The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
255
|
structure length |
212
|
Chain Sequence |
PRIAVVAPTYAGGLLGANIVAVNQQVDQSVLDFGVTIGDGDVEVAEPDLIIVYSTDDIYQVAPTVVVDYNHYLEQQEMLGIVGEDVAWDWEETTADGEIAIGQDATVSLFDEFDLYTYGDNWGRGGEVLYQAFGLMQPEQQLTAAGWAEVQEEIEYAGDYIVSTSEGPTPGYESTNMWNLATEGHIVVDAGTYWYNDPYTLDFMRDLELIAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb |
| molecule keywords |
Similar to ferric hydroxamate receptor 1
|
| molecule tags |
Metal binding protein
|
| source organism |
Staphylococcus aureus
|
| total genus |
45
|
| structure length |
212
|
| sequence length |
255
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2012-06-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01497 | Peripla_BP_2 | Periplasmic binding protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Nitrogenase molybdenum iron protein domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Nitrogenase molybdenum iron protein domain |
