4FL4B

Scaffoldin conformation and dynamics revealed by a ternary complex from the clostridium thermocellum cellulosome
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
165
Chain Sequence
ASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Scaffoldin Conformation and Dynamics Revealed by a Ternary Complex from the Clostridium thermocellum Cellulosome.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Protein binding
molecule keywords Glycoside hydrolase family 9
total genus 35
structure length 165
sequence length 165
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fl4B00
4FL4B 2XDHA 3KCPA 1TYJA 2B59A 2OZNA 3BWZA 3FNKA 4FL4C 2VN5A 5AOZA 4IU3A 2BM3A 2W1NA 4UMSA 1AOHA 2JH2A 1QZNA 4DH2A 3F2LA 2VO8A 3L8QA 3UL4A 5LXVA 2O4EA 1G1KA 4N2OA 5G5DA 2ZF9A 4IU2A 4UYQA 1OHZA 2CCLA 4U3SA 2VN6A 5K39A 1ZV9A 1ANUA 4WI0A 2Y3NA 3KCPB 4UYPA 4WKZB 3GHPA
chains in the Genus database with same CATH superfamily
1J05A 1YY9C 3OJMB 4MZ2A 1FAIH 3IDGA 4KTYA 5BW7A 3BZ5A 1MCCA 3FQWB 3L2LA 4G9FB 4JN1H 5I23A 1FNSL 1NCNA 3A6CL 4MDIB 1I7RB 5DUPL 3U83A 1DE4A 2LU4A 3Q8FA 3W39A 5B7MA 2DQJH 5A3IC 1F6LL 2E6PA 3CSYB 3P11L 5E2TL 2XPYA 1JV5B 4Y4HB 3GO1L 3IDYB 1AIFB 1JZFA 4OT1H 5T3XE 3LVEA 5JUEH 4XCCH 3HAEB 2DQHL 3J27A 2RACA 4DO6A 3T0EE 3WN5A 2FSEB 1T03L 5IMOB 1QD0A 2FJGA 2Z92B 4YUEH 4HUXA 4HUVB 2PPCA 5CAYB 2QADB 1P6FA 4C83A 4XBGB 1CBVH 2DTML 4KK9D 1HHKA 3NIGE 2NRDA 4KRPD 1ITCA 3PDOA 1XB6A 5DD6B 4RZCB 4GRLC 2WZ6A 1KGJA 3OKLB 4C4UA 5F0LB 3D2TA 1G9HA 4X6DE 1U95A 1B0IA 4X0NA 1Q9OA 4HV8A 4LSUL 4K3EL 5ICUA 4K5LA 1XTMA 3WIHH 2C26A 4F8PA 3ARVA 2EP6A 2HX9A 3I50L 3V6ZA 5H2BB 1WZLA 3IMSA 3JV0A 3PU7A 1UT1A 3QDJA 4KHXH 3H6AA 2UVEA 4LLDB 4OY9A 1LO4L 2XN1A 4RFNB 2EYTA 4IRJB 2V2TA 4NSKA 4ZJ9A 4AT6B 2EZ0D 4NN6B 5F1IA 4CMHC 1ECZA 4A7VA 2O30A 3A23A 1OAKH 35C8L 3B43A 3EO1B 4GW5B 5EA0L 5K1NA 2BRRH 4A38A 3JTTB 4EXPX 4Z8FH 3KMDA 4KO6A 4I0CC 3U9PH 3QEHA 1IJ9A 3GSNH 1A3ZA 3HRPA 2UZXB 3QNZA 4QLWA 2Y2YA 3VXMA 3LKPB 4H88H 5D71H 1SOKA 4DOHB 3QEGH 1A1MB 4FJYA 3VGHA 1EXUA 4JX0A 4UIKH 2XICA 3N5AA 3WAKA 1S7TA 3MRLA 4MMYB 3WU1A 5A2JH 3OG6B 1AG0A 5T1KD 1FDLL 2PTUA 2IAND 1NBQA 4GKNB 3QWOB 4TOYH 3IBOA 3VGFA 1VADB 3PAVA 1X5LA 3KLLA 4N90D 4PGEA 3FCGA 3HHSB 1S46A 1T0MB 3WE6A 3PV6A 5JW4Q 3DLQR 3QW9A 1QQDB 2VISA 1J5CA 5J06A 3ARGA 4ZFQA 5IEHA 4XZUB 4ZXBC 1XGYH 3NJJA 4XPTL 1EDQA 3BP4A 4GNKB 2P24A 1PD6A 2ZKMX 4RRPM 4NO3A 2E46A 3Q3GB 3U36A 3UYPA 3SGKC 4CC1A 3FQ4A 3IJHA 3I02A 1CXKA 1VZGA 1XAKA 2WYTA 3BDBA 3S7GA 1MAKA 1D7FA 2GY5A 2R9HD 4M29A 3B2VL 2JJUA 5JDJA 3WL9B 4Y5YA 1KCSH 1MCOL 2OAAA 4LCWB 3CVIH 1IT9H 2WTRB 4HWBH 1THCA 1CICB 2WO3B 3L5XL 3LKRB 4TNWK 4F20A 4PCSA 2X9XA 1H3PH 2CD0A 2OBGA 2R2HB 4L4JA 2ZXDA 4KXAA 3EHBB 2GUOA 3OB0K 5CD5D 3WJLC 1ZS8B 2FLMA 3LD8B 2Y5EA 1BF2A 2O72A 4KV5E 5IGXH 4UV7H 5I0ZA 4XPBH 2W88A 3KPOB 3UG5A 4X7FC 1D5IH 1F90H 4QXGL 3VRJA 2WWNA 4E41E 2W9LA 2QADD 3QH3A 3K4ZA 3FRPA 3R18A 4K8RL 5CZXD 2Q7AA 3KPRE 5J5EA 3NCJL 3ILPA 2O61A 4J3OH 2FO1A 1E9QA 2WWKO 3V4UH 1ETA1 2Q9OA 4ZUTB 2NY4C 4L3ED 4OGXH 1AACA 2K4WA 4UM9D 5C09D 4R7VA 5GRJH 3V0DA 3UC2A 4WK2B 1C5CH 3FRPG 1KIQB 5L4IA 4WUUE 1OB1A 2QEJA 2HX7A 2XG5A 5B1KA 3REWA 2PPAA 4HSAC 2EIEA 2WIIA 4PAZA 2VRKA 4IRJD 2NYZA 1WPCA 4LHUD 2WNWA 2H26A 5K1VA 3MRMB 3ZY7A 1DVUA 3MGTB 4PJ7F 1IFHH 3MRQB 3KYOB 3KXFB 4ALAC 2X2IA 4PWKA 2OSLA 3LEXB 2FBJH 4G59C 4Y5VC 2FTAA 1XF5B 3B3IB 5IMKB 1VFAA 4ZTOL 1EEZA 3NH7H 5CBAB 3ULVD 4WFED 5C3IA 3SPHA 1FFQA 3CPUA 1FNSH 3MBEC 2NZIA 1H5BB 1NANH 3FOLA 3L2MA 2H6PB 2XWTA 2X6AA 1ODAA 2H9GB 4MCZB 4WGVB 1UWEH 5DI8A 1MRCL 1F6FB 2IWEA 5HHPB 1Q72L 2CG9X 4FXKC 3QUMB 1BPVA 1AR1C 3DX0A 4FZEH 1D9KA 3BXNB 5I8KL 4F15C 3KPNB 3L3HB 1R5VB 4M5TA 4F27A 2NT0A 1A6AB 3IJSA 1COBA 3O3EA 4AK1A 3WJMB 5CFAA 3NCYS 1UURA 2RB8A 5ALBL 3AXIA 5EUOA 3TBWA 5CXPA 3RVVD 1TJHL 3MMEA 3TNNB 4OVUA 2V3DA 1PIFA 3Q2NA 4HJJL 4MWFA 1ZV9A 4UTCA 3ET9F 5I1LA 4Z7OE 2JE8A 4KGJA 1Q9WA 4PJ6A 1UKSA 2QPUA 3V0EA 4HFUL 3HC3H 3QDGA 1MFBL 2X7LB 5IESH 3QR0A 2O6CA 5KSUB 5ICZA 1JDAA 5CWSB 1HZLA 1BBJA 2HT4D 3P0VL 4Q9CA 4LLUB 4N2EA 4P2RD 1DJZA 2B59B 1AJ7H 2VSCA 2X41A 2R0WH 4XWOC 4XCCL 5CLZA 3VD7A 1MW3A 3WLBB 5K9QG 4DGYH 3R1GL 5DZVA 3EHBD 4F91B 1FGVH 1UD6A 2EDNA 2FL5B 2J8UE 1PS3A 15C8L 1L9MA 4HKJA 5DHVB 3X3FH 1V55B 4NP4L 5JA8B 2IOMA 5DJ8B 1JVKA 5AOIA 1BLIA 4OV5A 3US9A 5IEKA 5K69A 2X3AA 5D4JA 2QPDB 1ULVA 1AOHA 3DDGA 4MXWH 4M8VA 4XH2A 4YH6A 3MRRA 4OF3A 2VWEC 4BZ2A 4Y9EA 3NCMA 4XO5A 3S37X 4ERSH 3T6QC 3JWNH 2BIIA 3UAJD 3IJYA 4X99A 2N01B 4WZ9A 3UGXA 3WEOA 2W8CA 4OFKA 3IF1A 1KFAL 3RJDA 1JPST 5E7FA 3LKPA 3N1GC 3VFTA 5C2BH 4BFGA 3ZIMA 5ACZA 5IIEB 4IRJC 3IRZA 1B4RA 2J72A 4PLOB 4YDLB 4K3EH 4XVUD 4X7EC 1KJ2H 3UYRL 2AANA 4M1CD 2GJJA 4Q2ZA 5MEOA 3MKGA 1XXFC 2O5YH 3NFSL 3C6LD 5D4IA 1Z5HA 3NESA 1KBWA 3MRKA 2CAKA 2A38A 4Y1TA 5CEYA 1YEHH 2XFXA 1GOHA 2VSMB 1YUHB 3WO4B 1NC4D 1N8ZA 4FABH 1NGQL 3QJTB 4K3JH 4UZGA 1P69B 5DRWB 5KVDE 3GBMH 5IK3B 2Y3AA 2DKMA 1C12A 1KBBA 3IAPA 5AW9B 2OSWA 1HSBB 4FG2A 1ZLWH 4ONFL 1EAPB 1R5WB 3QIBB 3JTBA 4L4VA 3HUJF 1HEZA 2HLAB 2RQ8A 4KAQL 1ZKAA 3I2CH 3VWJB 4G7VH 1GY1A 5EOCJ 1QLRA 4R2GB 3LIZL 