4FKMA

Structure of unliganded and reductively methylated fhud2 from staphylococcus aureus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
255
structure length
212
Chain Sequence
PRIAVVAPTYAGGLLGANIVAVNQQVDQSVLDFGVTIGDGDVEVAEPDLIIVYSTDDIYQVAPTVVVDYNHYLEQQEMLGIVGEDVAWDWEETTADGEIAIGQDATVSLFDEFDLYTYGDNWGRGGEVLYQAFGLMQPEQQLTAAGWAEVQEEIEYAGDYIVSTSEGPTPGYESTNMWNLATEGHIVVDAGTYWYNDPYTLDFMRDLELIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
molecule keywords Similar to ferric hydroxamate receptor 1
total genus 45
structure length 212
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fkmA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fkmA01
3AEKA 4OXRA 2XH8A 1K0FA 4WESB 1N4DA 3BE6A 2R7AA 3ZKAA 1G20B 4ND8A 4TKUB 5M2QA 3AEQB 1QH8A 5BVGA 4WZAA 3TNYA 4HN9A 1KARA 3AEKB 3K1AA 2WHYA 1K2VN 2PS0A 4DBLE 5BVHB 1K75A 4WESA 4FNAA 3TEFA 2XQVA 1MIOA 2PS9A 2PHZA 4HMPA 1G20A 2Q8QA 4MO9A 4ND8B 3AEQA 4TKUA 5BVGB 2OSVA 4WZAB 4LJSA 4NNOA 5HDQA 3ZTTA 2PRSA 4CL2A 3HH8A 3ZK9A 5KOJB 3PSHA 4PAGA 2M6KA 1L5HB 2XY4A 5HX7A 3K1AB 3G9QA 2AFHA 5JJ5A 5BVHA 5M34A 1MIOB 3AEUB 3R5SA 5GGXA 3LHSA 5CX1B 4OXQA 4PM4A 5KOJA 4HMQA 2OV1A 3UJPA 1L5HA 3PDIA 2AFHB 2AFIB 1ESZA 1N2ZA 3CX3A 3AESB 3AEUA 2R79A 3GI1A 2PS3A 2XUZA 3HJTA 4FI3F 5CX1A 3MD9A 4WN9A 3NU1A 1PQ4A 3EIWA 2YNMD 3MWGA 3PDIB 5B58T 4B8YA 2AFIA 4WZBA 2X4LA 2MINB 3AESA 4H0FA 1M1NB 4INPA 1QH1B 2XDQB 2Q8PA 4WN9B 3U7QB 4UTPA 1N4AA 5FLYA 4LS3A 4IRMA 5GGYA 2ETVA 4G09A 1M34A 3PSAA 4UDNA 4WZBB 4MLZA 5M3BA 2MINA 1M1NA 4M7OA 1QH1A 2XDQA 2YNMC 3AETB 4FILA 4UDOA 1KAEA 3U7QA 2XV1A 4WNAB 1M1YA 1M34B 1N2CB 4BBPA 1EFDN 4FKMA 5KHLB 4MX8A 3AETA 2O1EA 3ZK8A 4WNAA 3AERA 1M1YB 4UTOA 5CR9A 1H1LA 4NNPA 1N2CA 1G21A 5AFSA 2WI8A 5JOQA 3EIXA 1TOAA 2OGWA 4HMOA 3AERB 3MINA 4TKVB 1H1LB 3TLKA 1G21B 3HXPA 1FP4B 5JG7A 4GICA 3ZK7A 3R5TA 4G07A 3MINB 1QGUA 1KAHA 2RG7A 3BE5A 2QI9F 4K3VA 4N01A 4XPIA 4TKVA 5JPDA 4INOA 3LI2A 5KOHB 2M6LA 4OVKA 2OV3A 1FP4A 1K7SN 3MFQA 5M29A 4H59A 1XVLA 4MDYA 5I4KA 1QGUB 4XPIB 3MWFA 1QH8B 5KOHA 1PSZA
chains in the Genus database with same CATH superfamily
3DZ8A 1G17A 3DGFC 5CYOA 3LRXA 5IJ0A 2ZIUB 3OZVA 4EJFA 4P7BA 5JBNA 1D04A 3AR6A 1ZGJA 4LYEA 5HE8A 4DV1B 2FJUA 4PRKA 4Z49A 2I2DA 1E6WA 3L1JA 4H1TA 1PJQA 2NPFA 2QP4A 1FP6A 2W6OA 2HA7A 4D97A 2ZANA 3N7UA 3EZ9A 1PD1A 4NSNA 4YQEA 3RTGA 3AF0A 3H0KA 2NX2A 2ZCUA 4GXNA 4K88A 4DA0A 3WKEA 2QN2A 4RSRA 3R8XA 4BV2A 1TTHA 1FJGB 3BERA 3FDZA 1IQPA 1TEVA 3AI1A 3IIIA 3UJHA 3UPUA 2VH1A 2ONCA 3ELYA 2OLEA 3O8BA 5G4KB 1CR2A 3FPEA 3FZNA 2OGSA 1CTQA 3ELUA 3F97A 2IXTA 3U4IA 1OU4A 2WJYA 3V4LA 1T1GA 3LX5A 1D2MA 3OECA 1Q1ZA 1WLYA 4IKEA 4U9HS 5J2UA 3B6JA 4OXQA 1IBMB 4GOLD 2JASA 3EBOA 1F3OA 3W3AH 3W6PA 4CMHA 1NI3A 1RIIA 2C97A 3CFYA 3M1YA 3NRCA 4Y2TA 4D44A 1Q15A 3Q7IA 3DW1X 2BUCA 3UHFA 1C4OA 4C2AA 2ZB8A 1LDBA 3NHFA 4G0XA 5U1PA 1Q2XA 1SHUX 3P9KA 3VNQA 2WJAA 5JFTA 4PW0A 3QXSA 4C0QC 1ZESA 5BR7A 4I4TB 1Q1AA 2L82A 3W5DA 1YB4A 1MENA 5C7OO 1RZUA 3DDSA 4ZKEA 1RRGA 5DK4A 1XJ0A 5BT9A 5SY4A 1B16A 1G5PA 4PONA 1JDUA 1OXUA 3R7LA 2C7PA 1E8DA 4YP1A 4ZAVA 3FNBA 5DP2A 4R0MA 4KE6A 2YKGA 5JW6A 3I04A 4DEVA 2JHGA 4ZT7A 4H6WA 3KR2A 1GU1A 4HK4A 5A5GA 3QUTA 4UDNA 4LJ6A 2BY4A 4GGOA 1WXDA 1U0RA 2DSTA 5LQAA 2CNOA 2QU8A 4A26A 1XNGA 3LY5A 3GLIA 1D2CA 1HOXA 2C8LA 3VHQA 2JLWA 3HFGA 4TXNA 2PG3A 1JKFA 2WPNA 3D4IA 3V97A 1NI5A 1JIXA 4DMLA 1ZN7A 3DS8A 5IKOA 4UTNA 5K3DA 2NVWA 4UCQA 2AJ8A 3JVVA 3OWXA 1UJ2A 4JA0A 1DCTA 4EY5A 2HIHA 4BNVA 2GD0A 4H15A 1QDUA 3ASUA 2AHOA 2HY7A 3BFVA 5ILGA 4FINA 4TMVA 1IOLA 3ZDDA 4F3CA 4P3NA 2IWHA 4UAVA 3CURA 2C5FA 4RMJA 1P8AA 3IIJA 3LXMA 1G6OA 4WK4B 4BHTA 2Z1NA 2QLNA 3LPMA 2JIOA 1D2NA 2OO5C 4F3YA 4H7KA 2H7YA 2JZNA 1GPLA 4K28A 1MA3A 1BMFD 3O1HB 3TPFA 4NEGA 2GAAA 4CDRA 1KIAA 4DB2A 4WVLA 2J87A 5ELXA 2QSZA 4IV5A 1RKQA 3U2QA 2FDCA 4DIEA 4PCLA 3L92A 3UMGA 4DIUA 3GLGE 2CLDX 1NN5A 1P2DA 3MAAC 5EUQB 1YOBA 1QK4A 1SO8A 2PU7A 1YBHA 1UPFA 4G24A 3WQBA 5HR5A 1YGPA 1MCZA 1O95D 3SLKA 3NM5A 3I62A 3ICQB 3GRCA 3O26A 2P1ZA 1G3RA 4WK2B 3N6VA 3RLFA 3CUKA 3WO1A 2NTEA 4E33A 4C06A 5KVCA 1PV2A 3Q2KA 1I4WA 2I1QA 1NA5A 2QL7A 5DYNA 1B8NA 3TSOA 1RFGE 4N7BA 1UDXA 2TSYB 3BCUA 4G41A 5CB4A 1GCUA 1BRMA 2X13A 3V1UA 4L28A 4N9WA 1C80A 2C2ZA 5CDUA 1DEOA 4PYRA 1X7YB 4UFPA 4DRZA 3W1EA 3B12A 1AHNA 3CSDA 3QW2A 3FLBA 4I55F 4Y1RA 1SPXA 2B4AA 1X74A 5KOJB 2CXUA 2WY2D 2VDVE 5KTRA 2ZAIA 4DTIA 2QL6A 1TK2A 3BKWA 3PUIA 1JMYA 1E4YA 3M6LA 1F0NA 4IYJA 3HO6A 4EHHA 2QYHA 2VDMB 1D4OA 5FIUA 3TZHA 4C0WA 4G1BA 2VZLA 4F4JA 3M5WA 1OLOA 3WWPA 4K0KB 2GO7A 1Z0KA 3I64A 4FYPA 4CMEC 1JYSA 2V1UA 4NONA 1TFUA 2OBYA 1BMTA 2ANCA 3RFCA 5A9SA 4GOOD 1LLCA 4L5CA 4RVCA 5EXEA 1BQ3A 2FQXA 5A2GA 1T9HA 3A2NA 1EEXB 3RRZA 3HDYA 2CV0A 1XC7A 3GMDA 2G9QA 6ADHA 3PDIB 4YO8A 3KT6A 3LLCA 3UYKA 4PIPA 1QYWA 4UD6A 4BLUA 4JR1A 3SR3A 4F85A 3KYBA 3K35A 4J1TA 4KMMA 2AOUA 2VP6A 2EERA 4FYIA 4CVNA 2LVBA 2VNIA 4N7RA 4UZFA 5CB4F 2ETVA 4G5HA 1AS2A 4P3XA 4PAOA 1WULS 1RS0A 4FMBB 1E99A 3LQ1A 4JC0A 1BKDR 3CPHA 3GEEA 3WGVA 2R5NA 1WDTA 3QA3E 4MRVA 3U1BA 1FFCA 2PX0A 3U48A 1LBIA 1Y7HA 2AOVA 3FZYA 3OWOA 4HDSB 4B2PA 4KXVA 4DCNA 1XIVA 