4FL4B

Scaffoldin conformation and dynamics revealed by a ternary complex from the clostridium thermocellum cellulosome
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
165
Chain Sequence
ASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Scaffoldin Conformation and Dynamics Revealed by a Ternary Complex from the Clostridium thermocellum Cellulosome.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Protein binding
molecule keywords Glycoside hydrolase family 9
total genus 35
structure length 165
sequence length 165
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fl4B00
1ZV9A 4U3SA 4FL4C 5G5DA 3L8QA 3GHPA 2B59A 2VN6A 2CCLA 4WI0A 2Y3NA 4FL4B 5LXVA 4UYPA 2OZNA 4UYQA 3F2LA 1OHZA 4N2OA 2O4EA 3KCPA 1TYJA 2BM3A 3KCPB 2VN5A 2W1NA 3BWZA 1AOHA 5K39A 4DH2A 4WKZB 4UMSA 1ANUA 2JH2A 2XDHA 5AOZA 3UL4A 2VO8A 3FNKA 4IU3A 1QZNA 4IU2A 2ZF9A 1G1KA
chains in the Genus database with same CATH superfamily
4I3SL 4G1EB 4X6CB 3LNFA 2CCLA 3VFMA 1LWRA 1D5MA 1N64H 2B2XH 2FHFA 1I9RL 1WBXB 3RZCA 2OI9B 3CPLA 1UXMA 2NY3D 1HOCB 4QXVA 1FZKB 4ZW8A 2SODB 2D3LA 4F8OA 1H0DA 1UM6H 2XG4B 5GGQL 4UTBA 3NP4A 3WJJA 4JG0L 2JJSA 3ZHNA 4HJJL 3VFRB 4DJMA 1DHKA 4YSAA 1P7QA 3D2UD 4H1LA 1C1EL 3IDNA 1G43A 4IIZA 1YYCA 3S35H 2WXKA 1MIMH 2DQHH 4M48L 3FCBA 4LIQH 2Q1EA 5ITBL 5T1DL 5KWYC 5CD3A 1G7JA 2RBLA 4TVUA 1TTUA 2X05A 1FJ1B 1MRCL 2DWTA 2OMXB 1J1PH 3BWUC 1S7TA 3B7UX 2I7SA 4TULL 5AZEH 5ALBL 3WY2A 4NUJA 3QNFA 3T0ED 1SUJA 3VDAA 4K94H 2YJLA 5DZOA 1MH5A 4AYDC 1RUPH 5I71C 1PEZA 5EZPA 4N0RA 3SYQA 2HFGH 3L3JA 4LARH 2VDQB 3CFBA 4YR6A 4NC2B 5J6GB 2X42A 1ACXA 3RDTA 3QCUL 3ZW3A 5MHSD 4RRPA 5ERWA 3CFBB 3W37A 1R5VB 3G04B 5CD5C 3H0TB 1JGEA 5K33A 2DTSA 2X9YA 3LIZL 5GGVH 3WXVH 2XXFA 4IOFC 1BAFL 5G4NA 2IGFH 4AIZA 1D5IL 3RVUD 2BS8A 2J2ZA 4XNMB 2GTZB 3UIYA 4JO1L 4KITB 1GYVA 3MJ7B 5E9DA 2UZXA 3DJRA 3PWPE 4L8CB 5CUSL 1MXGA 2EIDA 3BJLA 3MRQB 4WWKC 5DJCA 1RZJH 2ARJB 2G75A 4JRXE 5F6HJ 1IRAY 4OCLC 1R3KB 1P4IL 1BMWA 2ENJA 1KJ2B 3OZKA 2ADFL 5FW8A 4RFOL 4M6NH 1U8OB 1XH0A 1A65A 4P5TC 1C5CL 4QRAA 4RWYH 3IDGB 2YAEA 1EO8L 5F7DB 2MJWA 1PY0A 3CDGA 2B77A 2QSCH 3P30H 4ZNEE 1D5MB 4OFYA 3B2VL 2AK4B 4FQ1H 3HI1B 3L1OL 2AJUH 3US1A 1D2OA 1FAIL 5ANMA 2MOGA 1HHIA 5HHVH 5DHYB 4B9YA 1QA9B 2BVUA 3H9SE 3JTSA 3VI4F 1CLZL 4Y5VA 5C09A 3PQYE 1Q0XL 2B9BA 2QV2A 5E1AA 3QWRA 3BKYL 4P2OB 4G9FD 3V9EA 1RK7A 4PJFB 1BZOA 4N3TA 3UBXI 1M3JA 5EN3A 4J8RB 5LNDA 4QO1B 5J1TC 1SOSA 2CMRL 1PPIA 1WAAA 2HB0A 2AQ3A 4G8GD 5JW4Q 5HYJD 2CCVA 4MKTA 3BAEL 3OM3B 5EU6B 5FIEA 3AM8A 5T3XL 3BO8A 3R06A 4NPKA 4WFHD 4NN5B 3QFJD 3GMPA 3PLYA 3BDYH 2JJVA 1I1YA 5E1HB 3V5KA 1D6EB 4YS4A 2PTVA 5ANME 1CDHA 3PL6C 2VITA 1UB6B 4IHOB 5D2NC 2Q8BH 4X7SH 5C09D 1DBAH 3QGVA 3DVGA 1B0GA 1HAWA 3DI3B 3PXJA 4G8EA 4R3SB 3EDKA 3RWGA 3SD2A 5ISZB 1U2HA 2UY6A 3MCKB 2EP6A 2ZUTA 5H35A 1CE6B 4FQCL 3LSOA 4NN6B 5HGHB 4D7BA 1A6TB 4CKVX 4MAYA 1T83C 2IWFA 4Y4FB 1V3LA 1JK9B 4PVMA 2DN7A 4DK3A 3QG7H 3G6DH 4OZ4A 1DLHB 4H2CA 2F58L 2GB2A 4HIHA 2Y07L 3LHPH 1GYAA 2OLDA 4HH8A 4U3XA 2WNGA 4PJ6A 5ABAA 2NY1B 3WNKA 1CXFA 4HKZA 3GHEH 1YEJH 3ZO0A 2E7CA 5SWZE 3CFCH 1DO5A 1GY2A 4DO4A 3FCTA 3LH8A 2DQCH 2DQJL 4LEXL 3BIAX 3P4LA 4P46C 2MNWA 2XWRA 3GS4A 4OLVL 4A6YL 4NRZB 5JIPA 2BMKB 5FWQA 1QSFD 4UBDD 3EBHA 3HMWL 2ERJB 1Q94B 4FYSA 3PABB 3VWJA 5FYJU 2DB8A 5AAWC 2HG5B 1K4CA 3SDXF 1KLUB 5HJ3A 1XHHA 2AABL 2KKQA 4P5SA 3W11D 3QJZA 4LGRB 2AJVL 2G0KA 1Y6NR 4PY8J 1BM7A 2OS7A 5IM7A 1W0WB 2HLFD 1KJ2A 3ZU8A 3QUYC 5C07A 4PV1C 4BZ2H 2R0ZH 4QJ5B 2J1YA 4B0MB 3DMMD 4NO5B 4MMZA 3MRCA 4LKXB 2XZAH 5AVUB 2HWZH 2FUQA 2BS71 3DX8A 3WIFB 5I6NA 3M1CA 4F33B 2F8OA 3LRLA 4A7UA 3WUWB 4KK6D 2VUOA 1KB3A 5HI5D 2VLME 2B7DT 3D6GA 4CAGA 2BHFA 4CDHA 1LP9E 3GTVA 2CHZA 1BQHA 5E9DE 1BGXH 1C5BH 3WO3B 1OF2A 4NN7B 5ADPH 5JORA 1O6TA 2CSPA 2IIJA 4ONHB 4Y5YC 3AT0A 3TPUA 4N0FB 2ZOTA 4RFNC 3TESA 3FUEA 4M9PA 4YDMA 2FBRA 4ZS7L 4JM2C 3HB3B 4Z0XB 3AUWB 4PYGA 5D4IA 1A21A 1FNSL 2DBLL 3DX2A 4NKIH 3FQNA 4YDVB 1XGTB 4F8LA 1I53A 5D7LE 3SPJA 3UMTA 1P7KB 3CG8A 4HCGA 5D4HA 5C0BD 3LRSB 2CCWA 4AGQA 3SGKC 2ZONA 1T4KB 4BXVA 4XN1A 3VD1A 3KWWA 4PRIA 4XAWH 2OYLA 4Z7WE 4Y7MA 1JZJA 4ICXA 3N0AA 4I88A 4FFYA 4P2RA 4UNIA 2OBGA 2IANA 4M3HA 3S96B 3S36X 4NP4H 3LCYA 2J1ZA 1FFOA 2RR3A 3C2AL 1NGQH 4M6AA 4DGYH 2HT3C 3BUTA 3O45A 3FTYA 4G3YL 1X5KA 5IK3B 4TSBL 3V0WL 3ZT6A 1QFWL 3V9FA 5DD1H 3ZTNL 3VFPB 5ID1B 1S78D 5DEJA 1RULH 1FL5B 3K0WA 2XJKA 5C0BA 4NNYA 4C4KO 2DKMA 2Z93A 5JMOC 2HKAA 5K9QI 2J5LB 3Q1SL 4HIPA 4H20L 4OLVH 4PY7A 4A6YH 4AYFA 1NJ9A 5AVZB 1EO5A 5C0RH 2VH5H 2IXQA 3U30B 3DMMA 1A9BB 1IC5L 2P5WA 1U8IB 4YDNA 3EIFA 2LVEA 3UABA 2WKOF 1JRHI 4HX1A 4XC3L 1LEGA 3L3HB 4FG4A 4PJBA 2NW2B 1JIBA 1ZY9A 3MXWH 4OW6A 2NW3B 2W9LA 2I24N 3NJXA 1Q9OA 3AXLB 3W0WB 1MCEA 1SZNA 4E41D 3VQ2C 1J8SA 2BOBB 2VZVA 3MRFB 3MRMA 4GYBA 1P9MA 3TT1H 3GM8A 2EXTA 1VFUA 2L7UA 1WSST 3VFVA 3LMJH 4M62H 1I1RA 1SN5A 5D71L 2JKSA 5JHDA 5LGYA 3OKDA 1HHGB 3UZEC 4IM8A 5D2NA 3IMWA 1SDYA 4WUUE 1T03L 2WLHA 4LSVH 4QRRD 4FMKA 4Y9GA 2ZOOA 4ZX6A 1RJYA 1U30A 3CQPA 1JNNH 1BAWA 5FOBB 2XG5B 4WFFE 3REWA 1KWKA 1GZQB 4GAGH 1ZS2A 4F2MA 4R7DA 1TFPA 2VR5A 