E73A 3CXLA 3UGLA 1PTRA 2J87A 2YUUA 3UFFA 5FUWA 1W4RA 2DB6A 1FARA 3E2IA 2QQEA 1KBEA 2QPOA 1R79A 2ORVA 4FKDA 1XX6A 4UXIA 4UXHA 2GVIA 1Y8FA
chains in the Genus database with same CATH superfamily
1FY7A 1FYBA 1XA6A 4A24A 2SGDI 2NU3I 2SGEI 1LR7A 1P9GA 1OYVI 1YTPA 1MJBA 3E59A 1PPFI 1IY6A 3FC3A 2WGCA 1WGTA 2VRWB 1TIHA 1TURA 1UVGA 1OMUA 2ERWA 2GKVA 2JXDA 3HH2C 1Z7KB 1SGYI 1SGPI 3TO6A 2QQ0A 1K7VA 2E73A 2QQDA 3SGBI 2J87A 2GIVA 2UVOA 1TUSA 5HQ8A 3TOBA 1Q9BA 3TO7A 3R5CA 3VDUA 2QQEA 1UUCA 2QPOA 5J8CA 2V1CA 5E3QA 1YU6C 1MJAA 3R5AA 5HI7A 2NU1I 3TJQA 1TBRR 2JW6A 2GVIA 5J8FA 2JA1A 4JCVE 2QQCA 1CT2I 2B8TA 3OXGA 1CGII 2ENNA 2K9HA 5EX3A 1PCEA 1M8BA 3UGDA 5DAEA 3B4VC 1DS2I 4SGBI 3KY9A 2WCYA 1W3SA 3R5BA 1Y1CA 5E3PA 1CGJI 2SGQI 4UXJA 1IW4A 1H0ZA 2UZ3A 5CCLA 2V53A 1HEVA 1TBOA 2N52A 5E3RA 1P9ZA 1SGQI 3UEJA 3RU0A 3UGLA 2L8EA 1CSOI 2BUSA 2P6AC 5FUWA 1W4RA 4DNCA 2B0UC 1CHOI 2NU0I 1ULKA 1V1HA 3SGQI 3OXFA 1AN1I 4E1PA 1MT1A 1XX6A 1PJUA 2CJSC 1K7UA 2LEOA 3D00A 1HPTA 2SGPI 5FUVA 1CT4I 1TBNA 1ULMA 3OVOA 1X4SA 4OVOA 2NU4I 2JYYA 2X3TA 1UHAA 2ROWA 1NUBA 1PTQA 1Z2IA 2J9RA 4WP4A 2GKTI 2ARPF 2N71A 5FUXA 3BJIA 1R0RI 3FSYA 2OZUA 3UOEA 1KMAA 2KMPA 2RIJA 2N17A 1N13A 1LR8A 2ORWA 1SGDI 3UFFA 4B6DA 1TBQR 4AMLA 1WKXA 2OD1A 3VDPA 4E1RA 2V1CC 3R5DA 2E5RA 2Y0MA 4FKDA 1ULNA 2DKVA 1HDLA 2RC4A 1CE3A 1HJAI 2N1AB 2CWHA 2CWGA 1WGCA 2ODDA 4UXIA 2KMQA 2OVOA 2PQ8A 1WTJA 1NXUA 2OU2A 2NU2I 1Y8FA 1OVOA 3UEYA 1RFHA 7WGAA 2KMRA 1KBFA 1SGNI 4HGUA 3QTLD 2A20A 2SGFI 3QWPA 2ENZA 3TO9A 1U5KA 2CWFA 3MEKA 2KMOA 3OL0A 5EX0A 1DS3I 2YQPA 3SEKC 3TOAA 3GOXA 1IY5A 2ELIA 1VDDA 2WVJA 4MPIA 3UGIA 2FNFX 2L7XA 1BUSA 2KCXA 2LB7A 4L9MA 2DIPA 2W0TA 1X74A 2LUYA 1FAQA 1SGRI 1UVFA 5JHWC 1XBTA 5FUYA 1M8CA 3CXLA 1MJ9A 5CCMA 1PTRA 1Y1BA 2GKRI 2YUUA 2DB6A 1TGSI 1S20A 1FARA 1OMTA 1LR9A 2M5XA 1BMOA 2X52A 1K7TA 3E2IA 3PDNA 1KBEA 1V1IA 3FSXA 1R79A 2ORVA 3VE5A 2JZMA 3QAHA 2F3CI 9WGAA 3OXLA 4UXHA 2XRCA 1TOTA 1CT0I 4GI3C 1SGEI
chains in the Genus database with same CATH topology