4RY2A 621PA 4W7IA 5K2OA 2V3CC 1PJAA 3O1IC 3F3SA 2AG6A 1O95C 4PX5A 5LN1A 2IOYA 1G8YA 5DM2A 1C9EA 3FOFC 3SAJA 4MI6A 1ISRA 4CDMA 1SWVA 4IG4A 2CJXA 4BWVA 3EOAI 1P44A 3INTA 1AQYA 1PWXA 3I28A 3KKEA 4D9JA 3QPBA 3UXHA 3IDOA 4LZLA 3EX7C 2QD1A 4JENA 4WACA 3K1TA 1C4WA 2X6TA 3EZ2A 1ZUWA 3FWNA 3QVXA 3R1IA 3D4BA 3H99A 5LA6A 1XU9A 2CYBA 3P9RA 2VYCA 1CF2O 2QDKA 4AG3A 3D0QA 1ZUNA 2HRBA 4NYJR 5JZMA 5AW2A 2DKNA 6GPBA 4OMDA 5IC5A 2PLFA 1LFAA 4BO4A 2CMDA 1Z63A 3BDAA 1BCSB 3GRUA 3FAZA 1W2HA 4FDVA 1I7QB 1X1RA 3K0CA 4E0BA 1KK0A 3NPAA 3OFVA 4ZOLA 2TYSB 1MJFA 4NZNA 3QUAA 1BKYA 5REQB 3MMXA 2QRJA 2OOSA 4KH0A 3LY8A 4CM9D 3H4MA 1RCTE 3IE1A 2RAFA 2X3FA 3ZHUA 3LUBA 2DFPA 1ZITA 1KH3A 2V7GA 3CN7A 3IQXA 3P2KA 3ENQA 3ZNNA 3AQIA 4NU5A 1TEHA 2VF8A 2FUG1 4MWOA 3ZE0B 1C1DA 1TMYA 1THMA 4YP6A 2DE0X 1WQ1R 2BMEA 2YBDA 5DLEA 3IP1A 3T06B 1SY7A 1NM5A 2ZBGA 1HKUA 3KJFA 4TTIA 4TTRA 4LJRA 4HH1A 3CMCO 3F4LA 3V8EA 2ZR9A 1Z26A 1UZLA 2LGJA 3AGQA 1BHQ1 3OE1A 4P33A 5FH9A 4I1RA 4TZTA 2O6HA 4Q15A 2CSUA 4HDOB 4A73A 2XJ9A 1YIOA 2DR3A 1VMAA 4HAZA 5C4GB 4QXRA 2X0DA 1H0RA 1XL0A 5K99A 3QEMB 2POQX 1G291 2CVHA 1Z6YA 2FN9A 2CBZA 1NLYA 4M1SA 5GVSA 3UT5A 4YRMA 1DEKA 1E9VA 1POWA 3PWKA 4PRYA 1TO6A 5BWCA 5LMUB 2X19A 1WW3A 4BZXA 1QANA 1BQ4A 3WGLA 1W0JD 1S7GA 1QC5B 5ITSA 4ZOQI 2WPDD 4XX0A 2HO4A 4MRPA 1KK2A 5AESA 3KPYA 2ZDQA 1XKTA 4X91A 1I1QB 3TS1A 4PN3A 4XI9A 5LSAA 4LTDA 1D03A 1X2EA 3N75A 4R40A 4ARCA 3UMCA 1R0KA 1U3VA 4B80A 2FLVA 1Y4UA 3EF1A 5JMWA 1AQJA 5EMNA 3H18A 1CDZA 4QXMA 5TMBA 5AIAA 1J5EB 1KFJB 2AI3A 1J33A 4XIYA 4A92A 2GAIA 2VBIA 4GYJA 1RWMA 4JJAA 4OSEA 1VBKA 3WL6A 4Q7JB 3H2ZA 1NQWA 3HLYA 5EIBC 2OQVA 3VDQA 5JO0A 4YUAA 1M9NA 2V4MA 3BWCA 4HWTA 1ADGA 3GFTA 5JQGA 5LU8A 1Z7WA 5JATA 3GFSA 1P7YA 5IUKC 2WIFA 4MI1A 1F3LA 2BBSA 3AERA 3TLZA 1GGVA 2OC9A 2FP4B 3AJDA 3AKYA 2WJ4A 3AP3A 3E9CA 2CDRA 3JS5A 4JR0A 3P45A 4O6VA 4EEXA 5IRCD 5KSYA 2EJBA 3O73A 5I4IA 1UOQA 1JKMA 1S01A 2AN9A 3D3NA 4L5AA 1ORWA 3ACDA 3DFIA 3FGZA 4XLLA 3D6MA 1Z2CA 3GIWA 3CVUA 2DECA 1J24A 3BTUA 3AOEA 2WG0A 4RGBA 3GG9A 3QF4B 2UUBB 1ZONA 2FPGB 3H5TA 3S2FA 1ZA1A 5IXJA 1QIIA 1IJEA 4CNQA 1JMKC 1VL2A 2GETA 2WMNB 2ZJ8A 1EVIA 2B82A 4M8IA 3GNTA 4A82A 3ZIAA 1RWOA 3Q8KA 3AR8A 2PL1A 4CFYA 3V2GA 1PV1A 4MCHA 2OZLA 1R15A 4Z1MD 3PFBA 1CUDA 2GARA 2PMKA 3R74A 1NFRA 1Z6ZA 2OLKA 3SE7A 3WVNA 2OCAA 1Z0JA 2RHBA 5AKXA 4ECEA 3H9CA 2RG1A 3W2EA 4EVIA 1RZVA 2ZGVA 2FN8A 3KLMX 1KYZA 4RADA 4YRGA 4E1BA 1UBUS 3BHNA 1EWYA 3MT7A 2AZMA 1MJ5A 1I51A 1LDEA 1K06A 3TMAA 1K9SA 4XXHA 4QJ3A 2IPLA 2H4YA 3M6VA 2PBRA 3NHBA 2ZM6B 3NHSA 1IOWA 3TKAA 3WNBA 5TGDA 4KZKA 3PDWA 4FEEA 4ER7A 3BGSA 5FOQA 1KY4A 3Q6MA 5K51A 2YMQA 4KMSA 5AW0A 2ACVA 1ZJZA 3AEKB 4LHSA 1TRKA 2IVZA 3F4KA 4NG4A 4RXUA 1IEQA 4YRAA 5BSWA 4DLWA 2AFHE 3FMFA 3KLNA 3GVIA 1LTHR 3WADA 2SCUA 1HH4A 2Q21A 2OHOA 4MITA 4PYMA 2PO5A 4D9GA 5I7SA 4RANA 4YP5A 3ZBPA 2H1RA 5CYFA 5E6RA 4MW2A 1KK3A 2BGNA 5SZHB 3KB1A 1LPBB 2FEPA 5ITZA 3GDGA 4LTNA 2HYIC 3I12A 1KZ9A 1RXSA 4KN6A 5THQA 3WBKA 1KPIA 2YV4A 3L8FA 1D6JA 1NBAA 2PT6A 4LVNA 3T3MB 2OHXA 1G19A 2H17A 2WICA 2P75A 1YTUA 13PKA 5AW4A 4LA4A 3RODA 1C30A 3F6SA 3MRVA 1GL6A 4OL0A 3OPMA 4PTYA 3QLUA 2F62A 1ZX1A 1R88A 3SYTA 2Y6VA 1DWQA 4D3YA 7REQB 4C4SA 2IUTA 1LVHA 2GK3A 5I7UA 3ESBA 1M8JA 5CBPA 2OP0A 1B1AA 2PT9A 2YJGA 2G4CA 1XLVA 3FPHA 5FTJA 3TBKA 1IULA 4KGZA 5CH5A 1UBNA 2XMQA 3VZRA 3IR7A 1XA3A 4YAGA 2MSCB 5LXTF 4EQZA 4JLAA 1Q7GA 3ROZA 1IEWA 6AT1A 1Y3AA 2BHNA 2CB9A 4GYKA 1PZXA 2PFSA 3NLLA 1YQDA 3PSAA 5F7OA 3FUUA 2YY6A 4RETA 3EDRA 3WFZA 1Y7TA 1WUTA 4CKXA 2W2VA 3SS7X 5FO0A 1SCNE 4B3IA 2GD1O 5EIOA 1QIDA 3DMTA 2VP0A 2VYVD 1PZEA 2D0IA 4TTPA 4IV0A 4FXPA 1V2HE 5JVDB 2WYIA 3T38A 5F23A 2YOHA 2O0MA 3KPWA 3PNKA 3JYHA 3HYRA 4C29A 1UDBA 3REQB 3BTSA 3FRJA 4DBLC 3ZC3A 5K6TA 3PDUA 4MK4A 5CHEA 1EJ0A 2I6GA 2QORA 5JMPA 3ZY2A 3KTDA 2P3LA 5D51S 2DMRA 2D5CA 4YJFA 4HFRA 2I2AA 2GAOA 4ND3A 3S55A 1WMBA 3RF7A 4MVJD 4FX5A 2WIDA 5J1TB 1NUQA 5C1IA 3ZE7A 1DLJA 5B4VA 4O63O 3KSUA 1PZGA 1BVUA 1US8B 4Q3NA 2YIVX 1U1DA 2BGUA 3C6BA 2I91A 1QVAA 3DLCA 4TSFD 2A84A 3M89A 1NVEA 4O4IF 3LA8A 4BWGA 4UNRA 4ZHQF 2QVCA 3FPBA 1FLDA 1O7JA 2OG2A 2P30A 2X4DA 3WLSA 4F6LA 3HDQA 2J3MA 2X0JA 3E8XA 1KC1A 2B8TA 3OUTA 2YOFA 5DBHX 5ESWA 3AKEA 1RWVA 2XDAA 4N39A 3QU9A 4B0OA 2EX0A 4AXXA 4FSHA 2H11A 2OV3A 2V8OA 4EVQA 2J3QA 2OCLA 5L7YA 4XWWA 2UZ1B 1AURA 1RM4A 2J07A 3PXAA 3R3HA 3ZI7A 4F12A 4FOLA 4GAEA 4L4XA 4MV9A 3WOHA 3TW8A 2G80A 2ZPUA 2G0TA 4I8IA 1NXQA 2CMHA 1IOVA 3HYTA 3JXEA 2HHHB 4LC9A 1P62B 1CNMA 1SCUB 4MUEA 4BLVA 1SKBA 3O8OA 2ZAOA 5LB2A 3EXHA 2Q7OE 3K0KA 3T5GA 5A4FS 1Y1TA 4QEZA 3ZV5A 1D09A 2V6BA 3M9LA 4IPTA 1HNZB 5AVQA 3AVUA 1VLZA 5TQJA 1AF4A 5JZBA 2WD7B 2JPDA 1DC4A 1XQXA 3DE6X 3NNSA 3R3JA 1DJNA 4KDRA 2GCOA 4IFBA 1G2OA 1NW6A 2Q50A 4PXSA 5HHTA 3UXYA 2ZFUA 3VU8A 2QN6A 1Y33E 1S8FA 1WZEA 3S2UA 4O2LA 4DR4B 3VMFA 2IHJA 3ZCSA 3SU8A 2V59A 4KJXA 1GCAA 2AX3A 1PS0A 4MCIA 4R1SA 1XLTC 1BOFA 4B7UA 4OLBA 3AVVA 3BMCA 4XWKA 1USGA 4DEXA 4OF4A 1L4KA 3AF6A 1S8AA 5JZ9A 3TM4A 1C3VA 1K66A 1I33A 1S9HA 3QBDA 5CLJA 3QJGA 1NPTO 4DXHA 3RUDA 4QIHA 5HFJA 1P2TA 1J06A 2H31A 1RI4A 4KU4A 4FFWA 4WJKB 4OQQA 