4PJIF 5CZKA 3H6AA 3K6SB 3CVHA 2WYZA 1ZCRA 1RY7B 4MA8H 2IWKA 2ZQKA 4U3CA 2BSED 1Z3GH 4HIJA 3HVDA 5AZUA 2R56H 3KPOB 4J3OH 3HKZA 4ZOEA 2R2BA 1QVOB 5KBLA 1KPVA 2CR6A 1JF6A 2Z34A 1DFBL 1R5IB 3NIFE 1NGQL 3DXAD 3EHBD 3EYFB 4JPWL 4BQ8A 1FVCB 2VN4A 5H37A 2HRPH 4AI7A 2GFBA 3JWDC 4YL4A 5L7XH 4BELD 3BP4A 3D3VA 4WSGA 3GI9H 4P4RB 5DD3L 4UIMB 3ULVF 5GS0C 5JW4N 3QS2A 3MLZL 1QQDA 3CZJA 4OFDA 5FGBA 3DURA 2FX8L 4OF7A 1NIAA 4YXKL 1LL1A 5J5EA 3X1NA 4I3RL 3FU7B 3BSZL 1JGLH 3WKMH 1PDKB 1D7BA 4EI5B 4OIIL 4YSEA 1KACB 3ATDA 2CK0H 2V5YA 2AAVA 1SHXA 1UACH 2YQGA 5HDQH 1E6JH 2X1WL 2CO7A 1WZ1H 3W57A 4PJAF 4XCEA 4XVSL 5DMGD 3NEOA 1CR9L 4AUJA 5BQ7B 1CFQA 5ISZD 2PLTA 3BAIA 5F7AA 3T4YA 2GJ6B 2IDQA 1T5XA 4HJGA 4J4PC 3A4FA 3OMZA 5LNEA 1MRFL 4WKZB 3IJYA 1Z9MA 5DHDA 3BGMA 5F7EL 3QEUB 1F90L 3V0AC 2EO7A 2ZE0A 3RG1C 5KS9F 2GITA 3AG1B 4Q6IC 3ZDYF 2XPZA 4FCHA 1R4XA 1O7SA 4DOHB 3VYOA 2YWZA 4UDUA 2PP7A 4PS8A 1NUGA 4ELKA 3JXAA 1W9XA 2HYMA 4V2BA 1PEWA 3C5ZC 5IBUG 3RILA 5M94B 4ERSL 4FFVD 4P23A 5F1NA 3V6ZA 5D7IB 4P9HC 3DIFB 3U2SA 3TOPA 2XFXA 1G1OA 2LE9A 1TPXB 1LO5B 1KT2A 1BG1A 2OCFD 1JZGA 1WEJL 1RZGB 1A6AA 3IFNH 2J44A 3HMXH 3JV4B 3DX9A 4MD4B 4N2NA 5DYOA 1LXMA 3VI4A 1E90A 1FZMB 4WEMB 2ZYHA 2EDTA 3KE0A 1A3ZA 1M7XA 3ATBA 3S37X 3SE8L 5I8KH 1IMHC 2F08A 1YEIH 2OCJA 3UYPB 1SJEA 2V17L 2WNXA 3OKKA 2JELL 4OJYA 3MYJA 3UDWC 4UM8A 5JW3H 2MKLC 2JB5H 3D4ZA 1A5FL 4LCWD 5GRWA 3RVWD 3SDXB 1EO7A 1JXFA 1QX1A 2CLZA 4GAYA 3QDGD 5HYQB 2CZNA 4A7TA 5B3NA 4ABQA 1HZKA 4HJJH 4Q4IA 4PRAA 2W60A 4HFWA 4PJBE 4OQ1A 1IKOP 4M4PA 4NO0D 2EH7L 1OT2A 3QQ4B 4GMSL 5IBTL 4X7TB 1YEGH 4Q6YA 5D1QB 3CFTA 2EDBA 2YO3A 2IFFL 1LO2L 5IB3A 2FT6A 2IQAA 4FZ8H 5I5JA 2YFNA 4NHUB 2XT1B 4PJCF 4ZFZB 1JVLA 5F8RC 2IV9A 2Y0SA 4GY4A 43CAA 3LNDA 2R4SH 3VXUB 4FF9A 5IFJB 2F61A 1I8IB 1ND0A 5E5UB 2ZX7A 4YHNA 2HRHA 1E2VA 4MQ7B 4XVSH 1QBAA 1S3KH 3FZUD 3FBQA 3M45A 1F13A 5B7MA 3HE7B 1FNLA 2RD0A 2BOCB 1L9PA 1M6OB 2MQGA 5I2IA 3SY6A 3SSGA 3FFOA 5L2KD 3MOBH 2BNUB 4K55A 4KVNL 1DYZA 3M8OH 1TU2A 1TNMA 4BSJA 1U8LA 1KY6A 1NQBA 3UO1L 3LYRA 1O6SA 2AQ1A 3RJOA 2O5XH 1UXSA 2A9NL 3E8VA 3WEXA 4N8VA 4PB0H 5T33L 5AW0B 5EUOA 3B3IA 2C3VB 1NC2B 1PFOA 3CSYB 3TASA 2Y7QB 3FONB 3QIBB 3VACA 4FQ1L 4LOEA 4J3BA 2EDQA 4L9DA 1IAOA 3WYRA 4QXGL 1AO7A 5DYOB 3TEYA 4JAMA 5EHFA 4TLKA 1UXLA 3NCYS 1MCIA 3BCFA 3W56A 2BVEA 3GXDA 4WGWB 3KLAB 3IFOB 1D7FA 4IJ3B 4HF5H 3PNWB 2PR9A 2QT6A 1M7IA 5FB8A 1SJHB 4J3XA 3PXHA 1TPXC 5JW5B 4F58L 2QV4A 2XV0A 3OQRA 5G5DB 5BXFA 3MRLA 3PGCB 4R5XA 3NCXA 4FEMA 5D7IA 2MFNA 1A6WH 4ZD3L 4DOHE 4KXBA 2VABA 3TBWB 1A8ZA 2WCSA 3QXUA 5GS0L 5DJ6A 4LQFL 1B2WH 2NY5L 4L1SA 1JZHA 3BH9A 1SMOA 3DA0A 4MHHG 3AREC 4I0CC 4IBVA 3ULUD 2IADA 3VDCA 3ARGD 4UU9B 4MFHA 4Z0XA 5AW2B 2VLJE 1LMKA 2I5YH 4LPTA 2JIXB 4L1HA 3B34A 4RA3A 1GAFH 1L9OA 1CIUA 6PCYA 4PV9A 2BZDA 3ISRA 3BE1H 4JPKL 1A7BA 4M56A 1IGIH 3CZNA 3MRKA 4UT9L 3GMNB 3SDDD 4E9WA 2X1QA 3LQZA 4GRLC 5D4JA 3CFNA 5EFIB 3H9SB 5CCKH 2L04A 1BMGA 2XY1A 5LWYH 4CVUA 5ID1A 1N59B 1A7RL 1NBVH 1H3UA 1EERB 3O4LB 4ZO9A 3SGDH 4L4TE 5LAXA 1F41A 3O45B 2BY1A 3PHSA 4EXKA 2YAHA 1C9SA 2IFGA 1G94A 4QF1B 4JDTH 4UINL 2AEIT 4P23D 4ZYKB 4JG1H 2ROXA 2B0SH 1FPTL 3IDXH 4PB0L 3DOSB 3HC0A 4P2RB 1TQBC 4DEPB 3D39D 1YEKL 4UQIM 2K9FB 3MLUL 5I1CL 3C08L 1MI5E 4CUCA 2AV7B 2YPKA 3VXUE 4LCUA 4M6MH 4TUOB 3VB9A 4YHIA 1DLFL 2P24A 3MLYH 5IOKA 1NCCL 4GKSB 1YMMB 2HKHL 4Q58C 3SE8H 4TVSa 4QXUL 1DDTA 1EZVY 2OL3A 2JI2A 2VDRH 3RIFK 2UYLA 3CZFB 5JMRA 2XWXA 1FF5A 5I5RA 1B3IA 1RJZA 2DDQL 4WJ5A 2FRGP 3KYKH 4I89A 3WFHA 3BGFB 1OTSD 3DK0A 5FOBA 3KDMB 2L8AA 3IVKB 2EDFA 4GUCA 1CL7L 4HEME 5F88A 2WSPA 1JWMB 4HKZB 5I1HH 4PGEA 2PPAA 1FZOB 4XGZA 2W8CA 5GRXG 4Y2DD 1FQ9C 3IU3A 4LP8A 4OU3A 3O9WB 1ET8A 3WTVA 4XO9A 5FM4A 4JO3L 5IBTH 1OLZA 4G82A 1HXYA 5AAMC 2HFEB 3ZTJG 5E51A 4IBLT 3S6CA 4CSSA 1U3ZA 2K4AA 1ODAA 2NTSP 3TJEH 2OW6A 4G5AA 4XHJC 1NUNB 2Q5BA 3D69B 5BZWB 4V11A 4HFUL 1M56B 2ZCLH 1Y1UA 4TUJA 3ZT5A 2H9GA 2R0WH 4DGVL 2QADD 2K3HA 3BZDA 1CMOA 4G9FA 1W0WA 5EZJB 1CYGA 1DVQA 5L6YH 3C8DA 2A0LC 2CE6A 4ZUTA 3N6YA 4FQJL 4GLRH 4DN3L 1HXMA 1MW0A 2R51A 3DTDA 4OLXL 5SV3A 4Z18A 2N7AA 3GKZA 2IXQB 4E41E 4Q6IA 3WELA 4KK8D 4JFYA 2J57A 3UG5A 2ARWA 9CGTA 5FOJA 3DBXA 3Q9PA 3QIUB 1X9QA 4MNQE 3WJMB 2D31B 3K5SA 1BFTA 4B95C 3CFUA 1DVTA 4PJFE 3OKLB 1FG2A 4YX2H 5EMYA 3ZDXB 1F4WL 2GI7A 1CBVL 2P80A 3FO1A 5EV7A 4OCWL 1MSPA 3PWNA 4IBZA 3ERXA 4XOBA 4QNPF 1UGKA 4M1CC 4Z3TA 1QFOA 2XV3A 4NQSA 2X2IA 2OW7A 4F9LC 1WBZA 1N9PA 4JJOA 3MODH 2DBJA 5CP3A 1I3GH 2WBJA 5KG9B 5ANMB 2K8MA 4QOKD 5C0JB 5IEKA 3HI1A 3GKWL 4WI8A 2N0KA 2ZXWB 5IB2A 2XBDA 1N5AA 4G5ZL 1T4KA 4B50A 4BBWA 2HUEA 5SWZB 3WFCH 2RA1A 1E4HA 1IC5H 4OIBA 3TIEB 4YDVA 2KBGA 1R3LB 4YGVB 4LPWA 5JQ6H 4FABH 3QPKA 4PBWD 3WNMA 3K8LA 3GRBA 1UCBL 2OR9H 2ZXQA 2YZ1A 4J3TA 4OCXH 5D7LB 1NZRA 4GRWF 3TPUB 2IH3A 2G2RA 3AC0A 3RWEA 3VM5A 3VWKC 1F3DH 2VXVL 4CILA 3GLDA 3L95A 1UCTA 2AXGA 4FLHA 4KMTH 2PPFA 5GZNA 4GKOA 3G6JA 4XPFH 1F56A 2CRYA 4R5VA 1F1GA 2DLGA 4NQEA 4CC4C 4GT0A 2NXYD 4UZUA 3RGHA 2FQFA 3RBSA 3PJLA 3QA3A 1QD0A 2WLJA 3MLVH 4RA0C 3P9LA 2VWEC 1MPAL 2V7NA 2VOTA 3QIWD 4ONOA 3GSQB 2O5YL 4CADA 2PW1A 1FZJB 