4FL4B

Scaffoldin conformation and dynamics revealed by a ternary complex from the clostridium thermocellum cellulosome
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
165
Chain Sequence
ASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 9
publication title Scaffoldin Conformation and Dynamics Revealed by a Ternary Complex from the Clostridium thermocellum Cellulosome.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Protein binding
total genus 35
structure length 165
sequence length 165
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fl4B00
4IU3A 5G5DA 2W1NA 2VO8A 2JH2A 4UYPA 4IU2A 4UMSA 5K39A 1QZNA 4WI0A 3BWZA 1AOHA 2CCLA 2Y3NA 2ZF9A 1ZV9A 3KCPB 3L8QA 4FL4C 4U3SA 5AOZA 2VN5A 1OHZA 4FL4B 2BM3A 3UL4A 4DH2A 1ANUA 2O4EA 3F2LA 3FNKA 2OZNA 2VN6A 5LXVA 4UYQA 2B59A 3KCPA 4WKZB 2XDHA 3GHPA 1TYJA 4N2OA 1G1KA
chains in the Genus database with same CATH superfamily
1X5YA 4GEJA 2QKIA 1PQZA 2XVBA 3Q1EA 1F56A 2GSGB 1A21A 3AMKA 3QEQB 1KWKA 2JKXA 1RZPA 4DHLA 3BIKA 3PLYA 5BW7C 1HSAB 5JXEC 2MPAH 2GI7A 5IVOA 2OZNA 3T4YA 4OD3L 2PPFA 1G7JB 2IFGA 5I1DB 4ZFOB 1LO3H 3REVB 1L9NA 2RA1A 1F8TH 3QHZL 1IZJA 2ROYA 3ZLQC 4U33A 1KCWA 3FCBA 1GGBL 1E4XH 1KELH 5IMOA 1KTCA 4MAUL 3EYUL 2R1XA 2GK0A 5HVGB 4XO8A 5FA4A 1G9NH 2WIMA 5AZ2L 4YZFE 1LDPL 1THCA 3MBXL 1KB9K 3CPUA 4R0LB 3GSVA 4UDUB 2BNUB 4V1DB 4QJ5B 3N3EA 3RWCB 1MHCA 3OTTA 4TNEA 1J5DA 2YWYA 5CR8A 2Q7NA 3T3PF 4F58H 1EJFA 1KXVC 2X6MA 2BRQA 5IEHA 3QI9D 4TNVK 2VABB 5E2VH 5IGXL 1P4LB 1XIWD 4X8JB 4YBLC 2F5AH 4XNAA 3ARWA 1OGTA 4K71C 1EHXA 5GS2H 3T65A 4DERA 2XZZA 2NZ9D 3C75A 1J48A 3LZLA 2CCLA 4JGUA 4F93B 4O02L 1EIBA 1PZDA 3RNKA 4N2FA 3TPKA 3EKCA 1F1DA 1KJ2B 1NGYA 1NUDA 1UD2A 4RAVA 1DFXA 3UPRB 3FOMB 2XPZA 2ZCLH 1N5AB 5EOQH 2ZOKB 5B7EA 4B95C 3DMMB 2HKFH 4PJEF 5JDSA 4C4UA 2ATKB 3LXBA 1N19A 1HH6A 3BHBA 4CKVX 2H0PA 3A23A 4PJCA 4PV8A 4TSCH 3VFTA 1U8MB 