3DV2A 4CM4B 3EC7A 4N5IX 1JYEA 3ENNA 4JJZA 2IZ1A 3I9LA 3TVYA 4TPKA 3QPUA 2LUOA 2G67A 4IMIB 4J94A 4EYGA 2HSDA 1QXSA 1ACMA 4KVAA 4ZOEA 3RHSA 3TVDA 4H16A 4C22A 1YZYA 4QDXA 3LGSA 2QYSA 1UZNA 2I4TA 4MYUA 4ZGWA 2W0MA 1V37A 1KOLA 3EDMA 3BILA 3D43A 2P2GA 4TN5A 3SM9A 3VR4A 5KQGA 3JQEA 4GLOA 1R1DA 4RS4A 3WGNA 3ZWPA 2XCRB 4H7FA 1YCGA 1Z6TA 2Z95A 1J23A 2ZJ4A 1LSSA 2UZ4A 3R5FA 3TLEA 1NLUA 4QQ8A 4DYVA 2O7SA 2G77B 2Q6LA 3KKZA 4K5QA 5SY9A 4LQCA 2IS1A 5EZ6B 1ENZA 1IJKA 1SBHA 4KG7A 1EFDN 1JPVA 5DNWA 5BQOA 3U1VA 1LNQA 4L6CA 4RJIA 2FG6C 3EE6A 3ND5A 2A92A 3UANA 4BO1A 3THYA 1NJ5A 4P98A 1OB5A 1QPBA 1U9CA 1YV9A 2IC5A 3TJRA 2JIQA 3H8WA 4JITA 1Q7TA 3P9NA 3CE9A 4YAOA 4AZWA 4CF3A 4OV6B 4MW5A 3BWEA 3JCZA 2C77A 1LI7A 2O7QA 3Q2IA 4EBFA 4QVKA 3EVCA 1YACA 3GVXA 4A8TA 4UXJA 1RT9A 1G55A 3LOPA 2YJZA 3Q5DA 2FP4A 3FW1A 5I51A 3C4JA 3VKHA 1WXEA 1OI4A 4BNZA 4E3WA 2HB6A 3F74A 4KRYA 4EITA 4AKSA 4ZC8A 1N2IA 1X1TA 1YIDA 3LIPA 5FEUA 2XGJA 1AS0A 2IEDA 2IPMA 4NCHA 1NQAO 5CDFA 4KV7A 4XQ9A 4KYVA 1OWNA 4U2KA 2W5UA 4S1PA 3QF4A 1REQB 1N8KA 2FPGA 2GEDA 2J46A 5BWBA 5IJZA 1E7WA 2INGX 3CKKA 3CX8A 3FYSA 3GJSA 1AGNA 4BMCA 4BZQA 4BKRA 1QPZA 1G98A 2YQZA 1L1QA 3AI7A 1WRBA 3V2UA 1DVRA 2WLTA 3WZLA 2XB9A 2CNLA 1XF9A 1YI0A 5HP4A 5CEJA 5KOIA 4HGQA 2YVAA 3KJIA 2XITA 1LV8A 2L18A 2HDNB 4R3WA 4EJSB 1BOOA 4HLDA 2VTKA 1FJ2A 3HYCA 2YUTA 4WXYB 1N4DA 1LWNA 2WEKA 2X9NA 2XRMA 5ICCA 3C5CA 4ITVA 1NSTA 3VRHA 4R2HA 1TTTA 2WU4A 1U28C 4B44A 4EA8A 4KZPA 4UU0A 2A9FA 4YMSA 5ALEA 1YS6A 1Y82A 4HRVA 1CJVC 4FTWA 3QKUA 4L3OA 4MV4A 4NMMA 2OWEA 5IDWA 4W1SA 4DLNA 6NULA 2IH4A 2Q6OA 3QYAA 1RFLA 2JFUA 2O5VA 2PFGA 2ZROA 3EGXA 1W29A 1FQJA 1JXAA 1E1NA 1N9KA 1XTRA 3FIUA 3I9FA 3JTEA 3QUSA 1DBIA 1F6BA 2JBAB 5B3AA 5D3ZA 2B8EA 5A9SB 4OHXA 5K0ZA 5A02A 3PVZA 1KF0A 1PWEA 4DNFA 4FYKA 3FRIA 1GPBA 4HYYA 2ZI4A 4F46A 1AQLA 5EQTA 1A69A 2OHHA 3ETNA 1Y1RA 3KSZO 3IVXA 1QYDA 3HMQA 2ZIZA 4C5BA 3M3PA 1VL1A 2B94A 3W4JA 3ICCA 2G0NA 5AT1A 1GTJ1 5KAPA 1U81A 3O31A 2ISQA 1P5ZB 1RXEA 4IWNA 4X90A 3QOXA 2BH2A 3KOUA 4HYEA 3B3QA 2WKWA 3HHPA 4II7A 3ROGA 2R4TA 4F92B 5B12A 3RBVA 1E79D 1G5IA 3L7YA 3AESA 4I8DA 2H9YA 4BUZA 1TGYA 2SNIE 5BW6B 1EGMB 1VB3A 3WJ2A 2VR1A 2DEUA 3VXKA 4DUZB 4D4HA 2PBFA 1MHPA 1SUCA 4L27A 1NJ1A 4KIJA 4UJ3A 1MFZA 1UAAA 3PRHA 4KN8A 2ZU6A 1KO7A 2VJYA 2O14A 4QVGA 3RO7A 5BPHA 3MLAA 5MGBA 2EFJA 4RZXA 1XD2B 3QEAZ 1MH1A 3ZR4B 1E62A 2ZK7A 3H1AA 3L8YA 1TO1E 3I34X 4BO3A 1OYYA 2AN3A 2GHTA 3D2CA 4QOEA 3QELB 2Y77A 4FKMA 4UC0A 2O2HA 1JR3D 3ZWCA 3A36A 3FPFA 3ML1A 1EGQA 2OV4A 5EVCA 4EY6A 5JS2A 3K0HA 1WU7A 4DCOA 4F5WA 1NIJA 1ONOA 3SBDA 3LT2A 4LFBB 1HL3A 5DYGA 1PCXA 4FHZA 1KXJA 2CHQA 4GBJA 2VL7A 4BFYA 3CRQA 2AN5A 3O4FA 1ULHA 2X8AA 1P6QA 5FJJA 2XNKA 3OZWA 3TAXA 3TL3A 3RS5A 1SVOA 4D74A 3P19A 1TF7A 3CIOA 2C4VA 4EDFA 4P0QB 4LJ5A 3UM9A 1PNQA 1DQNA 1QIFA 2VHUA 3RUEA 1FFSA 1Y6ZA 2R84A 1L7BA 3H7IA 3TQTA 2YDYA 4RORA 1TA9A 4AICA 1E0AA 3N86A 3R0ZA 4TKVA 2J3LA 1LCIA 2W6QA 4JJ8A 3K96A 4AROA 3CT6A 5CLFA 1DFHA 4CRWB 1ZC4A 4BNTA 4EG1A 3A11A 1Q0LA 1JHYA 1CQPA 3K8OE 1VMEA 2J5BA 2PA3A 3D1LA 4Z9BA 1UKYA 1P4HA 4ENPA 4XUCA 3KQPA 1W8DA 3LF2A 1HT0A 3HR4A 4QOFA 2OY0A 4Z8XA 4ZYWA 3L18A 3UJBA 3G8AA 4EL0A 3U19A 3NVAA 1SUIA 3QU2A 5F7ZA 4BV3A 3ZVKA 3TCXB 2P9FA 2JFBA 4KQJA 5AUNB 3GFBA 1EU1A 4JBWA 4YV1A 2C3PA 1FVXA 3LQ2A 2FPXA 4OATA 1AA9A 3Q10A 3V1KA 2AI2A 1KK1A 2X86A 5BSGA 3TF5A 2RGEA 5JNSA 3UWSA 1GLNA 3A05A 4HNGA 1YE3A 5JBIA 3Q8MA 4OSOA 5IFLA 1MF7A 1ZOPA 4BL5A 3KKQA 4IDOA 4EPXA 3FNIA 1A9TA 5E4FA 5TSDA 3SSOA 4AW9A 1KAGA 4ZT4A 2OAQ1 3KEOA 4FFBB 3DTVD 4QG7A 4QNRA 4D46A 5BWMA 1EHYA 3WA6A 5FA5A 4L72A 2OESA 3U5ZB 1RU3A 5DCYA 3KXLA 1UKCA 2EQAA 3PC4A 4EW1A 4L4ZA 3FOCA 4IH4A 4QYMA 4AK9A 4OI1A 3TW6A 3DKIA 3BGDA 1N7IA 2ZVDA 4HQKA 1IAQA 1R12A 4PGGA 4A03A 5HGXA 3SMQA 4BNGA 4US2R 3D0OA 4LJKA 1XPRA 3J7AC 1BEEA 3L6UA 4MGEA 1E77A 2O2GA 1K68A 3PFCA 2VIIA 3IUYA 4FOPA 2HLPA 5K0SA 3HCNA 1CIJA 2NUBA 3VBEA 4AMGA 1U2GC 5DWQA 5TPWB 5FP0A 3PQ2A 1Q0HA 3IEXA 5B2EA 2QVGA 3DUFA 3NT5A 4YY3B 1JWLA 3T7CA 2Q3EA 2D7DA 2ZBFA 1FFAA 3BXOA 3C3JA 4KMOA 4TM7A 4BO2A 2OSBA 3V48A 1XALA 4PVDA 4Q9HA 2FX2A 1QTQA 2R7KA 1KMMA 5KX5F 2C0CA 4TXHA 4ZGGA 3KE8A 2BTOA 4KACA 4XB6B 3CR8A 2QTFA 2PMDA 4MMYB 1IE3A 4QBKA 3UAGA 1SBIA 3EAQA 3LX8A 4L5IA 3AF3A 5DI3A 1K98A 4EPRA 2V97A 4DABA 2Q1YA 1U8XX 3L5OA 4NPAA 1NV9A 2XCQA 1ESNA 3BMOB 3EAGA 3CONA 1OZ0A 5LZ7A 3C74A 1N5IA 3TD2A 4BVHA 4C1NA 5KTMA 4YCLA 2W6JA 4NCNA 5AVWA 1NBMA 1KMIY 2B30A 3KSAC 1YZ3A 3GCZA 4EZBA 3CZPA 2VFAA 2ZSEA 3E5HA 3QQ5A 1U7XA 3JRWA 4CCWA 5FOUA 1X80B 2ANBA 2DQ4A 1O4WA 1Z08A 2R1UA 1DAHA 4PQGA 5J40A 4DDUA 3WIUA 4ZJUA 3RYFA 1QG2A 4UZEA 1DWUA 4C0XA 5B30A 4AQYB 3DHWC 4F3TA 4M89A 3R3WA 3TTSA 1IVSA 2X7JA 1JBEA 1GSIA 2G40A 3GUYA 4RK7A 5IDYA 2EYUA 5FI5A 4D0NA 1ST3A 1V1MB 3NASA 3PNPA 5U4QA 4TSFA 4EYSA 2PM8A 2XJ4A 4LRTB 4PZ9A 4O2AF 2Z6QA 1B8PA 5JISA 3DDUA 2WLSA 1GWNA 2Q3FA 2FV8A 3FSGA 3O3CA 1ISFA 1TT7A 3R77A 5JDIA 4X41A 1HT1E 3A9RA 4B5LA 5CG2A 5HQTA 4YMVA 3JWJA 3JQ8A 2GEVA 4BMVA 1LRKA 3Q15C 5EIWA 1TU0A 1XU4A 1XYGA 3M70A 1X1SA 4RMGA 5D3KA 1H6BA 1FRZA 1HTWA 1LDMA 3C5HA 4HWRA 3S4YA 3M4NA 1WA5A 5ENDA 1C0LA 2ZUUA 