1UA7A 4P2RD 4WWPA 4ZX3A 3D25A 3BAWA 3MMEB 3TVMB 3D39B 3BRFA 4AXWB 2X4RB 1QOKA 4NKMB 4LHUG 3BD4A 1HCYA 5AW5B 1I4FB 2GSIB 3NQKA 3ZZSA 4E68A 4ORZC 5I8EA 3IXAB 4ZMAT 2Q2EB 5AVTB 1NICA 4MJ5B 5E5LA 5C0AD 35C8L 4KKLD 5C0JA 3K6FA 2VAAA 2F15A 3OAZH 4FDWA 4HCRL 1RZKL 1TQBB 2WJ7A 4LFHG 5L7XL 3KBFA 1A2YA 4UDTB 1R0AH 4XX1G 4NQSB 1JG9A 2L7JA 3ARVA 4F7EB 1BAFH 3ZKMC 5DJCB 2ZKMX 3MLTB 4YHZL 3IDNB 3TA3C 2QLVB 6FABL 3BEVB 5HSFA 5CS7A 4YX2L 1Q0YH 4N2AA 4TLUA 4QLWA 1R17A 5LO7A 4KHXL 2OXGB 4PR5B 4DEWA 2AJXL 4YXHH 2D31A 2XTJC 1WFOA 5MEQA 2ADYA 1T5WA 4FL4B 3SDAD 2F19L 4UYPA 1IGMH 4YC2C 3ZJAA 2JFCA 3FRPB 5EO9A 1WBXA 1QW8A 3F05A 5CP7B 4XOCA 2E47A 2ADGB 5D7KD 3C8HA 2FB4H 1A6ZA 1B88A 3JV0A 4ONGL 3V6OE 1JFQH 3L4VA 3DVGB 3K6DA 5ERWB 3WIHL 4L37A 1HQ4A 1AO7E 2CR3A 2FATL 2NXYB 4FX5A 4FS0A 2ZUWA 5HVWA 2DIJA 2CLVB 3ARBB 2EIMB 3V6OC 4D9LH 5EU5B 3AREB 4ODVH 1ZVYA 3R0MA 5D1QC 3B9DA 1S7WA 3QUHA 3CFCL 5CEYA 1CG9B 1OAQL 4JHAL 4IBSA 2GYSA 3MLVL 2OMYA 4BH8A 5HYEA 3SCMB 4XVJL 4XOAA 2XTLA 4ZMNA 2ENQA 3EYQC 4ALAH 5AD0A 2BVPB 4DGIL 3V4UL 4PGEB 4OFPA 3HJ0A 2EEBA 1OSPH 1F11A 1HL4A 3RQ3A 4EO5A 4JL1A 3PAYA 1WBYA 3FSAA 3MV7D 2J6WA 5D70L 3T8XB 8FABA 3PNWA 4RWHA 3O3BA 4OJAA 4G6KL 3I3EA 3O3AA 3SDCD 4GS7B 4H26B 1FVEB 4DPAX 1F6FB 1T0MA 4E0RA 2XQYG 1H8SA 1F3JB 5DMKA 3MRRA 2NQCA 4PTTA 1HI6A 4UANA 1RZJC 2FD6H 4NHCH 4PG9B 4BGDA 1MJ7H 5EZIL 3QIBC 2OAAA 2NNAA 1HOCA 3EOAA 1J05B 3PWLA 4XZUB 3AQZA 4XVUC 1XGQB 1RHHA 4X0NA 3OWRA 4CMHC 2CXGA 4YBLB 5TQ2H 2HSIA 4XBMA 1G4MA 4IBQA 3B8YA 3WLBA 1OK0A 3MJ9A 1KXTB 1KELH 2ZWSA 4P5TB 3IT8D 4I13B 2EABA 4UV7H 3B43A 3ZE1E 5I16B 3FQRA 4HLEA 1JV5A 2E27L 3ARTA 1ETA1 5CKAA 1J0KA 3LDBC 2AK1H 2G30A 1MCOL 2AJSH 4HJ1A 4NWTL 3O6KH 3MXVH 4EIUA 3EOBA 4EIBA 5F9WB 3H2QA 1X7SA 1GW0A 5C9JB 3IS1X 5AAWA 3NFPB 1J7VR 1WT5A 3FQWB 4G70B 4Z7IA 5HHPA 4APQD 3LRMA 1U3HD 1PKQE 3I6LD 3OJDA 1GZPB 1MCFA 1PZ5B 1CDBA 4N2FA 1ET7A 4OCMC 5F88B 2DMCA 1KB9J 4E9LA 3N44B 3ZL4L 1NMCC 4AVIA 4N6RB 1D5BA 2Y7LA 3P73B 2YBRA 4P4KD 4LVOB 1U3HA 3X11B 3IMSA 1T21A 4JGUA 4NI3A 5AWNL 1KCLA 1L6PA 2WP3T 3NIFB 3KPRE 5FUZL 1H3VA 1YMMA 2BHUA 2P24B 1J5CA 3PREA 3HZYB 1TFHA 3RWDA 1MVUB 4MBOA 2N4IA 2FB4L 1DN2A 3FU8A 3CPUA 2WLIB 4PJ8B 1NMBL 3ML8A 1A14L 1VA9A 2GJ6E 4HUCA 3B9KD 3LN5A 4JFDE 3ARPA 3QORA 1JJUA 5J1SC 4LLWA 4QXTA 1BLNB 1YY8A 1A6WL 1JI2A 2APVA 1GR7A 4YVNA 5GISL 3ZN6A 4GG6B 1E3FA 2Z35A 4BFFA 5JZ7C 4ZYKA 4FG6D 1GMEA 4NGHL 4LL9A 2YMXH 5E2WL 4PRDA 4F2ME 2NLJB 3LJ3A 3QYCA 1FAKT 3L6FB 3N04A 2O61A 3EJCA 1KLFB 1GGCL 1KTRL 2KPNA 4H13C 3UTQB 4P2QE 1N59A 2ZD0A 1NMCB 2R2HB 3KPRA 5AW7B 5KYUB 3U9UA 3T0AA 5GRVK 4TULH 4XHQA 4S1RL 4G6JH 2GI0A 3H9ZA 4ZO7A 1S4IA 2H1PH 2CRIA 3TV3L 1JWUB 3DSNB 5IKCB 5EOTA 1BJ1J 4AZ8A 4L4VD 3SPIA 1AD0B 4GAJL 4P2QA 4S1SL 3I9IA 4UT6A 5I8CA 2WIIA 3ZIYA 2K6WA 4AQAB 1UWXK 3EYOB 3O2VL 1CXEA 3Q13A 4BHUA 4IBTA 1JHLL 3TJPA 2IAMA 2SEBB 4MA7H 4QWWC 4RIRB 1L6ZA 2Y2WA 3OR7A 2WYTA 3GGWB 5F3HB 5DJ6B 5DSCB 1G1YA 4NZFA 2DQGL 1OT4A 5HVHB 5J06A 3QUXC 1RIVL 3G5WA 4YHLH 1FDLL 4UQCA 2CO7B 1ETB1 2VNCA 2WMPA 3KR3L 4YAQB 3ESVF 3CXHK 5D7KE 1CUOA 3NJHA 3GXMA 4QRPE 5GRVL 1CZ8L 3Q8AA 1N7MH 4ETQB 3NACL 3HFMH 2NSXA 3QPQD 4DTGL 4HAGA 4ZNCD 3IE4A 4HA1A 5IJVB 5AKSA 3TBBA 3ZKXC 1IGFL 1FE8L 4OCSH 2XXMB 4I1PA 3UXFA 4JHWH 1TLMA 1IB5A 4H8UA 3LD8B 4BEIA 4GAYB 1CL7H 4ZW3A 4WEBL 1P2CB 1ET5A 3ZDYB 1FNGB 4IRSC 5DHVH 5IW1A 4Q9BA 5C70A 5GGVL 4Z7VA 2VDNB 4LKCB 3WTYA 1AJ7L 3GMRA 3QRFM 3CFKA 4JDTL 1EVUA 2XYCA 1WO2A 5E94B 5DFVD 1VEOA 4Z3HA 1CLVA 4C4UA 3HE7A 1J1OH 3RGVA 3RKDD 3WKPA 4FG2A 2IMNA 2V3DA 1QHOA 1WP6A 1KTKE 3ZMNA 1B4JH 1ZVNA 2WQWA 4XXDB 1XB8A 4UQDA 1JPTL 5BZDB 3C5SA 1BD2D 4KUCD 4KC3B 4R4BB 3U2SB 1CXHA 3QZBA 5CHNA 3NAAH 43CAB 5JPMA 5CF3A 3NZUA 2FLBT 1NOLA 1NSNH 3QUMA 1NEZA 3TA3B 3C09C 4X7TA 1SYVA 1TTFA 4X6DA 3AW5A 3EGXB 4GAJH 2DQMA 4B3VA 1KGYE 2BS9A 3FW6A 1G7LA 3WJJC 1I9JH 1G7HB 1XF2B 5MERA 4P3DB 1HL8A 1CLCA 1QZNA 1ZTMA 2EYTA 3O81A 4RQQA 1XH2A 4HSAC 4TNWK 1S7RB 3UJIH 4YSSA 5ABZA 4JFED 2DQEL 3FB6B 5ADOH 1KBBA 1JF1B 2G60H 1Z66A 1J9RA 4UUJA 4C83A 1OGPA 2B8OT 5JUEL 1AD0A 3IFNL 2W07A 3OPZL 1MWOA 4X9YA 2W0KA 4R96B 3SYPA 4JY4B 4XPHL 4OT1L 3VXTB 4YSPA 4R8WL 1NKOA 3ES6B 5D9SA 3KWXA 3BPLC 4F57L 2CPCA 5DURD 4N5UA 1GPOH 1J0HA 2IAAC 1UFUA 1PFCA 4JRLA 2WSDA 3B8SA 3TVMC 2FT8A 2X4OA 3DX9B 2KLRA 3L5IA 4XRCA 3JUZA 3NOIA 4QTFA 2XBZA 2GIXA 3W82A 4YHLL 3M17B 2CQVA 2DQ6A 4OCSL 4OLYL 1THAA 4YHPA 2AEWA 3ESUF 5K59F 1A6UH 2ERJC 3L17A 5C0CA 2XWEA 4D94A 2OYMA 1HZLA 5CEXA 4UAHA 3KYMB 2XPGA 5FYJL 3ZDZF 4KJYA 2Y25A 2UZYA 2YD0A 3AGVA 3PL6A 1TVHA 4OFVA 1S7XA 4WAFA 4NRXA 2YZ8A 1KJVB 3F6LA 3PDGA 4YNYB 1FE8H 1PZSA 1AMYA 1ZXKA 2D4FA 5IEHB 3OB0H 1CD1A 4BRVA 3HN5A 1D6VH 4U1GC 5E8DL 1I7TB 3L5XH 3RTLA 4K71B 5CKGA 3B83A 1KJ2H 4QRPB 1NCOA 1BF2A 3VE0B 3KPNA 1XL6A 3EBGA 1IBZA 3V10A 4BSVB 4QGYA 1UENA 3BN9D 3BPNC 2CJ3A 5CJQL 3N41B 4N6RA 2VM4A 2ZP8A 3F5WA 2Q7NA 4XPAL 3EH1A 1A64A 5HYIA 1TQCB 4N2BA 4E9RA 1ZSDA 4DVBB 5D2NB 1RFDH 3K6NA 4BCYA 5DEGA 1DQKA 1R3JA 3I6GB 2BWQA 2YPVL 2XX1A 3UZQA 4OCXL 3VO0A 5FYKU 3B6SA 3KJ6L 4MAUL 1IGCL 4Y16A 2VXSH 3MJGX 4GOSA 3NEXA 3U4EB 4XMPL 2J21A 2IBBA 4U05A 2VMJA 