4FL4B

Scaffoldin conformation and dynamics revealed by a ternary complex from the clostridium thermocellum cellulosome
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
165
Chain Sequence
ASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 9
publication title Scaffoldin Conformation and Dynamics Revealed by a Ternary Complex from the Clostridium thermocellum Cellulosome.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Protein binding
total genus 35
structure length 165
sequence length 165
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fl4B00
4IU2A 2JH2A 1OHZA 3KCPB 2BM3A 5LXVA 3UL4A 3BWZA 3FNKA 4WI0A 2Y3NA 3GHPA 2VN6A 3L8QA 2CCLA 5K39A 2OZNA 4WKZB 1QZNA 4N2OA 5G5DA 2ZF9A 2VO8A 1ANUA 1G1KA 1ZV9A 4UMSA 2XDHA 4FL4C 4UYQA 1AOHA 4IU3A 2B59A 4U3SA 2W1NA 4UYPA 1TYJA 3F2LA 4DH2A 2VN5A 5AOZA 4FL4B 3KCPA 2O4EA
chains in the Genus database with same CATH superfamily
3CSFA 2O6EA 5AAMC 2E9JA 4FN0A 3U7YH 3QFGA 5CLTA 3JTTB 1AZRA 4JZNA 5EFIB 3FQ1A 5D70H 1FL6B 2ATKB 1ORQA 5D7JC 5EUOB 4AK2A 5L88L 2BVOB 5CXPA 3K6SB 4CKVX 4Z78A 4J23A 2R7EA 5IBLC 4PJDE 1ASOA 4XNYL 5B7FA 4U7KA 5HYQB 1KCBA 2Q8AH 3RTQA 4HWUA 5C0GA 1MNUH 2MHAB 3FRPG 3W37A 3OHXC 3ECBB 4FNLL 1KMGA 5EO9B 3VI3A 4Z7NB 3L4CA 2R8SH 1S7XB 4KJPD 3TVMB 3T3ME 3FH7A 5E6ZA 3VD7A 3D33A 3S6CA 5LDUA 4ZUUB 3UTPD 1G6RH 1XGZA 1X5KA 2WWMD 3BO8A 4WI0A 4WHDA 2N3JA 3VXRE 3IGKA 3JZYA 4NP9A 3B8YA 2K70A 5ICZA 4J7RA 3T04D 1KZYA 4FXGB 2Z8VC 2QADD 4M5SA 4WV1A 5DSCB 2DICA 2IAAC 1G9MH 3JUZA 3MJ8B 4AMWA 4HK3N 2IALA 3SYOA 5T1KA 1NBVH 3HE7B 3K6OA 3KPOB 1UZ6E 2JKTM 1Q94A 2MNJB 4A2FA 2Y7NA 3FMGH 1BPVA 4OB5L 3GMMB 2B59B 4ZO7A 1BYPA 2R1XB 3ZTEA 2XVBA 3ZZLA 2W07B 3ECUA 3FSWA 2R0WH 2DL2A 1EEUA 1VEPA 4QXWA 4UQ2B 4TLKA 2Q0ZX 4JFEA 4NUGL 4Y8DC 4W9FC 1FNAA 3MRJB 3CCHB 5GS0C 4BFOA 3U9PH 1BVKB 4B9JA 5PAZA 3FTGB 1PZ5A 1BX2A 1J9TA 4U0RC 1KEGH 2E6JA 3A67H 3GXDA 3QYCA 4F9LA 5EZPA 3D8MA 5DEFB 3ZDYE 4XN2A 3TBSB 3ZT5A 4ABUA 4FNRA 1HQRB 3H3BC 1XH3A 2VN5A 3HG4A 3P4NA 3BP7B 3VD9A 3L6FA 1L5GB 2CDGB 4CA4A 5ENWA 5I18L 1G7JA 4NO5B 1QBBA 1I7ZB 1AC6A 1T1ZB 2OTPA 1HESA 2OS7A 3RWHA 5C3IA 3S9DB 2G60H 2OV0A 3RNKB 1UWXK 4TMPA 1B3IA 1WK0A 2HKHH 4Q14A 2OP4L 3NRPA 4D0CB 2F08A 1CC3A 3BWSA 1CK0L 1ZDSA 1LM8V 4W4OC 4XNBA 3SDCD 4KVCL 4I2XB 4R2GC 4P3CH 1LE9A 3BGAA 2YJLA 1UD5A 4TL4A 3KVDD 1N4XL 4PJDF 2X4RB 4DVBB 3LKSA 3DJRA 3PE9A 4K9EC 2OMTB 1EJFA 4MJ6B 4WK2B 4UU9A 1B2YA 1M57B 1JNNL 2DDQH 3ZE1F 3Q2WA 1BA9A 1O0VA 5EA0L 3KPRB 1NL0H 3PGFL 5EC2A 4JY4A 4KJPC 1LNUB 5JZ7C 5F72S 3RHWF 5E6UB 1AR1B 3QZWA 5TE7L 3TJEH 4MAYC 2XBDA 2OCFD 5BNXD 5JW3H 4JQIL 1N70A 1E40A 1JVLA 1XR8A 1C12A 1EVTC 2B2XH 2WWMC 4S1DC 2D7TH 2E27H 5D4JA 4W70A 3BAYA 5E8EB 5CEZD 4Q0XL 1OSPH 4CN1A 1J0HA 3T6ZA 5HVHB 4OZHB 1CJYA 4ZO8A 1UXLA 5FC9A 2X4PB 1NAKH 2XCMC 5JDSB 2GY7B 3B9EA 4UINH 5I5JA 3OGOE 2Y2TA 4GQPH 1D2PA 4Y19A 4A6YB 4UBDC 4JFFB 2NLJB 3C08L 3SKJL 4FGMA 5I0VA 5KVFH 2Z3FA 4IBWA 4KJQD 3OL2A 4GW4B 3GSVB 3HLKA 5E9DD 2BZ7A 5C09A 2Z35B 3DIVA 1UH3A 4IGBD 1NFIA 4YK4B 1DDTA 2B1OA 2LLGA 5LCVA 5B3NA 3A6CH 4HUKB 4PJ5E 3T1FB 4KNTA 1DEEB 3PFQA 4ANXA 1K5NB 5GJSL 4QTIL 3OQ3B 4Q6IB 5KYYA 5J3HD 3EYVA 3FFCD 1WZLA 4Z9KB 3L1OL 4U6VH 3DDGA 4XVJH 4YUEL 4FI6A 1A25A 2YPLA 2DBLH 1WP6A 4ONFH 2JI3A 2VO5A 4CC4A 1HL9A 5FYJU 1D5BA 1G0XA 2LU7A 3OGCA 4QRPE 3TTSA 2F74B 1IKFL 2ITCB 2P28B 2CDFB 3CVBA 4ISVB 3P4OB 5DQ9A 4QJ3B 4S2SB 1G0YR 4RGMC 1MWAH 4PJ7B 1XDTT 2VLME 4FKHA 3C2SA 4GSDL 2W0FA 4WSJA 4CGTA 3B8SA 3CXDH 3DVGA 4XH2B 3NIGB 5F0JB 2IWFA 3SOBH 5FUCC 4XP9H 3KGTA 4NQTA 2AZUA 2WOYA 3MROA 1DVUA 2KLTA 4DT2A 1P4UA 1S2EA 2IWGA 4HWZA 1A4KA 4F58L 3WIIL 4RMUA 1M6OB 2A6IA 5C9JA 5I1KL 1TPXB 2NY6B 3HKFA 1D5XA 4DP8X 2QGDA 1NIEA 5F7LB 5ADPH 3NA4A 3MLXL 4MB3A 4BM7A 1SHSA 5AVSB 3E0GA 1IVLA 4HT1L 3C6SB 4J12A 5AZEH 2IG2L 3CH1A 4ATWA 1BG1A 2J57A 5KSBA 7FABH 1OAXL 4Y5YA 2YFNA 5E8NA 1HCZA 1FFOB 5EPMA 2VIRA 3LPFA 4DGIH 3H7BA 1Q9LA 5DZLA 1U8LA 2F6AA 4NAMA 5INCB 1BP3B 1M9SA 3QUGA 4NP4H 4AITA 3U30B 4LOEA 2XQBL 5FECB 2OL3B 1PDKA 3BVDB 1CD1B 2XU9A 1IQWL 3LKNA 4S1QL 4B5ZA 1IE4A 1NCWL 1KYOJ 3JWOC 3WO4B 3T1WA 4X6BB 3WJLC 4L8CA 2Y1ZA 43C9A 5L8LB 3TEXA 4FHKA 1E7VA 5CFHA 3QT2A 2P5WE 1EHKB 4KJQC 1OAQL 2ZX8A 3CWGA 1EV2E 1KCVL 1X5FA 2XFGB 1V3MA 4JO1H 4M7ZB 2MQ0A 5DVKA 5BW7A 1S7VA 5HYJD 4P9MH 1KBGL 4O02H 1E5BA 3ZOAA 1Z0MA 4E0RA 3FBKA 2DJUA 2GJ6D 5D71H 1A3QA 2HVJB 3A23A 5KVFE 1NFKA 1BLIA 2LHAA 3VD3A 4AE1A 4Z0BL 3ZDZB 1AYRA 5LCVL 2WNXA 5F9WC 1LHZA 5B1BB 3SCMD 3RDTA 3VG9C 5IROD 5EIQA 4Y9CA 3MOAL 4NKOB 3VXSA 1I82A 2JH2A 4PGJA 4LCYB 4KITB 5KYXB 1JTOA 1MCRA 4H8WC 3D52A 5J13B 1N10A 2NR6D 3LKRB 5INDA 4K3EL 4JJOA 2R1YB 5CJOH 4WTXA 5MHSD 4NM8H 5TFSH 2WYTA 1BMGA 4KZEH 3PWPA 4HUVB 5ACLA 2NY0B 1WWWX 3ARFA 1QRNB 3O11A 3U2JA 4ERSH 5D6CA 3DV4A 2RH0A 4MSWB 3X3FH 3H42H 4RQQA 3DX6B 3BDBA 4D0BA 3EOAB 5HVHC 3KGUA 4P5RA 3U6XS 3ZKSD 3RWCB 1WRFA 2P49B 4LLVB 3QCTL 5DQJB 1QUNA 3V10A 1W6WA 4JBSA 1DANT 4Q2ZA 4ELMB 4M56A 1NC4B 4MRCA 1QHPA 4R4BB 5GGRA 1CQYA 4Z7VA 4G2AA 3FQRB 4PBDA 4X7CC 4HCRA 1Y18A 4HIIB 4YK4C 3VXNA 3OPZH 4J2XA 1FNSH 4I18C 2W65A 4NSKA 5DJDB 3KPSE 3HJ0A 3RX7A 3K1DA 