1FYBA 1XA6A 4A24A 2SGDI 2NU3I 2SGEI 1LR7A 1YTPA 1OYVI 3E59A 1PPFI 1IY6A 3FC3A 2VRWB 1TIHA 1TURA 1UVGA 1OMUA 2ERWA 2GKVA 2JXDA 3HH2C 1Z7KB 1SGYI 1SGPI 2QQ0A 2E73A 2QQDA 3SGBI 2J87A 1TUSA 5HQ8A 3VDUA 2QQEA 1UUCA 2QPOA 2V1CA 1YU6C 5HI7A 2NU1I 3TJQA 1TBRR 2JW6A 2GVIA 2JA1A 4JCVE 2QQCA 1CT2I 2B8TA 3OXGA 1CGII 2ENNA 2K9HA 5EX3A 1PCEA 1M8BA 3UGDA 5DAEA 3B4VC 1DS2I 4SGBI 3KY9A 2WCYA 1W3SA 1Y1CA 1CGJI 2SGQI 4UXJA 1IW4A 1H0ZA 2UZ3A 5CCLA 2V53A 1TBOA 2N52A 1SGQI 3UEJA 3RU0A 3UGLA 2L8EA 1CSOI 2BUSA 2P6AC 5FUWA 1W4RA 2B0UC 1CHOI 2NU0I 1V1HA 3SGQI 3OXFA 1AN1I 4E1PA 1MT1A 1XX6A 1PJUA 2CJSC 2LEOA 3D00A 1HPTA 2SGPI 5FUVA 1CT4I 1TBNA 3OVOA 1X4SA 4OVOA 2NU4I 2JYYA 2ROWA 1NUBA 1PTQA 2J9RA 2GKTI 2ARPF 2N71A 5FUXA 3BJIA 1R0RI 1KMAA 2KMPA 2N17A 1N13A 1LR8A 2ORWA 1SGDI 3UFFA 4B6DA 1TBQR 2OD1A 4E1RA 3VDPA 2V1CC 2E5RA 4FKDA 1HDLA 1CE3A 1HJAI 2N1AB 2ODDA 4UXIA 2KMQA 2OVOA 2NU2I 1Y8FA 1OVOA 3UEYA 1RFHA 2KMRA 1KBFA 1SGNI 4HGUA 3QTLD 2A20A 2SGFI 3QWPA 2ENZA 1U5KA 3MEKA 5EX0A 2KMOA 3OL0A 3SEKC 1DS3I 2YQPA 3GOXA 1IY5A 2ELIA 1VDDA 2WVJA 3UGIA 2FNFX 2L7XA 1BUSA 2KCXA 4L9MA 2DIPA 2W0TA 1X74A 2LUYA 1FAQA 1SGRI 1UVFA 5JHWC 1XBTA 5FUYA 1M8CA 3CXLA 5CCMA 1PTRA 1Y1BA 2GKRI 2YUUA 2DB6A 1TGSI 1FARA 1OMTA 1LR9A 2M5XA 1BMOA 3E2IA 3PDNA 1KBEA 1V1IA 1R79A 2ORVA 3VE5A 2JZMA 2F3CI 3OXLA 4UXHA 2XRCA 1TOTA 1CT0I 4GI3C 1SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUV A;  1XA6 A;  1TBN A;  1RFH A;  3UEY A;  4B6D A;  2B8T A;  1KBF A;  2ENN A;  3UGD A;  2ENZ A;  2ROW A;  1PTQ A;  2J9R A;  2VRW B;  3KY9 A;  2ELI A;  2WVJ A;  3UGI A;  2JA1 A;  2FNF X;  4UXJ A;  5FUX A;  3BJI A;  2UZ3 A;  4L9M A;  1TBO A;  1FAQ A;  2QQ0 A;  1XBT A;  2ORW A;  5FUY A;  3UEJ A;  2E73 A;  3CXL A;  3UGL A;  1PTR A;  2J87 A;  2YUU A;  3UFF A;  5FUW A;  1W4R A;  2DB6 A;  1FAR A;  3E2I A;  2QQE A;  1KBE A;  2QPO A;  1R79 A;  2ORV A;  4FKD A;  1XX6 A;  4UXI A;  4UXH A;  2GVI A;  1Y8F A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  1FYB A;  1XA6 A;  4A24 A;  2SGD I;  2NU3 I;  2SGE I;  1LR7 A;  1P9G A;  1OYV I;  1YTP A;  1MJB A;  3E59 A;  1PPF I;  1IY6 A;  3FC3 A;  2WGC A;  1WGT A;  2VRW B;  1TIH A;  1TUR A;  1UVG A;  1OMU A;  2ERW A;  2GKV A;  2JXD A;  3HH2 C;  1Z7K B;  1SGY I;  1SGP I;  3TO6 A;  2QQ0 A;  1K7V A;  2E73 A;  2QQD A;  3SGB I;  2J87 A;  2GIV A;  2UVO A;  1TUS A;  5HQ8 A;  3TOB