5KSBF 4RGOH 2X3CA 3E8UH 1S7UB 1W8OA 2F7QA 2NY4B 3SGEI 3STZA 1ZRUA 1G0XA 3WAKA 1ZK5A 3BSGA 1QLEH 4KDWA 4NM4H 3VSQA 3C60D 5D7HA 5G2NA 1OF0A 2QQLL 2WXIA 5FC9A 1I7ZA 2GSGA 5J8OA 1CFNA 2X09A 1TTCA 4JQVC 4FZ8L 3QJRB 2P47B 4GFXA 5JR1L 3F01A 2JH2A 1B2WL 5HJ3B 2YSSA 4XMZA 5D2LF 1QI4A 2WGNB 5I1JL 3HZMA 4NUQA 1XGPB 5B22A 1TNNA 4JBSA 1MFMA 3S37H 2HVJB 3GK8L 2PCFB 3WDHA 4B5ZA 2YSTA 4NQDE 4X4ME 4XBPB 3VI3F 3KBPA 1UKQA 5DMKB 2BSTB 1GGBH 3OKNA 1DBMH 2ZYSA 3LPGA 5ENWA 2F53B 5JDSB 4FXKA 2Y07H 1KTDB 3FQTA 3O3BB 4O2EB 3I85A 1XCQB 1QEWB 2FUTA 5T5FA 4BKSC 1RJYB 3HBGA 4XNYH 2HTKD 2WANA 1XH3B 2AXHA 1C08A 1SYSB 4HK0B 1NTDA 4MDIB 3WTTA 4TKWA 2AP2A 5F89B 3TEXA 2XN9E 2AKRA 4WNSA 3A6BH 1KYAA 4JFOA 1J88A 1PG7X 3BW9A 5EWIL 5IVXF 3UTZB 1WWCA 5JQ6L 3EJRA 2BOBA 2PP8A 4X9BA 4ZAKA 5ECJE 4NAQA 5EU5A 5JOEA 4YDLB 2NW3A 2WXHA 1G7PB 1N18A 3AITA 3PP4H 3KLQA 4L37B 2AMGA 4NP4L 4JFZH 4IMLB 4MDRA 1X5FA 3LRGA 3HZKB 4JO2H 4KKQA 4FE9A 4J3VA 4ZTOH 2D8KA 4WTZG 4ODUB 1E27A 2DLIA 3NIDB 3DGCR 1GMIA 4IMLA 5KVFL 1UD8A 1I8LC 2B2XL 2QQKL 4ZMOA 5TH2A 3EW3B 3TGXA 1TYRA 5JA8B 4LQ1A 2Y22A 4OD1H 1HH9B 4AJ0A 2IC2A 3ZKXB 2ITCB 3FT0A 7PCYA 2XSKA 4G6MH 5F9OH 1IZJA 4FNLH 3WEBA 5I0XA 4FQQA 3GFUA 5C9KA 1AGBA 3W38A 1DVYA 4AX3A 3WE6B 1CF8L 4HLZG 3UMNA 1JCVA 4Q0XL 1QRNB 5ICXB 3HAEG 5DI8B 4NO2A 4MCMA 4C56A 4DN4H 4DZBB 3TN0A 2CALA 4JY6B 3QZWG 1DQVA 1MFAL 1X6LA 2DD8L 1FFNB 3N3EA 4PJIA 2JJTA 3UTTE 2B1HL 3A6OA 3FMGH 5F9DC 1KYFA 3CNKA 3BP7B 4Y4KD 4TL5A 5HGDA 1S7QB 2P3YA 2XRAH 4KY1L 4P5KA 3FPXA 1S6NA 4PWIA 3LKQA 1LO0L 4V33A 1FFPA 2A6IB 3RL2A 1H15A 2DRUA 2Z4QA 4WFEE 4XB7A 4MAZA 4KROC 2VDPB 1UD3A 4HUWA 5I75B 1KLGA 3U46B 3Q9QA 3D30A 4XP6H 4QNPE 5DO2D 3D7PA 5DC9B 2QGEA 4X6DE 1Q1JL 3C5JA 1NBQA 3LN4A 1E5BA 3Q48A 4PJAB 1X3DA 3P3SA 4JRXB 3KXFB 4MA8L 1FHGA 3LHAA 4F91B 4MMXA 2A9BA 4DKEL 1ZA3A 1J9TA 2HFTA 5D7IE 4ZFOL 5IBLC 3T09A 1USQA 3BVDB 3L2NA 3QHZH 1CGTA 1MFDL 3HS0B 2BC4A 4R83A 5HDRA 1A3RL 3I6SA 2HP4A 3US9A 1ZK9A 1WISA 1TETH 4L4TA 3RU8L 3VXPA 1HIMH 4KPHH 2GK2A 5A7BA 5AB2A 2DH3A 5DK2A 4LVEA 1L4IA 1YAIA 4ZFQA 5AWNH 3UPCA 4H88H 4GS7C 3PE9A 2UUDH 3U36A 4L48A 3RNQA 1DQJB 3L3IB 4J8QA 4JO3H 5F1IA 2YGVA 4GQ9L 4L3EA 4LL1A 3BH8A 4JQVA 4YSDA 1GJIA 5B1CA 5D5MF 3BMVA 1PZ5A 4U1LA 1SLUA 1KF9B 3IDMA 3S34L 4W6WB 4J8RA 3UBXG 3WNIA 4BKLA 4GQPH 1KDJA 4NBZB 5BO1L 3GZQA 3BSZH 3HEIB 3EF4A 4ZODA 4IBWA 1XB3A 2OMUB 4JQIL 5J6HA 1P1ZB 2XWJB 3H8NA 4QTHA 5DQ9B 4OLXH 4PJ7A 1D5XA 1XIWB 3GXFA 5GS1B 4O5LL 2F74A 4FXGC 2NYYD 1UYWL 5SWSA 3TL5A 2UVFA 4G8GE 1BX2A 3BZEB 2OK0H 3EYSL 3JVGC 4Z9KB 5C0CB 4LSPH 4QHNA 1MFCH 5F7NC 3PP3H 4MAYB 1OCRB 2JJSC 3T6WA 3RZCB 1E9PA 1L0QA 2YC1A 3MCKA 3VRLE 1WFIA 4IJTA 4H8HA 1QSVA 2EXYD 1SM3L 3K46A 3GMMB 4KKBC 2WV3A 1BECA 4NM8L 3BAXA 4U6XB 2PTTB 3AB0B 4RETB 4IRZL 2ZUUA 4MQXD 2V5RA 3BQUC 4ZTOL 5E8OA 2CJUL 3MLRH 4JN1L 2BRQA 4A1RA 4OBSA 1UWGH 2WZ6A 3P3YA 2X4SA 5D7LD 2UZXB 3GSRB 4HAFA 2JTDA 2FO1A 2F54A 4E9QA 2DYSB 4CMHB 1PVHA 1N6VA 3JV6B 4Z7UF 1G7HA 5ECGA 4TVPL 4NNXA 4U0RB 4I77L 4KTDL 1E50A 1DSYA 3G6DL 3L3IA 4HHAB 2XVBA 2ZXAA 3WFHB 2OFQA 4L9LA 1A7QL 4LU5L 1M42A 4PBDA 3EADA 2VDMB 3AREA 1KGIA 4AUYA 3TEZA 2CDEA 2O72A 5AYQA 2OR9L 3ASOB 4LCWB 2APSA 4PCTA 4ZK8A 3UH8A 1KIRB 2R27A 3GUFA 3KGSA 3JZ7A 3FN3A 4HWBL 3VXSB 5K9OA 1T66C 2I07A 1GZHA 3EGSB 3LH2L 3STLB 1EHLH 3ZE1B 4WRLA 1IUZA 2IG2L 3FRPA 2GY7B 4IRJD 2E7LC 5GIRA 3IDGA 2V5MA 3CLEH 1JP5A 3HS0A 2XPYA 3FTSA 2XIBA 4N2HA 1TQWA 4N3UA 1O9WA 1S5IL 2VXQL 1A4JA 2O6CA 4OGXH 4IU3B 5J7CC 2FCBA 2C1OA 3IWVA 1QLEB 3P2BA 4F7CB 1DUYB 3LXCA 4PG2A 4ZDHA 1DCLA 3FKUS 1M05B 3O4LA 1P7HL 5FDYA 1XIWC 4IU3A 5AALA 2ZPKL 2HVKB 5BVPL 4R7LA 4X50A 3C6LA 4O02L 5HI4C 4L2LA 5EUKA 1LO0H 2ARJQ 3T1WA 1BBJA 4O9HL 4HS8H 3WIAA 5I0YA 35C8H 2EEAA 2GJZA 1UD5A 2E9WA 3C8KB 1E9QA 3EFOB 3NZSA 4QRRE 4HH9B 2J43A 2VDLB 3TO4A 1J12A 1SVCP 4ZI8A 4ZW6A 4X6CA 2X4RA 4NKMA 3V9CA 4GEIA 4ZMWA 1KTJA 3QG6B 2BIIA 3LVEA 4YDZA 3W0WD 1FPTH 2Z65C 2MHAB 3HNVH 2YN5A 4EBQL 5CEZL 4QIRA 2ZX5A 3T2NH 4JHVA 4TQPA 4TSCH 4JY5H 3KBEA 3VFSB 3B2PA 1YN7B 4IBUA 5EOCH 5HDLA 4QRTA 4HV8B 1ZWIA 3SDCA 5E8DH 3O8XB 1CDUA 5DFWH 4ESKA 4NSKA 2WN2A 3A4AA 3EH2A 4MYPA 3OKEA 5E1GA 8CGTA 3G6JB 1BD2A 3APNA 5KBNC 1A1NB 1R24A 2ORBL 3MA9H 4GBXD 5DVKA 4XH2A 4U4IA 3TYFB 1PKOA 1YC8A 2E6QA 4KJQC 4U7KA 1K6QH 1G4RA 3MBEA 1IKFH 3GS7A 4LLVB 1YDPB 4MMXC 5EOTB 4EQ3A 5E4EC 2PYED 2X6AA 1TTRA 4Z76A 2B4CC 1LO4H 1X5ZA 2D0HA 5E8PA 1FO0B 1URZA 4MWFB 5B39G 2OX5B 5I1DA 4LHQB 1RXLA 4JE0A 3B37A 5FYLD 5C6TH 2R0LH 5J11C 3MOBL 3GSUA 4G80A 3CXDL 3SE3C 3VGFA 4LAQH 1GS8A 4HVBA 2XICA 3BUPA 3PY9A 2L7EA 3WLWD 4FKKA 3VFMB 1BYOA 4BK5A 3VJ6B 1ZHKA 4YFLF 3F7LA 2DDQH 1QSZA 3GMLA 3MV8E 2Z35B 1P4BH 5I17B 3K8KA 4ZPVA 1IJ9A 1NLBH 4JUTA 3WS3B 1SXZA 3O2DA 3WFEH 2ISDA 4HS3A 1H3GA 4W4OC 1NLDL 1CFTB 4PB9L 2W5PA 1ED3B 2I26N 3IJEB 3MR9A 3NSJA 3FUIA 5JDSA 4JKPH 2HLAA 4UQ3B 2V2TA 3KEHA 3NBNA 4XBEH 5EO1A 2GBAA 3IRCA 3II2A 3LEXB 3Q8CA 4GG6F 5CU9A 4J2XA 2KQNA 3S3CB 1KBGH 3CFIC 4NBXB 3MNZB 1ACYH 4DT2A 2Y1AA 1KENH 4XC1H 1WE5A 4KJPC 4L9LB 5GZOC 1FP5A 4ZTPL 5L2JB 2N56A 4PRBB 5AOLA 5CWSA 1U58A 2EDDA 2Q3XA 4FYRA 4YDJB 5TGBB 3L3OC 2EDHA 4RDBA 