5C0CD 4XCNB 2YC1B 3QUMA 3QXAA 1CB4A 1EEYA 1CE1H 1T0MB 1GC1H 5FCUL 3PJLA 1CL7H 1MVUB 3FB7A 5DD3H 1HZHL 5F9DC 2EDKA 4HUWB 1GAFL 5DVMA 4HS3A 3OKKB 3PPSA 4P4KA 2FX7H 2A9CA 4Y88A 3U4AA 3ARBB 5IVXA 1T0NB 4LEBA 5BQDA 4GW5A 5G5DA 4A7TA 5I9QC 2N7AA 1OP9A 5DJYB 1VZHA 3IKCB 3U9UB 2DI7A 2E9BA 3NJMA 4FL4C 4YC2C 4JREC 1ZLSH 1MVFA 2MTAA 3Q06A 4KNQA 2W1NA 4NRXA 5ITBH 5SX5K 1UVQB 4KDWA 3MLRL 5HDLA 1N5YH 12E8L 1JD9A 1A1OA 8PAZA 2R15A 3M17A 3PIQA 1T2QL 5DFAA 3FU7A 4R83A 5T5FA 1QNZL 3QQ9C 4XWGL 4E41E 2DBJA 1FO0A 1KYAA 3EGDA 4EJ1C 2X4UA 4PRPB 3LKPB 5A16B 1BWWA 1UD4A 3CHOA 5D9SB 4QOKB 2LFEA 3BAEH 3TWCL 4L3ED 3ESOA 3SCMC 1A14L 2JCCB 3I9GH 4HPYL 5IROC 1AOHA 4OLWL 5IOPB 2FLRT 2J73A 3GGWB 4NO3B 3X1EA 3WI9A 5HPMA 4YDMA 1JP5A 4MDJB 2ADGA 3BIKA 3ILPB 3OJVC 3E80A 3AU0A 4JJHA 2I69A 4A7GF 2BERA 1XIWB 5IESL 3L3KB 2F53B 5ICUA 4CBZA 2HTKD 4JRYE 1J9QA 1WLHA 1T1XB 4OZGA 4DPAX 4Q9CA 4JRXD 5E8DL 4A63A 5I5RA 5KS9B 3TCXA 1KIQA 1EXGA 3EJUA 4PIBA 1WZ1H 5IJVB 3CV5A 3V6ZB 2N7BA 3CVCA 5LN4A 1IJ9A 1B3JA 3RILA 3KS0J 2VQTA 2CH8A 2B15A 2VQ1B 3C6LA 3D07A 4NBXB 1H8SA 1DJWA 5GGTA 2R0KH 3LV3A 2H4EA 3NJKA 4OAWA 1U3ZA 1CDBA 1CLYL 5DYOB 5HGBB 3VFRA 3CC5B 1YN7B 3D85D 4LOUD 1PD6A 1WA2X 2KZWA 3T0EE 2BK8A 2QQKH 4NOFA 5ESVA 1GOFA 3QS2A 1I8MB 3VNZA 3CFDA 3ARGD 1V7ML 1IC4L 4GS7B 4YOKA 4HCRL 3HE6A 1DQDH 1QBLH 4PTUA 4HIXL 3RGVB 3SDCA 1RJYB 4CMMB 4EVNA 4X42A 1LP9E 2XKSA 2FT8A 2DV6A 2AZAA 2EC9T 2QSCH 3ETBJ 3SQBB 5JHDB 5LLIC 1PKQB 2BLFA 3QUML 1HOCB 1RZFL 2K6ZA 3SIKA 7TAAA 1L9MA 2VLRE 1ZDQA 4X6CB 3N44F 3BRDA 5H37H 2O5XH 4U1KA 3TL5A 2PR4L 1HQ4A 2WYZA 3MUHL 1E28A 3SGKA 3CX2A 2WLZA 4N1HB 3WENA 3SKNB 2CPCA 1OAJA 4POYA 5A6IA 2X4NB 2Z0BA 2MCPH 1JHKH 1NGQH 1ZHNB 3RVTD 1KTKE 4P59H 2AK4E 1GGBH 5ABDE 3KWVA 4NDMA 3BP4B 2J8HA 4P57A 3HAEG 4RFEA 4UM9A 4Y0GA 3DURB 4PTTB 5DD6A 1WIUA 1YUHB 2MQGA 1JPFA 1NSNH 1E3ZA 3FH5A 3O0RH 5EU5B 4HSAC 3PP4H 1TEFA 2FWUA 3APNA 5CHNA 3P30H 1E3FA 2EE9A 2FO1A 4F9PA 5D1QB 1FFPA 5EU4B 2C9VA 3L7FB 1I8LA 4GLRH 5TE4H 2EYRB 2Y24A 5T5FL 5F3BA 5FR3A 5IW6B 2X88A 4BXVA 1QSVA 1P84K 1QW9A 4WU5B 3VI4B 2AJSL 4IGBA 1FSKC 1JZ4A 1SZNA 3IFPA 3P73A 4C54A 2QT6A 4XPAL 2G3NA 3FF8A 1DJGA 1V5JA 2O1AA 4O5LH 3QUYB 3KLDA 2XTJB 3RZCC 4UB0L 1ECZA 2HTKC 1K8IB 3BWAA 3FFCA 3FK3A 5D93C 3O8XC 4KBPA 4ZMOA 3HI5H 3S5ZA 3ARBC 1KB9K 1NAMA 3KLAA 2NY2D 5AZ2L 1GZHA 3I75B 2WOBA 4XVOA 4ZBJA 3NSDA 1KCLA 2GB2A 2LU4A 1IUZA 4QHNB 3FW6A 2CHDA 3SKOB 1IM9D 2VGLM 4XOBA 3KAAA 3GQFA 3IGAB 1DBJH 4OTXL 4FJYA 4OD2B 5EIIB 3US9A 1JGEB 3ME0B 1AI1H 1EZLA 1FYTB 4NKDA 2QQLL 2UYLB 3DROA 4KK9D 3GJFH 3QJHA 4UF7C 3QJVB 5F7UA 1Q0YL 4K5LA 5GGTL 5F7YC 1A9VA 1ADQH 2PTTB 3ARGC 5EZIL 4MHHG 4ZUTB 4GRMA 3TH2T 1YEKH 4Y4HA 2XY1A 2PCYA 5FHAH 3GSWB 3QIBA 2A5UA 3R0NA 3TM6A 2ZD0A 5MP6H 4U1MA 3VXPB 4NO2A 2AEOA 2PP7A 5BRZD 1RIVL 3ZZQA 1RURL 3ZQXA 4Z7WA 2VDKH 5I24A 1I31A 2HG5B 1EZVX 4XVTH 4NQQA 3BKYL 5EV7A 2KH2B 4UAHA 4IHOA 3VFNB 3EF7A 3FULA 1C16B 4OZIF 1HHGA 5TF1H 3I9PA 4DGYH 1U58A 5T3XH 1SN5A 1DTUA 4Y5VB 1QZNA 1YVLA 1JF5A 2F7QA 3AREB 4PQXA 4BJLA 3EBHA 3WLBA 4L1SA 3GSNA 4XOCA 1LO3L 5DFTA 3FCGA 1EDQA 1X5IA 3JTBA 3E6FB 5CEZL 1IILE 1KNOB 4KKLD 4AYMC 3WTVA 1R24B 1H8NA 3F7KA 4PIRF 5CO1A 1N5AB 2B08A 2BNRB 3STZA 4AIEA 3P4LA 2UY6B 2XN2A 3CN0A 3JWOL 5C7XH 1CF8L 1Q9OB 2FJFA 2QR0B 5ESAA 4BXSV 4LAQH 4R90H 5HYJA 4X4ME 1I7UB 1KV7A 1PX4A 2A6DA 2DLFL 4PH8A 4YHZL 3TS8A 2UWEF 2P9RA 3VFUB 4TKWA 1UJ3B 1FH5H 4P2QD 2X1QA 1MHPH 2GJ6A 2W9LA 3RGVC 4Z7IA 5A40E 3OF6D 1RK0A 4LLWB 4Y5XB 5BV7C 1JGDA 4JM2D 5I15H 3UX9B 1CO1A 2XJLA 3I02A 5B3JF 4HEME 1F02I 3IBEA 3CGTA 4LESA 5C0BE 1GOHA 3IJSA 3KLHD 4WGWB 5E5MA 1SQ2N 4N2IA 4HD9A 1IIIA 3IF1B 3ZE2F 3PDOB 2AHIA 2NNXA 2NR6A 3AY4C 2K78A 2G9HB 4O2FB 3BOVA 2QTEA 4TN9A 5C7ZA 3ZU8A 4Y9EA 2A6JB 1TT6A 3BT0A 5E1AB 4FFYH 3S5LB 5JW4M 3B2PA 4YSDA 3I85A 1BFOA 5DI8B 5K1JA 1XBRA 1UCTA 4LKCA 3QUZB 4KK9C 4X0KA 1J87A 2NW3A 2X4TB 3QEQB 5AVRB 5EF2A 4EI6A 2ZUWA 4X7TA 5BS0A 3SE8L 1IU1A 3WHE1 5CCKH 4ZS7H 3OSKA 1HS6A 1TZIA 2OPCA 1W8NA 3H2WA 3O2WH 4G8EA 4B3VA 4WW2F 1WFUA 3WJMA 3QEHB 4HAKA 1J0KA 5FF6A 1KTJA 2B5IC 3PHOA 4M1DL 4XHQA 4HU2A 1ORSA 2R23A 3DHUA 5DHVH 1WS8A 1QSED 3MNVA 3O3AA 4Z3GA 2XSKA 1P0SE 5C0CA 1PQZB 3NIDB 3EH3B 4M48H 4YPJA 2K7QA 2CUMA 4RDQF 1UB6A 5D7LA 1PX3A 5AVVB 1CXEA 3GTNA 4CGUB 4NM4H 5IMOB 5A2BA 5GS3A 1JZ2A 3UGXA 2GK0A 1HDMA 1I3RA 1SLUA 3H4FA 1H0DA 1K3IA 1WD8A 1TQSA 3FONB 3RPIA 1A6AA 3PL6B 4KY2A 5JQ6H 4KKLC 3BHBA 1MFDH 4H8VA 2CSPA 2HPOA 4OJFL 2DMHA 5M95B 1PD1A 5E99H 4AUYA 2BIHA 4Q9RL 2J8UA 1ZA6B 3D7PA 4GH7B 4LHQB 2WIIA 4GAGH 4P5KB 5GRVL 5BOJA 2CJTA 3QHTC 4JFYA 5DC0A 1OE2A 2WXIA 2CXKA 5MI0B 1YDPA 2JK5A 2QPUA 1L6ZA 4PGBB 4IRJD 5AVXB 5FXCH 1ZS2A 3LZFL 1TQCB 4W6XB 4JM2C 4N90E 5ESQB 3FQUA 3T4AC 2EDJA 4EE2A 3FKUS 3QRLA 2E0PA 3L7EA 5LNDA 2ZCLH 3GMRB 5GGQH 2RAMA 1KB5L 1S7WB 4L3EA 2DWDA 4P06A 4ODVH 3KLHC 3BH8A 1E9PA 3VXRD 5E4EC 1LEGB 1RERA 3FCSA 4KXZI 2HUEA 2PP9A 2WWNA 4UIKL 3FUHA 3KPPB 1YSOA 4JAMB 5A2KH 2DIAA 2YRBA 5LG1A 4N6RA 5C0ND 3KLKA 2DQHL 3TBVA 1ZTMA 4GRWF 3P0YL 4M9OA 1XB3A 2Q6WB 1GTNA 4L4VB 1ZT7A 2FVNA 3TZVD 4S0SD 1ETZA 5EZJB 3ZKXB 4JO3H 5ECJE 4JRXA 2FX8H 3WO3B 