A;  1Q9B A;  3TO7 A;  3R5C A;  3VDU A;  2QQE A;  1UUC A;  2QPO A;  5J8C A;  2V1C A;  5E3Q A;  1YU6 C;  1MJA A;  3R5A A;  5HI7 A;  2NU1 I;  3TJQ A;  1TBR R;  2JW6 A;  2GVI A;  5J8F A;  2JA1 A;  4JCV E;  2QQC A;  1CT2 I;  2B8T A;  3OXG A;  1CGI I;  2ENN A;  2K9H A;  5EX3 A;  1PCE A;  1M8B A;  3UGD A;  5DAE A;  3B4V C;  1DS2 I;  4SGB I;  3KY9 A;  2WCY A;  1W3S A;  3R5B A;  1Y1C A;  5E3P A;  1CGJ I;  2SGQ I;  4UXJ A;  1IW4 A;  1H0Z A;  2UZ3 A;  5CCL A;  2V53 A;  1HEV A;  1TBO A;  2N52 A;  5E3R A;  1P9Z A;  1SGQ I;  3UEJ A;  3RU0 A;  3UGL A;  2L8E A;  1CSO I;  2BUS A;  2P6A C;  5FUW A;  1W4R A;  4DNC A;  2B0U C;  1CHO I;  2NU0 I;  1ULK A;  1V1H A;  3SGQ I;  3OXF A;  1AN1 I;  4E1P A;  1MT1 A;  1XX6 A;  1PJU A;  2CJS C;  1K7U A;  2LEO A;  3D00 A;  1HPT A;  2SGP I;  5FUV A;  1CT4 I;  1TBN A;  1ULM A;  3OVO A;  1X4S A;  4OVO A;  2NU4 I;  2JYY A;  2X3T A;  1UHA A;  2ROW A;  1NUB A;  1PTQ A;  1Z2I A;  2J9R A;  4WP4 A;  2GKT I;  2ARP F;  2N71 A;  5FUX A;  3BJI A;  1R0R I;  3FSY A;  2OZU A;  3UOE A;  1KMA A;  2KMP A;  2RIJ A;  2N17 A;  1N13 A;  1LR8 A;  2ORW A;  1SGD I;  3UFF A;  4B6D A;  1TBQ R;  4AML A;  1WKX A;  2OD1 A;  3VDP A;  4E1R A;  2V1C C;  3R5D A;  2E5R A;  2Y0M A;  4FKD A;  1ULN A;  2DKV A;  1HDL A;  2RC4 A;  1CE3 A;  1HJA I;  2N1A B;  2CWH A;  2CWG A;  1WGC A;  2ODD A;  4UXI A;  2KMQ A;  2OVO A;  2PQ8 A;  1WTJ A;  1NXU A;  2OU2 A;  2NU2 I;  1Y8F A;  1OVO A;  3UEY A;  1RFH A;  7WGA A;  2KMR A;  1KBF A;  1SGN I;  4HGU A;  3QTL D;  2A20 A;  2SGF I;  3QWP A;  2ENZ A;  3TO9 A;  1U5K A;  2CWF A;  3MEK A;  2KMO A;  3OL0 A;  5EX0 A;  1DS3 I;  2YQP A;  3SEK C;  3TOA A;  3GOX A;  1IY5 A;  2ELI A;  1VDD A;  2WVJ A;  4MPI A;  3UGI A;  2FNF X;  2L7X A;  1BUS A;  2KCX A;  2LB7 A;  4L9M A;  2DIP A;  2W0T A;  1X74 A;  2LUY A;  1FAQ A;  1SGR I;  1UVF A;  5JHW C;  1XBT A;  5FUY A;  1M8C A;  3CXL A;  1MJ9 A;  5CCM A;  1PTR A;  1Y1B A;  2GKR I;  2YUU A;  2DB6 A;  1TGS I;  1S20 A;  1FAR A;  1OMT A;  1LR9 A;  2M5X A;  1BMO A;  2X52 A;  1K7T A;  3E2I A;  3PDN A;  1KBE A;  1V1I A;  3FSX A;  1R79 A;  2ORV A;  3VE5 A;  2JZM A;  3QAH A;  2F3C I;  9WGA A;  3OXL A;  4UXH A;  2XRC A;  1TOT A;  1CT0 I;  4GI3 C;  1SGE I; 