3EYQD 1J5OH 5D6CB 4NQVB 3ZE1E 3MRQA 4J28A 4NWTH 4MX7B 4P5MB 1DQLL 1OWWA 2HTLC 2W0FA 5I23A 4FI7A 3PL6A 3VFNA 4QRSA 2BVYA 3MX0A 2ZX7A 2D2CC 2FX9H 3OKMB 3O81A 5KBMA 2DDQL 4L48A 1N7MH 4BINA 4LCYA 2IDTA 1TLMA 3ARDD 5DFVD 1E8ZA 4P2CG 12E8H 1A6VH 1XB8A 3UBXG 4GQZA 3U7WL 1DQML 2O5XL 1ZTXE 2C9RA 3IWVA 2PWGA 1DJWA 1TJGH 3C6SB 1OCCB 1HHIA 1OCOB 1RJZA 3LMJL 3Q9PA 1D5BA 4XBGB 3I85A 4TVPH 3ZKND 3IAGC 4IBVA 3HW7A 1JD9A 5DK2B 3QIBA 3RY5A 4FFWD 4OY9A 5IHUH 5LN8A 3RWHA 3B37A 3K1DA 4LU5L 3X3GL 1ONQB 3OHMB 5IZ7A 4JN2A 4XMKH 5FIEA 3Q5TA 2QTEA 1G1OA 2EUZA 3KLAA 5LNEA 1CWVA 3TEUA 1VFMA 1H3PL 1TVBA 3P0VL 3KYMB 4BCXA 3DYPA 3RVUC 1DL7L 5FKPA 2VLJE 4QT5A 5TDOA 1DE4B 3C6LA 4LVNC 4PJHF 2XQ0A 4QXGH 2BCMA 3CDGA 2MFNA 3SE6A 1RMFH 3Q43A 3PQYA 5E24E 4KXDA 3LHPL 4BK4A 3RIKA 4IQHA 1JDCA 4Y1AE 5D7EA 3DGDA 4A37A 2PCPB 2AJZA 4HWZB 3JWOC 1A64A 2V2WA 4UBDC 4E68A 4OF0A 5I73B 5IR1B 2GJZA 3W81A 1RJYB 3DJSA 3T2NH 3Q1SH 2CLVA 3ARRA 4K23H 4PJ7E 4BQ8A 1DJHA 4ZOEA 4XNZC 5CIPB 4ENED 1RHFA 2OTUA 5D7IA 3BXNB 1USZA 3DVGA 5DHYA 4OZHF 3DIDA 2ZP0T 2VYRE 5I6PA 2J55A 5BZWB 5BV7L 4QYOB 5T8IA 4OI9A 3SDDC 1KIRB 1NDTA 4K3EL 3U2JA 2OL3B 5FYJL 1PCXA 1TQUA 3S2AA 4UNTA 3NZ8A 4N2BA 2GIXA 1ZA3B 3K8KA 3HZMA 4FQCL 4TL4A 3UAAA 4WGKA 2WXQA 3NSYA 3TBVA 2VQ4A 3MZGB 3RIFF 3DGGB 3TA3A 3O8XC 2IEPA 3G9VA 4QXWA 5F3BB 4GP8B 5F1SA 2G60L 4B3EA 1NMAL 3FB6B 1O7DC 2W0LA 4IRSA 3HRZC 3SPGA 4LQFH 1BFSA 2CU9A 3NFPA 3RDJA 5G2NA 2FT7A 7CGTA 3QFGA 3QUMB 5JHBA 5CUSL 4PJ9D 3SE8H 4E9TA 1IKFL 5SWZA 1GZQB 4ZW3A 1NGZA 4KY1H 1DSYA 4TTDC 4OF7A 4RMBA 4MD4A 1CXHA 4YVUA 4KWUA 2ZPKH 3M8OL 4FC3E 5IB5B 4JQIL 4KDTC 1DEEB 1OLLA 4XB8A 1I85C 4MDJB 4UQAA 3KYKH 1A9BB 1BZDA 4MQXD 4OCXL 5DZVA 2VMJA 2DQHH 2AEIT 5IB4A 1AHKA 3L7FA 4JG1H 5FO7B 1RHHB 3WAKA 3L4UA 2P5WD 3UP6A 2X70B 5JYLA 5LCVA 1JYWA 4U1MB 5CILH 1DO6A 2EXWC 1D9KC 3UBFA 3WU1A 4W81A 3MR9A 5M7QA 4F33A 1M42A 2DV6A 1ZT1B 2EUVA 3U82B 