3DJ9A 3U79A 5IB4B 4RNRA 5CP3H 2F15A 2E9IA 2XHNA 3PABA 3E3QC 3QHZL 2Z31D 2TSAA 2VE6B 3H85A 5GRUL 3SOTA 2Q76A 3V9EA 2CIIB 6FABH 4RWHA 4UUJB 4OF8A 3ISYA 2AXHA 5EU6E 4YEFA 1JUFA 3FL7A 3DARA 4XO9A 1AGBB 1D7FA 2OMBA 1X6LA 1JGUL 1HH6A 5EHFA 4UIMA 4PLJC 1UJ3C 1JF6A 4Z95H 3ZE0E 1B0IA 3NCCB 2EYSA 3G6JE 5IIEB 5TJWK 4G3YL 2A9DA 2FEDD 3AWEA 4MMZA 5ANHA 1JNLH 4M4RB 3W9EB 2WP3O 3OR7A 5HGDB 4ZFZA 4L9DA 1YNKL 4IKNA 3QFJE 2NW2B 5KJRH 2QGEA 4GRLA 2H3NA 2FQGA 1JYVA 4FX5A 4IU3B 1XF4A 4X6FB 5IR1A 3C60D 1JDDA 4G82A 2ZOTA 3OKEB 3CFCL 1JFQL 1C08B 1QLFB 3DGDA 4LRIC 4XN7A 4WWKD 3TNNA 2Y23A 1CLOL 3FT1A 2EE6A 3TV3H 5L9DH 3Q9QA 1SDDB 2XZCH 4GQZA 2VDPH 1LDSA 1IBFA 3RU8H 4OIBA 1KN2H 2E74C 3L3IA 3LPWA 5B38G 3A6BL 4NWTL 5CJQL 4JZNB 4ORGB 1R3IH 5JOEA 4DP1X 3QA3A 4P9HC 4ODWA 1T89A 3ULUH 1ORQB 1EFXD 3AM8A 5LGHH 5DD5L 2X09A 3LDBB 1RCYA 4Z78B 1BQRA 2R7EB 4IRJC 4LMQI 2R4SL 1N8OE 1R3LA 4PUBL 3P9LA 4FERA 5F3HA 3EYUH 1ZHLA 2WKLA 2XIBA 4GKSA 4X98A 1DSFL 5IBTL 1BM7A 3K72A 2VDOB 4YSUA 3GBMH 3RL1A 3VI3B 2BOLA 4J39A 2WLYA 4OZFA 1M7IA 4PJ8A 1X5GA 5FX3A 3NCWA 1YEIH 4M6NL 3LPOA 4R97B 3SEPA 5KZCD 4O4YH 4WI0B 1QZ1A 3PDDA 3IAPA 2VDNL 4D3CL 4J3OH 5SX4H 4BFFA 1VCAA 5C0NC 2L04A 5ICZB 5IF0B 1N8ZA 2ENJA 4WV1B 4FQ1L 3O6LL 4GFXA 1OB1A 1R0AH 1X4ZA 4PJXA 1CGYA 2IALB 4AW7A 5JDJA 4LOVA 5T1KB 4JFSA 1LWRA 2VDLL 3EH5B 2YHGA 3Q1SH 3OZLA 1E27A 4OLVH 1R17A 1DLFH 1IGCH 4YHML 2ZUVA 1KELH 4N3TA 2XPGB 4OGXH 1AXTL 2R59A 3OAYH 2D8KA 3VU1A 1AS6A 3EDFA 4MAUL 4MXWL 5GGSA 2BZDA 1T1YA 1UWXH 3ZE0F 2N1KA 1PZ5B 3BDYH 1BX2B 2E4FA 4ZO6A 1TQCC 1NC2D 3G6JF 4AQOA 2BX5A 3S35H 3T6XA 2VDMH 4QRPD 3PGCB 5F2FA 2GEQA 4YSQA 2DMGA 2FEDC 1XH3B 1W16A 1B90A 1S5IH 1FJ1A 3L6FB 3KYNA 4GIAA 2YD6A 1G7JB 5ENWB 2VLMD 4YBLB 3BVVA 4LQ1A 1JIBA 3L4UA 3RWHB 3MLUH 2PMZA 1E8XA 4UILH 4N68A 3RLSA 5CLWA 2DTSA 1L7IL 3CVIH 3C60C 2VN3A 2BIPA 4AVKA 4TRPH 4WWKC 4FHJA 1KPUA 1SN2A 4PJHE 3CAFA 3DK2A 4Q6KA 5F71A 4FA8A 2IBZX 1AACA 1P4BL 2BSED 3WNKA 4KRLB 1OQOA 1SMOA 2OULB 2CO2A 2YXMA 4XC3L 1LE9B 1KBVA 3LQAH 4NQEE 1DBBL 3LKSB 4M29A 1H3VA 2NY1B 5KVGL 4UU9B 3Q48A 4BSWB 2V3FA 4TL5A 1QEWA 4G80A 4PCTA 5F9AC 3ZN6A 5EO1A 3ULUE 1PIGA 1QTYT 4JM4H 5E2VL 5EC2B 3BKCH 2NY3D 1WFIA 1NKGA 4I0PD 3LX9A 4FI7A 3PS6A 3QZWB 4TUKH 4J6IA 1UT2A 5GZOD 3H53A 1KCUL 1XR8B 1C12B 2GIMA 4LLMB 3FTYA 2HJFA 4P2QA 1T5XA 5C0DA 4WKZA 3OF6A 4F7CA 1VACA 1MCIA 1U0QA 4JKPL 4Z7AA 3B4NA 1RHFA 3VB9A 4G6FD 5DWPA 3N55A 1WTGT 3D9AL 5HI4D 7CGTA 3TH4T 2WSPA 3H55A 1MFCL 3UMNA 1HJBC 3TP4A 1D5IH 2OMXA 3BEVA 4NC0B 2Q10A 4IRSA 1G9MC 5I74B 3M7OA 5C3LD 1LMIA 3PWLA 1CICC 1K5WA 3GXIA 5FKAB 1KEMH 4LBEA 2NZ1A 3ATAA 1A0QL 2IOMA 3O41A 5C09B 1NFIB 3H3PH 3WDIA 3DGGA 4IBLT 3OAZH 3GMPA 1A7OH 5DJ0A 3LZQA 3PF2A 5KYYB 3LDBC 2LQRA 3TYFA 1MH5B 1WTLA 3EYVB 1RAMA 3PJSB 2ZG1A 5D4HA 4BRJA 2YPLB 1F4AA 1DQLH 1QI4A 3WL9A 4U3SA 3O3EA 1DL7L 1I8AA 2X42A 1D5BB 1BD2E 4FMFA 4WJKB 1C1EH 5ECGA 4JN2A 5LBSA 3SE3C 4PHXA 2QV4A 2WJ7A 1BOYA 2HH0H 1DBKH 1X4YA 4O9HL 5DQ9B 4ILDA 4QEGA 3V4VA 2FATL 4R97C 4WWPA 4UDTA 2UV3A 2AXFA 2XLLA 5C0EA 3I9IA 4G9FB 3RKDD 3QIUD 4XMKL 3HS0B 4JE0A 5E08H 2W0FB 1QSEA 3DVGB 3FT2A 2OKMA 5G4NA 5CZVL 1A4AA 1UA6H 3UTTE 1D5MB 2B1HH 3MROB 5F6IB 3P3SA 3WNNA 4HWZB 5DVNA 4HUCA 2D0HA 2A6IB 5C9JB 4LNRA 1U3HD 3CK0H 1DQQA 2CJ3A 1ZT4B 1D5XB 1CXKA 3DVNB 4N0CC 1NLBL 1I3GH 4OF3A 1A3LH 3KPSD 4G7VH 4XMVA 2DQJH 1EGJA 4JZJA 5HGGS 1BGXH 2D9CA 2NSXA 3K8KA 4RIRB 1CI5A 2H0FA 3GI9H 3IETA 1EDYA 1B2WL 4N3UA 3CH1B 4MBOA 3QDJD 5KSBB 1URZA 4NGHL 2VDQH 2YFOA 2NY3C 4IOFC 4Y5YB 5E8NB 1CMOA 2GJJA 5EPMB 1MSPA 2VIRB 3TA4D 1U36A 4TVSa 3H7BB 1Q9LB 4PJDA 1U8LB 1PZCA 3RFZC 1TNMA 3O2VL 1OAZH 1PDKB 1TZGL 1JPSH 1OK0A 3LKNB 3X17A 3KD4A 1TCRA 3EOYG 5C0RL 2QGCA 3KM1A 4MNGA 2GITB 4HFUL 4L8CB 1JZ6A 1WSST 4TF4A 4PLKC 1W0WA 2IPTH 3VXRA 5EIVA 1OWWA 3M1OA 3U0PB 1UXMA 3LN4A 3VUAA 1S7VB 3N43B 4P2OD 1F5WA 2EUWA 1OW0C 5I8OH 2B20A 1H9VA 3X14A 2CWRA 3OV6A 2FNWA 4BK8A 4WHYH 3V4PH 3TZVA 2V7HA 4E5XG 2XN9A 4GAAA 4L1BA 1QRKA 2CRYA 1IIKA 3EFOB 3QXVA 1H5BA 3RDTB 3VXSB 2Z31A 3WEAA 3ILQC 3E8UH 5CU9A 1AHWB 3FTUA 4CW1B 3B2MA 3KR3H 4M6OH 3MACH 3REVA 3VFGH 4BHUA 2HRGA 5INDB 3IPBA 4WNQB 4JRYD 2CDEA 5DUPH 3PWPB 3EYOB 1CR9H 1LEIA 4FQXD 3ARFB 3O11B 4UWQB 1PNCA 5D6CB 3DV4B 3WIHA 3QIUC 5GZND 2IGFL 4OLYH 4RQQB 4ZD3L 3V4UL 3QIWB 1QR1A 2P24B 4D0BB 3BT2L 4XP6L 4ONGH 4NQDE 3OX8A 5F1IB 5CZXD 2DQDH 2VXQH 3MAWA 2IANE 2C9UA 1QUNB 4EKJA 1BQUA 4CC1A 4Q2ZB 3JT2A 2QLYA 3WXVH 4BFJA 1N59A 3WFHB 2AEQH 1YYMH 2K4AA 4U7MA 5GGRB 4Z7VB 5AW1B 2APFA 2ZUTA 3K8LA 1Y18B 1F0LA 1CIUA 3VXNB 4I3RH 2BJMH 2W65B 4NSKB 3ZTDC 2UZPA 1JCKA 2BIIA 5KVDL 5SX5H 4FEIA 3RY5A 5AG9A 4ZX5A 5B8CC 3QUMB 1EGJL 3FPYA 3QXAB 3DDFA 4ZXBD 4AGMA 4G5ZH 4ZSOA 4JG0H 4KKAD 5AKSA 4MQ7A 5TH2A 5JHLH 2WVUA 2VLRD 4JKLA 1DJSA 3NACH 2BXYA 3WSQH 2COVD 5L4FA 3SZ6A 3MU3A 4DAGH 5LGJA 4W6YB 5E95B 4P4KB 4WI6A 1H6UA 5DZVA 2MIZA 3HC0A 2ZXCA 5AFAA 3S37H 3T65A 1Q1JL 4P9HL 5IVXB 1Y1DA 4K3JH 2HX8A 1NCGA 4C47A 2IDFA 2BY0A 2V5TA 4GW5B 5G5DB 4YHYB 4X9BA 3AQYA 5CZRA 2PF6A 5IB3A 2ZZUT 1MJ7L 1PLGL 2AF2A 3SD2A 1DYZA 2WVTA 4ES8A 2H1XA 3FTWA 3HS0C 3IFLH 4FE9A 4NRXB 4UOW1 5AVWB 5B1KA 4WO4D 