5T6BA 3AEKA 4DA6A 4CMIA 4ZKDA 5JYBA 4D96A 5E6UA 3FVRA 3BE6A 3ZDQA 4A6PA 2G9ZA 1FP2A 4BRWA 3COZA 3EQ9A 2PLAA 4JP2A 4RL6A 5AM1A 1UBJS 1Y4ZA 3FNHA 4UHJA 2XVXA 4WUTA 4INAA 2PXHA 2DUNA 5ITZB 3KV1A 1M2FA 3ILXA 1TA4A 2D1FA 1F51E 1MX9A 1EPUA 1ULBA 4ITUA 5IBQA 5HOQA 3LPCA 4U02A 1V35A 3AB8A 4OP2A 4DA4A 4E94A 4MQEB 4EGQA 4XEUA 3U7HB 1XSEA 2J9GA 5ITVA 4RGQA 4G8JA 2E85A 3MS7A 4CM8B 5IX8A 1N5KA 1WPRA 1IPHA 3LV8A 4G3XA 4C4ZA 3VAAA 2EJWA 2WSSA 2E87A 4LZNA 3STYA 3ZCXA 2R8EA 1NHWA 2MSDB 1H05A 5FWXA 1AV7A 4L16A 3CINA 2DCMA 3V2IA 5EWMA 4K9QA 2FX3A 3LK7A 1HXHA 1RQLA 2Z8XA 4D4KA 4BMSA 3HFSA 1SQFA 3G8CA 4DLAA 3W5CA 3I6ZA 1EX1A 1T5IA 4AWAA 4UUQA 4F8EA 3RABA 2JFZA 2JIPA 3ZDXB 2CF5A 2OMEA 3TQRA 4EJ2A 3DE0X 3LBNA 1JMVA 3FJYA 4ARUA 2A4MA 2O2CA 1HFKA 4EBBA 5L3SB 4J3NA 5E7IA 2OFPA 2IE8A 4MVYA 3QFFA 1ULTA 3MWKA 3H84A 1Z4KA 3MN1A 4W63A 3X3HA 4CN9A 1ARZA 4DSAA 1KQOA 3DT8A 2O23A 1WMDA 3WKDA 1UUFA 2HJGA 4RAQA 4ZZ0A 3ANTA 1OXXK 3VSAA 3I3OA 3F73A 3FWYA 5C46F 2JS7A 3UOGA 1TXGA 4GI7A 4NENA 2HJRA 5JEEA 1RJWA 1UP7A 3OU2A 4L50A 4U2GA 3MWJA 4O8CA 3UO8B 1CRLA 3PQ7A 3RIMA 3TTUA 4NOJA 4COKA 1FFXA 2ZPTX 3BXXA 3LXRA 4XJSA 1SUDA 4AMUA 1DO8A 3HPQA 3U5TA 3QJYA 4BCCA 5EJMA 2B6NA 4HGZA 4LY9A 3E9QA 1UBOS 2WVGA 3FTQA 1EAYA 2AX4A 3ILHA 3L01A 4FE7A 5JRDS 1U3TA 3E4DA 1OT5A 4CF7A 3H1EA 1PQWA 5JXHA 2RH5A 5AFSA 1VP3A 3U4QB 2ZI6A 5AJUA 1F2TA 2PKRA 5EC8A 1PT5A 3TGPA 2O54A 3I5YA 3HC7A 1J2TA 3X0DA 3OMXA 3I4FA 5K8CA 5K5EA 5GZ3A 2YWEA 2YCLA 2AF3C 4YASA 4QUIA 3W7AA 1T15A 3KOZA 4P4SA 1R0WA 5CAEA 4CIDA 4V1CB 3TW8B 2ON6A 3ZHXA 2GEUA 4H35A 3GGJA 1U3WA 2E9SA 3Q0EA 1MVLA 4W6QA 2X1MA 3WK8A 5DX0A 5C3MA 4DCGA 4HUJA 1AHPA 2LRHA 3BYZA 1UXIA 1VBMA 1DCKA 4G0NA 4TN1A 4IHJB 5J59A 4EVSA 4Q02A 1NNI1 5AVXA 4EW2A 3QLJA 3ZLVA 4BP1A 4M3NA 3MS2A 4TTTS 4TVSA 1E2KA 5EKSA 2P6PA 2AXPA 5CT9A 5KU1A 2ZSDA 4YRSA 1PTJC 1ZBQA 3KQMA 3H6HA 1WR8A 2FNAA 3BFXA 3SNHA 5FV4A 3PX2A 4HZUB 1XPUA 4F93B 1M1ZA 3RAJA 2BFOA 2J3IA 3JD1A 6REQA 2GCOB 1RHRA 4L8VA 3N8KA 4G5OA 3H17A 1NR5A 1Y8QB 1ZEMA 3T61A 3U3DA 1ULUA 1YR1A 4KVZA 2ZYUX 1QH8A 1JDPA 3I39X 3TIVA 5AUPB 4HB2A 5JH7A 2NVOA 5TT1A 4AURA 2YHUA 3UT0A 4BBAA 5UKDA 4S1NA 5KKCA 2QVBA 1XQVA 1G2PA 1HDEA 1M2NA 1XHEA 2AR7A 5CVDA 1CEQA 1GZ5A 2O0JA 3FCYA 3K0CC 1R0BA 2Q3MA 5F4ZA 2ODNA 2VQSA 3Q5EA 4WOCA 1N8NA 3VR0A 1J25A 4C1BA 1UWVA 1E2MA 2R6ZA 2UUOA 3U3RA 3D8HA 1GJRA 1QRAA 3FNQA 4OP1A 4GRDA 1SIBE 5G1OA 1QV7A 1GA6A 3ANSA 5CLHA 2ATEA 3MWEA 3ZWVA 5L7TA 1Z0DA 5JXIA 1BO6A 3V8BA 5JAIA 1ESEA 3D6HA 4W8HA 1YK0A 1GM5A 1XDSA 4QSMA 2VBGA 4OKSA 2WF7A 3GLRA 3A1CA 4MCJA 1U6JA 4V0QA 4ALKA 3F8WA 5CJPA 1V8DA 2E49A 4BATA 1RYNA 5FL3A 2DQSA 1P2BA 2PA0A 4B3BA 2WP0A 2NUPA 2Z1DA 1WMFA 2NSLA 3B7GA 2I65A 5ER9A 1HRDA 2VBCA 4GVXA 1TYAE 1EM8B 1OFGA 3ABSB 1YKSA 2EF1A 3KBBA 1LJLA 4UNSA 3GA0A 5ALOA 5GJWC 3JQRA 2X8JA 3KAJA 5HVNA 3RANA 1ZR2A 1AC5A 2BWJA 2X4IA 3E0XA 3CIFA 1I6LA 3A7EA 3E1KA 2C5BA 4MPPA 3ELBA 2HU8A 1ZICA 2V7WA 4L5YA 4XB1A 3WGMA 5D7NA 5GZ1A 4PQFA 4G5XA 2NPOA 1QGED 4FFDA 3IQZA 2CC2A 3R6GA 4TWBA 3HU5A 5FPQA 5IAEA 1R27A 3DTVB 5FBLB 2D2IA 3KWLA 4I4NA 4JBHA 4JQCA 3KQHA 2TMKA 3ADKA 1MA0A 5D8DA 5FR1A 2PLNA 4ZU3A 2GEFA 4IWXA 3GEHA 5EKXA 2CCGA 4HGPA 4MRAA 2IKQA 2Z8ZA 1U8FO 3HB7A 4UTOA 4GQBA 4YJ2B 5HXAA 4MVWA 2XSZD 4M1OA 3IHTA 4OYYA 2H92A 1HY3A 4IDHA 4GQIA 4B47A 4MWBA 1P33A 2DJIA 2AJTA 4LOKA 3L41A 1SXJB 4KQXA 4PLHA 3M4XA 1T36B 5CA0B 3KPUA 2ZT7A 1JQKA 4M0KA 5IJXA 2PRKA 5AVSA 4FT4A 4D45A 3C85A 2WM9B 5IT0A 1ZLXA 2VAWA 3V7UA 3MMNA 3NC4A 4O4JF 4NATA 1NG1A 4PGHA 5B1EA 1OY1A 2CNWD 3BFKA 4EG3A 2IHUA 4D9CA 3NBYC 2W2XA 3O8LA 4GPAA 2O07A 4X1YB 1QVZA 2AXNA 1RYFA 5NULA 1SOAA 3ONVA 2SICE 5HZHA 3BE5A 3F6EX 2WSYB 5E2AA 2FMIA 4AZ3A 1ADCA 2LCQA 4H7JA 1FX1A 3NC0C 1V1MA 3P4UA 5JS8A 1XO1A 1DJPA 1J90A 3N3AC 4JT9A 2P27A 4JWTA 5JD4A 4F4UA 1Q6ZA 5INTA 3MTAA 3UW3A 3ZDFA 4I7EA 1P74A 2WHEA 4L4RA 4F4CA 1GSHA 2GZDA 3CWQA 1BD4A 1G8SA 2IYWA 3ASZA 3KDSE 4PGAA 4QGBA 1MX1A 1SK9A 3JQ8B 4QQRA 5FPYA 3ZGOA 3WIVA 3W79A 4N5DA 1Y5IA 4DLLA 1H3FA 1E0DA 3L04A 1GZSA 3V8QA 3EGXB 3OURA 3PUJA 4G4SP 1TTQB 3T5PA 4LWQA 2Z6AA 3DAPA 1D8TA 2XOXA 4WXEA 2PLRA 2PS0A 3H5AA 4FI3C 4CMAA 2NTVA 3UYLA 4PBTA 4RKQA 1QQ6A 2AJDA 3BXHA 1R16A 1UBFA 2R8YA 1T6XA 4MP3A 4BLPA 1Z6XA 2QIPA 5JEDA 1SC9A 3PSHA 3QY0A 5KMGB 3WQHA 2DH5A 5DNUA 2ZR7A 4L3WA 2R1VA 1YB5A 4ARSA 3ABOB 3F6YA 3SBEA 2O2IA 3DFUA 2H9AA 1RLOA 4P0TA 2QAGA 1RPTA 3Q0TA 1L7DA 2ZRKA 3TLYA 4Z4CA 1EZ1A 1XRNA 2Z5GA 5FO1A 5J23A 1W0JA 3GARA 1H5NA 4EI9A 4QO8A 2ZI9A 4F6RB 3B7WA 4KDFA 3TLMA 4CKBB 2D3TA 3FI9A 1I5RA 1N9GB 3I0MA 3VOBA 3W8RA 3MJCA 5LIRA 2ZBQA 2YWCA 2VT3A 1JHMA 2A0XA 2YL2A 1O6GA 1Z45A 3KQSA 4ZCPA 3TO5A 4O4HF 4Y6SA 3EDYA 3VTZA 3RJTA 4IGKA 4NC9A 3T3EA 4FFVA 5AVKA 3D7SA 1N6NA 3L8ZA 4LE1A 3GJZA 3TMKA 4V02A 3R24A 2A67A 4DAOA 1VE6A 3DZJA 5KYKA 4KAXA 3CX6A 3O9MA 3IVGA 1OFHA 2I76A 1Q1EA 4HJXA 3C6ZA 2NZYA 3AY6A 4NMWA 4CFZA 4D98A 1PT6A 4Q3OA 4EPTA 2WT4A 2Z57A 4KR3A 2WTEA 1G8HA 3SCZA 4I4CA 1V41E 5K45A 2D59A 1NF9A 1W2WB 3QWIA 1PJ2A 1L5LA 3ZZ1A 2HTFA 4CL0A 2WWWA 3OCJA 1Y6QA 3EHEA 1RM5A 4LV8B 3QVUA 4CM7A 4BNKA 2BVNA 1HDRA 3SYRA 5H59A 5CVTA 3HCCA 3D64A 3EUAA 1NXXA 4LOAA 