1RPQA 3TV3H 3OL2A 4AUUA 4HIEA 5IROD 1QBBA 3QIUC 3SIKA 1DQIA 3RVVD 1XVSA 2PCXA 4HHWA 2CUMA 2PYEB 5E9AA 4F7MA 4GIPD 3T9WA 1NMAH 1GC1H 1JD9A 4WFHE 2BSDA 4UAOC 5DHVB 2DYPD 4I0PC 3LN4B 3LPPA 5IHUH 1XL4A 4LSUH 2P8LA 3D07A 4FXLA 2YAPA 5GS3A 3GTNA 4GW4B 5CSZA 3WLBB 5TTRA 2VDKL 2OL3L 1TQTA 2IAMD 1A1OA 5LAPA 2Z4QB 4F5CE 5DQJA 3NIGF 1F6AA 1WCQA 5TK2A 2DQGH 3P9MB 1BQRA 3WHXB 3KPNB 1WA2X 2F8XC 4KWUA 4Q7DA 9PCYA 1MG2C 2B5IB 5IMOB 4R6UA 1TOXA 3CZUB 3FSWA 5CZXC 3ESPA 5I1LA 3DIDA 1F3JA 3W9DB 3S36H 4Q74A 2XWJA 4EZLA 2J71A 4Y5YA 5TDOA 2V4LA 4IU2A 4YK4C 2VO5A 1QNZH 5PAZA 2VLRA 3CBRA 4L1DA 5HTSA 5ES4B 4FQ2H 3O6FB 2ZUVA 1LILA 4G72B 5C0BE 1KGJA 2BHZA 3QZNA 3MLUH 5F96H 4XP4H 4OM1H 1GZHC 3EJZD 3UGEA 2WO2B 3OLEA 1VZGA 2VUKA 3FULA 3ARGB 1FWXA 4LVHC 3RTQD 3ZMRA 4DPRA 1LEIA 1YEFL 5KTEH 1D5ZB 4U1LB 2EDYA 1P5UB 1Q9KA 3HLAB 1D9KB 1L9MA 4GB9A 4WZ9A 3LV3B 2WC7A 4G6JL 1N7ML 5HVFB 5CEYB 3HN3A 1E5UI 2Q6WA 3X3FH 3RWHA 2NXZB 1JWSA 3Q01A 4YGAB 1MJUL 2NNCA 3DJ9A 3JTTA 1UWFA 3HUJB 4HXBH 2X7LA 1G9NC 4NCC1 1KPUA 4Z7OB 5KYXB 1P9MC 4LLQA 3N42B 2X41A 3GLEA 4E5XB 1MF2L 4DEPC 4LHUD 1AACA 2NUPB 1GGUA 1EUUA 1L9SA 2G3MA 4PW9A 3V0GA 2B16A 4HU8A 2BIOA 2MQ3A 2Y6SD 4N0YH 5L4FA 2W1NA 3FCSA 4HIXH 4R90H 1BPVA 2J56A 1KENL 5T8IA 2V7HB 1NA8A 3VWJC 1F4AA 5DLMH 2H5UA 1TQCC 1KYOK 3EJTA 1GOFA 4K7PL 4ELMA 1A02N 1LO3H 1N6QH 4X7CC 4RQQB 4WW2C 4N87A 1RV6X 2QTVA 3S7GA 3OR6B 1XDTT 3O6ML 4JPIB 1MAJA 2EDLA 3MLTA 2J1KA 3HB3C 3N50A 4LLYB 1J5HA 1SYVB 2YD7A 1MREH 5J6SA 2D2OA 4G9DB 4BZ1L 2AKRB 5I8KL 1NAKH 1YEGL 4M3KB 1J9CT 1V05A 2PUQT 4LXFA 4RGMC 3JBG7 1CICA 1EAOA 2Y1ZA 4G7SB 5FF6A 5B4MC 3GRWA 3SJVA 5FA4A 3QQXA 3LOWA 3WFBH 5ICZA 4A39A 4L8SA 3EJPA 4PGCB 1WAEA 1LMIA 1ADWA 2UX6A 4UTBL 1G7MA 3GEWB 4JJ5B 3EDEA 1T7YA 4FXKB 4YEFA 3ULVD 3O11A 4L8DA 2AANA 1T0PB 4JO5A 4L0YA 1UZ8A 3KDPB 3OWEA 1WAAE 5IROA 2BSBA 2QGDA 2XN9A 3QUYB 5K9JL 1RUKH 1YVLA 4N8VB 1V7MH 4ZOBA 1EEZB 4JR9L 5E6IB 4LLYA 5TE4L 4MA3B 2EAEA 1I1AC 3DUHA 5F70A 4H1LG 1A3RH 4JHWL 3F12A 1RZ7H 1FL6A 4LSPL 5EORH 2JCWA 4GI9A 4KRPD 1P5VA 4LSRL 1QSED 2CNZA 1Y1DA 3EO0B 1XX9C 2V7HA 2AXGB 2BFVL 3HIZA 3L3GB 3IDIA 1CQKA 1DEEB 1ZVSA 1MHEA 4U0RC 5I5IA 2Z1PA 2V2XB 3QFJB 1CGUA 2IH3B 3WSQL 3CVHH 2C3XA 1EEUA 2HKFH 1NMAL 5EBWA 3H56A 4KZDL 4DVBA 5I19H 2J5WA 1KELL 4U3SB 4ZG1A 3GSNL 3ZYZA 5A3ID 4M00A 3KLHC 1WUNT 4MZ2A 5E6RB 5A6MA 2GJRA 3F5WB 4UNTA 2IQAB 2JI3A 4MS8C 1VFAB 5H94A 3HPJA 3QJFA 1MJ7L 5JIKA 4LLMB 3LV3A 4BK8A 3E2HB 3VXSD 4EKJA 2GTWB 2WXFA 4DKAA 2PXYC 1WWBX 5C0IA 4XCYB 3H3KA 5KOVC 5FYJD 3ZE0B 3BT2L 4RFEB 5B21A 1AZNA 4MASA 4U1JB 3KWWB 4OZHA 2QR0B 4PRIB 3HLKA 3OLDA 1MFVA 2IWGA 4JFTA 1JGVL 1H19A 1XCQA 1CLOH 4DP1X 3PL6B 3NGBB 3ILPB 2P7TA 4WTWA 3P2DA 3KJ4B 1XXFC 4KQ4H 4AQ1C 4HUVB 2CUHA 1F45A 1U93A 5DUBB 2X5PA 5D7JC 3VXOA 3WNOA 2Y24A 4ES9A 4Q97A 3D9AH 1T04A 5TK4A 1PX3A 3BDXA 1U95A 3IM1A 4HUNB 2YSSB 3T8MA 4AYMC 5JYMA 1SMAA 3MZGB 1U8PB 3E6HA 1K2DA 5CN2A 3UTOA 1FLRL 2Z8RA 3DX6B 3RX9A 5EBLA 3BIBX 1IQDA 4LSSH 2ZCKL 4AMXA 4WEEA 2KYIA 4Y19D 1INQB 2OTWA 1ZHBA 3NIGE 5FYKL 3KS0J 1RZFL 2APWA 4ANWA 1SXSA 1FYTE 2C4FT 1HC1A 1PJWA 2QPDB 3AADB 3FFDA 3GSWA 3NZHH 4FGMA 4AQ1B 1PU0A 5TPWH 2DQTL 2EO1A 3ETSA 1MI5B 4XMUA 5HVHC 5I30L 5AUMB 4NDMB 1T03H 1SBSH 2OYKA 3S5LB 5D72L 5C0CE 4NZDA 5A7EA 1H9DA 5D1ZI 2XFGB 3CSBA 3LEVL 1E4XH 4JRYB 3WAJA 1U6AH 4Y8AA 5JPNC 1KCVL 4WW1B 2Z8VC 3G5ZA 5E2VL 3K71B 3QDMD 4OB5H 1KLUA 4ZZFA 4GO9A 5L2KA 3QEQE 4F5CA 1NIBA 2ATPB 3LKQB 2J6EL 1U8MA 4RMSA 2EJ1A 1S7QA 1I9IL 3LDBB 4X5XA 1NPJA 3FFCA 5CEZH 3T77A 3SZ6A 1KCSL 3JVFC 2WQRA 1PDKA 2X4QA 3NCCB 1A25A 2N0MA 3JWNE 4HETA 4HS3B 4UIKL 1Q4NX 1MW3A 3U1SH 5DR5H 5DJAA 3RI5K 2OJZL 4XNXH 3CN4A 2B9AA 3PJSB 2PPDA 3ZKNC 1FAIH 4ZXBD 4BFEA 3V4PL 1MWAL 3ASWA 2CDFB 3RHWK 1PYWA 5FUCE 1R5WB 4P5TA 2OULB 3DSFL 4FQQB 2NCEA 4JCMA 3WTSA 5H94B 3LSOB 5HGHA 3MTXA 4YHPB 5E99H 4DW2L 4L18A 3TJEL 2JJUA 1FIGH 1T7VA 2QQKH 3T3MB 2PWEA 4CJ1A 5EA0H 1ZVHA 4L5FL 4KRLB 5K1NA 1HNYA 4GUPA 3MRPA 4W9JC 1EJ8A 5K9JH 4FI7A 4PJ8C 4F7KA 2C7FA 4ETQA 4KUZH 4DVRH 1ZT1A 4TOYH 1MZZA 2W07B 3KLLA 1HH6B 5DRWB 4RNRB 3B7TA 1PY4A 3INUL 2X6BA 2X2JA 2YFOA 1JF1A 3QNZA 4U1NB 5KYNA 5EUOE 5JW4R 2BVPA 1H3WM 4NSKB 3U6XS 4QO1A 4DP6X 1KPRA 4M93B 4A2HA 3VRJB 4HOZA 1MCKA 3UERA 2X4TB 4Y4KB 3UPRB 1PCSA 3VFSA 3UTZA 2CRZA 2BP8A 3QUMB 3IAGC 2SEBA 4RIRA 1GCFA 3QEGL 3MBWA 1IFHL 1EO8H 1YY9D 2AEPL 2Z0UA 1IGYA 3PIQB 5DZLA 3VFWB 5A2BA 1RU9H 2EIKB 1ZTXH 2VQTA 5GGRY 2H6PA 1LEGB 1U91B 3L3HA 3Q6GH 1KN4H 4MKMA 1KBGL 4PWJA 2FAUA 2YQ3A 3VD2A 1B4TA 4HGWB 3NCFB 1SDDA 3S4SG 3RTQB 4HGKC 5AW4B 4RGNB 3EJYD 1F00I 1DUZB 1ZT1B 5C3LD 1T1ZA 3POHA 4F20A 5D1XB 4JAMB 1AG6A 1L0YA 1QUNA 3N9GL 4ISVB 1KGXA 2X10A 3OHXA 1KOAA 3WL9A 3R7RA 3ZSTA 3CUPB 2QHRL 4P0DA 1N0XH 3VXSE 1J0JA 5I1EH 2FYYB 2HT4D 3VYPA 4N25A 3PGFL 4EDWL 3K0YA 3MSPA 4DKFH 4ZDHB 2VRKA 1BQHG 4UZSA 2WWKT 2EDRA 2YAOA 4QYAA 4PRDB 5FHAL 1OOWA 2WLZA 2CIKB 2CDFA 3A22A 3MJ7A 2GVYA 3NMEA 5DJ0A 5BRZE 3Q05A 1W6LA 2J73A 3IE9A 2AQQA 3L3DA 1QFUH 3QDMA 4NUGL 5F7YC 3STZB 3TJHD 4B9JA 2BNUA 2VDPH 5BZXA 2OJEB 4HKXA 5G55A 3TNMA 5KW9H 3FQ1A 2BOCA 4GXFA 1VPOL 3VG9C 4Y89A 2R69L 1G9MC 1CS6A 1E0OB 