4WCYL 2PYEE 2YOAA 1RPKA 2G5BA 1NFDB 1JZ8A 3LH8A 3QFDB 4Z76A 4WTZA 4N2GA 2F19L 1A1OB 4QGTA 2W9DL 3M17B 5K39A 5I1JL 3BZ4B 1JPTL 2X9YA 3PIQB 5DLLA 3APCA 3FU7B 5BO1H 2DTML 3FRUA 4OCNC 1SGKA 1FO0B 2AK1H 3NQIA 3EGDB 1DVFA 2X4UB 4RGNB 1H15A 3UTSA 4JKKA 2QPDB 3MCYA 3F5WA 3THMH 3WJJA 4EQ3A 2JKIS 2WANA 3ETTA 5HPMB 4NZRL 4P8QA 2AP2A 3MRCB 1HWHB 4Y4KB 1G5AA 1Y0LA 3BIKB 1LK2A 2QFRA 1OK8A 4NQUA 1UKSA 1YEJH 3D0LA 2UZIL 3RG1C 2O5ZH 3L4VA 1DZ0A 3DV6A 3JV6A 5F44A 4FQXC 4AMKH 2MEJB 4DKEH 2HRLA 3KYOA 4WEEA 5IBUB 3UDWA 4TOYH 2EJ1A 3HI1A 2NY7L 1NC2A 1KIQB 3KCWA 4HISA 3CVHB 3RNQB 4W9KC 2VDRH 3EH1A 4QRPA 5F7EL 4DO6A 5FO8A 1HIMH 1T7ZA 3NT0A 1DP0A 4AYSA 5FWRA 4EDXB 4B9KC 1UM4L 6PAZA 1AJ7H 5BXFA 1MCJA 4MNHA 3C6LB 4JNXA 1GIGH 3HC3H 1YN6A 3MYJA 1YLBB 3T0EC 3KMDA 4QWWD 3DSNA 3LV3B 3MV7E 5H8DA 4OAWB 3VFRB 1IBHA 1RHHA 4KZ0A 2AV7A 1RUPL 4Y16C 2FD6L 3LD8C 5ESVB 5JW5A 4LSDA 2N59A 3CFDB 5D7IE 5AB2A 1TUPA 3N1GC 3O45A 5DJXA 1JPGA 1FORH 3HE6B 1P4LA 3GBNL 4HJGA 5I1EL 5IQ7H 2YN5A 1CTNA 3B2VL 1HEZA 1UWFA 4KKAC 4PTUB 3SDCB 4OUOA 4EVNB 2G0LA 2ADIA 2VMJA 1TJGL 4L05A 3EFFA 3CBJB 3GHEH 1TJMA 1AHWC 1RUKH 4X9HA 3GPEA 4U1IA 4WFEE 2ICEA 4PRDA 3VWJC 2K8QA 2GJZA 4U1KB 1C5BH 1HQ4B 3BVNB 3U7YL 1E28B 1CS6A 1BVZA 4IDJH 2ORBH 3ASOB 4DP9X 3BH9A 2B8OT 3PG2A 2IPUG 5D70L 1UC6A 5T1DH 1AZCA 4LVEA 2XZZA 4I0PA 3POHA 4BCYA 3SD5A 1XT5A 3QIWC 4ALAL 5GZOA 4NDMB 3JWNH 1BVNT 4NYLA 4P57B 2VKXA 5JW4N 4UM9B 1HINH 2Q8AL 3RAJH 5DD6B 3DECA 1MNUL 5CKAA 2O61A 3MI6A 2PW2A 1JPFB 1XCTA 3T6WA 9PCYA 1X7SA 2R8SL 2WNKA 5MENA 1UM5H 3GIVA 5CHNB 1G5GA 1E0OB 2ZPKH 3QXTA 1SLWA 4HULB 1FFPB 1IAKB 3BUTA 3CLWA 1G6RL 2PYFA 2GTWA 2NY4B 4M1GL 5T5NF 4M4PA 4BH8A 5F3BB 5AOIA 4U4IA 1P7HL 4W9IC 2JFCA 5CF3A 4FKKA 3QJOA 3CXHK 2RHEA 4IGBB 4HGKC 3IFPB 3P73B 5KANG 4Y2DD 3V52L 2CXGA 3Q2NA 4KVPA 2EXYC 3BESR 43CAA 3GWJA 1BECA 1UM6H 4KV5E 5C0BD 1H3PH 1JTTA 2EC8A 4DJMA 3FMGL 4NN5B 1MCWM 3EYQD 2R0ZH 4QHUA 1PJ9A 4YMPA 4HALA 5CD3A 3BWAB 1SUHA 1JPST 4P49A 4U6YA 4ZFFA 2IOOA 5D6DA 1JD7A 1NAMB 3KLAB 5SWZE 2QKSA 4A7GA 4B97A 3RIFF 4RCAA 3ARXA 2AV1B 4JPKL 1CLCA 2FJGA 3GXMA 3PHQA 4MA7H 4XOEA 3ZIMA 4HZAA 4KY1L 2EDTA 1H8LA 3MRHA 4BHUI 3A67L 1DVSA 5FOJA 2GBVA 1HU8A 1VIWA 2YEVB 4KUCD 4CBPA 2H6PA 4BWTA 2APTA 3EZJB 3L3OA 4NKDB 5DK3A 1U8MA 1PYWA 2Y6TE 3QJHB 3V0JA 1ROCA 1UA3A 4LCWA 3D48R 3WFBH 1JZFA 3BUDA 4FG4A 5HYSG 1VGEL 5DRZA 1OV8A 2A73A 1CURA 2IWEA 3T3PB 5JYLA 4GRMB 1NMBH 1S9WA 3I3DA 4Y4HB 1CTMA 1U3HA 4XMXA 1PD0A 1CU4H 3QEUA 3QIBB 2HKHL 2AQTA 4Y4KC 3WN5A 3KPSA 4U1MB 2NX5B 4AJ0A 5HHME 5DZOA 2CZNA 4Z7WB 5KG9A 2WXGA 4ZW8A 3U6RA 4APXA 3HS8A 3QDJA 2YZ1A 3EJYC 1K6QH 4PJCB 3RY4A 1OSYA 1HHGB 1A7QH 3NSXA 1T66C 2X9WA 1U58B 3OKNA 2BOCA 1OB0A 3LKQA 1TOXA 4EMZA 2WY3B 2R4RH 1YC7A 3K0YA 4K7PY 1J1OL 1T21A 1MFMA 2Z7ZA 1FVEA 3WLBB 3GSNB 4UTCA 3TBYB 3WE6A 4S11A 4DH2A 2DI8A 3JWNE 2EUVA 1H19A 1YJDL 5JXAH 3TJEL 2ETWA 5JW3L 1XXFC 4PVBA 5CNHA 5H37G 2D7TL 2E27L 2WK2A 3MR9A 3STZB 5D1ZB 1R5IA 4QHLA 4NERA 2Q1EA 1OSPL 2XQYK 2FJFB 1RUQH 4NC1E 4YFEA 5HYJB 4G43A 4P2OA 1NAKL 2A6DB 4N85A 4YXKH 4ZFGH 4UINL 4N90D 4JGNA 1LK3H 3HPLB 2GJ6B 3ATBA 1KWGA 1RK0B 1WZMA 4HXAL 3S36H 1JGDB 3M88A 3SGJA 5KVFL 1TTGA 3EYQC 3I02B 3IVKA 1MRDH 2E9WA 2ZXDA 3D0AA 3ZHLA 3KEHA 5E5MB 1N12A 2A83B 2Q2EB 3QWOA 5JNYA 3A6CL 3IJ8A 2D0GA 2FQFA 2QLVB 4NWUH 5LNEA 5E24E 3SJVA 3LQZA 2Y72A 3A0OA 3STBA 1HNYA 4MQXD 4GG6B 3OG4B 1U8IA 4XN9A 3QQ4A 3EOBA 3WUWA 2W0KA 1IAOA 3I2CH 2WQRA 4XVJL 1RY7B 3BPOC 3EGSA 2DBLL 2FIRT 2PLTA 3EGXB 3MLYH 3QJFB 4HHWA 4ONFL 3ARPA 5GZNA 5B39G 1EFQA 4LKCB 3F7QA 1S7TA 4XB3A 2NW3B 4HIJA 4F15C 5J6HA 3BZFA 4EI6B 3SE4A 1D6EA 5HVWA 3CC1A 1KTDA 5EU6D 4X7TB 1HKFA 2AAVA 4G7RB 2MNUA 4V1DE 5BS0B 5KBPA 4ZDHA 1TZIB 2FX9H 1KB3A 3MV9E 4G8EB 1BXUA 4XPGH 5IHZA 4JFDE 3DX7A 3CXDL 2LVEA 5FF6B 3PHOB 3NFSH 5TK4A 1ORSB 2R23B 4PPTA 3SOBL 4XP9L 3K4ZA 1L7TH 2ZNWA 1R3KA 4BUHA 4YVNA 2XWDA 3SBWA 3O3AB 3EOTH 3DUUA 3ZDXE 4AUUA 1ZEAH 1LP9A 5ISZE 3N9GL 4QD2E 4DPBX 2XX0A 4ZXBA 1BVLA 1UB6B 5D7LB 1QWNA 4APQD 3QFJD 3E8VA 1ZANL 3L5XH 2VLRA 5AAWC 1DN0A 4D0DA 2GK0B 4XXCA 4ZMPA 1L9QA 4HMCA 4PCSA 5BRQA 3RVUC 1B4LA 3B9KA 4KUZL 3RPIB 4FNSA 2W88A 1UD2A 3GZQA 7FABL 1A6AB 2V0AA 3QE5A 1RSFA 2CR6A 3EUUA 5L2KE 4F5CE 3GZKA 1FZMA 3VSUA 1IBGH 1CGVA 2H41A 2YS4A 4OZIA 2OJ1A 2AABH 4NP4L 2JSFA 2ZG2A 4KI1A 5K93A 4WO4A 4DGUA 4QRFA 3CFTA 1OD7A 2WIIB 3N42F 4JFYB 3KH3A 1D5ZA 1XBDA 5SWQA 3O4OB 1YDPB 3QW9A 4Q4EA 5TTRA 2JK5B 2X6VA 4DP7X 1PAMA 3MRNA 4AYEC 1HN1A 4LIQH 3NIGF 2Z34A 4HF5H 5T3ZE 2P1YA 4XPFH 3FQUB 1U3NA 4JO1L 1EBAA 1ZV5A 4FEMA 1CXIA 4L3EB 15C8H 2DWDB 4P9ML 3DTXA 4UQCA 4O02L 1E9PB 1RPUA 2Z4QA 2UWEA 5J8OA 3VH8A 3RIFK 4FFZH 1KCKA 2VITA 3FCSB 4YDNA 3ZYJA 1GRWA 1PF3A 4LSVH 2JJUA 3HZMA 3AG3B 3BJ91 4N6RB 4PS4H 4DP4X 2P5EA 4R9HA 3TBVB 3ZYIA 5E4OA 1OF0A 5IJKC 3BPNB 4FCHA 1FRGL 4LSPH 2K0RA 1ETZB 4PG2C 1YQ2A 4L1HA 4IOSA 3NSYA 3GIZL 4PJGE 4JRXB 1HL5A 1M71A 3FO9A 4PJAF 3WEBA 4RNRB 4NT6A 4X7EC 5DHXB 3PABB 4P5TB 5CJOL 3AT8A 4NM8L 5TFSL 2YAFA 4X4YA 1NMAH 3JYBA 4YGVA 2J5WA 1XGQA 4E9WA 1JUFB 5D1ZC 3JYCA 3AG1B 4ZRGA 2ZONA 3H42L 1L9NA 1S78D 2DZEA 3LNHA 4N2NA 4YSTA 2NXYD 4L4JA 