#chains in the Genus database with same CATH homology
 1FYB A;  1XA6 A;  4A24 A;  2SGD I;  2NU3 I;  2SGE I;  1LR7 A;  1YTP A;  1OYV I;  3E59 A;  1PPF I;  1IY6 A;  3FC3 A;  2VRW B;  1TIH A;  1TUR A;  1UVG A;  1OMU A;  2ERW A;  2GKV A;  2JXD A;  3HH2 C;  1Z7K B;  1SGY I;  1SGP I;  2QQ0 A;  2E73 A;  2QQD A;  3SGB I;  2J87 A;  1TUS A;  5HQ8 A;  3VDU A;  2QQE A;  1UUC A;  2QPO A;  2V1C A;  1YU6 C;  5HI7 A;  2NU1 I;  3TJQ A;  1TBR R;  2JW6 A;  2GVI A;  2JA1 A;  4JCV E;  2QQC A;  1CT2 I;  2B8T A;  3OXG A;  1CGI I;  2ENN A;  2K9H A;  5EX3 A;  1PCE A;  1M8B A;  3UGD A;  5DAE A;  3B4V C;  1DS2 I;  4SGB I;  3KY9 A;  2WCY A;  1W3S A;  1Y1C A;  1CGJ I;  2SGQ I;  4UXJ A;  1IW4 A;  1H0Z A;  2UZ3 A;  5CCL A;  2V53 A;  1TBO A;  2N52 A;  1SGQ I;  3UEJ A;  3RU0 A;  3UGL A;  2L8E A;  1CSO I;  2BUS A;  2P6A C;  5FUW A;  1W4R A;  2B0U C;  1CHO I;  2NU0 I;  1V1H A;  3SGQ I;  3OXF A;  1AN1 I;  4E1P A;  1MT1 A;  1XX6 A;  1PJU A;  2CJS C;  2LEO A;  3D00 A;  1HPT A;  2SGP I;  5FUV A;  1CT4 I;  1TBN A;  3OVO A;  1X4S A;  4OVO A;  2NU4 I;  2JYY A;  2ROW A;  1NUB A;  1PTQ A;  2J9R A;  2GKT I;  2ARP F;  2N71 A;  5FUX A;  3BJI A;  1R0R I;  1KMA A;  2KMP A;  2N17 A;  1N13 A;  1LR8 A;  2ORW A;  1SGD I;  3UFF A;  4B6D A;  1TBQ R;  2OD1 A;  4E1R A;  3VDP A;  2V1C C;  2E5R A;  4FKD A;  1HDL A;  1CE3 A;  1HJA I;  2N1A B;  2ODD A;  4UXI A;  2KMQ A;  2OVO A;  2NU2 I;  1Y8F A;  1OVO A;  3UEY A;  1RFH A;  2KMR A;  1KBF A;  1SGN I;  4HGU A;  3QTL D;  2A20 A;  2SGF I;  3QWP A;  2ENZ A;  1U5K A;  3MEK A;  5EX0 A;  2KMO A;  3OL0 A;  3SEK C;  1DS3 I;  2YQP A;  3GOX A;  1IY5 A;  2ELI A;  1VDD A;  2WVJ A;  3UGI A;  2FNF X;  2L7X A;  1BUS A;  2KCX A;  4L9M A;  2DIP A;  2W0T A;  1X74 A;  2LUY A;  1FAQ A;  1SGR I;  1UVF A;  5JHW C;  1XBT A;  5FUY A;  1M8C A;  3CXL A;  5CCM A;  1PTR A;  1Y1B A;  2GKR I;  2YUU A;  2DB6 A;  1TGS I;  1FAR A;  1OMT A;  1LR9 A;  2M5X A;  1BMO A;  3E2I A;  3PDN A;  1KBE A;  1V1I A;  1R79 A;  2ORV A;  3VE5 A;  2JZM A;  2F3C I;  3OXL A;  4UXH A;  2XRC A;  1TOT A;  1CT0 I;  4GI3 C;  1SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...