3HNTH 1IGFL 2IC2A 1CFNB 4AVHA 1QQDA 3N06B 1C1EH 3RDTD 4ZS6C 3HA0A 3M7FB 1KT2B 3OHMB 3D52A 1DQVA 1WZKA 2VO5A 2ADIB 1QFOA 1MFCL 2XXFA 4E0RA 1RJYA 3ALXA 4N25A 5TFSH 4BELD 3BRGC 1I9JL 2ZYSA 3CPLA 3SE3C 1EEQA 4LF3B 3A47A 5BS0E 2ZOOA 5H37H 3U0WH 3ZKMC 2X4OB 3CFEA 4UQ9A 2ZYHA 4J3VA 1JHKL 3WKPA 4R83A 3S6CA 5E8OB 2Q0ZX 3WD5L 1FA4A 3NZHL 4I18C 1ZA6A 5EUOE 1IAKA 2MH4A 4LSUH 1T04B 3T5WA 4ZYKA 4NPJA 2Q20A 4O2CB 2EVGA 2C4FT 2X7LA 4MAYC 3EH3B 4FXLA 1DZBA 1RULL 3ML9A 4MKTA 1IEBA 1FJ1A 5HXMA 1WBYB 4K2UL 1BZOA 1EANA 1YEGH 5ABAA 1SVBA 5FUCC 3AWEA 3TF7C 1PFOA 2D7NA 4F7EA 3BDXA 1LNUA 1QWHA 2QJDA 4FYQA 2VN3A 3CZLA 3GF8A 1ZMYA 1DUYA 1U3YA 1U95B 1V8HA 2AJVL 3Q44A 5DJ0A 3RVVC 3ZE1F 3ARED 4I8DA 4F8LA 2NY4B 2YGVA 5IQNA 3BKML 5FM5O 2L7QA 4UB0L 2X9WA 1H8OA 3GI9H 3VW3L 4MS8D 2R8SH 1W80A 1XR9A 1BZ9A 5D2NE 4G1MB 4EAEA 3WIAA 4KUZH 2BOBA 2H2PC 1BIHA 1DO5A 1I7ZA 4OCMC 5I0VA 5C0RH 5JNYB 4IKKA 4POZD 3FT0A 4C57C 4DTGL 2VYRE 4MB4A 4XNQB 3GSUB 1SN5A 4J28A 5DZPA 1GTNA 4M7LT 5FYJE 2EIKB 3R06A 4FQJH 5KVEE 1CK0H 2R4RH 5KBLA 4UMGA 4G71B 2AABH 1CF1A 1QBBA 4JPKL 3EH2A 2GJPA 1F13A 1N64L 4PW9A 5DA0B 5EF3A 4M43L 3D09A 4A2GA 1L4IA 1NCDH 5F7DB 4UINL 4TNFA 3L1EA 3KPRA 1QRNE 5FV1L 1VGKB 2BNQD 4Z7NB 1WUNT 3S3CB 5ALCL 2IJ0C 2V8MA 3ELAT 4Z7UE 2DWEB 4FXKB 4Q9QL 3UBXI 5CCGE 1KBGL 1QEWA 5B3JF 4YC2C 2ICEC 3VXUB 5DRXA 4M62H 3L3OB 1Y6MR 4MQSB 4CN1A 5IOKA 1NIDA 2X3BA 5EU4B 2JTDA 3CWGA 4ZD3L 5FUZL 1GYWA 1NBVL 1UCBL 5JW4M 1MXDA 2ZP0T 1UACH 1AH1A 2WBJA 5IHBA 1PG7H 2ZCKL 3SDXF 5I2IA 3DV6B 5E6UB 2O61B 2FO8A 2A0LD 2HKHH 2WN3A 3AU1B 3RWDB 4ZMXA 2C9SA 2D7PA 3QHTC 2OMUA 1ZOXA 4NPKA 1ND0B 5CWSA 2QZ5A 3VFUA 4S2SB 2PPDA 3KE0A 4PGBA 1BF8A 3MCKB 2CHDA 4OLVL 1BAWA 2XIIA 1HH9A 2MOVA 3WKQA 5I1GH 2AFNA 3OKEA 1KTJA 1E4KA 3RHWF 3CFBB 1UZ6E 4P4KC 4LNVA 3VFMB 3WSQL 4IBUA 4BZ1A 3KYNB 1TG8A 1A2YA 2A9NH 2JF1A 1P7HL 1KXQE 4NJAH 3RKDD 3SDDA 4DHLA 2EC9U 2ENYA 2KL6A 4L3FA 1FFNA 2JVUA 3TBWB 1RUML 3HHMA 2I24N 2IOOA 4Y4FC 3HOGA 4K3DL 1OD7A 4DH2A 1RPUA 4ATWA 2WBJB 2F5BL 5T5FL 1FL5A 4MB1A 4F33A 4H8VA 4AQEB 4K94H 4KROD 5E99H 1KCKA 2H9GA 1IGMH 2FNWA 1XXDC 4A6YA 3KW8A 1XF3B 1OTSC 1GZQA 2ZXEB 4CJ1A 5KSAC 1AZZC 1TTCA 4APQC 2C1PB 2XJLA 1DQLL 3SY0B 4M7JH 1EHAA 3N1MC 4YHLL 5B8CC 4LHUB 1I8UA 1NM4A 3C8DA 3MJ9A 3IBEA 4BGDA 4KTDL 4FXTA 2NUTA 3VQMA 1PU0A 4WTWA 2CIIB 3UL4A 4Y8DC 2MCMA 2DAVA 5EU7E 2EDTA 2R7EB 4TMPA 5JXAL 3LSOB 5C0JB 1W0WA 2YPLB 2VXSL 3P9MB 1MCNA 3C09C 4J6RH 3O8XC 1F4WL 1FG2A 2X1QA 1IBBA 3GTNA 4HLEA 1MY5A 4OFPA 3OR7A 3L13A 4KTEL 1I1RA 4WEMB 5IHUH 4WK0B 1UZ8B 3RVWD 1JZ2A 2XLLA 3UBXA 1NC4B 3L48A 2GC4C 3PP3H 4M00A 5I1EH 3QJOA 4JRYE 4NS0A 1IU1A 4TOYL 2OTUB 2XTJC 1AO7A 2JLPA 5D7LA 1Y6KR 1KN4H 4BUGA 2Z93B 4X4XA 2HPTA 3RP1A 5IHWA 1E42A 5IJKA 4LLDA 5EU6A 1TKWB 2GHZA 3RFZA 1JTPA 1HE8A 5DJZA 5GHWL 1SFDA 1N8OE 3HCVB 4FI8A 4EDXA 3Q1EA 4F9PA 4JB9L 3AB0C 2PYED 1VKXB 1BVKA 3TP4A 5ACLA 4MCZA 2X28A 1ASPA 4QD2E 1WTGT 4L8DB 3OKLA 1P5UA 4AY0A 1H3TA 3LVTA 1FH5H 1XGUB 2VLRD 4XXDB 1MPAL 2BM3A 1PZAA 3QHFH 2WOYA 3S35L 1SHWA 5FUOH 5I26A 1D3CA 5I75B 3UDWC 2YGPA 4YE4H 3CVCA 3TXAA 5FECA 2NQDA 3QUZC 1ASQA 1SHSA 4K3DH 1QVOB 4NZFA 3MGOB 4HPOH 3ARTA 4P8QA 1T0PB 2QSCL 2WIIB 3EYSL 4LKXB 5T5NF 3GSOB 3QFJE 5HYQA 1ZGLP 3GXDA 5B3SB 1F4HA 3AJ7A 3B56A 2GG1A 5FOBB 4MSWB 1NGXA 5T5FA 2R4RL 5I74B 3N6YA 3X3GH 4JW3A 3CQPA 4JE4B 1MCLA 2HTKD 4FZ8L 3HMWL 5T1MA 1QSFA 3QNXB 4L1BA 4Y88A 3ZGIA 1GRWA 5AW5B 2XKNB 4RDQG 2JCWA 5E6ZA 1S5IH 4JO4H 5HJ3B 3DSNB 3QWOA 2F7PA 3CC5B 4HXBH 5IBLC 3O45A 3QJFB 2DQGH 4QHNA 5AVVB 1KZQA 2IH1A 3FYIB 2E7BA 4KROC 3JUYA 5CEZL 2LT9A 1A1MA 3KDPB 2VDRH 4XP1L 3CX2A 5JHDE 1N3NA 2FX7L 3ARZA 5GJSH 2WZAA 4ZFGH 1A14L 2ZPKH 2ATKB 3BZ4A 3N2JA 2BLFA 3FPYA 3HE7A 4Z7WE 5IKCB 3A21A 3VFWB 4YAQB 4OBRA 1JJUA 4PJIE 2EC8A 2B1AL 4U1JB 5EU5B 5EZJB 1HCVA 4H0LC 1CLOL 3BGFC 4O2FB 1JI2A 4PQXA 5KTEL 3F6IA 1NIEA 4P2YA 1W8EA 1PLGL 1S9VA 3U7WL 4LCVA 3NCCB 4K3JL 4MJ2A 3VFTB 3IJHB 4HK0B 5TE6H 3P73B 4XGZA 4DZ8A 1G0XA 3CLWA 4H25B 4N8CL 5B38B 3C6SB 3V0IA 3FFDA 2AEQL 4ODVL 1RIUL 2X0VA 1M6OA 4K4KA 1LMIA 1ET8A 4WEBH 1F4AA 3Q2LA 1TLKA 4WI5A 4YLBA 2DBLL 3AXLA 1NCAH 3Q0HA 4N3UA 1N0LB 1H3WM 4KKZA 5T5NG 4UOZA 4N4YB 3BSHA 4NDMB 1G6RA 2M26A 2BVUA 4XAKD 1TF4A 4JM2C 4OQTA 3KDMB 4NBYB 4OF0A 4PRPD 3UIYA 4E9VA 5JHBA 2GBVA 3K2KA 1U91A 2VE6B 1QEWB 4NIYE 4JPKH 1PX8A 2VXVL 3GT6A 3SBRA 5IEKB 3IXAB 4QYAA 1DSFH 3OX8B 3ZZSA 4A2MA 4I0PB 1G7IA 2X6MA 2OXHA 3HW7A 3CVHB 3GM0A 5BZWB 4LLMB 5KWYC 2OMZA 3QDMA 5E1QA 3LOWA 2DEWX 3QRBA 3QJZA 4KDWA 5L6YH 4BEIA 3MO1B 4AEFA 3ULUE 3S36X 3T8XB 2LU3A 2WXNA 1FG9C 4F2MB 5HI3D 5FYJH 1A6WL 3ROLB 3QJSB 5HPOA 3KLSA 2PWDA 5J1TC 1QBML 3QXAA 4LCCB 3UP1A 5KZCD 3IS0X 1DQJA 2QSCH 3L2NA 1DJWA 4E5XA 4HPOL 3SQBA 2I60L 4LSVH 5I6LA 3TEUA 1A3LL 4YSCA 3TH4T 4U4BA 4QNPE 1KCRH 3AG1B 2YSSA 4M6ML 3RKDC 4B6ZA 4BCZA 2CCWA 4HKXA 2XV0A 1AHWA 3JSSA 4N9OB 4JVWA 1BZ9B 2AP2A 1ZRUA 4TPRL 3O9WC 3ZT6A 4MDJB 3C5JB 2D0GA 4P2OC 3FCTB 4H2CA 1QACA 1FRGL 1T1XA 2FJHB 4EXKA 1ZJBA 4HD5A 3ZKQD 3V8CA 3BVNB 3SQRA 4AENA 3DYOA 1UM6H 2DW5A 5LNDA 1RU9L 1TVHB 2E5EA 2N1TE 3U0PB 1RZJL 1O9VA 1AIZA 4DP0X 5DS8A 1Z9MA 4CN6A 4F57L 1SGKA 