4UIMB 5GISL 1NIFA 1YQVL 4AKPA 4LSTH 3KWWA 2E7HA 4N1EA 2V4LA 4QHKJ 4Y8AA 2X0VA 2EYSB 1ILUA 1V54B 5LDSA 4ODTL 1UOLA 4MMZB 4APQC 1WBXA 1QLRB 3OR7B 4ZFZB 4UDUB 3OPZL 1FNSL 4UM8B 4JFVA 2VMEA 1QATA 3IMVA 4JFPA 2Y9RT 2MQ3A 2ZE0A 4GRLB 5TDOB 3S98A 3FSOA 4ZQKA 5CLXA 1N6UA 4F92B 1CE1L 5I6NA 3Q01A 1GC1L 3S3JA 5E94A 3QAZB 4HK0A 2C3WA 5DD3L 3TNNB 2OMWA 1ED3A 4KI5F 1Z5YD 3BCFA 1DE4A 3PP3K 5J89A 3SYCA 3LZNA 5IFJB 1I8IA 4L5FH 2FX7L 3P40A 2ITEA 3SDAA 1UXSB 2JIXA 3D5OF 2GHZA 3TOPA 4NQED 4ODWB 1WZKA 4I87A 1IM3D 5EH1A 5FHBH 5J11B 1QBAA 2PW1A 1RZ7H 4HWBH 3VE0A 3ULUD 1JJUA 1R3LB 1ZLSL 1KLGA 5F3HB 5ITBL 1ZHLB 1ZA3A 4GKSB 4R5VA 4X98B 2EVJA 5AEAA 2HXAA 3WFCH 3K72B 4MVBC 3BX7C 4IK7A 4NKQB 4L1DA 3RL1B 4KQ3H 1N5YL 4I5BB 1QTSA 3NSCA 3NJNA 3GKWH 2HFTA 3NA9L 3VFTA 2OK0H 3AUVA 4OZFB 3UCRA 1M7IB 4LIQE 4KX8A 4PJ8B 4Z7OF 3B7YA 5AKTA 2MOVA 4Y2DA 2BS8A 1GS7A 3APDA 4E9TA 2BWDA 4WJ5B 1O6TA 3BAEL 3KYAA 5B1CA 5C0BA 1N8ZB 3I9GL 5IZ7A 1L9OA 1OB1B 4J3OD 1JN6A 1ET8A 4PJGF 4M5TA 4PJIF 4LSUL 4PJXB 3F3HA 4JL1A 3QRGH 2H2PD 2R9HD 1RSYA 5IHWA 1BZ9B 1S3KH 2H5UA 1R6VA 1E27B 4LHUD 4OJCA 1NOLA 3UFIA 4JL2A 5E7FA 5KVEL 5IWLA 4G6JH 3CD4A 2MOGA 5IJBC 4FXLA 3UYOD 2GAZA 1RLWA 3WCYA 3MO1B 2C8NA 5GGSB 2AVGA 2HP4A 1PL3A 3IU3A 1T1YB 4GJTB 1XZWA 2JJSC 2LV4A 3FFOA 2X44D 3O4OC 2G2RB 5E70A 1UWGL 3PHSA 4GAYA 2VM4A 4HBQA 2OCJA 2OLDA 1BD2D 1MY7A 4OW6A 4H40A 1KGXA 2ZWKA 3V0VA 1GCYA 3SPGA 1XB6A 1E90A 5JIDA 1ADQA 3C09B 3L2MA 4GUCA 4JK0D 4Q9QH 2CKBH 1J86A 3KYNB 2ICWJ 1NGWA 2QVKA 4BSJA 2QQKL 5CCJA 2XBZA 2BWQA 3GBDA 2COQA 1FN4A 1DSWA 2J20A 2P7TA 1CG9B 1JI2A 2VRKA 2VSCA 3UTTD 3IDGA 3F2LA 3L9RA 4Z7UF 1AY1H 3U1QA 5G4OA 2QSCL 1TQWA 3HLAB 4BWUA 4Z8FH 5I2IA 3UAJD 3D3VB 4OVUA 2O5XL 3G6AA 1S9YA 4XWOC 2E75C 3W9DA 4P5TC 3QORA 4X9IA 5F7DA 5DLMH 2BHZA 2P46B 2MCPL 1JHKL 1NGQL 2YPKA 3ABKB 4L5FE 4P59L 3CXFA 5I66B 4ZMQA 1V8HA 2Z1PA 4J28A 1QWHA 4X7SH 4DK3A 4EKXA 2CO7A 3G9VA 4B7LA 4EOWL 3UBXG 3NABH 3MJ9H 4G80B 3T2LA 5EO1B 5K9QI 2BSRA 2DN7A 2GTQA 4JHBA 3BGFB 2KBGA 3O0RL 3WTYA 4AGOA 4MTMA 2KLRA 2CD0A 1CVSC 2VOTA 3P30L 1MAJA 5FOBA 5K9OA 5FFGA 3S97C 1DBMH 2HJFB 4UT7L 1T5XB 2H3KA 5FV1L 5C0DB 1HHIA 4NKIH 4WKZB 4F7CB 5KANI 1VACB 3FSAA 4E9QA 3QO0A 4AKOA 4IMLA 1CBVH 2A0LD 4R4ND 2R9HC 3QARA 3LN5B 2OBGA 2OMXB 3AG4B 3BEVB 1IFRA 4IRSB 1MQ8A 1XF2B 1JWSB 5HHVL 2KL6A 1UENA 3C5ZD 3PWLB 4O5LL 3VXMA 5I76A 2GHWB 4RISL 5CD5C 4LBEB 1TQBB 4LVHC 1JWUA 5I1GL 1ZK9A 3BAIA 3DGGB 4ZTEA 3HI5L 3CPUA 2V5YA 3GBLA 2G4GA 4AL8C 2QQNH 1QLEH 3BDXA 4JE4B 4N6QA 1NUGA 1X5LA 2OQJA 4GMSL 4XX1E 5DJ0B 2EO1A 3W39A 1Y6KR 4G11A 3BN9D 2J4WH 1KGCE 1F58H 3GZOA 4IM8A 5EU6A 5GQBA 3ZO0A 3D2UD 4M7LL 1C8PA 4CU6A 1DQMH 5DURD 4GXFA 3WL9B 4U3SB 1TTRA 3O3EB 4LHUG 2K6YA 5E51A 5KSAA 4JN2B 4WY7H 3FUEA 1SLXA 5CP7A 5C07B 4HD5A 4JDZA 2IBGA 2EDNA 3KYMA 3OLGA 4FCAA 4KXBA 2NZ9D 3WU1A 4IQHA 3V4VB 1ADQL 4UDTB 3G6JA 4NQDD 2AXFB 5C0EB 2GK2A 3LB6D 4H88L 3H9SA 3T77A 4GUPA 1QSEB 1MLCA 3FT2B 1JHTA 1YEKL 2IAND 3IBOA 4LFHD 4HV8A 1OCRB 5EEVA 5FHAL 3Q2CA 1UADC 3QFJA 1NDMA 3VI4F 3K8MA 1R4XA 2B1AH 3SO5A 3MODH 4A68A 2A74C 1HSBB 2DQMA 2J1ZA 2VDKL 4LNRB 1DQQB 1S9XA 2CA4A 4XVTL 1HSAA 1KFAH 5B1JC 4JZJB 4WENB 3LQAC 2YD4A 4OKVA 1JAEA 4DEPB 3IETB 4DGYL 3PY9A 1WV7T 5I28A 1NM9A 1YMME 1KIUA 2X12A 4KO6A 2HFGH 5F1SA 2VERN 3QNYA 4Z77A 3SDXE 5FM4A 3T9WA 2AJVH 4PJDB 3D4ZA 1WITA 1TR7A 2YRPA 3MRIB 1A8JH 2EKSA 3S4SB 2BIMA 1N6QH 3VRLE 4NQCA 1KXHA 3ZE1B 4X5XA 4TPRH 2XXGA 2P5PA 5CBAB 4PD4J 2A0LC 2BCKB 4ZG1A 4MNGB 2WVVA 2HLFD 2PYED 4OV5A 1NBYB 1W0WB 4URTB 3VYOA 4ZX6A 4CVUA 4XZ4A 5FB8A 3LN4B 1EPFA 1HCVA 1NGZA 2V8MA 3JV0A 4GLRI 3SDDD 2WWKT 1NMCC 3O3DA 5HGHA 2APVA 3X14B 3ZVVA 2SEBA 3W82A 4OR1A 1XF3B 1E2WA 2V7HB 3ZRCC 2XN9B 4DKTA 2X10A 1X9UA 2J1XA 4D7BA 1H5BB 2MH4A 1JRHL 4KTYA 1J0IA 3FO2A 1JZEA 2Z31B 5DDHA 3NQKA 5C70A 4JG9A 1RUAL 2FQEA 3B6SA 3REVB 4GQQA 1KULA 2YWZA 4NIYE 3UC0H 5IQMA 1ZT1A 5TD4A 2CDEB 1AQKH 2BY1A 3RA7H 3F8UB 2G5UA 4XGZA 4HUUA 1LEIB 2ZXBA 4ZS7L 3BP5B 1ULVA 2D73A 1N68A 1QR1B 4PN6A 2BRRH 1XGYH 4G8IA 5HHQB 3V7AE 3OX8B 4JJ5A 3T0AA 1Q72H 1QG3A 4J3UA 3LPPA 2QV2A 1LILA 1SXCA 2PPCA 4Z7QF 3QSKB 3QUXB 1GVIA 1EAOA 5FM5M 5C0AA 4NFDA 3MV7D 3QH3A 5E8OA 4PRNB 4LCCA 3HN5A 1N59B 2EDQA 1WQVT 3G3LA 4GXVH 4R0LB 3UBFA 4OSUH 5LWYH 4F37F 4M6MH 3TA3D 2X53A 3WNPA 1OAYH 2ZQKA 2UVEA 4TUUA 5C3TA 3JVGA 4L29A 3JBG7 4JO2L 1GGCH 5D1XC 4PB0H 4IBVA 4LFHG 1XSJA 4FFWC 4ZSOB 4C4KT 2VRQA 5TH2B 4MQ7B 3WD5H 4FXKB 4YSPA 1AIZA 4NQEA 5T1LD 3F7YA 2IJ0C 2GG1A 2H6UA 5LGJB 5JQ6L 2X1PA 4PREA 3WKPA 2ZKYA 3TX4A 3CFUA 4J3XA 2ESVA 2QHRH 4HZLB 5E99L 4LK4A 3T65B 4NUJA 3CU1A 3FFDB 3C8KB 3R0MA 4GAGL 3T2NL 3G5YA 3OKLA 5GJTL 4XBEH 1OSEA 3TT3L 2BSBA 1IV8A 4PRIA 1FAKT 4K3DH 3TFKC 5ES4B 2G5BB 3VVVA 2EDLA 2C9PA 3HG1E 3V6FA 4Z76B 4L1TA 3RWEB 1FC2D 1QFWL 4YHOH 1SXBA 3CMOL 2ZCLL 3GO1L 4DHLA 5GGQL 5K39B 1ZXQA 2WTRA 5FA4A 4ODVL 5K1NA 3FRUB 1OTSC 1BOGA 1DVFB 1UYWH 3LNDA 1H15B 4HZ1A 3UTSB 3DMMD 5FYJH 2D2OA 4Z3IA 2EDRA 1K2DA 3CDZA 4IU2A 4L37A 3EJTA 4XNXL 3RB5A 1GGYA 4UV7L 3ULVH 2IQAA 1JK8A 4X9YA 2QJDA 1NPJA 4TLSA 2EECA 5ID1A 1Y0LB 1LK2B 2CO3A 3CHPA 5L4IA 4JO3L 2FX8L 3DV6B 1MRFL 3JV6B 