5C7XL 1S9VB 3JYCA 3QWRD 1JZJA 3WY3A 5I0VA 2Q5BA 1KXQA 3FN0L 5HGAA 5DJ6B 1FZOB 2D0GA 2XCMC 5DJDA 2HAZA 2BVTA 1XGYL 4D9QE 1FBIH 3HAEB 4H88H 3VRIA 1C5DA 3UJIH 3OHXA 1MI5E 4IGBD 3RJOA 3V4UH 4EKXA 3BZDA 4F7EB 3BQUC 4OBSA 1HI6B 4LGPB 3R06A 1B0RB 4U1GB 1UWFA 2HKHH 4N9GB 2ZCZA 4JZJB 3N85H 3LKOB 1SEQL 5B39B 4R9HA 3U0TA 4IDJL 1CFQA 3D50A 1IEBB 3VXMA 3UX9B 2J8UA 4NN7C 2XWRA 3VFWB 3BGFC 5D2NE 3CVHH 1R5WB 4MJ5A 4RRPA 1IMHC 2AHIA 2WVTA 1ADQH 4EN2A 1XEUA 3BP4A 3NQKA 4NUPA 1U8LB 4I77H 1P5UB 2PCFA 4ODTL 3HFML 2B20A 3U0PA 4OI7A 4P23B 5JZ7C 4XP9H 1H3WM 2EXTA 5IBTH 1UENA 2KL6A 3HOGA 2CR0A 1MFDH 1UOWA 1TZGH 3AU0A 3OAWA 3SCMD 2VLJB 4OGZA 5INDB 2P28B 4OM1L 4ONFL 4BK8A 2XFXA 2DYRB 2CM5A 4I9WD 1MJ7H 3IVKB 2BXYA 3MCG1 2PP7A 4LP8A 2HT4D 2WO2B 5I1LA 3NIGF 2DJUA 1M56B 1CFNA 1JPFB 4X6EA 2GY7B 3DOHA 1GGYA 4K8RL 4X7SL 4Y1AB 5BW7A 1MXDA 5JXEA 3BYYA 4OZFA 4E36A 2AEWA 5BMFH 4WHYH 2J5WA 5FYJD 1IQDA 3BSZH 2JCWA 1BECA 3TZVB 1SZNA 1VEMA 1DVTA 1FSKC 1WICA 2F68X 3EOYG 1BLNA 2CK2A 1AHWA 3LQAL 4WWKB 1P7QA 1S3RA 3C5ZD 3D09A 3HHSA 4JL2A 4ZOCA 1JSYA 3H0TA 1IAKA 1FH2A 1QTSA 3NT0A 4R8WL 4JY4A 2IBZY 5L2JB 2BDNL 4BJLA 3PWVA 5HHOD 4XBPA 5G4MA 2OYKA 3GMNA 3QCVH 4Z8FH 1ZLEA 1WBYA 1KY6A 3BZ4B 1MFMA 2WTRB 2OI9C 4N0UE 3WGVB 1IC5H 3I6LE 4UT6A 3S5LA 1P7HL 1LGVA 1KXVA 1INDL 4BHUI 3K2KA 1MVFA 5FA3A 4NZDA 4B9ZA 1SYVB 4D0CB 1KB5H 4MBRA 1VACA 2WZAA 1C12A 2ZP9A 5ICZA 2A9NH 3LKRB 4FG6C 1VCAA 4AT6A 3AS2A 5K9KA 1MOEA 4OCYL 4MJHA 4KI5E 5I19H 2ADFH 3FCGA 1ZPLA 1OLZA 3GSXA 3CDFA 5DR5H 5C0CD 1A7RH 4PJXA 3NPSC 5EU4B 4QTIH 1K9TA 1X5LA 4LLWB 3BPLC 3MSPA 2DQUL 3FTWA 4JHAL 4LNRB 2NX5E 1EHLL 3F83A 2NCMA 3EZ8A 4H5SA 3U7YH 2YS4A 3N40P 3O3AB 4L37A 3FO2A 4Z3FA 2G5UA 3BP6A 5KG9A 3PAZA 5B1CA 3OF6D 4L9LC 1L9MA 5EU6D 3AG1B 4HMDA 4IRJB 4ETYA 1H6FA 4JMXA 1D5XA 1U8HA 1P4IL 2DAVA 3KXFD 5D5MA 2NCEA 3PPSA 1A6PA 2ADIB 4Y19B 4BRJA 4LXFA 5FGCE 1PX8A 5HGBB 2UZYA 