4Q9CA 4KHXH 3V4PH 1Y6KR 1MVFA 1T6BX 4Y2OB 3I3DA 3SCMC 1FLRH 3VNZA 1U3NA 3DX3A 2WNKA 1LDSA 5KAQF 4IW4C 3NSYA 4PLJC 1U8HA 1DP0A 1DL7H 1KFAH 4N0CD 3VFTA 1CGXA 4QUOA 2F58H 2IALA 3WKYA 3RFZC 1KTCA 4LMQE 3IFPA 3GC3A 3VG0L 5D1QA 1H9VA 3KEDA 3W5NA 3EUDA 4P9MH 4YOKA 5KJRH 5GGSA 4A38A 5KVMC 1HE7A 3E38A 4MBRA 1S9WB 4IMKA 3WEAA 1T1XA 1BD2E 3K3QA 1J9QA 1FC1A 2AZUA 2CHXA 3IEAA 4LO9A 4QRBA 5E2VH 2KZ1B 2XI9A 4LSUL 4ZSOE 4A2LA 1S7XB 4PIBA 4Y5YB 4NO5A 5TDOB 3DJZA 1R34A 4AQZA 3B2MA 4K8RD 1TCRB 2C34A 2YEZA 4QRRB 3SKJH 3SQOH 1NAMB 1Z32X 3CX5J 5CILL 3QEQD 3RFRA 1MFDH 2DI8A 1G9ML 2NUTB 3VI4B 1EFXD 5FLUA 1U8CA 2NY4D 2R1XB 3RE0A 3UTQA 2H0EA 1HKLL 4QHNB 3EYVA 4IEFB 4PRHB 4Q9QL 3KHOA 1Q94A 1AKJB 4M8UA 3X1GA 2LGNA 4LQFH 2HWZL 1HEHC 4LCIH 1KCUH 2JWYA 4CC1A 4LZKA 1ZLUH 5KJ7E 4K3GA 5ILTH 2W65A 3I02A 4JFDD 4U1MB 4R90L 2PYEA 3T4AA 2VKWA 3CK0L 3JYBA 1N0XL 1XR9A 4OGYH 4UDUB 5DRXA 3QCVH 5FKPB 5I1EL 4BZ1H 2I5YL 1UWYA 2CUIA 3QZMA 5C08A 3ZVVA 1W72B 1PLGL 4M3JA 3ENEA 2F1BA 4NP9A 4W68A 1OGSA 2YXWA 4F3FA 3AY4A 5CCGE 1IM9B 5C0IB 2A77H 4A7VA 4I5BB 1JZEA 3WNLA 3BLBA 2IDTA 3E3QE 3ZLQC 1I8UA 4MXQC 1EHLL 1UWXH 5EIQA 2WYHA 4JPKH 4BFRA 4LL4A 1T5XB 1A6TA 5F0JB 3TC9A 5H35B 3MNZA 5JPMB 1MLBA 4NQED 1TG8A 4Z3IA 2E6PA 1U3HC 2H8PA 2PCYA 4XNYL 4F7TA 4KK5C 1UD2A 3KPPA 5HHMB 1N5YH 3VXPB 5GZNC 1EFQA 4E9XA 4W9HC 3VD7A 1BVLB 4ELDA 1TJXA 4LHUB 3DX4A 5CP7A 2WINB 3T3PE 1BP3B 1NUDA 2OSLB 3O0RH 4K15A 5B39A 3HS8A 2IJ0C 2Z8WC 5E8NA 1XSKA 3KL0A 2OMZA 2VW4A 3N0PB 4XNZC 3EOTH 2FO4A 3IRZA 2BHYA 1R3HA 3FO2B 2H0PA 1NAKL 1BWMA 4PJAA 5B8CC 3CFEA 2CJUH 4L3EE 1D7CA 3Q2WA 3AGWA 4DFIA 3BVTA 3MA7B 1TZ8A 4BZ2A 3BEVA 5JHDE 4W6YB 5E5RB 4ODSH 3VD5A 1OAXH 5EC1A 3OXSB 3UGXA 2MNUA 4HUWB 4R97C 2AEOA 5J12C 3X13B 4NENB 1A2YB 3ZYOA 4RCAA 3WS6A 5CCJA 3QWQB 2CKNA 1ZGLB 2NY6C 3MDJA 4RGOL 2XN9D 4WY7H 2WBJC 5KVEE 3EBAA 2WQAA 2I60H 5IT2H 5GGTL 2OMNA 2XQBL 3JT0A 4K23L 1KEGH 2K8QA 4CKQA 3BP7A 3L1OH 2HX8A 2P5WE 3CDGB 4PJGF 1DJIA 4XPTH 4LPXA 3O6FD 5FFLA 5CSGA 2EXWD 1FC2D 5E03A 5FA3B 4PH8A 4MDJA 3ARFB 7CGTA 2YXVA 3IJSA 4RMBA 5IGXH 3HG1B 1EJFA 3V55A 1BD2B 4OLZH 4Z78A 3IPEA 1VSCA 2FGWL 3KPRD 1JERA 2DLHA 4HS6B 3ME0B 2EE6A 3M86A 3SDCB 2G75B 2OMYB 5LKNA 5E8EA 4P2RE 2WO3B 5LGHH 4F7PB 3AFLA 5TE6L 1NFDF 1WD8A 5CFHA 5IJKA 3V4VL 3MRFA 1NC4A 2E8YA 4HPYH 3T0EB 2WOYA 2VLKB 3LAFA 4PCYA 2BY2A 3O6LL 3C5ZA 3UO8B 3UTTB 2NXZD 2WVVA 5D8JL 4XNMA 3N55A 5CR1A 4R2GC 2OYPA 4JFEB 3JVGA 4PJDB 4X8JB 3WFDH 4MJID 4DKTA 1AP2B 4GKZB 2ZJSL 3FCSB 3QJVB 3MJWA 4HH9A 1DQMH 5EO9B 1DDHB 1ODUA 4Y16D 5GGVY 4FFYH 4GP5B 2G9HA 3QUXD 3DTUB 1EUTA 3IFLH 1NJ9B 4GBXB 3MREA 4UT6L 5D96B 2JIXA 1WTLA 4AWJC 4BDVB 2KMWA 3SQRA 1CFSA 3FT3B 4M43H 4TTDC 2Q20A 1M05A 3KXFE 4BRJA 3ALXA 2YKLH 1X5XA 3LB6C 1FV1B 3TBVA 4OSUL 4YXLL 4V1DB 4Y0GA 5DC4B 3HG1D 2WKLA 3OSVA 1P5UA 1U41A 4OZIB 3WS6C 4HS6A 4YHKL 4GG6A 1F58L 1X5YA 2W9DL 2HT2D 1GSMA 2JB6A 3QORB 2CR0A 2AC0A 5ESQB 1T0NA 2KZKA 4FJYA 3IXAA 4NQVA 3ZZQA 2HMID 3KW8A 4NRYB 2P8MA 4YBQD 5GGRB 2XN2A 4KU1A 1JGVH 2JLPA 3B3BA 3MMEA 2ENSA 1EPFA 1BFSA 3BZ4A 3L7EA 5DLLA 1NWPA 5IVZB 1NSNL 5IQOA 1OALA 4ES8A 1AY1H 1CXIA 4HEPA 1F6AB 5D2LE 3S88L 4XO5A 1A1OB 5E9DD 3E3QC 5IMKB 1GVIA 1JF5A 5EC1B 4OLWH 3TWCH 5HHMD 1WG3A 1FFRA 5EZJA 1Q9LB 2C3GA 1I7RB 4MA1B 4S1DD 1EZUA 3SDDA 4HUXA 3GI8H 1HEZA 2C4FU 4PGDB 3BWSA 5E8NB 1FO0H 4RMUA 1OSEA 3ZTNH 1F8TL 2P5WD 4E9SA 2H2SD 1L9TA 3D2UA 3F85A 2G2RB 4WU7B 4JDZB 2D7TL 1CGWA 5DEGB 5IESH 1Z0NA 2PXYB 2HN7A 3BX7C 4Z78B 3E1ZA 1ADQA 4R7NA 1ML0A 3QRGH 3VA2C 4MDJB 3VXUA 4PTUB 1T89C 2ADIB 3KPSD 5E99L 4G1MA 3X1EA 4GO8A 1NFDB 5AVVB 1J05A 3PWLB 4N1CA 3PABA 3VWJB 5KVDE 1YQVL 1DVSA 3DOHA 3TBCA 4ZQKA 1PNCA 2PR4L 4P49A 5EIIG 5EZLB 5D7JA 4G7YH 4FXTA 4HD5A 3I50H 4JN2B 3ILQC 3TH3T 1RP8A 1KJVA 1YNKH 4WHCA 4A2DA 3GUTB 4PJ7F 4AENB 2C8NA 4QD2E 3POCA 4PUBL 4ZPVB 1ZTXL 4AEFA 5EBMA 2CBMA 4P5MB 1LO2H 3D8MA 4JUSA 1IU1A 2BWIA 4H8PA 1AYOA 5LXGL 5KSAB 4L3EB 4DIXA 5I0ZA 1VF5C 2WYIA 4OLUH 5EEZA 1YCSA 2WINA 1DJYA 1F58H 4POZC 4XPBL 1SXAA 5C09E 3SOBL 3RJDA 4QLRA 4TSBH 3N40P 3IMVA 4JW3A 4LLDB 4JFFB 1EBAA 2A1WL 3OZ9H 1MCPH 4WI0B 3QXDA 3MNDA 1AR1B 2JCCA 1OD9A 5EPMA 2P5EA 4IHOA 4EDWH 3DXAB 3EHBB 5H4ZA 2XKNA 4MJJA 1TCRA 3O4OC 2EDJA 4NQDA 1PG7H 3IGUA 3ZMEA 1DDHA 3BEWB 5C0RL 4PEEA 1MEXH 3SY0B 4FQIL 2GBUA 4KUZL 3TH2T 1U0QA 4WFFD 1BZ9B 5A2CA 1OAKH 3OX8B 2R0KH 1JZ4A 2BH0A 5DZ9A 1SLWA 2BJMH 1A7OH 1NGPH 4FXGB 1SM3H 1CI3M 4PR5A 3SKNB 1NM4A 3HE6D 3U0TB 1BEYH 2FL5A 2ED7A 1M4KA 4ODWA 1N4XL 2UWEF 3KYNA 5MERB 1FZOA 4XGZB 3QPXL 1OPGH 3ROOA 3ARYA 2E46A 1FCGA 1VEPA 5BS0D 4KBPA 2NR6C 2DQDL 1SRDA 1XR9B 3FHEA 1FYTB 2VABB 3GNMH 3FU5A 5D1ZC 2Q0ZX 5I6XB 1YPZA 1Q90A 2J20A 2VDMH 3I75A 3HG1A 2EIZA 3N9GH 4KMQA 3IN2A 2FK9A 1NCIA 1WAAF 5D2LB 2XWCA 5IG7B 2VLJA 1HINL 4CNIB 3UTPD 2ZP9A 5AW8B 4LHJB 3BN3B 1KN4L 5C0ND 3FUKA 3QH3A 4K4KA 1KBWA 3BAYA 1BBJB 1LEKB 3WSQH 5DI8A 5F2FA 3ARFD 3HC4H 2DQFB 1TT6A 4JRXD 3FT4B 4JE4B 2Z9TA 3K4ZA 1YEHL 1LK3L 2YRLA 3WXWL 4KVCL 4ZAKD 3VG0H 3GI9L 2BFVH 4FOMA 2A83B 1LQSR 4QR7A 5KS9E 1E28B 4WNQA 4HIQA 5D6DA 1D9KC 1ZLWH 4P9HH 4PRPD 3LZQA 4XP1L 3RL1B 2C1OB 2CDGB 5AVSB 1HH9A 3IGFA 5K1VA 