4IKKA 2IMMA 2OR7A 1G9NC 1I1FA 4DQOH 3KYOB 5SWZD 4L3AA 6FABL 5K9JL 3I9AA 3HI1B 3IM1A 1JRHI 1BD2A 4WHYG 5JOFA 2OJEA 3CZSA 3NJJA 2WSKA 2WWOA 5FO8B 1T7VA 5FUOH 2WBJD 4BE5A 1TTCA 3IB4A 5BXFB 4M5YH 4LGRB 1OOAA 1E7UA 4ANUA 2A2QT 4MNHB 2CNZA 4K94L 4Z95L 4OLZH 5DRXA 1A7RL 1SOSA 1YN6B 3MYJB 1J5DA 3WELA 3DSNB 3O4LA 2OTUA 1RHHB 3S4SG 2AV7B 1LGVA 5E2WH 5DUMH 1MF2H 2E76C 3BVUA 5JW5B 5DJXB 1JPGB 4BE6A 5KJRL 2TSBA 1TVBA 3KL0A 4OM0L 1KOAA 2Y36H 1P4LB 1OCWH 4HJGB 3UAJA 4AC2A 1HEZB 2ZT9C 4PJ6A 4ZZKA 2ADIB 2B0SH 3CMGA 1XGPA 1KJ2B 2H32A 2GC7C 3EFFB 5EU7C 4NIKB 4PYHA 5L9DL 4XP4H 4QCIB 4HH8A 4U1IB 2ICEB 2LLNA 3W38A 2GJZB 3RU8L 1FVCA 5FGBC 5CWSA 3WHXA 3E7JA 1KN2L 2ZICA 4PRHE 5GRXG 3BH9B 1R3IL 3LMJH 3H3KA 5HD8C 5E5UB 3ULUL 2XUWA 4Y1AB 5LGHL 4I0PB 2Q3ZA 4P46A 3KJ4B 2L3BA 3RP1A 3WXWL 4XCEB 1PZBA 4NYLB 2XVLA 2BP8A 4P23D 3JTSA 4U6HB 1QFOA 4D2NA 2O61B 3ZTJH 4NO0A 2A9MH 4GT0A 1XCTB 3GBML 3VWKA 3QUXC 2OR8A 3RFRA 3P9WB 4F91B 3IRCA 3PGDA 5MENB 3GIVB 5EWIH 1SYVA 1F18A 1IFGA 1YYLH 4R0LC 1FZOA 1YEIL 3DMMC 1OTTC 4N0FA 2PYFB 2GTWB 1IFHH 4O4YL 3U2SA 4BH8B 1O7DE 3S35X 4PVLA 3NJIA 5FW7A 4P05A 3DK0A 3FAWA 3VD2A 3C5ZA 1EEQA 1INEH 1TVHA 4DP2X 3MBED 1YEDB 4AENA 3DXAE 3RY6A 1PIFA 4NRYA 1R0AL 1MW2A 1QFWI 3GC3A 3MZTA 4N0YL 3D50A 4FFVD 1L0PA 3OD3A 4NZDA 1FE8H 4RSYA 4LPYA 4GG8A 5FYJE 1J8HA 43CAB 1IEBA 4FXKC 3ULVE 3Q1SL 3RIAF 1DLHB 3Q43A 4JG5A 4OLVL 1DLFL 1ACXA 4XPHH 1Z2KA 4KJYA 5IK3A 2W8CA 3T0WA 5CD3B 3GHBH 1T80A 1IGCL 1WD9A 3JWDH 4U6YB 4ZFFB 3RL2A 1LO4H 4JPVH 2JV6A 3D2UA 4OT1H 1A7NH 1AS8A 2H7WA 5DRWA 4U1GC 1FZKA 4IMKA 3HNVL 2FIKA 1EJ6A 2WBJC 4P3DA 3GFUA 2VYRE 3LRLA 3PHQB 5I30H 1Y1UA 2CIKA 1CXHA 3BDYL 3F83A 2KKQA 3MRHB 4QHMA 1PY4A 3HB3D 3LVTA 4MA8H 4F37K 2VDML 1Q8MA 3DX1A 2H6PB 3F64A 3QBTB 4NQDA 1RZJH 1AC0A 2HLAA 4L8SC 4V1DD 1U8MB 1NGPH 1PYWB 4GEIA 2YRZA 5AB0A 3KLSA 1S5IL 4ODHH 4OCLC 4LCWB 4CNIA 3MV9D 4FQPA 4N0UE 4A2DA 1EUUA 4K5OA 5DRZB 4JFDD 4OCRH 2A73B 3MLUL 1S9WB 2X0WA 4UILL 3CVIL 3NSJA 4GO9A 1MJUH 2ALAA 3FYEB 4S10A 3KPSB 1RULH 1TITA 1R5VB 2BVYA 2QKIC 4DP6X 2R2EA 5ISZD 4XNMA 4YDKL 1MCPH 2YAEA 2QVFB 5KG9B 4XP5H 1A1NA 3U6RB 4AT6B 4OM1H 3E6HA 3DO3A 4KDTA 2RBLA 3QDJB 2LFGA 1TF4A 3KBEA 3H54A 3C8DA 4KKCC 1KXVA 4KKNA 3MUJA 1MCQA 3OLIA 2OXGA 5LO7A 3SBPA 2FUQA 8CGTA 1W6LA 4LL9A 3N44B 3OKNB 4FQ2H 2BOCB 3JWNC 3PPEA 2GSGA 4ACTA 2DIJA 5L2KD 5AOMA 4JM4L 1T21B 3BKCL 1FVEB 3RI5F 3WE6B 4YPGA 2CKNA 3EDEA 1JGIA 4JGJA 5AVTB 3SDYH 3NEEA 4OJAA 3EO0A 4XNUL 2C34A 1W80A 3BQVA 2PYEA 3MRKA 4KROD 4X80H 5CUSH 5H35A 4NC1C 3MR9B 1J10A 1R5IB 4QHLB 3MMEA 3P0VH 5DFWH 2EZ0D 3KWTA 1FG9C 3SGDH 1FV1A 3OTTA 3MBEC 3VW3L 4G43B 1GGTA 3P9MA 5T3ZD 2HT4C 1WC7A 4FFVC 3SDDA 3VXUA 1TZ8A 3DWTA 1D5IL 2ZXGA 5FGCB 3QPXL 3JWNG 3WV0A 2JJTC 3BRGC 1A65A 4MXVE 2W92A 3GLAA 4WHCA 2GBUA 3IVKB 3I6LE 4NHCH 4F93B 3T0BA 5SX4I 1NOFA 5JNYB 2JLPA 3QWOB 3H3PL 5I19H 2EIKB 3VGAC 4LEOA 1VFOA 2NNAA 1A7OL 1A6ZA 5I6LA 3SJVB 2X4SA 3R7RA 1FA4A 4CVZB 3LQZB 4X99A 3DHPA 2H0EA 3CLEL 1U8IB 3QPKA 3QQ4B 3EOBB 3WUWB 1IAOB 3HB3C 1MIEH 4I8DA 4L9LA 4C4BA 2BWIA 4H8HA 1DQLL 1YECH 4QKTA 2ROYA 2H26A 1S7TB 5DHYA 4HIJB 4KRNA 2XV0A 1C1EL 4K9EH 4PP1C 1D6EB 3JZ7A 4MCMA 5AVYB 3UCQA 1YEEL 2AKRB 2HH0L 5H2BA 4ZDHB 1OT4A 3KZ8A 3FT4B 1A1MA 3MV7A 5IM7A 3O2DA 2CLRA 5E08L 5IHZB 3DX7B 4BFEA 4LOFA 1G0DA 2YBRA 4EIZC 1KJVA 1QSFE 1WBYA 3PYCA 5M94B 1OEZW 5LJYH 4BFRA 1UA6L 3TA3A 2PXYA 4TVPH 2WZPA 2B1HL 1R3KB 1BV8A 4S1RL 3TO4D 1MREH 2X28A 5DT1H 3MCLH 5SV4A 3ESUF 3CK0L 3FOLB 1BVLB 1AGDA 3KVQA 4K8RH 1AHKA 1I3GL 1A3LL 4G7VL 5K1VA 1DN0B 3FT3A 2DQJL 3HMXA 4GNKB 4XT1C 5T1LA 4D0DB 4L1LA 5CCHE 1VADA 1ETJA 4QY8A 5I71B 4UQ3A 4HG4K 1UQSA 3B9KB 3GM8A 3GEFA 4RMQA 3GZPA 3L3HA 5D96C 1OP3K 2CBQA 3BLKA 3NCJL 3LAFA 3LYRA 1YY9C 3QPQD 3W0WE 1FZMB 4OZIB 1MCKA 5LVEA 1F6LL 2LVCA 1OAZL 4HFWA 4LSRH 4RDBA 3MRRA 2NPLX 4X4XA 1S7QB 1JPSL 2J88L 4F1ZA 4NB7A 4DUWA 1WAEA 1D5ZB 4FA7B 3HN3A 3MBXH 1IRAY 5SWQB 1AIFA 1UH4A 3MRNB 3OJ2C 3RIAK 3O0LA 2IPTL 2VO8A 1OF2A 4PLNC 2AQSA 2YK1H 3AUWB 3FB8A 3QR1A 4N1CA 4EZLA 1XB8A 5EU3A 3CFNA 3H56A 3W1ZA 3WNOA 1ECYA 2DWXA 3CSPA 2ZUXA 3DTXB 5DGQA 1D7DA 2ZWSA 3OZ9H 2V5SA 3GXTA 4QR7A 4UT6H 5JR1H 2APSA 2UWEB 4JPIA 1WHOA 3VH8B 2L7JA 4BK5C 1S9KC 1SY6A 2CGRH 1A3RL 4W9JC 4MJIB 4EI5D 3GD1C 4HIQA 2AC0A 3HZMB 1NEUA 1GGIH 2PETA 1K3ZA 2P5EB 3LS4L 1DFBH 1F11A 2Z8WC 3X12A 3H9YA 3P2BA 2XWTA 5SWZA 3E8UL 4F7KA 2GTZA 2IC2A 3KR3L 1M71B 3MACL 3FO9B 3P2TA 4M6OL 3CHSA 4WAFA 3UP1A 3VFGL 2FR4A 3S88L 2E4TA 4YZFE 1RZGA 3FCTA 5DUPL 2FHBA 4YGVB 2CU9A 4RWYH 4CAGA 1CR9L 1XGQB 3PQYE 4FQCL 4M7KH 4WIQA 2VW7A 4ZMYA 4OLYL 2CM6A 5TQ2H 1ONQA 4ONGL 4NENA 4OBSA 3ABGA 2DQDL 3PP3H 4PAZA 3KWWB 4QNPE 4JUTA 2NDGA 1RIHH 2RQEA 3FUJA 3V5DA 4WW2B 1LYQA 2LLLA 3NYKA 3S34H 4M93B 3WXVL 2CCWA 2AEQL 5IEKA 1IZKA 1WBXB 1YYML 2X4QB 4TVPE 4OI7A 4IIQA 4YXLH 4FA6A 2BJML 3NIFE 1RP8A 1RL1A 1I7TA 1MOEA 2JXMA 3CZGA 1BQLL 4BZYA 2UUDH 3RI5K 4BELD 3C2AH 3HMXL 3MA9L 2JB5H 2Z8RA 1XV8A 4G5ZL 1ZKAA 2BSCA 3GF8A 4W9EC 4PVNA 5DJ8A 5E94B 4HK0B 2LAGB 3C12A 3UYRH 3MNWA 2ICWA 4B41A 3DOIA 5JHLL 3DSFH 2OMWB 3N3EA 1ED3B 3NACL 3WSQL 3G08A 1DE4B 1SEBA 4LDOB 4BH7A 4E9VA 2P26A 