1HDYA 3RFUA 1PVOA 2ODAA 5AMXA 1GNLA 1GUBA 5AK5A 1FZTA 4PNEA 5JCJD 1FFXB 4NU8X 2XRFA 2FEKA 1PWHA 1EUCA 4U7WA 1SKQA 1GPKA 4YCDA 5PGMA 1BMFA 4K1XA 1Y5NA 4G1MB 1N1EA 4ZOLF 3WTBA 2XBLA 4CV1A 5AM3A 2ZT5A 4A0FA 1JEYB 1G3IA 1ZMOA 1VRCA 1FMFA 3U80A 3O4RA 3RROA 4B83A 1CS0A 1CUSA 3SHOA 3UJ9A 3LDUA 1EAMA 4DSZA 4COOA 1EWQA 4MA5A 3VQTA 3WXBA 2OXTA 4B6SA 4EAQA 3TR5A 3WYGA 3L0OA 1M2EA 1XCLA 4JMLA 4MVJM 4OQEA 1M33A 5E7QA 2DR0A 2IXAA 2WG1A 3FNRA 3GPDG 4W4TA 4LVUA 4WOJA 1SCUA 3TQOA 1PIWA 2JC3A 3K4QA 1U0JA 1P1KA 2ROQA 3FTEA 4CQMD 4WOKA 4GMFA 1SOWA 1XMPA 2NV2B 2A7QA 1M2WA 3KO8A 4RA6A 2Q6VA 3HA3A 3L4EA 5HF9A 3IP7A 4LQ4A 4KXYA 1GL7A 4NESA 5JSYA 3TD6A 4D43A 3HG7A 4JI1B 1TQDA 3HO1A 5J2TA 1UXHA 1AM4D 2JIBA 5IANA 2PPLA 3BIJA 2G28A 2GPNA 2JBHA 3OMLA 1YB7A 4KSBA 5ERXA 4E7OA 3UCXA 1ADJA 1Z8HA 1NQTA 1B0PA 3DNPA 4MQUA 3WSWA 2EL7A 4IKOA 5BNFA 4KYUA 3NHUA 4NK5A 2GFHA 1JRLA 1MIOA 2I6XA 2QTBA 3JASB 4YJ2F 1P0QA 1LV7A 2C99A 4ITRC 2PCJA 4O0LA 5JH7B 3LHIA 3D4LA 2DH6A 4DT1A 5AUQA 4LOJA 1C0EA 2PGIA 2Q5FA 4PYIA 2QNRA 1XP5A 2BCGY 3M6IA 1SUEA 1NJ2A 4B9AA 2H06A 5BVHA 3G79A 1PS9A 1WY5A 4L5BA 4OA5A 3U4AA 2WUVA 4TVOA 2QWXA 2O0HA 1F4LA 3F7MA 4M0EA 5ALYA 3WNCA 4B09A 1GPNA 2D2XA 2WYHA 4MDHA 3ZZNA 4JWKA 4LC1A 5KHOC 1TAUA 3WSTA 4DREA 2FZGA 1WG8A 4OQDA 1PK9A 3IDFA 3JZFA 4YT4A 5HPYB 1OD6A 2HQOA 2RDMA 3ASYA 3V3KA 1V8FA 4BAGA 2R68A 5EGSA 1EUDA 1QE3A 2JAXA 3AOGA 1J1UA 1M6NA 3EIWA 3P9SA 4KSCA 3W6ZA 3S68A 4C3VA 1HSOA 2IYZA 1L2TA 3N39C 4KK3A 1FQOA 4YJ3F 1FZQA 5LJLA 2ZWPA 1T1EA 3PR2B 5CA1F 1NKTA 4LS3A 4KP7A 2Y0BA 1SBZA 5HS6A 5AW1A 1ZI6A 3PQFA 1CDOA 1HTTA 1L6IA 2ACWA 2P7HA 3AUTA 3AX6A 3MC1A 3A9WA 3GFPA 4HRYA 4V3BA 1L5NA 4ES6A 4K86A 1V48A 3K73O 3QVKA 4UM5A 1ODKA 4I55B 5ED0A 2JANA 5B4TA 4PHHA 2A86A 3MGKA 1EWRA 1KDZA 3WDMA 1M1YA 4HEHA 3JVEA 3L4SO 4WKOA 2GPBA 1RDFA 3C3DA 2P65A 1BDHA 4MP8A 1M5TA 2FOXA 2NXWA 2QRNA 3IOYA 3R5KA 4DCPA 2M2IA 3RKSA 3VSCA 1WD5A 2WV7A 4EAAA 5IK2D 4EFMA 5LWQA 3A2KA 4ZD6A 1R6TA 2C42A 3PUVA 3DTVA 3G5AA 3P9IA 5CCDA 3R7SA 3RYFB 4C4PA 4DUYB 2BJVA 3PE4A 3ISTA 4YUVA 4RHUA 2Y93A 4NBSA 4F3NA 3CJQA 4CTOA 3RHFA 3L4KA 4H9GA 3OBBA 2NIPA 1V3VA 3I6YA 2EWMA 1ISHA 3NV9A 3WRXA 2I4MA 3MCUA 4AS2A 4CG3A 3UJDA 2RMKA 4DLTA 4MUNA 2PDAA 1M2KA 3IS3A 1E8NA 5GINE 4W7SA 1AT1A 3KSRA 4MHOA 4FGZA 4OHUA 4X1OA 2QL5A 2JGAA 3VTAA 1EVKA 1NGSA 3S2ZA 4DNPA 1OFUA 3LX6A 2OFXA 4J16A 4NMHA 4KNYA 4INOA 4UUPA 2JCSA 2PV7A 1MB0A 2NV0A 1EG7A 1DBWA 1QNFA 2JA2A 4ZYXA 2NYRA 4HGOA 4X7PA 4EZIA 2I99A 4JIMA 2GEKA 4M0PA 1P2SA 2YRFA 1K5GA 2WDPA 1IK6A 2I67A 3DOFA 4O4HA 2P4HX 3C8HA 3SOPA 1BQEA 4NKRA 4U2CA 3NEAA 2IYRA 1ZDMA 4PZCA 2Y1EA 1TZBA 3GLUA 1I2BA 1YQEA 4XWGA 3ZY6A 2EX4A 4B79A 5IHPA 3GZTB 4BP8A 3ODPA 1A5BB 1K3FA 4ZAYA 2O8DA 3LVBA 2VAVA 1ZK2A 2H1FA 3HCOA 2E5WA 2H00A 1DARA 3K20A 2B9EA 2IL1A 4YYZA 1C0IA 2GM9A 3KWMA 2QF7A 1DKUA 3JQ7B 3R5JA 3PYMA 4YACA 4DV4B 1LWOA 1N33B 4R68A 4KO2S 3GGCA 2YV1A 2B1JA 1R4NB 2IOQA 4L9AA 3HPRA 4TT8A 4MNTA 2BRUA 3DCNA 3DAYA 3IH5A 1ECLA 4KAJA 1PNVA 3A1EA 3B13B 5JAMA 1HZZA 3T5BA 4FC7A 1XCJA 5GP1A 1KRHA 2HZ7A 2NZJA 1YU9A 2WTNA 3EWNA 5JYEA 2TMGA 2PJZA 1K7YA 2VHEA 3NWEA 1Y48E 4IQFA 4PQYA 4J3JA 4ZCIA 2FSFA 1EE1A 2C7GA 3VZSA 2YY7A 5IF3A 1T9ZA 4ALLA 4AUEA 2YV2A 1JSRA 1W25A 2DYKA 1M6HA 3CT4A 1PWYE 3OPYB 5AM4A 1OBFO 4NAUA 1ORHA 2JVIA 1UT6A 3SLRA 3IAAA 4QGGA 2ZYRA 4HDNA 1T4MA 4PEVA 4FN5A 3HLKA 1OMOA 2XDQB 4Z5XA 2O1XA 3N0WA 4ARIA 2QLJA 4ETIA 3BK7A 3R9XB 3BN3A 3MEQA 4WFIA 1IG3A 4BTEA 3KB6A 4C04A 5KC9A 4FR5A 2CF6A 3A28A 3H9JA 4J1SA 4EF6A 4PLCA 5AW9A 5M3BA 1CVIA 4K6HA 4TXMA 2QI9C 4HP8A 3KT3A 4L08A 4HY3A 1G5RA 4EARA 2YW9A 3Q0IA 3AT1A 2EQ5A 2V7EA 3PNBA 2Q6IA 4LDAA 2HFJA 3G7SA 3ZU2A 1Q83A 1MXFA 2R86A 3U4QA 4WDQA 4GEGA 3T7SA 3NRBA 3R5HA 4P3OA 1FYDA 3QYPA 4EI8A 1UKVY 1M6EX 2GYYA 4Q82A 4AKIA 2VJLA 1YHNA 2QW8A 5CR9A 1QHHB 2EXXA 3PTZA 1Y7LA 5CEEA 1D2EA 2C1XA 1T13A 1V1JA 4PLVA 3RS7A 4D3FA 2CJFA 3N2IA 2D7CA 1KAMA 1JA9A 2VZ9A 1Y81A 1Z3IX 5IDVA 1OLSA 2ALJA 4YUZA 1E1YA 2GWRA 2HL6A 2V96A 2J08A 4FD3A 4FFMA 4JLUA 4R8MA 5TPZD 4BMZA 3NP9A 4JROA 1LF0A 3LU1A 4Q39A 3K6SA 2WHXA 5FWYA 1PEKE 1EDBA 1MC5A 2ZTSA 4LY6A 3C3YA 3W77A 4H3SA 3R5TA 4QRHA 1AMUA 3D8TA 1R4ZA 2J7KA 3IDSA 4A6DA 2XKKA 1G8JA 1JFRA 1R64A 2C4UA 4FW9A 3DV0A 4KQGA 3N9IA 4Q37A 3PHIA 3R2JA 1P1IA 2JI6A 1FBTA 2UDPA 2QX6A 2A9VA 3W5SA 1LI4A 2JGMA 3LDGA 3K2QA 3UPDA 2J67A 5K1ZA 3PQEA 1MHTA 3EVAA 4ZAWA 1YRYE 4MDYA 1AXGA 1MAHA 2QN3A 3GGPA 4MQLA 4RZQA 5DHFA 3K72B 4YJ3A 2YJ5A 4FS3A 4YIHA 1EP2B 3DCYA 2NG1A 3I2YX 5IEJA 1IY2A 4TQGA 3EDCA 4I50B 3RYHB 5I8PA 2NYAA 3NHWA 3Q1KA 1ZCAA 1ZH8A 2PZJA 4IVRA 1MORA 1H9CA 1VG8A 3K6JA 3ZE2B 1ILWA 3OQVA 3OTHA 2G08A 4TL9A 3BRWA 5FBZA 1ZWKA 2FLKA 1Y1QA 3DTTA 1E89A 4KXWA 1CFJA 1H9BA 5K0EA 1J7KA 1IIRA 4WKGA 4DWOA 4GI1A 4WLNA 1EUYA 1OBCA 1YRWA 1Z56C 4M55A 3VVMA 2HX1A 4NNJA 1ZWLA 5J2TB 4R2JA 4EKEA 3A9TA 3TSWA 5FQOA 2EOAA 1DIAA 3S6JA 2DLNA 3HUFA 4A2PA 4CMKA 3WWDA 2VYNA 3VNRA 4XEHA 1DHTA 2QKYA 2C3OA 1IU9A 3HEMA 1ZU4A 2IHKA 2PQ2A 4TLDA 1DUIA 3N1UA 3VISA 1FY2A 5D86A 2NXCA 3NH6A 4RE6A 5EL0A 2IY7A 2FPOA 5ALRA 4B17A 1USUA 3PJEA 3SVZA 5B1IA 3HL0A 5A7HA 3SQDA 3ZXYA 1U2ZA 4PHFA 1DJLA 