4FKDA

Identification of the activator binding residues in the second cysteine-rich regulatory domain of protein kinase c theta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C theta type
publication title Identification of the Activator Binding Residues in the Second Cysteine-Rich Regulatory Domain of Protein Kinase C Theta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4fkdA01
1XBTA 2ORVA 2DB6A 3CXLA 5FUXA 3BJIA 4L9MA 2ORWA 2E73A 3UEYA 2FNFX 2J9RA 3UGDA 2UZ3A 5FUWA 3UFFA 2B8TA 2J87A 2YUUA 3KY9A 1FAQA 1R79A 4FKDA 3UEJA 1RFHA 4UXJA 3UGLA 4UXIA 5FUVA 2ELIA 2JA1A 1KBFA 2ENZA 2VRWB 4UXHA 1TBOA 1XX6A 2GVIA 1XA6A 2ENNA 1W4RA 3E2IA 2ROWA 1Y8FA 2WVJA 2QQ0A 1KBEA 1PTQA 1FARA 3UGIA 4B6DA 1TBNA 2QPOA 1PTRA 2QQEA 5FUYA
chains in the Genus database with same CATH superfamily
1YU6C 5DAEA 2SGPI 2DB6A 1CGJI 2N52A 3R5CA 7WGAA 2CWHA 2SGQI 2E73A 2V1CA 1H0ZA 2L8EA 1IY5A 2CJSC 2J9RA 2ODDA 5FUWA 1HJAI 3UFFA 1ULKA 1U5KA 1NUBA 1X74A 1Y1BA 1Q9BA 2OVOA 2V1CC 2WGCA 4E1PA 2OD1A 1R79A 2KCXA 4FKDA 3E59A 5HI7A 3RU0A 1PJUA 1V1IA 1SGQI 1TBQR 9WGAA 2JW6A 5FUVA 2LB7A 2SGDI 1Z7KB 2JXDA 1M8BA 1HDLA 2GVIA 1SGYI 1K7TA 1N13A 2F3CI 1UVGA 1UVFA 2BUSA 1SGRI 2WVJA 1LR9A 4B6DA 5E3RA 3OVOA 2GKTI 2NU0I 3D00A 5FUYA 2CWGA 1YTPA 1IW4A 1SGDI 2N17A 3OXGA 1WGTA 1PCEA 1IY6A 2JYYA 5J8CA 3UOEA 2XRCA 2YUUA 2K9HA 3FSXA 2QQCA 1HPTA 3B4VC 2NU2I 2GKRI 1RFHA 4UXJA 5EX3A 3UGLA 4UXIA 2JZMA 1KMAA 2ENZA 3R5BA 1X4SA 1UUCA 2VRWB 2GKVA 4UXHA 1MJAA 4A24A 2ENNA 3FC3A 4AMLA 4MPIA 1MJBA 1LR7A 2ROWA 1P9ZA 3HH2C 1TUSA 2ARPF 1Z2IA 1WGCA 1CGII 2NU1I 2L7XA 5EX0A 3UGIA 1TBRR 3TOBA 4DNCA 2X52A 5J8FA 3GOXA 3SEKC 1K7UA 1CE3A 4E1RA 1Y1CA 1CSOI 2N1AB 3OXLA 1FYBA 1XBTA 1CT0I 2X3TA 3CXLA 5FUXA 2N71A 1OVOA 1DS2I 2ORWA 1FY7A 4L9MA 1LR8A 1TOTA 2B0UC 2DKVA 2NU3I 2SGFI 3MEKA 2DIPA 2UVOA 2LUYA 1DS3I 1OYVI 2J87A 2ERWA 2WCYA 1HEVA 1TGSI 5HQ8A 2KMOA 1V1HA 1SGPI 1TIHA 1MT1A 3QAHA 1CT4I 3R5DA 2ELIA 2JA1A 3SGQI 1KBFA 2E5RA 4OVOA 5JHWC 3TO7A 2SGEI 1W4RA 5CCMA 2CWFA 5CCLA 2GIVA 1BUSA 2RIJA 2KMRA 1KBEA 2A20A 1P9GA 2M5XA 1K7VA 3TOAA 1WKXA 1TBNA 2QPOA 2QQDA 1UHAA 1VDDA 3OXFA 4HGUA 2KMQA 2QQEA 2RC4A 2YQPA 3FSYA 3QTLD 4JCVE 5E3QA 3TO6A 2ORVA 3BJIA 2LEOA 3QWPA 3TO9A 4GI3C 5E3PA 2FNFX 3UEYA 3UGDA 2UZ3A 1NXUA 1PPFI 2OZUA 2V53A 1M8CA 2B8TA 2NU4I 1FAQA 3KY9A 1AN1I 3UEJA 2KMPA 3R5AA 2W0TA 4WP4A 1OMUA 1S20A 1OMTA 1TBOA 3SGBI 1XX6A 3VDUA 2Y0MA 1XA6A 2P6AC 3E2IA 3TJQA 4SGBI 1R0RI 1TURA 3OL0A 3PDNA 1BMOA 1Y8FA 1CHOI 2QQ0A 1PTQA 1FARA 2OU2A 1SGNI 1W3SA 3VDPA 3VE5A 1WTJA 1ULMA 1ULNA 1CT2I 1PTRA 1SGEI 1MJ9A 2PQ8A