3BD4A 5HHOB 4JKPL 3ZTJH 2NXYC 5AKRA 3IDYC 1NFIA 3QORC 2J3SA 2CSPA 2WQAA 4PVBA 4NJ9L 4N8VB 4NWTL 5K39A 1A9EA 1WP6A 2J8OA 3PL6C 5D70H 4M4PA 4OF8A 5FXCH 1NGYB 1JFQL 3LV3B 3C6EA 5M7QA 5F6HJ 4JZNB 1IUZA 2ZKWA 3P1VA 1XD1A 3P3SA 4PTUB 1UOVA 1XGTB 1E5ZA 4R90H 2YAQA 1NUFA 3F12A 2G2PA 4QUOA 3HB3D 1X9UA 2DF3A 3L1OH 4KTEH 5KSVA 1SBBA 3GIZL 4JHWH 1QHOA 5EBLB 4PI2A 3U4BH 1SXCA 1U8NA 5GRVK 5B1BB 1O7DE 4BFJA 5JHAA 2GSMB 1MLCA 3PG2A 1F4XH 3UTSA 4Z7UB 3MXWL 3UROR 4F37F 4I0PA 4RISH 1NCAL 3V10A 3PLYA 4G8GD 5FDYA 4FAAB 4WEBL 3HFML 3B9AA 3KL0A 5DLMH 4XB3A 3CCHA 4CADB 1AR1D 3ZE2F 2E7LC 5E2UH 5CLWA 3BP5A 2D0FA 2MQGA 2PXYD 2R29H 3FO9B 3DUUA 4JZJA 1NSNH 4MMZB 3RVUD 3BZFA 4YGVA 1ZVYA 1MHEB 5ICXA 2BJMH 4FQ1L 3H3PL 5BUAA 4OIBA 3VSTA 2AJXH 3IDMA 2HWZH 3H2WA 4JGUA 5F71A 4NERA 3O11B 3KYMB 3V4PB 1JZ8A 5B39B 2HN7B 4HMDA 3LZQA 5DMGD 5JHLL 3B7RL 2XWJA 4P4KD 2XWDA 4JO2L 2H1PH 1K2DA 5EU6D 3BH9A 2NXZD 2ZOWA 2Q8AH 4E36A 3HIZA 5F7UA 3N43B 4BKSC 4K8RC 4FL4B 1HH9B 1NCUA 2J5LB 1TDQA 2JV6A 1TTRA 2WP3T 3MCKA 3WFHA 1M05A 1ZHLB 2J6EH 3TPKA 2UVFA 5HY9B 4QHKI 1IEAA 3QUZB 3FCBA 3SCMD 3K71B 2EIZA 4EZMA 3RX7A 3KH4A 3P3UA 1IAIL 1SOQA 5D1XE 1UJ3A 3WCYA 4ISVB 4XN7A 4ACTA 3F7LA 5GGVL 2Y07L 3GHBL 4MXWL 2FT7A 2OL3H 2WN2A 1BFSA 1UYWL 2J1YA 3APFA 3FU9A 1CFTA 3IF1B 4LEOB 4OJYA 1HJBC 4HPYH 1ANUA 2ZNWA 2Y7QA 4G11A 4AM0A 5B8CA 1KCUH 2DL9A 2XN9D 1BBDL 2AK4E 3BUYA 2ZICA 2QQLH 1U42A 4DKTA 2E7LA 4AKPA 1MVFA 3CXDL 2EKSA 4DWHA 3BLBA 3QE5A 1ETZB 4GAJL 4UNTA 2WSDA 2AVGA 2Z91B 1F4WH 4GSRA 2XQYG 4E9WA 5D7SH 5ANMA 5BVPL 1CVSC 1D6EA 2G9KA 4FTVA 5IB3A 5HYQB 1CFVH 2NY6D 3VXMD 1YAIA 3R06B 2IALB 3WEXB 1U8LA 4QPEA 5DD1H 5HYJB 1EXUB 4P5RA 1A8ZA 4MNQA 1UATA 1SN0A 3LQAL 5C3TA 3PJLA 4XN4A 5DZLA 3UBFA 2IG2H 3F8UB 4B5EA 2AZAA 3KWWB 4N0UA 1T5XB 2Z34A 1AS7A 1IAMA 4JZNA 4D8OA 1INQB 3SKOA 4PRAB 1YC7A 2P1YA 2PNDA 3GBNL 3WKML 3ZYOA 3FQRA 4JY4B 2WTOA 1KZYA 4HQQL 4L2YA 4QRRE 3SCMC 3VXUD 2IDTA 4ECNA 1QWNA 5KBKA 3GBNH 3QZLA 4KY1L 2EDWA 3PWJA 5BS0D 1U3HA 3BFWA 5H2BA 5BOZG 1VLXA 2F5BH 3IGUA 5T5FH 2PW2A 3AY4C 4WI0A 1DFXA 2WWKT 2BNUB 35C8H 1OEZW 4OQTH 5ESQA 1J0IA 3MXVH 4KUZL 4Z7UF 2G3MA 5FCUL 4PRDB 1QPKA 1S7XA 2NXZC 3WIFA 4PWIA 3RVTC 1YVLA 3RFZB 4PJBE 1A7RL 3VXSE 1T1WB 1EHXA 2BY0A 4G9FD 4W9JC 2BS71 3CTTA 5AVTB 5H37A 4LRNH 3S5LB 3ZW3A 5AUMB 1YPZF 1MHEA 1MXGA 3P4MB 2PW1A 1CTOA 4X5RA 3JYCA 5HDBB 1IEHA 2YA0A 3PAUA 3ECQA 4P5MB 3RZCC 2JJSC 2Y6TE 3OWRA 4JJHA 4CADA 4YBHA 5D2LB 3THMH 3P02A 1UD3A 4ESKA 3ULUH 3BKYL 3KCPB 4HSCX 3TH3T 3RPIB 4U1LB 3RIFF 5SX5H 5HGAB 3TWCH 4A39A 3S97C 1DQJB 2C9AA 4Q0XL 3P9MA 1P4BH 2WUCH 3QFDA 1U2YA 3MV7B 5CINH 4RGOL 5DWUH 1KXTB 3DIFA 3ECVA 1CIDA 1I7RA 2EIJB 4K23H 4M93B 5D7LD 3JT0A 3SGDI 5KSVB 1BEXA 3OHXA 3KWVA 4HGMA 4ELKB 1S9WB 3P77B 1PFCA 3GKZA 4Z77B 1TETH 3Q05A 2F19L 2X3CA 1JK9B 1OAXL 3O3UN 3G6AB 3F58L 1YZZA 5IJDC 3EUUA 3HS0B 4U1HB 3MLTB 1JSYA 1XWVA 5EMYA 1X5JA 4HD9A 5IP4A 4A6YB 2WINA 3QIUB 3VSVA 5CJXC 4JDZA 3VJ6B 4KVNL 3MRCB 3GSRA 1B4TA 4GQRA 4AYDC 1LTXA 4N2MA 3LS4H 4OCSH 5IWLC 1G6RH 1RLBA 5AVXB 3WSQH 4PBXA 2C4XA 3NYKA 5DC4B 5LBGA 4JQXA 3HAEG 1DL7H 4ZUVB 3GMLB 1WC7A 1M2OA 4CBPA 2BVYA 5DVNA 4NQVB 5K59F 2PKDA 4EOWH 4OGZA 4Z7WA 2WQXA 4UTBL 4B7LA 4UZSA 5HGGS 5IQ9B 1G7PA 1OF2A 5B3NA 4WW2A 1KELH 1MCDA 3MYZA 4XWGH 2A5UA 4YHIB 5C09A 3PWUA 1L7IH 2DWDA 2GSIA 1JPFB 4MYWB 5M94B 4A68A 1GZHA 1M56B 1TOXA 2PP8A 1UA6H 2N3JA 4HX1A 3DYMA 4Z7VB 2FZ3B 3BUDA 4IDJL 1MREL 5F7FA 5C9JB 4NQDD 4WJG3 1BECA 1EGJH 1KCLA 1EEYA 3RNKB 3DV6A 2LVEA 4LKCA 4XNXL 4DGWC 1HHGB 3DIDA 4PJXB 5D7KE 1YEGL 1S7RA 2IMNA 4XWGL 4YGVB 5EC2B 2H6UA 3N91A 3RVUC 2AXFA 4TSCH 4DEUA 4TN9A 1MHCA 4J3TA 3ASOB 4XMTA 2NTFB 4H0HB 2NNAA 3UZVB 3LKSA 3MACL 3R0NA 3NJNA 1ZA3B 4P59H 2WNXA 2AJ3B 1EV2E 3A67H 2B20A 2VXQA 2JH2A 3F84A 1JHTA 2BY3A 2QVTA 3K2UH 4OJFL 4PJ5E 4BFIB 3QXDB 1A4JA 3GZPA 4CAGA 5IFJA 4OJFH 4QY8B 4NUPA 3OC8A 2Z6FA 3ZXAC 3JXAA 1OAKL 1TPXB 4JQXC 4WKZB 5EA0H 1AZCA 3P2BA 4V33A 1YPZB 3WO4C 1GGBL 4F9LC 4I87A 4X6DB 1RZ7H 2ZNXA 5DEFA 3T3PB 1P7KA 1MI5B 4NQSA 4OF6A 5DQDL 3PCYA 1FVDB 2NXYD 1FHGA 4DZ8B 4XMLH 1F8TH 2J5LC 2CO6A 4PVMA 1A1OB 1MDAA 1SYSA 1BZEA 4XMLL 4RH4A 5KVGH 3D25B 4P2AA 4N8UA 5L0QB 4TLSA 2NX5A 4MA7H 3VXQA 3FUMA 4WWOA 1BQHG 1JPGA 1TITA 2NY3B 4NQEA 4M7LH 1BPLB 3BN9C 3ZU8A 2CBPA 1I85A 1F4YL 4GXVL 3I6GB 4XX5A 1TZHA 3UC0L 1FYTB 2A6DB 3OM3B 4BFBD 3DHPA 2G2NA 2XJKA 5SWQA 4UOQA 2VXTL 3E3QE 5L7XH 4JDZB 3TV8A 3P0VH 4X7DC 3CZJA 3LJ3A 3V5DB 4KOBA 1JMXA 4JAMB 5D1QC 3HS0A 4JHAL 1JGUL 3AM8C 4IBQA 1EXHA 5EF2A 3D08A 1SZNA 3F83A 5IMOA 2YEVB 4W68A 1MDTA 4R6UA 4UTBH 2VDMH 3RY5A 5DJAA 3BGAA 5IB1B 5AVYB 2X05A 5IVXA 4GP5B 5GRXG 4GUOA 4HVBA 4JO1H 1YNTB 4AXWA 2HMID 5EF1A 1G7IB 3DARA 4KQ3H 2X9ZA 1ZLDA 4JHAH 1W0WB 2YPLA 3WKMH 1IGIH 4XI5D 5SWZD 2IFFL 4YN3A 1XBRA 1Q1JL 2JXMA 1I4FA 4QRSA 5FW6A 4APQA 1KEMH 1WBXA 1G1YA 3ULSB 1IBGH 5CD3B 5EORH 1WK0A 2KDGA 2FJSA 5LXGL 1PZSA 1ZT1A 1H8SA 4Z7VF 4YHZL 2NLJA 3U6XS 4ZNEA 1J0JA 1KGCD 1E9QB 1CFMA 5DEJA 2JQZA 2ED6A 1M6UA 1M2VA 4KH9A 3V9FA 4J23A 4R96B 2BNQE 4R4BA 5C0NC 2RJMA 1S7XB 5TF1H 3A3YB 2CE6A 2NXZB 3VFRB 1ES0B 4F2FA 3HCVA 1JZEA 2R2CA 2H7WA 5J11C 3RFZC 