1GGIH 1EHXA 4NFDA 4Y4HD 1IGJB 2ZZUT 4U1KA 1TENA 5I6LA 1V3JA 2X40A 4QMEA 2YD2A 3GSXA 2LQRA 4FMFA 3DYOA 1OM3L 1DQDL 3NFSH 4AW7A 2XA8H 3DROA 4XMWA 4Q56A 5MHSE 4MQ7A 1WPCA 3G04A 2L4OA 1NKRA 4HGWA 4KO7A 2EE0A 3NDZE 1KV7A 1OSZB 3WCYA 2A74A 4UV4H 1HDMB 2DAVA 2E7MA 2V2WB 4Q6KA 1CGSH 4QHUA 4XI5D 5SWQB 1IBGH 2E86A 5AVQB 1BEYL 2HVBA 1N19A 1N5AB 2NYZA 3H85A 1WFNA 3TO2A 1WFTA 3GGWA 5F3HA 2RQ8A 4M61B 5FM5M 4QGTA 4ZX5A 3TNMB 3CFJA 4I9WE 3A67L 3QS3A 3Q2NA 4J39A 2WP3O 3IS0X 2G5UA 2DWYA 2ITFA 1NDGA 3F58H 1DBKL 1BJ8A 2LU7A 4JG9A 5C6PB 5CINH 2BCKA 4Z7NE 2FE0A 3QIWB 1OP3K 1O7VA 4UTAL 3QPXH 3P02A 4X7SL 4OCNC 3NJLA 5I82A 2DMBA 4AGOA 5DJZB 1KTDA 4O2EA 1QBMH 4AVJA 5E08H 3I02B 4N0UB 5B7FA 4I4WA 2ZUQB 4AYFB 4KRPB 3CUPA 3RUGB 1GTFA 3FDWA 4YIQA 5F7UA 1JGUL 2E5EA 1VAHA 3QJXA 2CO1A 1FL5A 4JFYB 5LXGH 1QWNA 1VB9A 3BISA 3P3TA 4MNGB 2C3HA 3KPRB 4TSAL 5T3XD 1OAYH 1Z9PA 4AYBA 5KZCB 3GBEA 2X0UA 1EBPA 2ICWA 2O61B 2NLJA 1R5WA 3MC0A 4HD9A 3BKYH 3D85B 4YVUA 1BX2B 1AKJD 3DUSA 2JV6A 2WZ0A 3LKSB 2WLYA 1LD9B 5KVFH 2R8SH 5CBEA 2PYEE 2H9GB 3CN0A 5D7SL 4EQ2A 2NY3B 1S7UA 2ZOLA 4Q0XH 1TEYA 3FSVA 3SKOB 2BP8B 2HA1A 1I85C 4NZ8A 5T3XH 3B6SB 4K3JH 4ZUWB 4B0MM 4MMYB 4D9QE 1WF5A 4N8UA 4KVCH 5DD0L 3O9WA 3UBHA 3R4RA 2BXYA 5GJSH 4NBYB 3WUWG 3IK2A 3DVNA 4LSQH 3VI4E 4A7GA 4U1NA 5C08D 4LPVA 5GGSB 4HPHA 4FQXC 1U3HB 4XP1H 1KB9K 4I3GA 2NT1A 1FGVL 3H2PA 5BJTB 1V8HA 1OGTA 3SN6N 1CN4A 4QT5A 4ZUVA 2Q8AH 2B3IA 2XA8L 3DHPA 5GGTH 4KQ4L 1Y0LA 3KWUA 1BM3L 3MRPB 4QRPA 1Z5YD 1MCQA 3UZVA 4RISL 5E4EB 4JM2F 1NDTA 3S5LA 5HGBB 1WC7B 4IIQA 4OM1L 5KS9B 2PWGA 5C2BH 2ICEC 3CLWA 1QR4A 1XFPA 2FLMA 1OP4A 5FXCH 4ZZKA 4LBEA 2DQDH 1HINH 4AQ1A 1ES0A 3Q6FB 4LRIC 2J5LC 1UB5A 3OZLA 3LEVH 1UVQA 3TBTB 4MCYB 4XZ4A 1PYWB 4HKXB 1AQMA 3P11H 2PO6C 4PI2A 3CIAA 1WCBA 3O41B 4HBCH 4RESB 4OF8A 5E7BA 4ZT1A 4QY8A 2ZCZA 2YK1L 1WDAA 4NQDD 3O8XC 1INDH 1QFHA 2GW5A 4GPVA 4K9JA 4JFDA 4DUVA 1ZV9A 4JFUA 1UA6H 1CO1A 3R1GL 2KPWA 4KXCA 4Z7QB 1GOGA 5ALCL 4KI5D 1A6AB 5GGTA 2MRYA 3VXME 3AU1B 2H1XA 1LP9B 1UEYA 2HTLC 5BOJA 5E08L 3S3PA 1U8MB 3EZJB 4LAJH 4OJFH 3Q06A 1KJMA 1S78C 3QRBA 1H6EA 4UZGA 5DS8B 3TWYA 4BZ2L 1IKNC 4WI9A 4JCWA 3BC9A 1WBYB 3IDUA 1BYPA 2GEEA 3ARDC 4D8PB 2DS4A 1GS7A 1Z2KA 4KXAA 1RK1B 2MPAH 2O4EA 4AK2A 3DUUA 3O4LE 1JMZA 1CYWA 3RZCC 5A43C 4QHMB 1AHWA 2EH7H 3L16A 2H6UA 2B4CH 3WE6A 3CMOH 4LRNL 4PLKC 5KYWA 2A99A 4Y4FA 1QBLH 1CG9A 1N70A 3N1GC 4AIOA 3QJFB 4NUPA 3LPWA 2VXSL 4YHKH 2GJ6A 5HHNA 2WLMA 2Y1YA 3HPLA 4LEOA 1X4ZA 4OUUB 3RWFA 3X17A 3PGDA 1QABA 2VCOA 3IU4H 4M48H 3TZVC 4CVXB 1B0GB 2YRZA 2FSEB 3DUSB 5CHNB 1XF4B 3RWGB 3U0WL 3V52L 2DQIH 1SLVA 4PRHE 4HX1B 4KJWC 4G7VH 4L5FE 4OGZA 2VITB 2HJLB 3IETB 2F5AL 4S2SB 1O75A 1CYXA 1ZHLB 2H1LM 2BVQA 3RB7A 3IKKA 2D03L 3GBNH 5BZZA 3WHE0 4FD0A 3IDIB 1ZEAH 3R06B 2ZXBA 3D12B 4NQTA 5K39A 5FYJH 5AZ2H 2VRQA 3I2CL 5E94A 3S37L 4ZQTA 2VZ1A 3CLFH 3FK3A 1BBDL 5DT1H 1E3XA 1DQML 1GYUA 3E1F1 2R9HD 5EBMB 3CZLA 2EZ0C 3BH4A 2QHLA 1M71B 3QWOB 2ALWA 4Q2ZB 2VSDA 3ZDZB 5HHQA 5LLIC 3DX1A 5CNHA 3ULSB 4J3OD 4NM8H 3QK0A 1LNUA 3KPSE 3VFUB 3C08H 2C9QA 4GG8A 3FU9A 2WD0A 3INOA 4ZMLA 1L5GA 4K7PH 3FT4A 4W9IC 1G84A 2GTQA 2V5TA 4D7PA 1K8IB 2GTWA 3LTVA 4HZAA 4EN3C 1XCXA 3CVHB 1KZYA 3VX1A 1OVZA 4AM0B 4Z77A 2UZIH 4N0YL 5INDA 4X4YA 4CSPA 2QBWA 1MW1A 4FNRA 1TSRA 1P7KA 3H42L 4CSZA 4G1MB 3FO0H 1LE9B 4CC0A 3QI9C 3AQXA 3GHPA 1PD0A 4CVZB 1INEH 2IH1A 5JPNA 1NGZA 3HFFA 5KVDL 5LDSA 1KCWA 4P8QA 2O30A 5L4IA 3BQVA 2X4NB 1YG9A 5CMAB 4G8GA 5KSBA 1IAII 4NKOB 2V2XA 3KWTA 4MAYC 2F9BT 4H44C 4ZMXA 3RGBA 3WG7B 4QXUH 4F80A 3T65A 3L4WA 1QFUL 4LNVA 3S5LG 2PF6A 4X99A 2FX8H 4IKJA 4TTGA 1CJYA 2VDLH 1IL1B 2FDBP 1MHCB 2L0DA 3GLAA 4JRFA 1Y7VA 2DQIL 2A74C 2XACC 3DRTA 3SQBB 4MJIB 2VDQL 5IFAH 1U36A 3QCVL 3TA4D 4WI4A 1TZHB 3SBRA 2NZ1A 1B0IA 1AFVH 3OZ9L 4FG0A 3UZQB 3A6CH 1G6VK 3R19A 4OGAC 2NNFA 1DCEA 1C12A 4K8RL 1J0IA 2LU3A 3L9RA 4PY7B 4LCIL 2EUVA 1HYSD 2E59A 4Y1TA 2AI0L 2UY7A 4PMEA 2NNRA 3QDJE 4LCCC 4JFFA 4YGVA 3D3VD 2P8PA 5DD6A 1VERA 3L3JB 2RHEA 1M9SA 4YR6B 3HG1E 3WGUB 4FTVE 5I18H 4LFHD 1Z3GL 4DKDC 3TS8A 3B5HA 1RSYA 1YRKA 4QCIB 1NGXA 2VR4A 4Y4HA 4DQAA 3P4OB 1PLGH 4HZLA 1BJMA 1NC4D 4NUJB 3SKMB 3KMDA 2P52A 5ICZB 5D6DC 2WB1A 4XWGL 3T0EE 1E67A 4G7QB 2WTRB 15C8L 3H3BC 5CJ8A 3GBDA 4PJHB 3FOLA 2PCPA 2NOYA 3CAFA 5IHBA 4AYGA 4AG4L 1CVSC 2A2QT 1IC7H 1B4LA 3VRIA 5A16A 2FWOB 3ROLA 2COVD 2FJGA 4KAQL 4H0HB 2VJ0A 3MROB 4PS4L 3RY6C 1FBIH 1LK2A 2AV1B 4IDLA 4PUBH 4ZFFA 2WY3B 5CU5A 1NBZB 2IANE 4M03A 4CGTA 3OX8A 4AYID 4WKZA 3QI9B 2R4RH 1LO4L 4Q6IB 3WHXA 1XCTB 4GSQA 4DP9X 3RKDC 1HHHA 5E56A 5JORB 3QQ9C 1NGWB 2FNBA 3ISYA 3T4AC 1F3RB 3MLWH 3Q3GA 2Q10A 1G6RL 1KNOB 2IPKA 2WCPA 2VDNH 1EMTL 4PWGA 3Q5TA 4YJZL 1T2XA 4LLQB 3MJ8A 4D0CA 2EEDA 2VC2H 4XE5B 1AAJA 3ZRCC 1ACZA 3FOMA 2YA1A 4HG4K 4WU7A 1YJDH 3M88A 4WENB 3STBA 5B8CA 2AITA 3NFPA 5LQBL 4NAJA 2R2CA 2O6DA 2IGTA 1OCCB 3UGUA 2DEXX 4KY2A 3RA7L 2Q7YA 3F2LA 3MLXL 1T3FA 2VB5A 3UIZA 1ZLUK 2J8UA 4IOSD 3G3LA 2ITEA 1TYEB 1G7LB 3V6BR 3FT2A 1MRDL 4LNRB 4PP1D 3EYFA 3EZ8A 5ETUA 5C09B 5KUKA 4XPTL 3QUYA 5EF1A 3GMOB 5FW6A 1BSIA 3QE5A 1AGEA 2YGPA 2BLFA 5DUML 5IVZA 3OF6D 3BZ4B 