chains in the Genus database with same CATH topology
1YU6C 5DAEA 2SGPI 2DB6A 1CGJI 2N52A 1H0ZA 2SGQI 2V1CA 2E73A 2L8EA 1IY5A 2CJSC 2J9RA 2ODDA 5FUWA 1HJAI 3UFFA 1Y1BA 1U5KA 1NUBA 1X74A 2OVOA 2V1CC 4E1PA 2OD1A 1R79A 2KCXA 4FKDA 3E59A 5HI7A 3RU0A 1PJUA 1V1IA 1SGQI 1TBQR 2JW6A 5FUVA 2SGDI 1Z7KB 2JXDA 1M8BA 1HDLA 2GVIA 1SGYI 1N13A 2F3CI 2BUSA 1UVFA 1UVGA 1SGRI 2WVJA 1LR9A 4B6DA 3OVOA 2GKTI 2NU0I 3D00A 5FUYA 1YTPA 1IW4A 1SGDI 2N17A 3OXGA 1PCEA 1IY6A 2JYYA 2XRCA 2YUUA 2K9HA 2QQCA 1HPTA 3B4VC 2NU2I 2GKRI 1RFHA 4UXJA 5EX3A 3UGLA 4UXIA 2JZMA 1KMAA 2ENZA 1X4SA 1UUCA 2VRWB 2GKVA 4UXHA 4A24A 2ENNA 3FC3A 2ROWA 1LR7A 3HH2C 2ARPF 1TUSA 2NU1I 1CGII 5EX0A 3UGIA 2L7XA 1TBRR 3GOXA 3SEKC 1CE3A 1FYBA 4E1RA 1Y1CA 1CSOI 2N1AB 3OXLA 1XBTA 1CT0I 3CXLA 5FUXA 2N71A 1OVOA 1DS2I 2ORWA 4L9MA 1LR8A 1TOTA 2B0UC 2NU3I 2SGFI 3MEKA 2DIPA 2LUYA 1DS3I 1OYVI 2J87A 2ERWA 2WCYA 1TGSI 5HQ8A 2KMOA 1V1HA 1SGPI 1TIHA 1MT1A 1CT4I 3SGQI 2ELIA 2JA1A 1KBFA 2E5RA 4OVOA 5JHWC 2SGEI 1W4RA 5CCMA 5CCLA 1BUSA 2KMRA 1KBEA 2A20A 2M5XA 1TBNA 2QPOA 2QQDA 1VDDA 3OXFA 4HGUA 2KMQA 2QQEA 2YQPA 3QTLD 4JCVE 2ORVA 3BJIA 2LEOA 3QWPA 4GI3C 3UEYA 2FNFX 3UGDA 2UZ3A 1PPFI 2V53A 1M8CA 2B8TA 2NU4I 1FAQA 3KY9A 1AN1I 3UEJA 2KMPA 2W0TA 1OMUA 1OMTA 1TBOA 3SGBI 1XX6A 3VDUA 3TJQA 1XA6A 2P6AC 3E2IA 4SGBI 1R0RI 1TURA 3OL0A 3PDNA 1Y8FA 1BMOA 1CHOI 2QQ0A 1PTQA 1FARA 1SGNI 1W3SA 3VDPA 3VE5A 1CT2I 1PTRA 1SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBT A;  2ORV A;  2DB6 A;  3CXL A;  5FUX A;  3BJI A;  4L9M A;  2ORW A;  2E73 A;  3UEY A;  2FNF X;  2J9R A;  3UGD A;  2UZ3 A;  5FUW A;  3UFF A;  2B8T A;  2J87 A;  2YUU A;  3KY9 A;  1FAQ A;  1R79 A;  4FKD A;  3UEJ A;  1RFH A;  4UXJ A;  3UGL A;  4UXI A;  5FUV A;  2ELI A;  2JA1 A;  1KBF A;  2ENZ A;  2VRW B;  4UXH A;  1TBO A;  1XX6 A;  2GVI A;  1XA6 A;  2ENN A;  1W4R A;  3E2I A;  2ROW A;  1Y8F A;  2WVJ A;  2QQ0 A;  1KBE A;  1PTQ A;  1FAR A;  3UGI A;  4B6D A;  1TBN A;  2QPO A;  1PTR A;  2QQE A;  5FUY A; 
#chains in the Genus database with same CATH topology