1H19A 1R0AL 1KJ2B 3D51A 4BYHA 3LS4L 4GKSA 2BO0A 1Q94B 3WOVA 3VFGH 3P30L 1R3JA 4QXWA 4WUUD 3V52L 5IROC 2YGNA 1GZPA 3TX4A 4X4ME 4EZLA 4KWUA 4WI9A 3LZPA 2YN3A 2XWBB 1OV8A 3CN0A 3MUGB 2B77A 5AVWB 1VPOL 4PJDF 2G2RB 4IHOA 2KC0A 2XN2A 1EBPA 2F7OA 3RDTA 1ZLSL 3ESMA 3KR3L 1IIIA 3CVDA 3HLAA 3P2DA 4ILDA 1RP9A 3U2IA 3C8KB 3L7FB 4H20H 4LRNL 1SUHA 5B39A 3WEXA 4R26L 2AQ1A 2YZ1A 3TJPA 1GL4B 2BRQA 2EDOA 1A9BB 4YDKH 4ZMYA 4I1RA 5E8PA 1WEJL 1XF2A 3FC8A 4WTZG 4GAYB 5C0AB 2RAMA 1IL1A 2Z31A 3U1SL 2BERA 5KJRL 2CALA 5DJXA 4YQXL 2CJUL 1NZRA 1OTUC 4ABWA 3ECBB 4QHKJ 2B9AA 1HEHC 4I0KA 3BC9A 3VJ6A 3QIUC 4NT6A 1JAEA 4IU2A 3NRFA 1JZ6A 1S3KH 3ZUNC 4B9YA 5HGBA 2P80A 3MLRH 3S3JA 3LQAH 5E70A 3OG4B 4FQXD 4PV8B 1E30A 4FQIH 3KS0J 4DW2L 3IJEA 1NCCL 2EDYA 3F12B 5ABZA 4W9IC 4PHXA 4Z7QB 4GW1B 5BVJB 4ELMF 1BYPA 3C5SB 1VAHA 1FE8H 2OL3L 3QIBD 1R3KA 4AL8C 4GO8A 1NMBL 1IAIH 3RPIA 3LNEA 3QDHA 3BUIA 3ZSSA 4CKVX 2WM0A 3H85A 2ZYRA 4XCEB 5FCUH 3WUWB 1E28A 4X4YA 2B3RA 4HWBA 4MXVF 4X9GA 5IQ9A 4QHUA 2EH8L 2Y1ZA 2VDNL 3FT1A 1EVUA 2KPNA 1HZHL 3QUXC 1U8OB 1GZPB 1TMQA 1TJMA 3DVIA 4ODSL 1M4KA 3TNNA 4EN2A 3BAEL 2VXSH 1WC7B 2Q3AA 3FB5A 3H3BC 4R97B 1FVEA 2EUZA 4TV3A 5L9DL 3VNYA 3RL1B 4AEHL 1PG7W 3GXMA 2H2SD 3PGCA 1YYLH 4RGMB 4MAZA 1QW9A 1E4XH 5JTWA 2OV0A 1FFOA 2CKBA 3V5KB 5DUJA 3QIUA 3DTUB 1RD6A 3BQVA 5K9QI 1JUFA 5IVOA 3ZTCC 1FRGH 3E6FB 2CR6A 1KXVA 1UASA 4NNPH 2QQKH 3HMXH 2SEBA 3P30H 1OM9A 5FW7A 2WXLA 3QNYB 2LLGA 2D4FA 2HZHA 3DGCR 3BW9B 4HPYL 1JZ7A 1C7TA 4PGJA 3C08L 1C08B 3OKDA 4ONHA 3UTTA 1U3HD 1T80A 3H9HA 2X5PA 4KJYB 4FLRA 4PJCA 4RWHA 4Y5XC 4JFFD 4NC2B 3MRMA 2NYYC 3WENA 2WLIA 4LRIC 4OCXL 3V95A 1KCVH 2NY7H 2OXGA 2OS7A 3H3PH 4TSAL 5I0XA 2KQNA 1KCWA 2DQIH 4X7TA 4OLEA 2PWHA 2R9HC 4U1LA 2Y23A 3VX0A 4F7CA 1ZXKA 3PGCB 4R90L 3F65A 3V7MA 2CJSA 4M7KH 4PBDA 4G82A 1MCQA 2F1BA 3E38A 4GP4B 3P4NA 3L3OC 2H1PL 1AFVL 1C5DA 1CG9A 1J9QA 3KGTA 5E5LA 5I75C 1FDLH 3P11H 4B95C 3ILPB 5JIHA 3C6LB 4GI6A 2WKOF 3ULVC 2FJHA 4A2DA 43C9A 4ZMVA 4NHCH 3CVIL 3CQQA 1NBZB 3K91A 2I32A 3DOSA 2VITB 3QH3B 3IB4A 3FO1A 4EI6A 3TBCA 4YXLH 4ZXBD 3SE8L 1IC7L 1B0WA 2HVJA 1KGCE 2OJZL 3QS3A 2BMKB 1U9KA 4DGIH 4WWKD 2CKBL 2E8YA 3GB7A 4FNSA 2YQ2A 1PNCA 5EC1B 2XU9A 2CDFA 4G3YL 1EGJA 1KPUA 3O9WA 5BXFB 3JWNC 4TUKL 2YAPA 4P5TA 3QPXL 4JZOA 4Y7OC 2A83B 2X4UB 2OX5A 4OCWL 3HKFA 4NKDA 4XVJL 4FYTA 4JFYB 5KVMC 3ABLB 3CFDB 3MXWH 5FX3A 4JFEE 1VFUA 4L37A 5JQHC 3VI3F 4J3SA 5LNEA 5C08E 1D5MA 4ZW3A 1NBYB 1JDCA 4OF7A 2D31A 4NENB 3IMUA 4NUJB 2YOCA 3S36L 4X8JA 2IALA 1J5OH 4PJFA 5BQ7B 1M7IB 4W9DC 1OT4A 2P49B 2YAHA 2P44B 4PREB 5DQ9B 2ODHA 1T66C 4LCIL 1NQBA 5KSAB 3FB7B 2XBZA 1HNYA 3PXLA 3T77A 1TEYA 2VDRL 4XP1H 4YBQC 4NKIL 3CH1A 3MCLL 1I9EA 5F97E 1G4RA 3FUEA 1ZGLM 2DIAA 3MV7D 2IQAB 4HIHB 3S48A 3HHSA 5DFWH 2X0WA 4XMXA 4EIGB 1MI5E 4XC1H 1AGBA 3LHPH 5AL8A 1XF4B 4FQ2H 2DI9A 4ZW7A 1Z32X 2CLRA 3OSVA 3DGGB 3ZKNC 3L7EB 4GI8A 5FYLE 3GSUA 2LU7A 3C5XA 3JUZA 2A6KB 1XO8A 3W9DB 2O1AA 5DMYA 4KOCA 4K9EH 1IKNA 1TNMA 3B7SA 4PJHE 3IU3A 5E56A 4AEIL 3PHAA 1PJWA 1JXKA 1I82A 4HS8H 1BBJB 4WUKL 7FABL 5C9JA 4FQLH 3G9VA 3MSPA 4DPAX 2F8OA 1KBVA 2JCCE 2V8LA 3BISA 3DX7B 3DWTA 4YLQT 4FEIA 2A7BA 4LSQH 3AVEA 1XCXA 4AQ1B 4AOFA 1B90A 4MAYA 2FECI 2KZBA 4N0UE 5GGSA 1G9NH 2Z64C 3PWUB 4OZGB 3CDFA 4TNWF 2O6DA 3HPLA 4KKBC 5E2WH 3DTXB 3PQYB 1KGUA 4P48A 1JHKH 4JVPA 5LGKA 3BI9X 3EADA 2PN5A 4UTAA 2VZOA 2GYSA 3QZBA 4G6KH 1ZV2A 5ES4B 1ZTMA 3NP3A 1Y7VA 4QTHA 5HD8D 3UJIL 4LVOB 2CCLA 5EEXA 3KGSA 1G1OA 5F9JB 1KMGA 4KVCL 4XMWA 1X5AA 3BYYA 4N8CH 3X1EA 4U4IA 4XP9H 2KLTA 3D25A 4WIQA 5HJGA 4A7TA 2VDKL 3L3JA 4RMUA 4Q6KA 4ZXBB 3N9GH 2HRGA 1NMAH 4WY7H 2Q3XA 2ZX7A 1WF5A 4I18A 4RNRA 3U1QA 3QARA 4HC1A 4EBQL 3OKMA 3B2DC 4WSJA 1EO8L 3OPUA 2FBRA 3OB8A 4Q89A 4YHPA 2NX5D 1KTKE 4Z18A 5L4MA 4S1DD 1RZFH 5C08A 4FNRA 4F57H 1RZJC 2A77L 2FWUA 4Y19E 3VYNA 4QOKE 3RBSA 4X5PA 1A6UH 1SN2A 2QELA 2H26B 5AB9A 3IU4H 4JRXE 3FT4B 5D6DA 4OCXH 4P2RB 4W93A 4JFOA 5LO7A 4Y5YC 3VWKC 1CLOH 2WYHA 4ANKA 4C56E 2B0SL 4KO9A 3U25A 3ZKND 4KBPA 3RL1A 1KIUB 5TE7H 2GW5A 5C2BL 2ITEA 1CYWA 2Z7YA 4K9JA 2Y9RT 2DY2A 2E6JA 3V0WL 2H6OA 2ATAA 3MRIA 2CUIA 1DN0B 3W11D 1P4IH 1FNEA 5GGVY 1K4CB 2VNCA 4G6AD 1EEYB 1MI5D 4GG6A 5KOMC 2NUPA 5D7LB 5J4MA 1Z5LA 5LWYH 2BDNL 3EYVA 4W9HC 4RIRB 4UOJA 1U8OA 4Z7VA 5C0GB 4E9XA 4AGOA 2FVNA 3SKMB 2APSA 1KB9K 2DICA 3DECA 2GK0B 1HSAA 2GQHA 3QZNA 2C3XA 4PJFF 4QRUA 5GJSL 1NEZA 1FZMA 3P4OA 2RFXA 2EC9T 3WL9A 2AQPA 1BJ1H 1KTDA 1E67A 4NXSA 4PY8J 1PDKB 4GW4A 3FQUA 4L3CB 5KVDH 1XCTA 4O02A 1E8XA 4GW1A 1SXZA 1R5IB 1G9MH 1DLHA 2TRYA 4RMRA 2OZ4H 4V11A 3SOBH 1WZ1H 1CCZA 2J25A 5D9SB 1I9RH 1T6WA 1U3NA 3ZHDA 5E4OA 5CP7A 1PNDA 5I19H 4YDZA 4H8WC 3BKCH 2FO4B 3V0VB 1I9IL 3N40F 5JXAH 4TVSa 3E80A 3HZMB 4HIJA 3VWKA 4DP6X 2E27L 1T83A 4FQXB 5HJ3A 1A7PL 3ULVH 3ECBA 5AYTA 4BFEA 1JZHA 3QWNA 5BNXD 2V6HA 2AJYH 1LXMA 4G6FD 4NUGL 4Q8BA 5T1MB 3GUTA 3QXUA 3WXVL 5C0AA 2UXGA 4TVPE 2EXYD 1A5FH 1JRHL 1S7SA 3HZYA 4XPHL 2HCZX 2CRMA 4TUJA 2Y7QB 4AM0B 5GS0H 4HWZB 1QI4A 1RIHL 4JRXD 4B0MB 3TESA 2QHRL 1S7TB 2PCPA 4JCMA 4KK5D 2X4NA 2XX1A 4XO3A 1QSEA 1HCZA 1DSWA 2A0LC 2APTA 2VC2L 1JNNL 4X42A 3NN8B 