1FCGA 1FG2A 1I8IB 1IARB 1XH1A 3AQXA 3DJSA 3SDAB 2JIXB 3S37L 4M00A 4WFFE 3X1FA 4P23A 2CUIA 3G9AB 2VW4A 4K3JL 1X7TA 4H8WH 2Q5BA 2X1WL 2PW1B 2YUVA 3ARDD 5EUOE 1EHLL 3VE0B 3MLWH 5ACMA 1H3WM 1KLGB 2F1AA 3IFLL 2GSIA 5E8PA 4QLRA 2F7OA 2R1WB 4H0GA 1ZA3B 4ODUA 3TN0B 3TTYA 4XO3A 3QNZA 5FYLH 2RCSH 3AGVA 4HWEH 4Z7NE 1IGJA 1F97A 3VFTB 2IDSA 3LZRA 2X6AA 3MLSH 3E1ZA 5BO1L 3RUGF 5CMAA 4EI5C 2YJQA 4K71B 4BZ1H 4ZMZA 4FMVA 4Y2DB 1RPQA 3RVXD 4A6YH 2D7NA 1K8DA 5C0BB 4N8CL 4JO4H 4TSAL 1JN6B 1GYWA 5A7BA 4DNLA 4OCWH 2J12B 2JKXA 3VG0H 1SM3L 2O5ZL 3TBWB 4JN1L 4OI8A 1P5UC 4DKEL 5JORA 4GRWB 3AQZA 4WWOA 1OCOB 2D0FA 1X5JA 2MFNA 4KK8D 3VXOA 4H0HB 2GAZB 4TOYL 3F00A 1CFQA 2XXFA 2VDRL 3IU3B 4PJAA 1KGCD 3DIFA 4PLOB 1HIML 1JGVH 3HFFA 2UVFA 2R69H 3L45A 1NLDL 1NIDA 5B21A 4GAYB 4G42A 3AZUA 1FLRH 2XV6B 3ZY7A 1GIGL 4JFDA 2FTAA 3F84A 2D2CC 2Q8BH 2H47C 4BBWA 1SNRA 3HZYA 1ETB1 2WLIA 3UBGA 4P2RE 3NIFF 5DQDH 1NGWB 2C9QA 1FHNA 1IGMH 1FN4B 4J6RL 2DQUH 3T09A 2X3CA 3OXSA 1TO4A 1M7DA 5LNGA 3IDGB 5IQ7L 1MJJA 3NDYE 3I6GA 3L9RB 1FBIH 3WAKA 2PWFA 4QRSA 4EN3C 3GHEL 4GO6B 2GQHA 3IDIB 1MFVA 4HHGA 1S46A 2WTPA 3GMQA 5I2IB 1CFMA 2ZUSA 3FT9A 5DC4B 3UAFA 1XL6A 2ZOOA 1F4YL 3ROLA 3W9DB 3GUTA 3EHBD 1NGXA 4I2XE 4IDJL 2ORBL 5EF0A 5KEZA 2MPAH 4XP1H 3QORB 2DS4A 3ARDC 4MMYA 5I5MA 1RJLA 2XWZA 4OZGF 2YKLH 4QHKI 1URLA 3IRZA 1PW3A 4QF1B 1YMMD 2CO6B 1AD9A 2CO7B 1QMUA 1XXDC 2GEEA 3DTUB 3FTSA 3QWRA 4ZAKC 2J2ZA 3CFBA 1HINL 4PJFF 3DO7B 2WD0A 3A4EA 4PR5A 3RAJL 3KPRE 2OL3H 4NJAH 4BQ9A 5L7XH 3S3BB 2VN6A 1N6VA 5DZAA 1UM5L 1MIMH 4WW2C 5K9OB 2ZPKL 1HH9A 4UTAA 4DW2H 5FOBB 1MI5E 4HCGA 5FYLE 1HHIB 2WNWA 2FJHA 4WK4B 1A9BA 4CL7A 5G4MA 2NTFA 3UZQA 1U8QB 3V9CA 3QO0B 1ZPLA 4AVHA 2DYPA 3FHAA 3N6YA 4HC1A 3D25B 4IMLB 4OZHE 2JTYA 4XO8A 4YR6A 2BS71 5EORH 3B7UX 3UAEA 1TYRA 1ZTXH 1U8HA 4OFYD 4JFFE 3VXMB 5I76B 1CFVH 2WGXA 2X2IA 3CSTA 3K74B 1A4BA 1JWUB 4Z6AT 3HAEH 4XHJD 4PJIA 4PJGA 4ZTPH 1CGWA 4GY4A 5B4MD 2XVGA 3HBGA 1QUPA 5CEYA 2OQJB 3W39B 4PJ9D 5DJZA 4YSEA 4MA7L 3ML9A 5GS1A 3ILDA 4FDWA 2FSEA 2ZUQB 4EN2A 3TO2A 4QRAA 2VISA 3KWUA 2EXTA 2K45A 3DBXB 3KCPB 1KCRH 3KL5A 4IBZA 5E2TH 3TN0C 1IGTA 1HKLL 4HCFA 5KSAB 1B9KA 3ARRA 3K2MC 4FNQA 4W93A 5CP7B 5F0PB 5J1AA 2WB7A 2FEJA 2Y7MA 4JDZB 3ZL4H 3VSVA 4AQ8C 2OZNA 3ZE0B 1CZ8H 2IVFC 3KYMB 5K5YA 2JI1A 4XX1G 5KSUA 3AW5A 1PU0A 2OX5A 3WFBL 1VFMA 3G6JB 1F8TH 1X5AA 4PI2A 3GINA 1XGUA 3H9SB 4OJDH 3DIDA 4PJ7E 1CGSH 1MLCB 2FRGP 2KI6A 1JHTB 3TO4A 1NMBL 3ERXA 1GYVA 1CU4L 2O4EA 1ZWIA 3QFJB 5AW2B 3D08A 3ZRFC 2PTUA 5CSGA 3QQ3A 2BPBA 4DGVH 5AD0A 1D9KA 5C0IB 1GY2A 3EHBC 4XAKE 5IHLB 4JG1H 5C6TH 1YNTF 4A66A 1S9XB 4I1RA 3FO0H 1HSAB 4Z7UA 2R0LH 4C56A 4AQ1A 3S36X 4D8OA 3V0GA 4DFIA 5J5EA 1SXAA 4OKVB 3ASNB 4FOMA 1MEXH 3KEDA 1P53A 1I9JH 1KIUB 5EUKA 4MMXA 4LL4A 3TPKA 2ICWI 4GO8A 1WVZA 3QNYB 2R4RL 4Z77B 4HGMA 1P4IH 3FQWB 4XBGA 1H3XA 4ZNEE 4AGQA 1Q38A 1QASA 1Z5LA 4JVUA 1VGKB 5JXAL 4NQCB 5EN2A 2VC2L 3O6KH 3QDAA 3SE9L 3AABA 2Y6SD 4TNWF 2PUQT 3MLPA 2W9EH 4AQAB 3RWFB 4X8CA 5T3ZL 3G6DH 1UWEH 3KHQA 3OMNB 1RUQL 2WVVB 4HKZA 3EXLA 2EDEA 4YXKL 4OV5B 3UACA 4ZFGL 5GPRA 3LEXA 2AGJL 3HG1D 1LK3L 2CRMA 4D8PA 4WW1A 2WVSA 5FB8B 4WSKA 2Y2WA 5J6SA 2X4OA 1WHPA 1NGZB 4MLIA 4IJ3B 4X6DF 2ITDA 3O3DB 1ZTXE 4HETA 1G1OA 1BQHA 4BKLA 1X9LA 2SEBB 2YQ3A 5CFAA 3V95A 5B4MC 1ID2A 4YHLL 3UZEC 1LQSR 4NWUL 2VLKB 4B50A 2XWBA 1NEZG 1I1RA 1HWWA 4FTDA 3PFUA 1E4WH 3FO2B 5DDHB 1YAZA 3CN1A 1H9DA 3WIFA 3I2CL 1G7QA 2I60H 5C97A 4RAVB 1QX1A 2UX7A 3K6IA 3HTLX 5F7FA 5I5IA 4EUPA 2NXYB 5J9PA 5JXED 3T08A 2Q3XA 4XGZB 1HL4A 4LASL 4DETA 1AOZA 4HCIA 1QRNE 3H9HA 2ATPA 4O2CA 3WNJA 4G8IB 4XPGL 4JJ5B 5EZOL 4K23H 3CHXA 3NFSL 4LP4A 2BIQA 2ERJB 1F45A 2EEXA 1A47A 3FN0H 3BYTA 5C0AB 3QH3B 2CAKA 1L7TL 1TYEB 1T20A 2NXZB 1FI8C 3QHFH 5E8OB 4AEIH 3GSXA 4LCCB 3EOTL 4ELME 4AC4A 5GGRY 3CFQA 1I7RA 35C8H 3R4RA 1OARH 3IXAB 3V7AG 2OA9A 4IS6A 4E2OA 4L29B 3QQXA 4QXUL 2G3ZA 3X1NA 3IU4H 3O9WD 2C3XA 2P44B 4OLUH 4NN6C 1ZVNA 2IPKA 2ZNXA 2YIHA 3EF4A 4FLQA 3S2CA 1YAIA 4NQEB 4K0OA 3F7YB 3X13A 2Y7QA 2W0LA 4PREB 3VJ6A 4IKLA 1IBGL 1MZZA 4PRHD 1MXGA 2ESVB 2WXJA 3HW7A 2AABL 2Y6SC 3FZUD 4W9ZA 5AKRA 3VRIA 3WFEH 4NUJB 4KPHH 3G5YB 4H13C 1LO2H 5HI5D 3OKLB 4MLSA 4PY8J 1KXQE 3L81A 1DZBA 4W9LC 3BPLC 2I25N 1QEXA 3LXBA 4PRIB 1DVZA 4WEUD 3T2PA 2ZOKB 2JTDA 3NCMA 4HF5L 4XPFL 4FQIL 1E4HA 3V6FB 2HWZH 3L1EA 4JCMA 1N0XH 3J7HA 3IAGC 2WTRB 3BQUA 4QXGH 5FA4B 4RAUA 2AJXL 1BOGB 4Z1PA 5CLYA 2ZIDA 3ECQA 2GKIA 4U1SA 4PRPE 2J25A 1K2DB 3CDZB 3L4WA 4IU2B 4L37B 4NZUH 4LSVL 4QOKE 2Z92A 4RFNC 2GYSA 1TJIH 1KJ3H 2JCCE 5FYJD 2DQGH 2IQAB 4XNZB 1JK8B 5ID1B 3UAAA 3ULVD 2BVQA 4H2CA 1WG3A 1XGRA 5DU7A 4HAFA 2R39A 5JXEC 1NKOA 3CX5K 1B4RA 3SGEI 2ZJSH 2QHLA 3V6OE 2ATAA 1I1FB 3U0WL 4R8WL 4W1TA 2CQVA 2PO6D 1CF1A 2J8UF 4HW6A 3E2HB 5KS9E 5JOFB 1EMTH 5JPNA 2OZ4H 1OCZB 2PPDA 3K5SA 1CFTA 1VB9A 1O75A 3TWYA 4LSTL 4HJJH 5D2NC 1PSKL 5DRXB 3FC8A 1ZY9A 4JKWA 3O4LB 4QRRA 3O6FD 2OTUB 4MB1A 4IJ3C 4JPWL 5EOQH 2L7QA 2Z6FA 3OKMA 4BEIA 3ML8A 2NCEA 3MLTA 4QLWA 3EYSL 2P8LA 1TVBB 5D5MF 5CEXA 3AXHA 3QI9D 4RMVA 1KTRL 1W72A 4WFGE 1I9RH 4E9YA 2EYTA 4Y4FD 3BVWA 4M6AA 2AVFA 1XGPB 1KC5H 