 1YU6 C;  5DAE A;  2SGP I;  2DB6 A;  1CGJ I;  2N52 A;  3R5C A;  7WGA A;  2CWH A;  2SGQ I;  2E73 A;  2V1C A;  1H0Z A;  2L8E A;  1IY5 A;  2CJS C;  2J9R A;  2ODD A;  5FUW A;  1HJA I;  3UFF A;  1ULK A;  1U5K A;  1NUB A;  1X74 A;  1Y1B A;  1Q9B A;  2OVO A;  2V1C C;  2WGC A;  4E1P A;  2OD1 A;  1R79 A;  2KCX A;  4FKD A;  3E59 A;  5HI7 A;  3RU0 A;  1PJU A;  1V1I A;  1SGQ I;  1TBQ R;  9WGA A;  2JW6 A;  5FUV A;  2LB7 A;  2SGD I;  1Z7K B;  2JXD A;  1M8B A;  1HDL A;  2GVI A;  1SGY I;  1K7T A;  1N13 A;  2F3C I;  1UVG A;  1UVF A;  2BUS A;  1SGR I;  2WVJ A;  1LR9 A;  4B6D A;  5E3R A;  3OVO A;  2GKT I;  2NU0 I;  3D00 A;  5FUY A;  2CWG A;  1YTP A;  1IW4 A;  1SGD I;  2N17 A;  3OXG A;  1WGT A;  1PCE A;  1IY6 A;  2JYY A;  5J8C A;  3UOE A;  2XRC A;  2YUU A;  2K9H A;  3FSX A;  2QQC A;  1HPT A;  3B4V C;  2NU2 I;  2GKR I;  1RFH A;  4UXJ A;  5EX3 A;  3UGL A;  4UXI A;  2JZM A;  1KMA A;  2ENZ A;  3R5B A;  1X4S A;  1UUC A;  2VRW B;  2GKV A;  4UXH A;  1MJA A;  4A24 A;  2ENN A;  3FC3 A;  4AML A;  4MPI A;  1MJB A;  1LR7 A;  2ROW A;  1P9Z A;  3HH2 C;  1TUS A;  2ARP F;  1Z2I A;  1WGC A;  1CGI I;  2NU1 I;  2L7X A;  5EX0 A;  3UGI A;  1TBR R;  3TOB A;  4DNC A;  2X52 A;  5J8F A;  3GOX A;  3SEK C;  1K7U A;  1CE3 A;  4E1R A;  1Y1C A;  1CSO I;  2N1A B;  3OXL A;  1FYB A;  1XBT A;  1CT0 I;  2X3T A;  3CXL A;  5FUX A;  2N71 A;  1OVO A;  1DS2 I;  2ORW A;  1FY7 A;  4L9M A;  1LR8 A;  1TOT A;  2B0U C;  2DKV A;  2NU3 I;  2SGF I;  3MEK A;  2DIP A;  2UVO A;  2LUY A;  1DS3 I;  1OYV I;  2J87 A;  2ERW A;  2WCY A;  1HEV A;  1TGS I;  5HQ8 A;  2KMO A;  1V1H A;  1SGP I;  1TIH A;  1MT1 A;  3QAH A;  1CT4 I;  3R5D A;  2ELI A;  2JA1 A;  3SGQ I;  1KBF A;  2E5R A;  4OVO A;  5JHW C;  3TO7 A;  2SGE I;  1W4R A;  5CCM A;  2CWF A;  5CCL A;  2GIV A;  1BUS A;  2RIJ A;  2KMR A;  1KBE A;  2A20 A;  1P9G A;  2M5X A;  1K7V A;  3TOA A;  1WKX A;  1TBN A;  2QPO A;  2QQD A;  1UHA A;  1VDD A;  3OXF A;  4HGU A;  2KMQ A;  2QQE A;  2RC4 A;  2YQP A;  3FSY A;  3QTL D;  4JCV E;  5E3Q A;  3TO6 A;  2ORV A;  3BJI A;  2LEO A;  3QWP A;  3TO9 A;  4GI3 C;  5E3P A;  2FNF X;  3UEY A;  3UGD A;  2UZ3 A;  1NXU A;  1PPF I;  2OZU A;  2V53 A;  1M8C A;  2B8T A;  2NU4 I;  1FAQ A;  3KY9 A;  1AN1 I;  3UEJ A;  2KMP A;  3R5A A;  2W0T A;  4WP4 A;  1OMU A;  1S20 A;  1OMT A;  1TBO A;  3SGB I;  1XX6 A;  3VDU A;  2Y0M A;  1XA6 A;  2P6A C;  3E2I A;  3TJQ A;  4SGB I;  1R0R I;  1TUR A;  3OL0 A;  3PDN A;  1BMO A;  1Y8F A;  1CHO I;  2QQ0 A;  1PTQ A;  1FAR A;  2OU2 A;  1SGN I;  1W3S A;  3VDP A;  3VE5 A;  1WTJ A;  1ULM A;  1ULN A;  1CT2 I;  1PTR A;  1SGE I;  1MJ9 A;  2PQ8 A; 