5D7JB 1BBDH 5FYLH 1U3JA 3S36L 2BMKA 4O5LH 1SOXA 1AGFA 3KJ4C 4JJ5A 3QUZD 1P1VA 2V6HA 5DZAA 1OCWL 5E6ID 1H8NA 2F53D 1AGDA 3VXUD 1WEJH 4TQEH 4O2CA 3S4SA 5DO8A 3V0EA 1N5YL 4KTEH 1A5FH 5F1SA 5DTFB 4KZ0A 3VD9A 3PQYA 2Z7ZA 4JDEA 4JHZA 3ECBB 2XX0A 2J8UB 3Q0HA 3CIQA 1R3HB 4HGMA 1DSWA 3ULVL 1S2EA 4LKCA 3SCMA 3NT0A 1NANH 3O3DB 3N40F 4V1DA 3E2HC 5DF0A 4WJG3 1JZ2A 2XZQH 1M7UA 4ZS6D 3F7PC 1ZE3C 1BXUA 1R46A 4IIQC 1S3RA 4HWEL 4UT6H 5T1KA 4NN7C 4WO4D 2D3JA 6FABH 1ZGLP 1SHMA 4AL8L 2ZAIA 4PRBA 3MGTA 1DQLL 2QELA 3D4CA 2X3AA 3C2AH 1ZLWK 3Q3GB 1YDPA 4BQ6A 5AB0A 1XR8A 3HS9A 3WKNA 1NDMB 3O3EB 1CFMA 3GO1H 2QQQA 2BFGA 2F8VA 5HI3D 3BPOB 3G6JF 1ESOA 2PYFB 4ZO8A 3KD4A 1F86A 4K8RH 2XVGA 2WSKA 3MACL 5EO1B 3ET9F 4L5FH 3AWFA 2AV1A 4AW4A 1C16A 3EG9A 4F3FB 1NCBL 1HJBC 4X4MA 4ZFOA 5FKAB 3MROA 3FF7A 4G9FE 4HEPG 3DXAE 4NB7A 3G08B 4NQVB 1BOGB 5K9KB 3QNXB 5TF0A 4BWTA 3UTSE 5CINL 4PP2B 2ZTBA 1XSOA 1AE6H 3H9SD 3GD1C 4KI5E 5GHWH 4DO6A 2YPLD 3HLAA 1Z5LA 4XP9H 4UDTA 2VIRB 3VM7A 2J8HA 3VWJD 4DETA 5I23A 2E9IA 2IANB 1YO4A 3FB5A 1FA4A 1JZDC 3VJ6A 4J1UB 3BOVA 2EKSB 3HG2A 3K2KA 1HSAB 1SJHA 3W39A 4PVNA 4NQQA 4HEMA 1E4KA 4WW2A 4NKIL 1YEFH 5KTEL 4R4FH 5E2TL 3RJQB 2GJZB 4AQ8C 5FHBH 5IHZA 3QORD 3MUY1 2XG4A 2P80D 1TMQA 4LT7A 4OZFH 4WI2A 4CMMA 4KH9A 2PMZA 4URKA 3JWOL 2DM7A 1F02I 4GI8A 5ADPL 2ALAA 2Q8AL 4I0PA 5FGCE 4BFIB 4DQOH 2K3TA 3VI3B 4MJIA 4XXCC 4PJ5D 3WJLC 2MCPH 3GXTA 1A1NA 3KVDD 1PLBA 5LCVA 4RFNB 2XY2A 2P9RA 3FO9A 3GM0A 4MSWB 3MV11 5M7QA 3BPCB 1IFRA 3FO2A 4R26H 4Z7NB 3W5MA 1OXYA 3QEHA 3DOIA 1V7ML 4WU5A 3U0PA 4QRTB 3WDIA 2RGSA 4PSPA 2X0VA 5DD5L 4PRNA 2HUHA 3CHOA 4U31A 4AOFA 3GSNA 4TSCL 2WLIA 2P49B 4IMKC 2MHAA 2DOCA 2UVEA 5KN5B 1PD1A 5KSBB 3BWAB 5GRJL 4JQIH 4ZFOB 5FAAA 4JZNA 1A22B 1I8KB 1JGDB 1EDQA 3ESMA 3U7WH 5ESVA 3KM1A 2CLRB 4JFPB 4KRPC 4XWOD 4OCRL 4DFHA 2Y2YA 1VCBC 4Y9FA 1GA2A 5GJSL 4NZJA 1MFCL 5F6IC 1E7VA 3BFQG 3FQ2A 3QWRD 3C5ZD 2X9WA 2A0LD 1IV8A 1NL0H 3LS5L 3QQ4A 4YSRA 5C97A 1W0YT 2Z31C 4X5PA 5IEKB 3W9EA 2WVUA 5IJKC 5BNXD 2FTAA 1BXAA 3JV6A 5EDXA 4TNEA 3B2UC 5EN2B 5CEZE 3IJEA 4KK8C 1F3DJ 2ZOKB 3EO1B 3NIDF 4G43B 2ZX8A 1A6VH 2EEXA 3V0VA 3FHAA 4BK5C 1KULA 2TRYA 3G5VA 4MB5A 2BW4A 1NKGA 1LHZA 5INCB 4UM9B 3HNTH 3BT2H 3WTUA 2PXYD 2PTTA 2DW5A 3SHSA 5I6KA 3FQRB 4QHLB 3ARZA 1H0DB 2OMZB 2D2CC 1ZHKB 3E9TA 4J4PA 3QIUA 5DJYA 1S8DB 5BW7A 1J48A 4N2DA 1PNDA 1QUNB 4IEFA 4PRHA 5F7BA 4U1IA 1CDIA 1YYML 1Y18B 2E7HA 3EXJA 5HYJB 1EZVX 2R1WB 1INDL 2VZUA 3GSUB 4R84A 3SODB 4NQXA 2ATAA 1OE1A 5BMFH 4PJ5A 4B27A 5TDPA 4EE2A 1LO5A 4N0UE 3P0YH 2B59A 1MFAH 1ZPLA 2DICA 3U4BH 4YQXL 2LABA 2K6YA 1YLBB 3F00A 4W9KC 4BUGA 4S11A 3PGDB 4DP4X 3HPLB 3RWFB 4X6EA 4HT1L 1LJMA 1UHVA 4FC3E 3LRHA 3CWGA 3NZHL 3PPSA 3QQ3A 1GYCA 5LN4A 3M1OA 5ETUB 1IE4A 3BO8B 4UB0H 4GW1B 4NCDA 1HXYB 2ZYRA 3OQ3B 4U1SA 4Z7UA 4H25A 1KC5H 1II4E 3HC4L 2QFPA 1ZTXE 2WAQA 2ZF9A 3ZSSA 1W72A 3LZFL 1BVKA 4AV4A 1IM9D 3BSHA 3X1BA 2E0PA 5AG9A 4NFBA 3F7YA 4N2OA 1MDTA 4KK6C 2QZQA 4NXKA 5CIPA 1M2VA 1Z5HA 2DZEA 2NY1D 4AL8C 2BP0A 4QHKJ 4TNWF 2Q3AA 2CJTA 4EF3A 3HI5H 3IAPA 3MRNB 4OZIF 3AU1A 3JWDL 3RPBA 2FX9L 2XWDA 2FHBA 4I1RA 4YHYC 5DZPA 2BRRH 2TAAA 4OGQC 4TQIA 1KB5H 3L8QA 2DM4A 3WEMA 5F3BB 5MEQB 3BZEA 3RGVC 2ZSWB 1XCWA 3CV5A 5FV2A 5EG6C 2X88A 5MENE 1BVNP 1WCBB 2IPUK 3O41A 3QUXB 4Y1AA 1IEAB 4NNPH 1K8DA 4EVNB 1B6DA 1FL3A 1UB5B 3BYTA 3MNVB 4KZEL 3CLFL 1KPVB 3N91A 1AH1A 2I85A 4R4FL 5E2TH 4MXVE 1G7QB 2WTRA 4CN6A 4BE6A 4PN6A 1KZQA 2DQTH 1D2PA 2NY5H 3A3YB 5A2FA 2W0LA 1CGSL 4BE5A 5FGSA 1FSKC 2OMBA 1NCTA 2JSFA 3UADA 3IGLA 1R47A 5HGDB 2DMKA 4O02B 3QCTL 5D1XA 1KXQA 5LBSA 4BJLA 4TQ8A 3IFPB 3EDJA 2MCG1 2VAJA 2XOTA 4R4ND 4WW1A 3S8GB 3K71A 1RP9A 3WO4B 3QDGA 1U6AL 1LDPL 1AS6A 3HKFA 3OGCB 1A7NH 3GSVB 4DHLA 1ROWA 2WXPA 1DN0A 3V5HA 5JYLA 1XEDA 4CADB 1X5HA 5BV7B 2WO4A 4NT6A 4RRPG 3ZKQD 2F68X 4P07A 4JM0A 3VGBA 3UPRA 1G0DA 3DRTB 1E40A 3SQBA 1JDDA 1JZIA 2QPUA 4IOFD 1I3RA 2YXMA 4WWID 3MI6A 3OHMB 4P4KB 3F3HA 5D1QD 3RX7A 5BOPA 1JHTB 5C0AE 2O5YH 4AKOA 2YD5A 4B9IA 1NUFA 4WGVB 3ABLB 5DUPL 3HTLX 4CBZA 4MHHI 4XXWC 4PWHA 4RNRA 2Y69B 3KLAA 5H2BB 1F4YH 3NRQA 1EAQA 4K5OA 5CMAA 5HGGS 1OKEA 4UV4L 4AITA 1ZXQA 1GTNA 1UOVA 1HN1A 3SO3B 3WL9B 2BWDA 5CJXA 4LVOC 1FZKA 4Y1SA 3VFPA 2P7TB 4Y2DB 4FXKC 3ZBMA 2XZAL 4U2YA 5EUOB 3MLYL 1HFUA 1WZAA 4DWHA 5CJBA 3NZ8B 1I9EA 2Z64C 5JDJA 3BW9B 5D2NE 4U33A 1GXEA 3O4LD 4J1UA 1PKQA 3MLSL 3QJSB 2V8MA 3P2TA 1AZUA 1O5DT 1YJDL 3P9WB 2G3XA 4GP8B 4Y9EA 2BRRL 4TUKH 2C9RA 4MA1C 4X9HA 2IH8A 4ZFGL 1NCAH 3EHBC 4POYA 3GXIA 5C2BL 4P3WA 4TPRH 3AJ7A 5EOQH 3ZOAA 1CL7I 3EGDA 3TO2B 3TTSA 2DL2A 3CJJA 1MFBL 2MTAA 2NX5D 3QNXA 3BZ5A 2CHWA 2OJ1A 1VACB 2W9EH 1EGJL 5IMMB 3GI8L 1WFUA 4WWNA 3TFKC 1HDMA 4QHUB 4AC2A 4B5EA 2HRLA 4DK6A 5DDHB 5MENA 3MV9D 3GEFA 4L8SC 3DECA 1ZT4B 4NQUA 2HVJA 3MJ6A 3RURA 3X3FL 3HZMB 3DVFA 4PJFF 3FN0L 3P4NA 2ZKXA 2D7TH 2WKGA 1T1WB 5CJOL 2FHCA 4GLRI 4FYTA 3S34H 1MNNA 3NH7L 3G5ZB 2IWEA 4QRQA 3ARBD 5C7XL 3TIDA 5MEOA 1T0OA 1Y07A 3NN8A 2ZAHA 3DBSA 3VXMA 2R29H 3DO7B 1IGJA 1KBPA 4LP4A 3CH8A 5DRZB 4FI6A 3ZZ1A 1BJ1H 1TXKA 2OSXA 4OUUA 4PRAB 4JJHA 5KYYB 1I3RB 4U6VL 3ULVE 1ZHNB 3FUNA 3KPQB 2FQDA