4CG1A 1N1MA 1PDOA 4ZCRA 4PICA 2Y99A 3T9DA 1GRNA 1XMVA 4WCDA 1A9XB 3D31A 3OFSA 4BDTA 3FMPB 4IOKA 2UXDB 5H68A 3HUUA 1U0NA 3L02A 3NT4A 4WASA 2BFWA 3IVCA 4O4LA 3GLFB 2JAUA 1MW9X 5DGXA 3FYDA 5AOAA 1PBTA 4ONEA 3MRSA 3FSEA 2IHNA 1HT2E 3TX6A 4CQNA 3S8MA 1J00A 3ND8A 4LEIA 3CUYA 4NCIA 1OBVA 3CLRC 3ZJYA 2MINA 2RBKA 3PXXA 3GNQA 2O8FA 1H2ZA 3I1IA 3KAPA 4JEMA 1QH9A 1E3WB 1AHIA 3CF4A 1U2PA 1NP3A 4FYHA 3RJ5A 1HX7A 5TMPA 4P7KA 1H69A 1XYVA 2H0QA 3OQIA 3D8BA 2D4AA 2ZXFA 4EFKA 1ZD5A 5BUSA 2ZUSA 4IIJA 4MUAA 3ZWXA 3LUAA 3NORA 1Z4JA 5F2EA 1ZKDA 3EBPA 5TF0A 4DCSA 1GGJA 1YS1X 4ILEA 1LDGA 4AN4A 1ZJ5A 3SSMA 3KJQA 1FA9A 3B6IA 3QTLA 4MS4B 5LB4A 5K8VA 3ZU4A 1QHIA 4F11A 3FZEA 1UWCA 3WB2A 1YI8A 2VT6A 4S1TA 5DVZA 1ZRSA 1QGAA 4DR1B 3HN7A 5E9AA 2RONA 2K2QB 5C35A 3OKAA 1O9GA 3IPCA 1SHJA 1RWQA 2YX1A 1S6YA 3A9CA 1W76A 2RK4A 4PX3A 3DH0A 4G4SO 4WECA 4QT4A 4REQB 1MG0A 1N57A 2HADA 3OF5A 4TWRA 5FLXA 2A94A 4ABTA 1T5HX 1CR6A 2B4QA 2GK6A 2YWHA 3FF4A 1GRVA 1U04A 4H7HA 3C6QA 4DDVA 5IBCA 3ER6A 2ONKA 2OE2A 4K9NA 3O4IA 1AS3A 4MJXA 5F1YA 4JLKA 3GFFA 4CMIB 4YAIA 4FMDF 1P0MA 3CRNA 5LQSA 1I80A 2OFOA 4LMBA 5FCDA 4E5KA 1TM7E 4N8SA 1Q3HA 2H0AA 3ESXA 4XSGA 3JVIA 4KPYA 3UHOA 3TNJA 4DMFA 2VWGA 1WEKA 4JGBA 2JLQA 1R0ZA 1WXQA 3JALB 3GLKA 3QPCA 1F2UA 1RWWA 5L3RA 3T7TA 3OQNA 1QCYA 2CFSA 1ZZGA 1YJCA 3L07A 4YX9A 2HJVA 3C48A 4O59O 4Q9KA 1IBKB 4O4HB 2PX2A 4R2MA 1EXNA 4TT3A 3LP8A 3OPNA 1ACLA 2PZMA 1WXGA 1KEEA 3SSAA 1K86A 3FUTA 5TXGA 1XLWA 4QHTA 2R1VB 4Q9JA 2OFFA 1MP0A 2D00A 2VQ3A 1E6UA 3QBVA 1YWGO 2FZCA 2IPNA 3A0RB 1J1ZA 3OFNA 3PRJA 3WBJA 4C6SA 4LIPD 1PE0A 4L0DA 1DBPA 1K4YA 1XD9A 3E3NA 3N74A 4L0MA 5ALFA 3VR1A 5FWXB 1I3NA 4WUVA 1XTIA 1JHOA 2D62A 4LRXA 5LQDA 5EQDA 3IEVA 3NIBA 4GRIA 5CNIA 1JH9A 2CV2A 3MT0A 3C3XA 1G3MA 4N5MA 1CZNA 2DTXA 2C2XA 1N1DA 1E2FA 1LSOA 2R7LA 3CG4A 3FHOA 3NW9A 4I5EA 5FEMA 3OJOA 4EGCB 1H8ED 5L3SA 1EK0A 3C1AA 3NDBB 1E96A 1VCMA 4Q9LA 4M60A 4QC2A 1YZUA 4I6EA 4UVDA 4CIVA 1A2OA 4ZJZA 5TLSA 1Q1GA 4B6OA 1Z33A 1LX7A 1RD4A 2GZAA 4CR6A 1X0VA 3PQCA 5SY6A 2AFIA 1T43A 2JGLA 1Z7EA 4K6MA 3RIGA 1XROA 4EA9A 5BUZA 4D6XA 4J90A 2FSPA 1YBAA 5KNCD 1Z2AA 1O2DA 1RAAA 2HO5A 1VE1A 4LRSB 1YS4A 2BZ0A 5CK4A 1JPUA 4PSVA 4DMGA 4ZHSA 4YI5A 1P4JA 3E7XA 3GAMA 2REBA 4G86A 4YRJA 1J0CA 2FTKE 4HUQB 5F51A 1M1NA 3WGGA 5LD2C 1A71A 2XDQA 2ENWA 2HPHA 5EHGA 2O8BB 1TGVA 1QFMA 3HGQA 4ZXPA 4PTLA 1AX9A 1PNTA 4GPBA 3HU1A 4OJYA 4AM8A 4OB8A 1N2CB 1T5OA 4Y6GB 4Y6QA 1ZVJA 5GOTA 3VZDA 3QBEA 4ZVPA 1XFAA 1AIPA 2P2YA 2Q4RA 2R97A 3CY6A 3GYBA 3QE0A 2QLLA 4HXFB 4RIGA 4CN8A 1TLFA 4NJEB 1EINA 2GASA 1STOA 4V0LA 3GH3A 3HXMA 3GROA 3BAZA 3C5WP 4YP9A 4A6XA 2Q5IA 2PTHA 3BIXA 5TARA 2I78A 3WP0A 3SF8B 2WZQA 4RBNA 2ZJAA 1WDKA 5IKEA 3LWBA 3IUPA 2XNJA 1R74A 2ZVPX 4KVGA 2O2XA 4PSCA 4RVFA 1WXHA 1U63A 3ON5A 1T5SA 4RX1A 2Z58A 3IP9A 1ZFNA 5EE0A 1QZ3A 2QMOA 1C0PA 4U7TB 3PLRA 1A2QA 2CXPA 3UA4A 1P4SA 1M2VA 1KXZA 3Q7QA 4JUDX 3AL3A 2TRSB 4WIAA 4G0ZA 3URKA 1SA0B 3IT3A 3E70C 4KRXA 3ETHA 3TUJC 121PA 2IE0A 3WYEA 2O57A 2ODEA 3BZUA 3HY4A 1FMCA 4F5EA 2C4TA 5K6AC 4X24A 4OHKA 2DLCX 4DLBA 1C1DB 1MMFB 3SFVA 1XK7A 2JGJA 1W1IA 4W5WA 4DNXA 1JDNA 1G8GA 1I2ZA 1FYXA 1QH8B 1UDCA 2GD6A 2IUSA 3A4VA 4DMCA 5K05A 1GAXA 3VHRA 3EMBA 1E2BA 4Q6WA 1PR2A 4RTOA 5C8YA 3HDGA 3DMDA 2B3DA 3PA8A 2JD2A 3WL5A 5EJGA 4EUEA 1YMVA 4DT1B 1QQTA 3UBTA 1BX1A 3G2LA 5F5LA 3IOCA 3I05A 4Q9DA 1XVAA 2WIBA 2X2EA 3TRHA 3MELA 4JLWA 1SKUA 5EHNA 2ZRNA 4LQDA 2ERCA 2J5XA 5E7JA 1CHNA 2PHZA 2VEOA 3PS9A 1SXJE 1JFTA 5BVGB 3AC0A 3A6EA 3FCUB 4JFAA 5G02A 4DCUA 3SYLA 2CL7X 4MGKR 4MKHA 1R18A 4U63A 5KDLA 1RQPA 2H2DA 3UT5B 1AZTA 4NJMB 5JAZA 2J0VA 4HVTA 1D6MA 3LLUA 4GNRA 1UJNA 4AJNA 4F4FA 1Y5LA 4QGFA 1QQ5A 1V11A 2FZEA 3CZ4A 1AKWA 1QE0A 3R3SA 2BKAA 1NC1A 4P86A 1UBRS 2GCIA 2RGCA 3SPXA 4WWHA 3LFTA 1KYWA 4OAQA 3OZGA 2DBQA 4GYWA 4IG9A 4TX1A 3IBSA 4LE0A 4OYHA 4D80A 4F71A 3OOYA 1AY0A 2HBZA 4FK8A 4QU5A 1ZIDA 1JIIA 1DIGA 4RIEA 4RTSA 4W5RA 2QTLA 2OGUA 2PJUA 3UMJA 3QUCA 1XCGB 3MQ2A 3GQVA 1I30A 5CCBA 4YBRA 3JTMA 3F5QA 4F97A 5AK4A 1J2UA 1VI5A 3LO5A 1QO9A 3ANLA 5BSHA 3WMXA 1IUNA 2NNWB 1TYBE 2FRDC 5DT2A 1JZSA 3MAJA 4LBZA 1JQAA 3LNCA 2FVXA 4X7MA 3V4VB 2R9VA 1R2QA 3KFLA 4AG5A 3WGKA 1TK3A 3OKFA 4UUMA 3A9VA 1I9GA 1X7WA 1Z16A 1JKJA 2CE2X 4UKDA 1NZJA 4AWBA 1WDLA 1MU0A 3MB5A 2EF0A 3AIKA 2F1HA 3EGWA 1G3UA 4ZV4A 1IN8A 4XWAA 1RR6A 4QYIA 5A06A 1IPEA 2DUUA 3ZTWA 2JDIA 5ANRB 4E03A 4H6PA 1ZMTA 3ONWA 4FFLA 4B6GA 3LLMA 4KXNA 1AUXA 1R5NA 4V0ME 5HEKA 3E4CA 3B7PA 4B73A 4X1YA 3L0DA 1PVVA 1HI9A 3FUXA 4CBVA 3AERB 5HJEA 4RELA 3IESA 3UMFA 3U49A 3G23A 4QTTB 4MHSA 4FBMA 1Z35A 1JI3A 5EZSA 3NVMB 4GUDA 4F9FA 4PGFA 2RBEA 1NVAA 1PZFA 4EMSA 2NV6A 4B7XA 4AU1A 3NEPX 2IOFK 3WDSA 4F21A 5F77A 4DLKA 3THWB 3L40A 5KYVA 1TQ8A 4TSKA 2XMCA 3RAPR 4A0QA 3MTEA 1GRRA 4P2BA 1WKCA 1YQQA 4JQZA 4OAPA 1E2LA 3DL2A 4CEHA 3C70A 3RM3A 4FQ5A 1NJGA 2YN4A 3NPMA 1Y3DE 1LW6E 1VSBA 3K09A 3SMVA 1G5QA 4CG0A 4J8PA 2XQFA 3UG7A 4JBIA 1RABA 2E82A 3AG6A 3B60A 5CMLA 5FAKA 1VG1A 1YL7A 5COQA 3TZLA 1PSDA 2FE4A 1KDOA 4D0SA 2WJJA 4XVUA 3IE2A 5LYJA 1I10A 4QUAA 3V55A 2BGLA 1OA0A 3NIDB 3RR2A 2W2MA 4BNHA 4E15A 5F9HA 1TYEB 1JLKA 2GO1A 