4Y9BA 4ZBJA 5LLIC 3MRGA 3HC2A 4MA3B 5I8KH 1RXLA 1UXWA 3NIDE 4HCGA 4C47A 3O2VL 3U2SB 3LQZA 2FX7H 4I3RL 3S8WA 4A04A 1CD0A 3ARSA 1YC8A 1QRNB 1MFUA 4EIUA 2DJMA 4JE0A 2I07A 1NCGA 3TLRA 3O9WB 5T1LA 4GKSB 3B9DA 3IFLL 4TLUA 2B7DT 3H3KA 1BYNA 5C6TL 3JYBA 5T3ZL 3QDME 1BMWA 3B5GA 1SPDA 3K6SB 2P46B 3V4PA 2AV1A 1C5BH 4J3XA 4PG9B 3P9LA 3O4LA 3BO8B 3QFJB 3F7QA 4BQ6A 4CC0A 4XX1E 1NMCB 4NZRH 5TH2B 3N0AA 2NXYB 2OR9H 1AZVA 2EDHA 4NQCD 3CZFB 1D9KD 4QEGA 1UWGL 1C5DB 3CHXA 2NLJB 4IRSB 4XBGA 1UACL 1LHZA 5CGYD 1DBJH 5L2KB 1R3HA 3HI5H 4YBLB 1W72A 4KXDA 4F24A 4H1LG 4L8BB 5D1XD 1A1NA 4RETB 2IH9A 4YNYB 4JQVC 3TYGL 2WUBH 1JWSB 1FCCA 3H42H 5EU7C 3ULVF 5DK0B 5I17B 3II2A 2OR9L 3IFPA 4X98B 2OLDA 3PFUA 4QHMB 5LXGH 2VZ3A 5DJAB 1DJSA 3DRTA 4WU5A 2ZG3A 4YX2L 2EH8H 5IVXB 3SHSA 4FQCH 2DLIA 5LAPA 5A2BA 4QRQB 2YUWA 3MNWB 3M1BB 1G7JB 5IY5B 2V9RA 1DJIA 3VB8A 2NY0B 1V3KA 3MV8E 1QG3A 2WYIA 4MMZC 5I18L 5HHVH 1MJJB 3OJ2C 4N0RA 3ZO9A 4EKXA 5I19L 3ARWA 2Y6SC 3MREA 4GRMA 4WSKA 3T3MF 1DO6A 1JYWA 1KEGH 4FADA 4O00A 4WV1B 4LMQE 4FTVD 3JVGA 1R34A 3BRDA 1N64H 1RUQH 3QO0A 1AD9A 2F74B 5E1IA 3O0RH 4RDBA 1CIUA 1DVYA 1N4XL 4GSDH 1HHIA 2YD2A 5KBNC 4A66A 4M93C 4QT5B 5MHSE 2F08A 3FO2A 3I6KA 3IJ9A 4E9QA 5G2NA 3QGVA 1QI5A 1CB4A 1LP9E 3UMTA 2JKRM 1T5WB 4OZFA 3SKOB 4YIQB 1BZ7A 4APXA 1RIHH 4OCNC 5ACMA 1PZCA 5CEZD 3DO7B 5CZKA 3HS0C 2HKHL 4OM1H 4YSUA 2ZUTA 1BX2B 4P9MH 5AOMA 2ZCLH 4YQXH 4ODUB 2AQNA 5E94A 2MPAH 1UM6L 2VMJA 3DGGA 4UTBA 4XCYB 2EE3A 4UM9A 5GS2H 2VDPB 5EZPA 1BEYH 3KH3A 1Z7JA 3QA3B 4NN5C 4MXVE 2I69A 2R7EA 4WU7A 1GR7A 1KB9J 2EDEA 4AKOA 5IW1A 3HPJB 5TQ0L 1FCGA 4PY7B 5D71L 1M9SA 1BFOA 1T0OA 5KAQF 4X4KA 4AV0A 3AWGA 2ICWI 4LPCA 3F85A 5EZOL 4Z5RA 2HPOA 4N2IA 5HDOA 3R19A 4LCYB 2J1ZA 4XCNB 4C4KO 2GUYA 3TYFB 3VD2A 1RUMH 3IFOA 1F00I 2BSTA 5DQ9A 3QVAA 1NOFA 4YEFA 4YO0B 3RGHA 3X1FA 4PGCA 1ZANH 3QQ9D 1XGQA 5AOZA 4P07A 4DVRL 5KS9B 2VB5A 4PSRA 5BOPA 4AQEA 1IBZA 3ARDA 3WGVB 3GINA 3F2LA 4PJHB 2G0KA 2W91A 4UI2A 5G5DA 1IGFH 4OIAA 1UWFA 1A6VL 2VLJA 4CSSA 2AERT 3JTTA 4PJAB 3K72B 3JWOL 2WGXA 5DZNA 1OZUA 1KTDB 2NR6C 2P45B 3ZLQC 4FFYH 2A4EA 3FQUB 1P7QD 3GRWH 4ZDHA 2AHIA 1ZLUH 2P8LA 1RULH 4HCIA 2YD7A 1DQMH 5JIDA 1I7UA 2ED7A 1RSFA 2ORBL 5AVQB 2PWGA 4OI9A 1J1OH 1AGEA 2H3NA 5MEND 5FYKH 1QSED 4FCAA 5C86A 1MLBA 3D1MC 3BEWA 3WNKA 1S9VB 4XNMA 2Z0UA 1IM9A 4N2GA 5AZUA 3JVFC 3WY4A 2NNCA 4YSTA 4U3SB 1CT8A 3SYOA 3EBHA 3BVNA 3VTAA 1BREA 1JV2A 2OA9A 4CMMA 3SE9H 1JF1A 5CN3A 3OWEA 4X99B 5JMRA 3IKCB 5A2CA 2EDJA 5CGYC 1GAFH 2WKLA 1OCWL 4AG4H 2ADJA 5HBBA 5L2JB 5C71A 5I1DA 3OR6B 4HUXB 3CZNA 1KTBA 2YBRB 1NAML 1OGPA 2VXUH 5JQIB 5LGHL 2B8OT 1V7ML 4WV1A 5CJOL 4A67A 4XOEA 3C5ZC 5SWSD 2IH1B 3TVMA 5JLZB 4S0HA 1BLNA 4R7DA 2ARJB 4BSVB 3O8XD 5DZJA 4WFGE 2Y06L 4PRHE 5TD4A 5K5YA 4PJ7E 4PLKC 3K0WA 1V10A 2KLRA 4HT1H 1LE9A 3MRBB 3EXJA 3G6AA 4N2KA 1OAYH 3MLXL 3DROA 1KPRA 1MVYA 3KXFA 2WZPA 2CHXA 4NQXA 3TA3C 4XNDA 4IEFB 4JDEB 4ODWB 2PYEA 1SJHB 1ZTXL 1NDGB 4YHML 3RTLA 3ARDC 2BVOA 2V2WB 2JI2A 5F93C 5EIQA 1QFUL 3P0YH 1OTSD 3GJFA 3MCLH 4X7SL 5KSAD 3VTMA 2DYRB 3GMOA 2CKBB 3UTQB 1KYOJ 1QFWL 4PB0L 1RZKH 4TL5A 4EPSA 2WVSA 5C7ZA 3DO7A 4IGBC 1H6TA 5J0BA 2Y5TB 3MC0A 4YZFF 1NGQH 1PW3A 5AUMA 2R23A 4D3CL 1G7MA 4GEJA 2IO5A 3O3AB 4AQ8C 1XGUA 3LZFL 4XXDA 4Y0GA 5IB4B 1HX0A 3RZCD 4TKWA 3L9YA 5FUCE 3D69B 3G5YB 1M6OB 4HFUH 4Z7OF 2B1HH 3P9LB 1B3IA 2FLRT 1CDBA 4XN2A 5GGUA 3EOTH 3VQLA 4HCFA 3BEWB 4DOHE 4UQEA 5ESQB 3TJHD 1NMCC 5I76A 4MA1C 4TVPH 5GGSB 3DMMC 2EE9A 2MCG1 3O3DA 4U05A 3HPLB 1VJSA 3A4AA 1A7BA 3QZWB 3V0HA 4HJTA 1OL0A 2VDNB 1T0NA 2D2OA 1M71B 2FIKA 5D1QE 3E1ZA 4M8QB 4F7TB 1B3JA 1YN6B 2DV6A 1INQA 2HFTA 2JJTA 4E42A 5HYSA 2VDRB 5ITFB 2ICWB 3M8OH 3M1CA 1DDHA 3FOMA 5ACZB 3DYPA 2WHVA 3RIKA 2CDGA 5DC9B 4HUWB 1AHMA 1YEEL 4U6VH 1QSEB 5KSUA 4OI8A 2X38A 1KCSL 4URKA 5GZNA 2CLRB 1CDGA 1RZIB 4FLQA 4U7KA 3BT0A 3VG9C 4JDTL 3APCA 4MA8H 3O45B 5KUMA 2FD6H 3DVNB 1ILUA 2C3VB 2R27A 2WNKA 1KXHA 5IEHB 4LSRL 1KYUA 1QRKA 1DJYA 4WGWB 3EJJX 5LN8A 4LCYA 2PO6B 5JIQA 3L1FA 4K7PH 2EDDA 1T83C 4ZUUB 3U0TA 1CBJA 3ABGA 1RP8A 1LDPL 3AQYA 6FABL 4LGRB 1N0LA 4J3BA 5FM4A 1XV8A 1M57B 1CMOA 5HDRA 1JNJA 5AZEL 4DSYA 2IPKA 3ZHKA 5CMAA 1I1YB 4NQQA 1CXIA 5F9AC 1UA6L 2N7SA 4YSQA 3QPXH 1IARB 1MFBH 3QZWG 5HHQB 3C08H 2K7QA 5EC2A 1DR9A 1IQWH 4X8CA 4N5UA 3ME0B 2WZ0A 4WHTB 5I1AB 1WIOA 2VOTA 2WLZA 2WQUA 4OQTL 2F53A 3FRUB 4YHLH 4D8PB 6PAZA 3DRQB 3QISA 2OJEA 4XO9A 5C8JA 2Q10A 3EO9H 5F3HB 2FIRT 4UQBA 3BE1H 2FB4H 2OX5B 5GGVH 1CGSH 1PZ2A 3F5WB 4FG6D 5F96L 5HDBE 3VGGA 3VFWA 3U2SA 3NH7L 3H0TB 4JFPA 3UBHA 2A2QT 1C8PA 2CJ3A 4PRPE 3ETBF 3BKJL 5F7KC 2X1XR 3QFJD 1UEYA 4LVEA 3U1SH 1AD9B 4KKCD 2V5RA 5IT2H 1HIMH 3NACL 3FHQA 3HUJE 2QVMA 3DOSB 2JELH 4TUOA 2QMJA 4Q97A 1IGJB 3ECUA 1H15A 5D4HA 4XP6L 4HWUA 4OUUA 4GG6B 4XZUA 4BKTC 2ZF8A 1G7MB 4GQ9L 5IQMA 2A9MH 2HTLD 3L4XA 1A6ZA 3B2UD 4UU9A 3GXUB 1IGTB 3MBEA 4X5QA 3MNVA 3Q1SL 5DJCB 5J56B 3TBSA 3DETD 4OZGF 4EKJA 3L6FB 1GC1L 2DWEA 4FXKA 4JM4H 2DLEA 2H6PA 3BD3A 3V4UL 2CHZA 3GXFA 1HXMB 3HFFA 3X12B 3RILA 3E1F1 1JPTL 3TVMD 3KYKL 3FT4A 4XXCA 1V7NL 4ZPTA 2OI9C 3B3IA 5IMKA 4BXVA 5IESL 2EYSB 1P7BA 4U1GB 4BFFA 