2H32B 4F20A 1FH2A 3HBQA 5JHDE 1KLFA 5AG8A 1AO7A 4YX2H 1K4CA 4TNWK 3ZGHA 3FZUC 1KIPB 1FVCB 4ICWA 4L5FL 5CWSB 4X6CE 3WHXB 2WWKO 5E00A 5BMFH 2Z7WA 1Z9SA 4MD5A 4PEEA 5HI5C 1SXSA 4F33A 1SDYA 4GBXC 2RFXA 4A7QA 5FHBL 1OANA 1KF9B 4DVRL 1MZYA 3MJ9A 4P46B 1RZ7L 4FG2A 3BAXA 1PX8A 1OPGH 2YAPA 3ZIYA 3N41F 3F7VB 3U4BH 2IDCA 3UOAB 4QMEA 3JTSB 1FLTX 3N04A 4NAQA 4NO0B 2ERJC 5A3IC 3VWKB 5GS2H 3QZMA 4K07A 5EEXA 4LDEB 3U4KA 5I1CL 3PGDB 2ADYA 3GKWL 1QYGL 2OK0L 1O7DC 3IDYB 3TIDA 1SYVB 3HZKA 4RBPH 4JM0A 2N56A 1J5OH 1UGKA 4N0FB 5D1QE 2YD3A 5AVQB 4DN3L 2PWEA 3QG7H 4OFYA 2Q7AA 2OMVA 4I77L 1RZKL 1TVHB 3C5ZB 4WGKA 5CJ5A 4AENB 4KTDH 4NRYB 3ULVC 3FO1A 4FQLL 1JXFA 4GG8B 3QRGL 1J8HB 2ZKMX 3NK4A 5TF0A 3V4LA 3FXIC 1JXDA 1IEBB 1R47A 2GBAA 3I6LD 1S3KL 3K1KC 2YN3A 2OMNA 4PJ9A 4NRZA 2YRLA 2C26A 3P77A 4XTRD 4KJYB 5IK3B 4TNVF 5DUJA 1ITBB 2F5BH 2LTQB 2PO6C 3MLVL 4G6JL 1OAUL 3HUJF 1P9MC 3U0PA 5DRWB 4MNQB 3MCG1 1FZKB 1HFUA 5DURB 2EE2A 3KDPB 1JZIA 5FUZL 2FIKB 1TU2A 4P3DB 1F1DA 4IHBA 4TXVB 4PV9A 1KPVA 2CIKB 2Y1AA 4C4KO 3DX0A 4HHAA 3X3GH 4CVWA 3DYMA 4QHMB 1NCAH 3QO1B 2ARJA 4MDIA 4J8QA 4OIFA 1AMYA 3ARQA 1E42A 1FYTE 1F90H 4QRTA 3BWUF 2EH8H 5D8JH 3GRWH 5D7JD 4Q9QL 3SO3B 1S7UA 4CNIB 2W81C 3MZGB 3NFPA 5JYMA 5IBLD 1K4DA 1BIIA 3HMWH 3QI9C 4W9CC 2DH2A 1CN4A 1QSFD 3UABA 1BFVH 4TSCL 5GRJH 3D39B 4Y4FC 4M62L 1MCOH 3PU7A 3RJOA 3SPJA 2IQ9H 4OLXL 4B0MM 4E9RA 1RFDH 4FQHA 1AY1L 1B9ZA 1VPOL 1F2XK 5DTFA 3NFNA 4JKMA 4Z8FL 2R2EB 4XNMB 1ILSA 5FW8A 4ZS6D 1HI6A 3UJTH 3UGEA 1B6UA 1ZLDA 3E6HB 4DN4H 1IEAA 3NJGA 3Q6FA 1GSKA 4PVMA 3UYPB 1RK7A 5DLML 1MFBH 1T2XA 2QPSA 2UXTA 2OXGB 4JVPA 4KMQA 5C08E 4JGUA 1KBWA 3IMRA 2CG9X 1U2YA 2OFQA 3HHRB 1E50A 2FWSA 1DUZA 3Q44A 2DQFA 3NABL 3MJ9L 1NCDL 2GSGB 3LCYA 3W0WD 1WFMA 1KPRB 1U6AL 3HZ3A 5JPMA 5BVJA 1YHPA 2B16A 2ZOUA 3ZYZA 2DF3A 3EO0B 3V0WH 3VTTA 2PYEB 4TUOA 4H8UA 4PG9A 1RZPA 1EEZA 5H35B 5IW1A 3WTTA 1DBML 3HG1A 1JPEA 5ILTL 2BNRE 3MMEB 4IEFB 4IRZA 2ZAGA 4NKIL 3Q5OA 4OF6A 5H94B 4YO0A 1FV1B 1IGFH 3R8BB 1CBVL 4PWKA 4I9XA 3P9MB 2WBXA 4QXVA 3VXUB 3K4AA 4JMXA 1ZD6A 5DJ6A 3TNMA 1ACYH 1KGJA 1P69B 1SVBA 4DCQA 5FO7A 1W15A 4XNQB 3ZTJG 4WI7A 2BVPA 4XTRC 1YEHH 3BRFA 3HG3A 1XZ0A 2CBTA 5G55A 4QT5A 4CJ0A 3HCVA 4WUKH 1IC7L 3ZUNC 4LEOB 2BS9A 2NNAB 4DF9A 1QLEL 1A6ZB 2V3EA 3S7GA 4DK6A 1GR7A 1WBZA 5F1KC 2XWRA 4X99B 4BGDA 2CJSA 3DYPA 3RX5A 2I07A 2J4WL 1P7QD 1F58L 1G7MA 1J9CT 3F65A 5I8KH 4L9LB 1AGEB 1DQML 1NIBA 2FLMA 4NUGH 4MDRA 4R2GD 3BP6A 4M7JH 3NN8A 3QEQE 1RZJC 5HHOB 1TLKA 3PQYD 4PJBF 1HHHB 3IS0X 3OBAA 5H2BB 4L4TA 4X7DC 3QVAA 2XXMB 5HHPA 4TQPA 2WKOF 1BFTA 1A1MB 5CN3A 1HC1A 1HZLA 3MV7B 5IM7B 3ZJAA 1WWBX 2DEYX 2CLRB 2H8PA 2F7PA 4JQIA 4JM2F 4AEEA 4G71B 4G1MA 1CLZH 1OP3H 2YBRB 1WBYB 1YMHA 2V5RA 5JZ7D 3QS3A 2YD0A 3TA3B 3U0TA 2PXYB 4HVBA 2B14A 4MAYD 4NN7B 4KMTH 4S1DD 4ZS6C 4K7FA 3VGEA 2BNUA 3O9WA 4TVPD 2W0PA 4GQ9L 1GY1A 1FFRA 1SPDA 3LN9A 5F7NC 2VW6A 3NIDE 3AXLB 2JCWA 3HVNA 1KFAL 4A1RA 1AGDB 1PG7X 3L5HA 3W5MA 2LE9A 3FT3B 2OI9B 4P2YA 3U9WA 4JCLA 5IJCC 1VADB 3MLZH 4HUMB 4UBDD 1AS7A 4K8RD 4KVCH 3B2UC 4QY8B 1OGAB 4UQ3B 4PRHA 1SOKA 1UQSB 3WNMA 1NCBH 4JFHE 4ORZC 4N8VB 4Q7DA 1YZZA 4YL4A 5HHNB 1N4XH 3L3HB 1GCFA 5DHDA 4P04A 2YGNA 4KNUA 3TPUA 3K80A 4Y9FA 4WFFD 2V9QA 2WLHA 4HFWB 3MRRB 5EA0H 2VLJA 2ZX5A 4X4XB 4LSSL 2I5YH 4TPRL 3SO3C 2X0UA 3D05A 2NY5H 1L9PA 2XQYG 1F1AA 4N2OA 5TE7H 4N2MA 2VDOH 1AIFB 4IRZL 5ANMA 4BFIA 4UOW0 2Y7OA 1TQUA 5IEHA 2X1OA 2VWEE 5D7HA 5EBWA 1OF2B 4BUQA 3ZHNA 3FB8B 1T6WA 3L1GA 5IQ9B 1OT2A 3KLQA 4QDGA 5EU3B 2HX7A 4LGPB 1T7XA 3PWUA 3BWZA 1I53A 3QJZA 4J4PD 4LP8A 4JPIB 6CGTA 4WJG3 2VERA 5HYIA 1JYNA 1MHEA 1PPIA 4GKLA 2AW2A 4U4BA 4XXWC 5IMKA 1BJ1H 4WFHE 3LEYL 1JS4A 1QOKA 2EIZB 1F11B 1RP9A 2E7LA 3NJLA 3X12B 2IFFL 4RAHA 5SWZB 3HNTH 2AEIT 2R83A 4L4VE 5GJSH 3HE7D 4QTIH 2GTZB 3RWDA 4KK6D 2FR4B 1RZGB 1QFUH 4AYBA 2OR9L 1G1YA 4Y9BA 1RMFH 3FCTB 1LWHA 1JWMA 2X41A 3MFGB 4YUEH 3BAKA 3BCDA 4FHBD 3ZKQD 3QQNA 2LAAA 3SPVA 3BKJH 2E6PA 3L48A 1XD1A 4N2DA 1C7TA 2WKGA 4ABVA 3UJIH 3F85A 5FO2A 5EC1A 2BRRL 1XGYL 3T3MF 3O6FA 2KZ1B 1BMWA 4N0UA 2HAZA 1CYGA 1M4KA 5FA3A 1X6NA 3EO9L 2DQCH 3NTCH 3V5DB 1BJ8A 5KVMC 2Q9OA 3GMOA 4P2RD 4QGYA 1SOQA 3ZX1A 4KO7A 4GXVL 3V0FA 2I9TB 5IEKB 4OSUL 1CDJA 5LWYL 1H3GA 4M6ML 4GQRA 1OAYL 1F86A 4F58H 1XCQA 5T1JA 1E5CA 1YEFH 5E0QA 4XRCA 4KWUA 4YHPA 4K8RC 3BZEB 3A21A 1I7TB 1UZ6F 2A4EA 2JXMB 3N2JA 5C2UB 1GGCL 1YNLH 4WUUA 4PB0L 2J5LB 2YXWA 3DPDA 4ZUVA 5F1NA 1BBDL 5DJ8B 3N1PC 1TEYA 1QKZH 3MNWB 4H1LG 4YDJA 1TFPA 2P8MA 3JUYA 1KIRA 3CSYA 3UTQA 3G08B 4BH7B 4RETB 1G1CA 1AGFA 1FG2B 2P8PA 5JO5A 2IG2H 1RLBA 4AH2A 3NPSB 2WTOA 3MSPA 5TDNA 1MPAH 1UCBL 3GSUB 1U91A 5IKCA 2XC8A 4YHNA 3UTZA 3GJEB 4WWID 3WNLA 4RFOH 1WT5C 3ZDYF 3BC9A 2GABA 4E9SA 5E8PB 2A1WL 2GSIB 2YPVA 2DLGA 3KPRD 4N2EA 4FYQA 3TVMC 3QNZB 2WBWB 3N42B 1M05A 1HCFX 3VI3E 2UX6A 3GSOB 4OF7A 2CNYA 4J4PC 4NN7C 3HRZA 3VA6A 1U41A 1MI5D 4KO9A 5FYLD 5AQ0A 2FECL 5CMAB 1GS8A 1OALA 2F5AH 3N40P 1OAQH 3G5VA 4WI4A 3B1UA 1LQBC 4ANWA 1UYWL 4FXGC 5IP4A 3W5NA 2AMUA 5FYJL 3GKZA 1KTBA 2DOCA 2WN2A 3ULVL 1J88A 4NNPL 2VH5H 2R56L 4JLRA 4JFFD 3HE7C 1MCDA 2F1BA 2WMPA 2VUOA 2XG5A