2ZTLA 1FSGA 2PQMA 3BORA 1DAMA 3O82A 4R1MA 4Z1MA 4MA4A 1PI3A 2RHHA 3DM5A 2VOJA 5H9VA 1UANA 3L7NA 1PHRA 4ZCTA 2IPXA 3PCTA 3OJ0A 2ZJBA 2RAVA 3OZDA 4HMPA 1VXRA 1DUSA 1G20A 5ER6A 5E8RA 3VDNB 5KNDH 1L4LA 5TEWA 3MERA 2F3TA 2DUJA 2DHEA 5JPIA 4ZMSA 3H83A 2QS9A 1JT9A 2NO0A 3A1VA 2W2LA 2FUNB 5M34A 1NBMD 2OR3A 2A7XA 1JI0A 2NN3C 3QE4A 4JBNA 4DV5B 2DFDA 5HE9A 2AOWA 2GFIA 2VH2A 4UMEA 1SXJD 4N3GA 3F2VA 5AXAA 4PTZA 4I9FA 2HCRA 1DWOA 2Z2IA 4ZEVA 1TJ3A 3T7DA 4E51A 2B4YA 3OQJA 2AYYA 3HJTA 4KUEA 4OJTA 4WNCA 1QIKA 3A6GA 3DOEA 4LCJA 2ZZMA 4K87A 4KITB 1FFEA 2X9LA 3D1JA 4GR5A 1IY0A 1RAHA 1VGQA 2VSFA 4CDNA 1I2DA 2XCTB 3HXTA 5ECDA 3UXEA 4GLJA 7GPBA 4M54A 1KI9A 1YAHA 2GUGA 2CVFA 2CFTA 1OWPA 1M6WA 6YASA 3NBZC 3KEQA 2ZIEA 4P4LA 5D7BA 4ZALA 2GZ3A 2VNSA 1UJ5A 3K53A 4Q7EA 4YI3A 5FOTA 3ZQ4A 3NTQA 4F9GA 4ZJYA 2ENUA 4RM3A 1KQFA 4KQMA 4C20A 3RRJA 3VSDA 1NVMB 2GD2A 2VRBA 4PHTA 5DNDA 4DCVA 3SVTA 3ZUPA 4BCDA 3G0DA 3O83A 4TGLA 2F1OA 1TUBB 2H4ZA 2ZT6A 3EG9B 4ZC1A 3O74A 5F73A 3VTFA 1YZQA 4O3MA 5BSKA 4LYHA 2WPDA 5JIBA 5AKEA 1I5OA 4NHOA 4BASA 1NUHA 3GOQA 1PR5A 3G7NA 4ZO9A 1G9TA 1P8JA 5AM2A 4TMKA 1C9YA 2FWRA 2NTYC 2DUWA 3A3KA 1XZFA 1XXHB 2QGNA 3IAM6 4MRRA 4CMEA 5BWOA 2NP6A 1US8A 1YTLA 1U8UA 2YYYA 3UMSA 5F2OA 2UUAB 3U31A 1J0AA 2P2DA 1HDGO 2PZFA 5TEVA 1N2CA 1YUMA 2PSFA 1H66A 4L8YA 4IY1A 4R5MA 3NRJA 4WY8A 1IONA 2ZS8A 3QPDA 4NABA 3NVDA 1AKTA 1SHZA 5AJTA 2P40A 4GGPA 2ZSIA 1ZISA 5F7JA 1TI7A 3JSXA 3NCTA 5C5CA 1Z2PX 4DADA 2Z4SA 5SV2A 1N5MA 2HWUA 3L7JA 2W6IA 4U2EA 3RC1A 3ZXSA 4GSKA 4ZYZA 4RGYA 3FWPA 2ECKA 1K5DA 3AUYA 3CG0A 4LNHA 2B7CA 5DOVA 4DLYA 3KQTA 3ANMA 2C54A 4F4HA 2V7QA 1XMJA 1M1XB 4IF4A 2NO9A 2HF8A 2YQ4A 4P1ZA 4WOBA 1DT3A 1VLMA 5AOBA 1UBGA 1X13A 2QTCA 2ZOSA 3BIOA 4L7QA 2FVYA 1O95A 2HF9A 4FONA 4MLCA 2ABWA 5DV9A 4BVBA 2VUIB 3R8FA 2BSXA 3NNNA 2Q6KA 2CYAA 4X63A 4ZP1A 5KOHA 2FPSA 2BUAA 3IA7A 4U5QA 1B76A 1F20A 2WD7A 2LZ0A 4JX9A 4PHCA 1UXKA 4PQRA 4E30A 2N75A 1T0BA 4FKBA 5EFOA 5ALTA 1RM3A 2JGDB 1W4LA 2XOKA 4R54A 5IS2A 2VEDA 3IEMA 4MKFA 2ZTUA 4FZVA 4GP6A 1ECJA 2DKFA 2O1WA 4POAA 1L9KA 3CF4G 4ZT2A 5EFZA 2YDXA 2MYNA 1J7JA 2O2SA 4XGQA 3BJIC 2VWQA 2WUDA 2ERYA 1YF3A 4BXOB 4X8HA 4RDHA 1H2HA 3RHZA 4QRIA 2QR3A 2R48A 2WV9A 3AHIA 3BX1A 4YRDA 3TW0A 4LYYA 2J8ZA 2GGSA 1OVGA 2X0KA 3K1AB 3TQIA 1QYVA 2BFDA 2PQ0A 3PWZA 4A5SA 1ISMA 1V7CA 8GPBA 2ZPAA 5I7WA 1E32A 3R23A 2WU1A 3O8DA 4OFWA 4XYLA 1VZ3A 2NACA 4OB6A 1PR9A 4FMCF 1D7OA 1B93A 1FUIA 2PEZA 3CUEF 5LJIA 4FZJA 2A58A 1NUPA 4YAJA 4XYMA 2KS6A 3WICA 5KU7A 4YONB 3UV3A 5LR6A 1VB5A 4G5SA 3T15A 1N8TA 2VLIA 4RM2A 1GNQA 3VOAA 5CGQB 1O0CA 2P3SA 4NULA 1CERA 2R47A 3L06A 2AEEA 5FI1B 4YAUA 4Z7JA 2FH5B 2HIMA 1DOZA 1R9MA 1XF1A 1IVYA 2IPOA 5JLAA 1JDZA 1U8CB 3GRAA 4LZJA 1TCAA 4C05A 4A1FA 2NZXA 4YVFA 3SJAA 1EG2A 2PK3A 4U3JA 2IP4A 3GLVA 5DBFA 2I7CA 3U0BA 3FNGA 4BB9A 4D3DA 1QYXA 3QF7A 1UC5B 4NY1A 3R0JA 4XGRA 2PEYA 4B85A 5KJFA 1CLUA 4IX9A 5T4HA 4FHEA 5LKAA 3UJ3X 1OUMA 2YHAA 4Y2JA 4LG1A 5AHOA 4Q4HA 4ROTA 2QG9A 1ODSA 1U0EA 5BYBA 5F5NA 3C4QA 4MS4A 1V71A 4C7VA 2FWJA 1TF5A 4YGYA 4E5NA 4NS1A 4M2LA 5H82A 4S0ZA 2NXEA 2IYUA 3G9XA 1BJRE 1H85A 4IS3A 3PGMA 2OHFA 4QYTA 5SYMA 3W6OA 3ORHA 4ZCLA 1I24A 4C0KA 1G41A 3JD3A 4ZAFA 5B3KA 3VPXA 4A0HA 2QD5A 1U0BB 2KW5A 3QVTA 2BONA 3PJFA 3RSHA 3IYLW 3EIXA 3ES9A 2AKYA 1KSHA 3KZXA 5JAPA 4R3NA 5IVDA 3WLHA 4C7KA 2CBXA 4L22A 4X8MA 1G38A 1GKKA 2WWIA 3QX8A 3HJUA 4O0MA 2RCYA 1AK2A 1OAOC 3TNFA 2PV0A 3LVFO 1KQ3A 2AEMA 1NWCA 3ZZMA 4PSDA 3WMWA 3EASA 1H4VB 5FTWA 1U5AA 4G01B 4OHYA 2UVPA 1VQ1A 2W93A 3IP6A 1ONNA 1DTSA 4R9UC 3RIXA 1T3GA 4AI6A 4D5EA 1PWZA 1XUOA 2DBZA 1M8PA 2Y2VA 2Q6TA 5DNYB 1SOMA 2GCEA 5JR3A 2ZRPA 4HZIA 4QUHA 2D1YA 3EZ7A 4IDDA 1O5TA 2QVYX 1WM1A 5IN5A 1ECPA 3JPWA 4JEUA 2OPHA 5EINA 1K0FA 1NQVA 1QKKA 2HN9A 1U5BA 1XJ5A 2V7QD 2ZJ7A 4JLMA 1AJEA 1ZZEA 4IMJB 4NCKA 4PO3X 2ZJ1A 1V95A 4RV9A 1NR1A 1U8AA 2G3YA 1EVJA 1DCMA 1FDTA 1FJHA 1U2GA 2XA1A 2B1RA 2YZMA 1X3LA 3B1FA 2WSMA 3KXIA 4YFYA 5E4YA 5AW5A 1DO2A 1O3YA 3E23A 2W2PA 4LOLA 4AN0A 1XRMA 1OGJA 2COEA 4A10A 4DARA 3JZDA 3LH5A 5J1SB 3CNOA 3IKTA 3Q9UA 5TX7A 3QXJA 4D8UA 2OTCA 1XQ6A 5CFNA 1R0LA 2BH9A 4J6EA 5JS6A 5FTLA 3HB5X 3C1UA 1QH0A 1XZIA 2JEOA 4OHFA 3QE2A 2B83A 2IYLD 4GPTA 1N0WA 1XN1A 2JBAA 4D8XA 1W73A 1ZNQO 4JFRA 3RFFA 1KWKA 1R5JA 1UFKA 2E6UX 2VSQA 3LCVB 1OKKA 1ZIYA 2GT1A 3F71A 3JY6A 3W3AA 4J7XA 4QZVA 5L3QA 2BW0A 1SHLA 1DBRA 4BVEA 3UFXA 3CJTA 4Q1FA 1H65A 2B37A 2EKZA 2CXOA 4YJGB 3QRWA 8MHTA 3O38A 2QUJA 4ERXA 2XI4A 3KZVA 5BV7A 2XLCA 3PE6A 2P8SA 4WSOA 1YU6A 2H07A 3ZWBA 1PLLA 4O2BF 2IS2A 5BW8A 2GKSA 4YA6A 1ZIOA 1SVNA 4I9UA 4MLPA 2MR5A 1NX6A 4EGSA 4NBLA 5LOVF 3C8ZA 1UFRA 4P32A 1W4ZA 4RE5A 2FGKA 3M34A 3K70B 2ILVA 3LQRA 3LZ6A 4BLQA 1E9SA 1P7ZA 1USIA 3QELA 4AMYA 3NONA 4ZI2A 3THXA 1DDOA 3DAFA 3AJ9A 3E7DA 4KIGA 4UQOA 3MUEA 4L9RA 2JJ8A 5C31A 4V0MA 5ALPA 1R5BA 3IUEA 3DHNA 1W48A 4M0LA 3PGA1 3AVPA 1Y1KE 3GT0A 2CHUA 4OMFG 4C89A 3FBTA 4LE2A 4C0SA 5K8IA 3L8GA 1GNSA 1ZQ9A 5DISB 4BE7B 2FRDA 1PQUA 3BBLA 3Q3CA 3CW8X 3TWOA 3SY8A 4AYTA 4OK3A 5JSZA 2B20A 3R4CA 1K3UB 1AUVA 2I8AA 4IV8A 4KFSA 5A03A 5CDFE 3ZW9A 1O4VA 2SKDA 2ZATA 2BOVA 2EL9A 3L1HA 1DKPA 