1SF5A 1IV8A 4UT9L 4XBMA 5EUOF 3AXHA 1W9XA 3RTQC 4F3FB 2GTQA 4XC3L 1GOGA 1YN6A 3IFLH 1JN6B 1KGYE 3PGFL 1CXHA 2QGBA 2H3KA 1PBYA 1FUNA 4EDWH 5IWLA 2B5IB 4IRJA 3CUPA 3KPLA 4JJOA 1K8IA 4BHUI 4RGMC 2AK4B 1IZJA 3L1OL 2MNWA 3RWJA 1LO0H 3VXRE 4GXFA 3B3BA 4LPXA 2DQCH 4HJ1A 4LSRH 4HISA 3GSNA 4IMLB 1QLFA 4F2EA 1SJVA 1MWAL 1CFQA 2G9HA 3JV4B 3MVSA 4KJPD 4JFVA 1T22A 2ZSVB 2YD4A 2OR7A 4HCRA 5IB5B 2H1LM 2LVCA 2NX5B 2XI9A 4POUB 3QYNA 1YRKA 3WIFB 2VN7A 5GGTL 2BY1A 4PRIB 4RFNC 5EZIL 4DERA 5I28A 4L9LB 2BRRL 4NM4L 4FQHA 3IVKB 1OGAA 3KEHA 1KY7A 4DKEL 1ZLEA 2ZJSH 2HUHA 3OR7B 1YEWA 4D0CA 5JW4N 1U8CA 1A3RH 1UTDA 5I0DA 2FRGP 4NRXA 1XHHA 4U33A 1JI1A 4AC2A 1GYVA 4XAWH 5H37G 1AOZA 4P2QE 3NJXA 5CEXB 3HZVA 4X4MA 3UO1H 1FN4A 2FAUA 3GXPA 2BNRD 5DMKA 3E8VA 1KLGA 3EW3B 3GZQA 3HR5B 2YD6A 1S3KL 4I9WD 4XVTL 5LQBL 3AU1A 3IMRA 3MBED 4Z3IA 1S7SB 3C6LC 5TGBA 4M6NH 1Z9OA 1HH6A 2J21A 3Q9QA 3QQXA 1TZGH 1F4YH 3ARDB 4Q7DA 4NZDA 5I5MA 4K7FA 4A63A 5PCYA 3VXTB 2EDKA 4X6BA 4GT0A 1GGBH 4QRAA 4OCRL 1LK3H 4R8WL 2JKLA 3H7BB 4JJ5B 1J5IA 2NNAB 2BSSB 3VXSD 1KIQA 2N4IA 2Y07H 1ETZA 3GHBH 1LDSA 3SDXE 4O58L 1A25A 2NR6A 1YNKH 1KEML 2D3JA 2JB6A 4KHXL 2ADGB 3F7PC 3KJ6L 3R7RA 4QCIB 1KG0A 1QFUH 1T0MA 3QQDB 3WE6B 1FBIL 1YNLH 3RU8H 1HEZB 1WTLA 4FFZA 1NAKH 3HRZC 4PREA 3PWPE 3FRPB 2BZCA 3DOHA 1IGJA 4FQQA 4GKZA 1NM9A 1N9PA 4W9ZA 3FSZA 1OCRB 2IAMA 32C2B 1JPFA 1VRSA 1BX2A 2AEWA 2CPUA 1YDPA 2XG4B 1CE1H 5HYEA 2IXQB 4LXFA 4UF7C 4LSPL 1T5WA 4LLVB 2P8LB 1X9RA 1WD9A 4QRPA 1A4BA 1NIBA 4WSGA 1A65A 2VQ1A 4QRTB 5JQ6L 2VL5A 3ARBD 1G84A 1WAAA 1DUYB 5E51A 1G4MA 5EPMB 5DYOA 5AQ0A 1B4JH 3LMJL 3U7WH 3GLEA 2CK2A 5LAXA 4K7PL 4R97C 1YEHL 3GFUA 3VG9B 1T03H 1J8SA 5IREA 1U4EA 5CHNA 5D7JC 3FUIA 3LKQB 3QFGA 3MHZA 4L0PB 3EFOA 1R3IH 2FX9H 1DJXA 4NQEE 4PRHB 2VLJD 3L8QA 2UZYB 4BV1A 3EF4A 3T2NH 1SQ2N 2BNRE 1VIWA 3B9KD 2FYYB 1KBKA 1MAML 3CLFL 3O2DH 4PN6A 4CGTA 2R23B 5JIKA 4KY2A 1ZTXH 4ABQA 3F00A 1G6RL 4HOXA 2MWCA 1XSJA 2KHAA 4LESA 4KRLB 2PMZA 3KJ4B 3GSNL 1BM7A 2IGTA 1AMXA 3RJOA 1D7BA 3DRTB 3O6FC 4AQ1C 5A2KH 3GRWL 1U58A 5FGRA 1PCSA 3SO3B 5C07B 4OV5B 1O6SA 1YEFH 2E7MA 4AW7A 4B9KC 4M1GH 2JXMB 3UJIH 4E41A 1BIIA 2G60H 3VG0L 3OV6A 4AXWB 1YMHB 3FF8A 5B1JC 2ATPB 4YLCA 4L5FH 4CL7A 5FECB 5MEPB 1DHKA 1H5BC 2VLKB 3FQTB 4L37B 2UX6A 3L3IA 3W2DH 3UTOA 2V9QA 1G9EA 3FU5A 2DLFL 1WISA 5HI4D 5J6HA 1P4BL 1TO4A 2WUCL 3LNDA 4X5LA 4ANXA 2V5TA 3RX5A 3PABA 3IFNL 4D9LL 3UAAA 5F1NB 3RIAF 3MLSH 4P46C 3KCWA 3GB7B 5KZCB 5ILTL 3LN5B 3EJCA 4KNSA 1LEIA 3FH7A 5FUOL 4YJZL 1EJFA 5I1HL 1U3HB 3G5YA 4W6XB 4AVJA 1PKQE 5CGTA 3IKCA 4IDJH 4ZPVB 4OFIA 1DUZA 4RFEB 1J7VR 2ROYA 4OSUL 4DQOL 1GPOH 4S1DC 5E9DE 4PLNC 3BPCA 5FKAB 3ABKB 3BQUC 5C0CA 3VACA 3AQDA 1KUMA 3HN3A 1F3RB 2GK2A 1YQVL 4FFVC 5TDPB 4HZLB 1RPQA 2VLKA 1PZ3A 2A74B 4DP8X 4RMBA 1EMTH 4G72B 5L6YL 3OAUH 1OAQH 2WO2B 1I8IB 3O81A 5DR5L 3V7AG 2ADFH 4B53A 3CMOL 3DMMD 3O2WH 1IO4C 2R1XB 5INDA 1UWYA 2NY5H 43CAA 2X70A 4Y2DA 1YCSA 2WMPA 2DKSA 4D0DA 2VJ8A 2GFBB 4BFIA 3HNSH 2F54B 4UT7H 2ZCLL 1LE9B 4LQFH 1OCWH 4AG4L 5A40E 3IPEA 3QEUA 4W4NA 2FJFB 3NZ8A 1EXGA 5EO9B 3RWGB 5LDSA 1E3XA 1BLNB 2QDVA 2VLLB 3V8OA 1XB3A 1TT6A 2QGEA 1OVZA 2C3HA 5IROA 5BUPA 2E75C 1G6VK 2NTFA 4KKAC 5FS5A 4XP5H 3F6LA 4Z5RB 4BXSV 1RJCA 5ESAA 4ADGA 1NBYA 3GQFA 4DUWA 1L5GB 5AKVA 1DBAH 5T1LD 5D7IE 1C8QA 4XBEL 2J4WH 1FNLA 4J3OD 1BD2B 4OF5A 3RLSA 1CT8B 2VH5H 2ZUSA 4JZOB 1LM8V 1N7MH 1LEKA 4H26A 1ETJA 1FAKT 5IQLA 5I18H 3OSKA 1LQSR 2YD9A 5I16A 4TLKA 3V0FA 3C8KA 1INEL 5C6TH 4PHZA 2PPFA 1GHFH 2ODIA 4JQIA 5KS9F 2P26A 4W81A 1SVCP 4L9LA 4LLYA 1E7UA 4GQ9H 4S10A 5KW9L 4YC2B 2NDFA 3CSTA 4DN4H 5F70A 4L2LA 4MYPA 2YJLA 1NFDF 1G7HA 3M88A 4D8PA 1K9TA 2R39A 3MRJB 5CU9A 5IKCA 3T08A 4HIXL 3OAYK 3GSWA 2ADGA 4LVOC 3MRFA 3KPSE 5I66B 4LVNB 4NGHL 4MD0A 1OSYA 2ZE0A 2QTVA 3MA7A 4G42A 4HUUB 2E47A 1JDDA 3VXUA 4L8CB 1AKJD 1TJIH 2X1PA 3L5XH 1VFBB 2APXA 4QF1B 4ZOBA 5FGBA 1N2RB 4EN3D 4QRRA 4OZHF 2UXVA 4ZUUA 3D39E 5F7DA 5ADPH 5JA9A 3AY2A 5E2VH 4TSBH 1WYJA 1JNNH 3HG5A 3TU6A 1EIBA 1AQHA 1XCTB 2DWSA 2E27H 1AGFA 5D96C 5F7WC 4QRPD 2AXGB 2NTSP 4K71C 1BW8A 4ZG1A 2QMKA 1UUNA 4PLJC 3UTPE 3RI5K 4QNPF 3QIWA 5D7SL 1CGWA 3TCXA 2RTTA 8CGTA 2XG5B 2ZOKA 2VR9A 4R7LA 5D5MF 3PREA 2VAJA 3ATEA 2W60B 1F1DA 4Y16C 5FYLL 1JZ5A 3KBFA 4KKAD 3O0RL 1I7ZB 3UAJC 4IU3A 2FR4A 1M71A 1ORSB 2FIKB 3ZOAA 4IRSC 3EGSA 3CMGA 4P9HL 2X1OA 4IMKA 1J12A 1F4XL 1KNOB 3G6JE 2DM7A 5KVFH 3DUSB 4WY7L 4F7EB 1U8JB 4YXHH 3QI9C 3TTYA 1RHFA 2ESVE 3FL7A 3CHPA 3LX9A 4LLQB 4APQD 5D7JB 4X0KB 4HHWA 4FQCL 4IOSA 4WRLA 1PLCA 5E2VL 3H0TA 3TO4C 3ETTA 4P2QB 1KIRA 5I8CA 4LBEB 1HQRB 3MUUA 1U92A 1D5XA 1OAZL 3U7AA 4PRNB 5C07D 1JYVA 1H9VA 2WUBL 5DMJB 1BGXH 4IOFD 2Y5TA 1QRNA 5EB9A 5ETUB 3PL6D 3O6FB 1JS4A 3DX6A 1N6QL 4QHLB 1LWHA 2NT1A 2WXHA 3FQYA 1BVNT 4NM8H 2XTJB 4HULB 2HRHA 4L8SB 1OP9A 4LARL 5JORB 3U7YH 2AJYL 4ZMNA 1E4JA 2YAMA 3EG9B 3PGDB 3RWFA 1NAMB 1I1YA 2C3WA 2JMRA 3ARDD 2XV3A 3D6GA 3T3PE 5HYJA 4RA0C 5IZ7A 4RNRB 3FTXA 1U6AL 2AABL 3LSOA 4PLJD 5ANHA 1P1ZB 5C0JA 3ZE2E 2F1EA 4DN4L 5GS1C 3SJVA 3SDXB 2WBJD 4L3AA 2OMTA 3STBA 4XBPB 3FO0H 4H20L 5DU7A 5EUKA 1F5WA 3NTCH 2JI3A 4FMKA 4HHGA 