#chains in the Genus database with same CATH homology
 1YU6 C;  5DAE A;  2SGP I;  2DB6 A;  1CGJ I;  2N52 A;  1H0Z A;  2SGQ I;  2V1C A;  2E73 A;  2L8E A;  1IY5 A;  2CJS C;  2J9R A;  2ODD A;  5FUW A;  1HJA I;  3UFF A;  1Y1B A;  1U5K A;  1NUB A;  1X74 A;  2OVO A;  2V1C C;  4E1P A;  2OD1 A;  1R79 A;  2KCX A;  4FKD A;  3E59 A;  5HI7 A;  3RU0 A;  1PJU A;  1V1I A;  1SGQ I;  1TBQ R;  2JW6 A;  5FUV A;  2SGD I;  1Z7K B;  2JXD A;  1M8B A;  1HDL A;  2GVI A;  1SGY I;  1N13 A;  2F3C I;  2BUS A;  1UVF A;  1UVG A;  1SGR I;  2WVJ A;  1LR9 A;  4B6D A;  3OVO A;  2GKT I;  2NU0 I;  3D00 A;  5FUY A;  1YTP A;  1IW4 A;  1SGD I;  2N17 A;  3OXG A;  1PCE A;  1IY6 A;  2JYY A;  2XRC A;  2YUU A;  2K9H A;  2QQC A;  1HPT A;  3B4V C;  2NU2 I;  2GKR I;  1RFH A;  4UXJ A;  5EX3 A;  3UGL A;  4UXI A;  2JZM A;  1KMA A;  2ENZ A;  1X4S A;  1UUC A;  2VRW B;  2GKV A;  4UXH A;  4A24 A;  2ENN A;  3FC3 A;  2ROW A;  1LR7 A;  3HH2 C;  2ARP F;  1TUS A;  2NU1 I;  1CGI I;  5EX0 A;  3UGI A;  2L7X A;  1TBR R;  3GOX A;  3SEK C;  1CE3 A;  1FYB A;  4E1R A;  1Y1C A;  1CSO I;  2N1A B;  3OXL A;  1XBT A;  1CT0 I;  3CXL A;  5FUX A;  2N71 A;  1OVO A;  1DS2 I;  2ORW A;  4L9M A;  1LR8 A;  1TOT A;  2B0U C;  2NU3 I;  2SGF I;  3MEK A;  2DIP A;  2LUY A;  1DS3 I;  1OYV I;  2J87 A;  2ERW A;  2WCY A;  1TGS I;  5HQ8 A;  2KMO A;  1V1H A;  1SGP I;  1TIH A;  1MT1 A;  1CT4 I;  3SGQ I;  2ELI A;  2JA1 A;  1KBF A;  2E5R A;  4OVO A;  5JHW C;  2SGE I;  1W4R A;  5CCM A;  5CCL A;  1BUS A;  2KMR A;  1KBE A;  2A20 A;  2M5X A;  1TBN A;  2QPO A;  2QQD A;  1VDD A;  3OXF A;  4HGU A;  2KMQ A;  2QQE A;  2YQP A;  3QTL D;  4JCV E;  2ORV A;  3BJI A;  2LEO A;  3QWP A;  4GI3 C;  3UEY A;  2FNF X;  3UGD A;  2UZ3 A;  1PPF I;  2V53 A;  1M8C A;  2B8T A;  2NU4 I;  1FAQ A;  3KY9 A;  1AN1 I;  3UEJ A;  2KMP A;  2W0T A;  1OMU A;  1OMT A;  1TBO A;  3SGB I;  1XX6 A;  3VDU A;  3TJQ A;  1XA6 A;  2P6A C;  3E2I A;  4SGB I;  1R0R I;  1TUR A;  3OL0 A;  3PDN A;  1Y8F A;  1BMO A;  1CHO I;  2QQ0 A;  1PTQ A;  1FAR A;  1SGN I;  1W3S A;  3VDP A;  3VE5 A;  1CT2 I;  1PTR A;  1SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...