2HLNA 1XCOA 3CZQA 2HI0A 4JL8A 3TEJA 1JG2A 2CLFB 2G70A 2WABA 3JPYA 3L3BA 3NBFA 4M4SA 4TKVB 3TDMA 3QHQA 2BF4A 3DTNA 3ZWKA 3MWYW 3VYVA 1DTEA 2J09A 2DPGA 4ZDIA 1JDTA 3TH5A 3Q9SA 1KDYA 2GF9A 5LZ4A 3B36A 3BJMA 2BTEA 2E48A 2ARKA 1CNFA 1XZKA 4OQNA 5K3FA 2O8EA 4WLOA 1AKMA 4PLTA 5C8YB 1L8OA 4EX7A 3NOXA 4HYTA 3ZTYA 2I5PO 4YROA 1IVNA 2YC2C 3L4BC 4TS1A 2JNWA 3U09A 1IHOA 2FSSA 2XUIA 5EMLA 5AQ1A 4MRMB 1S8OA 1V26A 1V5GA 4ZEWA 4DDTA 2C7RA 2Z6UA 2E2WA 3D8RA 1FMTA 2YFHA 4NP6A 5SYAA 3I1YA 2ORVA 3HI6A 3ESCA 2GNPA 2QR2A 2A5LA 2ZAYA 2IU0A 1WTAA 3GV0A 3HCFA 4QD3A 5L53A 3O75A 3KKKA 4KUHA 4YJHA 3USCS 3ORFA 3RU2A 2C9MA 2OO3A 2WFAA 4HLUC 1EEHA 2FY8A 4NOLA 2OD9A 4QXOA 3EXG1 4UVIA 5ESXA 5B55A 2OOKA 3FPAA 3ZDYB 3WWOA 5JJBA 4A3SA 1SC4A 3CF2A 2CLOB 1KYYA 4ZAGA 3KX2A 3IQEA 5CIQA 3LYUA 4IIYA 3RYCB 3RAFC 4ZVQA 1HPLA 4DSNA 1CE8B 1PO7A 1PJSA 3B51X 1DG1G 3FYHA 3T1TA 1DP4A 1RRPA 1DCFA 1DXHA 4IIDA 3M0EA 5G4KA 3U0VA 4MR7B 2HWXA 3FMGA 4KVFA 2OD7A 3UJAA 1A3CA 3VU3A 3WIOA 2X9VA 2C94A 3ROKA 2DQYA 5F33A 1VE7A 4UUOA 1BWSA 1B41A 3TKLA 5I7FA 2JCBA 4AJLA 1OTYA 2GVZC 5A5DA 3IMGA 1J5XA 2C83A 1QB7A 3PD0A 1RHQA 5EZYF 5B7GA 1IEXA 2M1XA 3FZGA 3I32A 2C61A 3OX3A 4KWCA 1YASA 1BN6A 4Q4DA 2O8FB 3RIHA 3REGA 3EH2A 4LVOA 4EI2A 4JOSA 1QK5A 1IZ8A 3RBAA 4F2DA 1A4XA 4X65B 3C5VA 2PVPA 3F5FA 3GD7A 3OC6A 4GS5A 4XCQA 5CDGA 3UAYA 4BQPA 3A10A 3IHKA 1JDSA 5EE5B 2BFCB 3ZJ4A 1UJBA 1XZQA 1XOIA 1EBUA 1UZUA 4C08A 3BMOA 3HE3A 3W6UA 2J5QA 1TVKA 1A88A 3EIFA 5EXSA 4ENQA 3NOVA 2FPUA 2P9JA 3FTPA 4QYIB 1EDOA 4LV5B 4RQAA 3U3XA 1LRJA 5AJYA 3U3JA 4CT4B 1H2XA 2PUJA 4Q4AB 5KZMB 3FTDA 5M5BA 1PSWA 2FSGA 2Q5LA 1MV8A 1W4CA 3OFKA 4PO9A 2W8ZA 1E1RD 4Q4HB 3JQGA 3JQBA 1MB2A 5IAGA 3QXHA 1QSGA 2EKBA 3ZHYA 3ZJVA 1CQJB 4M37A 1Q3TA 4OH1A 3UK0A 3CH6A 2O8NA 1TMGE 3PQDA 1V3TA 2VK1A 1DMRA 4Q24A 3TG8A 1Z4LA 1DC6A 4J29A 4EL5A 3THWA 3NZEA 1VMDA 1N5OX 1D2HA 1E6LA 2ZRGA 3EDQA 4HDMA 3GRVA 1JG6A 4KNWA 3ZCVA 3MQ4A 2RK6A 3CO5A 3E9RA 4Q6BA 4S1OA 2Y6UA 3O1LA 1X80A 1Y3BE 2PX4A 4KQEA 4PIVA 1IXSB 1EZ4A 1T2DA 3GJ4A 2Y1KA 4AJOA 1QHGA 4PANA 2JFVA 1GUZA 2H54A 2XVMA 4GPEA 3RW9A 4MV5A 4WINA 3JQCA 5HZMA 3GCXA 4FS8A 1K7SN 1F2UB 1PEAA 3NHKA 1VBFA 1J2JA 1W34A 1T4CB 3VYRB 4TLMB 3DLIA 3V1LA 1RLJA 2MSEB 2IYYA 3DQPA 2VT7A 1Q5PA 4TROA 3R75A 2XODA 1GN8A 2RGWA 2QZ9A 1YVEI 2Q2VA 1KEEB 1OXBB 2IP2A 1SIWA 4TMFA 1SULA 1QR2A 3GUUA 1FNDA 3OTQA 1OXMA 4YO7A 3H4VA 2G1KA 2XUFA 4M6WB 4G0QA 1G20B 4LXXA 4TKUB 1DZIA 1RCUA 1QFSA 2VZEA 4OXXA 4PLYA 3WR5A 4C5CA 1IXKA 4BP3A 4MQEA 3JYPA 2Z5VA 4Q0MA 3PI6A 4MKIA 5IM5A 3GT4A 3QNUA 2W0SA 3BFPA 2OO5A 5U9CA 3QMPA 3STUA 3ZIDA 4QLBA 1K8ZB 1THTA 2ZUDA 1PJRA 2B98A 2I4IA 3BJRA 4GZLA 2R8XA 4CL2A 3GJ8A 5DLQC 2RI1A 1GFZA 4GX0A 1AGYA 1GG5A 2C7VA 3MPUA 2P6NA 3HRHA 3N8DA 5AVOA 1A7JA 1NXSA 2PLWA 2X15A 1ZGBA 3S2EA 1YZFA 2IEAA 5CIYA 3PT5A 3WA7A 2BGJA 2NVBA 2Z4TA 1XK6A 4HN4B 2QMQA 1Y6RA 3PWSA 4Y1RB 4B3HA 4FB5A 4W8GA 3MHTA 3PHLA 3K1ZA 3L84A 4GT1A 4LGYA 3L7CA 3QVOA 2EZ9A 2WVHA 3CR7A 4MR9B 5DNAA 4YMHA 3PNLA 5ALXA 2AFIB 1R0CA 4P92A 4EP1A 1HV8A 1ZYUA 1RJDA 3HUEA 1QZUA 1E7QA 4K6GA 4OJKA 3B38A 3TTXA 3WFIA 3NU1A 4FJ0A 4UULA 2JFXA 1HOTA 1GG2A 2V4UA 3G9TA 1E9BA 1V9SA 3IFSA 5EG5A 3TZQA 3VPAA 5A3RA 1QQBA 2YHBA 2MTBA 3HR7A 3PNSA 3MBOA 2DSNA 1J2RA 2VDLB 2DULA 2XMGA 4ZGBA 3ZHQA 2RGUA 2X4LA 3THOA 1M1NB 1Y4DE 4NFLA 3H2SA 1TZKA 1E9AA 1U8YA 3DE3X 5D00A 3RWMB 3HRIA 3V46A 2IUEA 4AVYA 2W6CX 3KUKA 1TYCA 3TLXA 1AH2A 2QUIA 2CWDA 4K8OA 4LK3A 3RWOA 1UOPA 1JVSA 1ZOOA 3HRKA 5HCUA 1ZQ1A 4I1SA 2BV3A 2SKCA 2PMEA 3ZWQA 3T35A 4BE4A 5BUQA 4EGAA 4FILA 2B4KA 1I32A 1IHPA 4PZEA 4ZT5A 4C76A 5A6VA 1RXYA 4JHLA 2JGFA 4PXAA 5FPTA 3S5JA 2OILA 3ITKA 3MPOA 1MAAA 3IO5A 5CGZA 1DRJA 3SI7A 4NJEA 2IX3A 5B3JC 4JUBA 1XTPA 3LBHA 4UEQA 2BGRA 5EJ2A 2VCYA 3ADBA 5HJ7A 1NFFA 1K6JA 1OH8A 1C8BA 1E3TA 5ILOA 1HMYA 2FMKA 4IOJA 4TQ9A 3LCMA 3VYUB 1CB0A 3CPJB 2QGZA 4JT2A 4Y0VA 3SEAA 5IVIA 3B5EA 5KSPA 1Y8RB 2QX9A 1ATZA 1TOAA 2HU5A 1XYYA 1E4EA 1Q16A 5J47A 1M2VB 1YONA 3MILA 1BE1A 3DJFA 1P2VA 1TLTA 3CNEA 3JX9A 3P2OA 4LI3X 4UE3S 3I5UA 2DC1A 1AO3A 3HXPA 4V0KA 5BNTA 3CV3A 4X44A 3WGYA 4N0DA 3I6QA 4NDAA 1A9ZA 2VHWA 4TSRA 1BWPA 2BM9A 4YHHB 1YQUA 3BQNB 3OIDA 5GM2A 3MJTA 5BN3A 1TW3A 5FFNA 1BDMA 1U99A 4FDTA 1QYCA 5BNWA 1WDWB 2Q1UA 2H1CA 1I7NA 1SCIA 3IQGX 3R8CA 3IT0A 2I22A 2MMGA 3HKBB 4JI3B 3G88A 4MV8A 3UK6A 3WV5A 2VXYA 1E7SA 4QUGA 1GKUB 1U1GA 2O3QA 3UQYS 2O8EB 1U3UA 2VRNA 1JEDA 2W2KA 1DAKA 2C1ZA 5ARCA 2HC9A 3G0GA 1PT7A 3X44A 4DG5A 1QOPB 1I7SB 5HTOA 1F8YA 4Z54A 3OM9A 3A27A 4OI2A 2IHBA 5F98A 2G25A 1UWLA 3FD8A 4CNBA 2GPWA 1JHZA 2F00A 5ILQA 2Z4RA 4ZI7F 1F8XA 2JD1A 4EELA 4HJRA 1XZCA 3E2PA 4KXMA 5DTRA 4KXFB 1U7PA 1ZA2A 4HZUA 5J5CA 3K1AA 4PZ0A 5LMNB 4KR6A 5BV8A 3DWFA 3ZY4A 2DHDA 4JYCA 2ZS9A 4BQRA 5HUHA 1KPHA 1V11B 3QITA 3UY4A 3ZDRA 3LHFA 2NU9A 4BBZA 3CVXA 2JK1A 3OBIA 1RC1A 2QPTA 4L78A 3SBXA 4ZTUB 3ZD8A 2XTJA 3EY4A 1CUIA 1CD5A 1Z4QA 2HLHA 4UUNA 2J3JA 4WBSA 3U4HA 2JVKA 3OE4A 2YZ2A 2ZETA 4URFA 3NALA 3X1WA 4QM7A 2J0UA 3RYCA 1P0FA 3BEDA 4ISBA 4DIMA 1JG4A 2QHXA 1PS8A 1Z17A 2C2MA 3AR5A 3H5RA 4M83A 3IOBA 3HHEA 4RIFA 3Q11A 3TE7A 3QVSA 4QREA 3ZHZA 1RTKA 1MQAA 2B8WA