4IRSA 1G9ML 1N68A 3MOBH 2C1PA 4G2AA 5DEGA 1KGIA 4JY5L 1IL1B 5FM8A 4QYOB 2YMTA 3V9EA 2W0KA 1IKNC 5T1JA 1OT1A 4GI9A 4ZS6D 1JGVH 4HXAH 2CQVA 1NMAL 4UV4H 5J13C 4FI6A 2WVVB 5EO1A 2VDQH 1A6TA 1WT5A 5I73C 1OSZA 3FFDB 3ARBA 5E8EA 4DNLA 1D5BB 4KVPA 2IDSA 2XWRA 3GSWB 3MRPB 2EH7L 2XZQL 3HLAB 3KXFE 1HXYB 3UTTE 1J87A 3PHOA 4HMCA 3A24A 5EU3B 2VR8A 1DSFL 3KPMB 4JKMA 4FULA 3EUDA 4LSSL 4CBZA 4G6KL 3QUXD 1QW8A 2J7LA 2V9UA 3WFHB 1EZSA 3FZUD 2O6FA 2J4WL 3UZEC 4DPRA 4YHYC 2A74C 3LIUA 1MJ8L 2EXSA 2JIXD 3EYFA 4QLRA 5AZ2L 1P4IL 3M45A 1KPVA 1SHXA 1RFDL 4AYFB 1SEQL 2YLHA 4R5XA 5DUBB 1N59B 3B6SB 3NQIA 4Y4FB 1N18A 1VZIA 1X7TA 5E1AA 2HSIA 1BQKA 4Y16D 4KV5F 5KTEH 3ARRA 3JWOC 4L1SA 1AGBB 3GNMH 4Y2LA 1OZTG 5GSRA 5FHBH 3VGBA 2DQDH 4DVBB 3D4CA 3RPKA 4M6OL 1MW1A 3ISYA 4MNHB 4EI5B 4WO4D 2VQ4A 1DCLA 3NG5A 2BH0A 4Y1AE 2JB6B 2F7IA 3LIZA 1F3DH 3IRPX 3BVWA 2VDQL 3TH2T 3VRLE 2HFGH 4URTB 2X2JA 4M56A 3SPCA 3T2QA 5ICYA 3W5NA 1WFUA 4IM8A 4BQ9A 3MQIA 5GJTH 5CUSH 4KZEL 1ZE3C 1MQ8A 2QFRA 1KN2H 4PJFB 2OXGB 4AGLA 2QKIA 4LASL 1AXSB 4OV6F 4LPYA 1H0DA 5HVFB 2B4CL 1K3ZA 1KY6A 1MFVA 1T2QL 3RGVD 3QNZB 4JPSA 5B1CA 4IW4C 5J8OA 2FWOA 1A4CA 4OCRH 3QG7H 5GZOD 5K9KB 3QNYA 5E2WL 3UMNA 3LKNA 1VGEH 1LK2B 2NY5C 2GJ6D 3LYRA 2FWLB 1I8MA 1NINA 4R4FH 3IJ7A 4LOUC 3OGCB 1KPUB 1QLEH 2ZWYA 1KENL 5F72S 2JJWA 4YPGB 4ZTEA 5I1HH 5JMOC 4LIQH 2Z35B 5IMMA 2XXCB 1I1CA 5I1LB 4U1IB 3JTSA 2HVJB 1YMME 3WFZA 1E27A 2WANA 1QSZA 4NKMB 2MCPH 3I6LD 3DUSA 3BVVA 1YPZE 3JWNG 1NUDA 5DGQA 4XHJD 1HTYA 1VENA 1QLEL 4W9FC 1JRHI 3DXAB 3L4CA 2AMGA 4C83B 2OK0H 1QLFB 2AITA 4PWJA 2R2EB 2R0KH 3DX3A 3BQUA 3PQYA 3IDNB 3L5IA 3REVA 3F62A 2XCMC 1T2QH 2NY6B 3ARQA 4NHCL 4KXCA 4GSXA 4YSDA 4E5XB 3HNVH 4LSSH 5JPMC 1BF5A 3CFUA 1DE4B 1XD0A 4FI7A 1TCRA 3QO1A 4S1RL 25C8L 3SY6A 2F0CA 3KBEA 3FONB 5G55A 2WB1A 1LO3L 1ZDQA 4PSPA 2E74C 2OSLB 3LEXA 1BAFH 2J71A 4FP8H 1TZGL 5D96B 5LBSH 1EFXD 4C4KT 2OMZB 3FSVA 4KI5E 1CGYA 3BFQG 4KPHL 3LZOA 4TNVK 5I24A 1OAUL 5I74C 2XTSA 4UDTB 3LH2H 2VDOH 2A9AA 1ZS2A 2Z1PA 4OD3H 1IVTA 1E2VA 2BNQB 4X9FA 4BH8B 1MREH 4Y16B 2PTTA 4AJ0A 3L6FA 3B2MA 5FHBL 3LHAA 3ES6B 3PJSB 4FZ8H 3S36H 4YDIL 1KT2A 4LHQB 1A4KB 1WFOA 2AXFB 3FO0L 1V7NH 3IK2A 4ODXA 4H0IA 2KYIA 4AVKA 4EI5A 2XPGB 3NJIA 3MRJA 4I0PD 3QAQA 4Y1SA 4NAQA 2AZUA 3BO8A 3QFJA 1X7QB 3LDBB 3VRJB 1AQDB 4UDUA 4XNMB 1O6TA 5TDNB 1Z66A 2C9RA 5CIPB 4XMVA 4BDVB 3PWJB 1ADQA 3QUZA 1AANA 3WHE0 1GGUA 3WELA 4OFQA 2XT1B 5IFHL 1F56A 4TTGA 3N04A 4JEGB 3SJVD 2X6UA 3LHPL 3Q13A 4U1JA 1ND0A 3FQNA 2Q8BL 2YC1A 3DBXA 1V54B 2PR9A 1ZHNB 3MBWB 1H3XA 3MCG1 4GRWB 5I1JH 1ZHBB 4MQTB 3CHRA 4XT1C 1AKJB 4WHTA 5DC0A 4GG8B 4P23C 4PCYA 2ZT9C 5GZNC 3MUHL 4Y2OB 3CSGA 3VFRA 1HYSC 1CR9H 2BFVH 1FLRH 4Y5XA 3NJHA 5I0WA 2MQCA 2ZWZA 3H7LA 4PW3A 3KS0H 3STZA 5H94A 1FF5A 3SIKA 3HI1A 3HMXL 4MLSA 2VERA 2BXZA 4XAWL 4PJDA 5EN2A 3GBDA 5ICXB 3MLPA 3VU2A 3C60C 3QUGA 4GMTL 5BRZE 1HNGA 3D0LB 4YPJA 1CLYH 3LY6A 3D2UA 5HHXH 1JTOA 1T7ZA 5LUMA 3AS3A 3LNFA 5EUKB 5I6MA 4PEEA 4OLVH 3VI4E 4OM0H 4PGEB 4ZFOA 3MUJA 2X4QB 3H9SE 3VMNA 4M6AA 3QZOA 3UO1L 5E03A 3CFKA 2V4LA 5F7AA 4O02H 3RY6C 4LQFL 3IGAA 2IIJA 1CN4A 4JDVA 3WXVH 3FQXA 2JKTM 3E9TA 4XNBA 3TV3H 3VU1A 4GG8A 2EVIA 5FHAL 3H9HB 3V6BR 2B59A 5D2LA 4E42B 5HYSB 2WCGA 1NDMB 4YMPA 2NZ9C 3FJTA 1BJ1J 1WZAA 4UNIA 3X11B 1ODUA 4PJ5A 4NFBA 4RGND 2N7BA 1QUPA 4UUJB 4G8GB 5CZVL 1ZSDB 3J07A 3S3DB 4MNGA 3MTRA 1BHGA 3WGUB 3TIDB 1FZMB 3P4OB 3VFSA 3DJSA 3MKKA 5CZVH 5E6IC 1BDYA 4LBEA 3ZQ9A 1QKZH 1GKOA 5AKTA 3CHOA 4NGHH 2A6JB 4MFHA 3BN9D 2FBJL 4AYBA 3GK8L 4U6XA 3GMQA 5F9WC 2I9LA 3V0GA 5A6LA 1CFBA 1BV8A 3GMNB 3QSKB 4GAFB 1D7DA 3S37L 4B9JA 1I8AA 2HRPL 2A6IB 3NEOA 4S11A 4DN3L 1I31A 1PY9A 1X5YA 4R26H 4YVNA 2PCFB 1EZVY 3UABA 4ZS7H 3D3VA 2BK8A 1DYZA 3C60A 1A64A 1GSMA 3CIQA 5ISZB 3TCLA 5DRNB 2Q7YB 1IKFL 1X44A 4ODTH 3MNMA 4GFXA 4PYHA 2OMNA 3BP5B 1RK1A 3PL6B 3PJSA 1N7ML 3DGDA 5B4MC 1Z9SA 2R8SL 4FQIL 2CJUH 2YRBA 4MNQB 1AQKH 1FZJB 4IIQB 1F58H 3ZE2B 4XPAL 4NNPL 3A22A 4CVUA 2ZX8A 1SJHA 4K8RH 3SZKC 2VN5A 2J5WA 3WEBA 4WWKA 2WXGA 3NFNA 1DBBH 1VDGA 2H5UA 1HHJB 4N6QA 4YDVB 3GM8A 4XNYH 2NY1C 2Z65C 2Z91A 1J05B 1IGYA 5DD0L 1LD9A 4BE6A 1BXXA 3QI9D 3TZVB 5I1JL 3MLSL 3VRIB 1LE5B 3DUHA 4CKQA 2HT3D 1A4AA 4N86A 2KH2B 1HHHA 4FQXA 1XF3A 3EFFB 1IQDB 3OMIB 4QJ3B 1I9JH 5I5JA 2EAEA 3AZUA 3TBTB 5CCKH 1U41A 3TVMB 3IXTB 4BQBA 2HH0H 3BIKB 4WI7A 1QO3B 4I77L 4LHUG 3QRFM 1JXGA 3ZE0B 1B2WH 3NSFA 4PJCF 1CYGA 2DJUA 4TM9A 4Z1PA 3VMPA 3ARBC 4OGYH 3BE1L 4PJDE 5HY9A 2DJ4A 1XQ4A 2NYYD 3WKYA 1ESOA 4NKMA 4WJKB 3GKWL 3AAZB 4GBXA 4NZUH 3DX4A 2O6PA 4KKCC 3BHBB 2AJSL 2KPWA 2CBMA 2NY6C 3ARFB 2ZOTA 4K15A 3AM8A 4MQXD 1OF2B 2DI7A 2ISDA 4E68A 5IG7A 2OPCA 1AGEB 4L1DA 2ZP8A 5C0GA 4HEMA 2CO7B 4BM7A 2XKUA 3UERA 4N2BA 3GLZA 4RISL 3SN6N 5BS0B 1ZWIB 4XN1A 4KJQC 5A43C 5JW5B 1XH2A 2HLFC 2IQ9L 2YIHA 1NDTA 2GTZB 4JPIB 1Q94A 3H1ZA 5DUMH 1MG3C 4CDGC 3OXRB 4JPQA 5IOPA 3MRCA 2MPVA 2UXFA 1J18A 1TENA 4ZMLA 1CVRA 1WBZB 1QAWA 5HPMB 3VWKB 4NFCA 4MD4B 3FTSA 4JHZA 5FO8A 3AU0A 3Q8BA 3NCFB 4U1HA 2M83A 3T4YA 3HG1B 3DHJA 3LB6C 3GEWB 3VM7A 5CP7B 2ADFL 1YEEH 4HKJB 3G5XB 4FFZL 1LD9B 1MG2C 1U8KB 4PS8A 4UAHA 3G5ZA 3OPZH 1SDAB 3ZJAA 2XRAL 3LRSA 4MNHA 4XBPA 3RUGA 3QS2A 3ULSA 4U1GC 3GHPA 3T2LA 3A6BL 4Y2DB 4PGDA 4Q4EA 4J3OC 5BS0A 4JBSA 3SO5A 1OPOA 3LZFH 1PZDA 2F58L 2HG5A 1LO5B 4F37K 3D30A 4N2LA 4NO0B 4OR1A 3WY3A 4TPRH 3ZL4L 4GSQA 4OZHB 1MCWW 2QVFB 4O2EA 1KIPB 5HHOE 4F8OA 1G7PB 1G1KA 4WO4A 1ACZA 4RSVA 3QJVB 2ETWA 1XR9B 1X7SA 2VDPL 3FN3A 3L9EA 2CR0A 3VFOA 5GSVA 2P5PA 5E8DH 2WLMA 2F58H 4RAHA 4AMWA 1J5OL 4LP4A 4M8UA 5KYNA 3GLAA 3CHQA 1BZDA 3I9AA 3OMAB 3QDJB 1PEWA 2F74A 1TPXC 4KO7A 3WLWD 4J2XA 4IS6A 1TQBC 2XZZA 4DKEH 3T0VA 2ZXBA 5FB8A 1M1XA 2DQHH 4XVTH 2M8XA 1YJDC 3RDJA 3FOLB 4OJAA 1A3QA 1RJLB 3CUPB 3KPLB 4CVXB 2HRPH 3B9VA 4AH2A 3RWIB 3P4NB 3BP7B 5FGBC 1JN6A 2NMSA 1CS6A 2AGJH 1V7MH 5CJOH 3CU1A 4F2MA 2F54E 4KQ4L 4LAJH 5L0QC 3BMWA 2OJZH 4XTRC 4BSWB 3INUH 4D9QE 3AGVA 1T1ZB 3O2DA 1OSPL 5GRWA 2EEDA 4HH8A 4JVUA 3ZT7A 2OMWA 3T6ZA 1XMEB 2NQ3A 3HNTL 4U31A 5AD0B 1FIGL 3UTZA 3WEMA 3R7QA 4G7VL 1UH4A 2VKXA 1MUJA 3KJ6H 2DMBA 4NUQA 3LRMA 4MDRA 3UPRA 1RUPH 1U3HC 1RJYB 1YNKL 3FB6A 4JPVL 4ZMAT 5DJ6A 2MPAL 3BVXA 4HETA 1DBML 2Y3NA 4LL1A 3VDCA 4I9XA 5J6GB 3GEFA 3GJFH 2P7TA 4P9ML 3GRGA 4P4KA 5E08L 1USZA 3LN4B 4TRPH 4CVXA 2OMVA 4L4VB 1AGDB 5D1ZB 4ZTOH 3DTDA 3VWJA 3BWUC 5DT1H 4KK6D 3R1GH 3F64A 1WBZA 5F9DC 4NUJA 5D72H 4BGLA 5DRWA 1EHKB 3LRLA 2XZQH 3TBYA 1A7NL 4LLQA 3VQ2C 2DM2A 3BUQA 1T4KB 1FH2A 3V6FA 1CTMA 1Q1PA 2ZUUA 4MZIA 2EE0A 3RX8A 2VL5B 5JXEA 2QT6A 3QQ4B 3KPRD 4MNGB 3T65B 1ZVSB 2EUWA 1F90L 4LLWA 3B8SA 1K6QH 3AMKA 3QEQB 4LO9A 4AQAB 3BVTA 1MLBB 4BDVA 2FH6A 4YAQA 2JK5B 1UZ8A 1JZIA 2VMCA 2XWXA 3W9DA 4RWYL 4IBTA 2K9FB 5C97A 3O6LL 1OM3L 2HJFA 1XZWA 3RQ3A 3UZQA 1XGRB 2WVVA 2DH2A 2NY3D 3MLYH 3MX0A 3SGKA 3EJZC 5I6PA 1D6EB 3A67L 5F7MC 1G87A 2PXYC 2EILB 3SDYH 4KDTA 5E00B 2P47B 4NYLA 4EEEA 3BZFB 4TQEH 1Z6JT 3NUKA 5CZXC 3TT1L 1ID2A 1Z1WA 3THML 5C0CD 1EBAA 5IB2A 5KYYA 1JHTB 1Z3RA 2EXTA 5E9AA 4OLZL 4I85A 3ZTJG 1SYVB 5FO9A 4BIKA 4Z3FA 3UZVA 3SO3C 2WLLB 2BHUA 2IG2L 4KHTL 2O5XH 5BUGA 5BRPA 1DP0A 3E6HB 5DDHB 1SOSA 1GGCH 5GGTA 2BFGA 2IBZX 1L7IL 1IGYB 5LN4A 3LPFA 5TQ2H 1ECYA 1MFNA 4G9DA 1S5HB 4BWUA 1SM3H 3RTQA 3V6OE 5E8PB 3WMQA 2EDFA 4Q14A 1EO7A 2WLNA 3SDDB 1KN4L 1YECL 4ADIA 1DVXA 1ORQA 2H2SC 4PRHD 3BUPA 1WCBA 2HLFD 1FIEA 3QZWA 3QEGL 3REVB 4LCUB 2Z7WA 3CK0H 4UQ2A 2YJQA 5AAWC 5EBMB 5H8DA 2VZ1A 5B7EA 5BMFH 1AQDA 4UDUB 1WDAA 2Q7YA 2UYLB 3M07A 4ZW8A 3SPVA 3EGDB 3QXVA 2VAAA 3QQ4A 4J6RL 3D69A 4WFGD 4JQIH 1CICD 2EJ1A 4YHKH 1P2CA 1AMYA 3IS1X 1CFVL 1SY6L 2J8UF 3MODH 1P9MC 1AYOA 1CFQB 2G9HB 4X6EA 2YGQA 1YNTF 1KIUA 5J1AA 3M8OL 1ZLSH 2Y7NA 3VCLB 4DGUA 3GSXB 3DO4A 4XB7A 5FLVA 3VXPB 2A1WL 1DBBL 2W80C 4K23L 2GSGB 3DSFL 2XWTB 4JKWA 4ONOA 5MEQB 1YN7B 5AVUB 2EQDA 4HS6B 1DQIA 4FGMA 1I9IH 3RVTD 1FP5A 2IWKA 3KPRB 1RV6X 2RIKA 5C7XL 2F54A 1TJIL 5HI5D 4Z76B 1R3LB 1ZD6A 1CO1A 4NQXB 2W5PA 4Q6IC 4AIXA 5LGJB 1I4FB 4QRSB 3D85B 4UTAH 2AEIT 3HE7C 3QK0A 2WSPA 3QI9B 3TZVD 1MCEA 3IM1A 4NP9A 4Y9CA 2WXMA 1OTUD 2YWYA 1R47A 1N10A 4LAQL 4I89A 4ZFOB 4YDIH 1PAZA 4E9TA 4Z0BL 1I1AC 2XY1A 5C6WH 4B27A 4HDIA 4QXGH 2DDQH 1XX9C 5EBWB 4NHUB 1LO3H 3VCLA 1HS6A 5ESVA 2EACA 1OK8A 3ILEA 1NTDA 3BPCB 5FKAA 3P0YL 1FZOB 2YK1H 1NWOA 3AXLB 4LOUD 2VDOL 3KVDD 4WW1A 2PCFA 3SKUD 2EABA 4HFWB 1A9BA 1TQBB 1X4XA 3QIBA 1CGSL 3OAZK 4OGAC 3RI5F 1URZA 3LKQA 5FGCE 2BWIA 4PJEF 4XPFH 4IOIB 1KOAA 3VI4F 5IJVA 4NRYA 5KOVC 2XX0A 4LLYB 4FHBD 4MJ4A 3KNBB 4CNIA 4U1NA 4HK0A 3EYOA 4WQOA 3I74A 1JGLH 1HXKA 2VR5A 4OZGA 4K9EC 5KANI 3LXCA 4L18A 4IBSA 4O02L 4N0CC 1CDIA 3ARGD 3AACA 2F61A 4XP4H 1SXAA 4NAMA 1ZSDA 1AR1B 3SBWA 4M7ZC 1RZJH 1VEPA 3I50H 3IU4L 2D9CA 4WCYL 3UO8B 4MA3A 3LEVL 4UBDC 5I2IB 2EE2A 3FU3A 4OLWH 3ROOB 1KV3A 3GPEA 1LO5A 3ZT5A 4AYMC 2YD0A 4LVNC 5IQOA 2F9BT 2QDWA 3GXTA 2AJUH 4JKLA 4MA7L 3OGOE 4G5ZH 3KM2A 1BQLL 5DR5H 4GQZA 5EO9A 1SJEA 4GAAA 1TYRA 3GJEB 4QO1B 4QCIA 5FEBA 3F7VA 5AW0B 4ZFGL 4Y4HC 1K4DA 3CE1A 4AIZB 1ZT7B 2UWEE 3I6LE 3K5SA 1VEMA 2GFBA 2K8QA 3FB7A 2FYYA 3QHZL 3LRKA 2VDKH 4JG1H 3ORJA 1FNAA 5JR1L 2J8UB 5IW6B 1HI6A 3MRLB 4MMYA 5MI0C 5AD0A 3JWOH 3VXTA 1YLBB 4UM9B 5BV7B 3PWNB 1KLFB 2DIJA 2G5BA 2BVQA 2N0KA 3C2AH 2EUXA 5DS2A 1KB3A 3DK0A 3CFDA 1CJYA 3OLGA 3PWLA 4QHLA 4O02B 1PEZA 4K2UH 5ID1A 2VZTA 5IJCC 4JREB 5CILL 4KZEH 1ZHLA 4CVZB 3PYCA 4NOFA 2ZP9A 1A21A 3CFCH 1T3FA 12E8H 1XL4A 3RURA 2ILLA 1KACB 4A1RA 1E6JL 1ZE3H 1PQZB 4JS7A 3T0WA 3UJTL 3V4VB 4JFZH 1HSAB 1V3LA 3DPBB 4U1NB 1NWPA 3TBYB 4AYSA 1EVTC 4YHNA 3U0PA 4DIXA 1TJGL 4H2AA 3VE0A 3TEZA 3UOAB 1F11B 1HILB 4E5XG 3WFBH 4DK5A 3GMLA 2W59A 4FFTA 4ZUVA 4BZ1H 5HYJD 5T33H 3UFIA 2P5EE 3IDMB 2A99A 2GABA 4G6AC 3EGXB 4PG2A 3HAEH 2YPLD 3TIEA 4Q58C 5C3LD 5D6DC 3QNXA 4LK4A 2J73A 4UILL 3OKYA 4KPHH 4G8FB 2FSEA 3FB6B 2ERJB 4HG4J 1ETB1 4JRXB 4B96A 2CO4A 3RAJH 3IJ8A 1HL5A 5J12B 3CBJB 2I7SA 3H2PA 1H5BA 1UKTA 1PIGA 4L05A 4JY5H 5ELIA 1CXEA 3CFTA 3II3A 3AS2A 3R8BB 5AW3B 5CD5C 3CX5K 2AJUL 3MV8A 3IDGB 1O6SB 2WLIB 1AGCA 3SDAA 1LVEA 2D3NA 2C9PA 3LRSB 3RUGB 3CC1A 3HI6H 4AYID 1NFDB 3NQKA 4TVPD 4I77H 4WTXA 5C92A 1G9MC 3WJLA 1JGVL 4KVNH 3LEVH 3VWJC 3HR5A 4JG0L 1BFTA 2WQ8A 3ZHNA 2OXHB 5CLXA 4PR5A 3OJDB 1D5XB 1ADWA 1XH3A 4Y19D 2GTWA 2DBLH 5DHYA 5EZLA