2LOEA 4KX7A 1JTPA 5DMGD 2CIKA 2ZCHL 5D2LA 5J1AA 3BDXA 5HI5D 3VG0H 5CGBA 5D1QD 2KT6A 5BOJA 5C09A 1BQUA 3RTLA 5CFHA 3ZY7A 3OLEA 4YEEA 1N8ZA 43CAA 4HIEB 1T2QL 2WGXA 5KSUB 1QFOA 1T7YA 4HZLA 3GBEA 2NYYC 4GSUA 4UAOB 3V55A 3FOLB 5TDPB 4GO8A 5HHVL 1E27A 3SE4C 1OKEA 4CC0A 5LGHH 2DL2A 4YK4C 4M02A 1I9RH 2WPGA 1REIA 3ZTJH 3KM1A 3GRWL 3BH9B 3APFA 2C3GA 3DSFH 4QOKD 4CSSA 1HOEA 2NT1A 3LXCA 3V4PL 1IGIH 4LSQH 5F7LB 4TLKA 4ZD3L 4YN3A 3LIZL 1FZKA 1SEBA 2R9HC 3B2XA 4KRPB 3LKSB 5D2NB 1JNNH 1I1RA 2HRHA 2Y36L 2RGSA 1FZMA 5K1NA 4JFVA 4HG4J 3BZEB 4R4FL 3ILQC 2Y7QB 2Z7ZA 1A3RH 4WFHD 2JIXD 1EGJH 3EGSB 3EYFA 1H3UA 1E30A 3QCUL 1V10A 3DSNA 3LS5H 5ID0A 3QRFM 1UJTA 4JDTH 5I71B 3C60B 2CGYA 3ZN6A 6CGTA 4YHNA 3ZL4L 2AANA 2HT3D 2IG2H 3ATAA 4X7TB 3MCLL 3K2IA 3ZSSA 3HA0A 3S4SB 5JPNA 4LSUH 1E3ZA 1JTTA 5F44A 3MLZH 3O2DA 3MYZA 1TVHB 3K5RA 1EV2E 1W0VA 3MRDA 2R29L 4XCFH 5F89B 5CCKH 5JHDD 1S7WB 3ZU8A 4ZMOA 1MWAB 4MA1C 4WUUA 3CN4A 2M2DA 2F7IA 4X6FB 3MC0A 1JNLL 1S9YB 1VJSA 2WGNB 5EZJB 4PREA 2ZJSL 1NAKH 1PKQE 5LAXB 1KCBA 3D8MA 3E6FB 2XZQH 3NJHA 4PRAA 1IIKA 1NIDA 3ALPA 3O8XA 4XCYB 5BRZA 5F9WB 2WLKA 5K39A 1XT5A 3CH1A 4WV1C 3QPQC 6TAAA 1J8HA 3BEWA 5AVTB 1YECL 3HRZA 4KROB 1H8NA 2VR7A 4DGIL 4QY8B 1JVKA 3OKNA 4K3DL 1Y6NR 4WK0B 3C9NB 4AX3A 3PV6A 4WWOA 4YZFF 15C8L 1XD1A 4R97B 4JM2C 4N0UB 3QH3A 1AD0A 2L7JA 3JV4B 5FR3A 3NFSH 1SYSB 2B1HL 1DBJH 3WHXA 3EAKA 4NIKB 4OJYA 2IPTH 1BQSA 1BZEA 1IBGH 4M7ZB 1I85A 3BDBA 2FSEB 4RX4A 2VWEC 3DO4A 1XXFC 3TBTA 4AIZB 4JDZB 1IGFH 5I15L 2OX5A 3N0AA 4F7MB 3MRNA 2HFTA 3TPUA 3CBKB 3MN8A 3NOIA 1NCDH 3UTSE 3D51A 3IN2A 4POZC 5CCGE 1D9KA 2ENSA 1KYUA 2A74B 3PY9A 4X6DA 1K5NB 1MFEL 2QKSA 2NY2D 1E9OB 2VRAA 2Q76A 3GD1C 3RX5A 3ARGB 4UTBH 4YFLF 5AVUB 3D07A 1MZYA 4N25A 3U1SL 2FWUA 2NX5B 5CU5A 1E3XA 5D1ZD 3S34L 1ERNA 3FULA 3EG9A 2TRHA 1E6JL 5GS0H 3GJEA 1RULH 1MY7A 3J8F7 4GQ9L 1N4XL 1PSKL 4JY5H 3ZE1F 4ISVA 5GRJH 3EO1B 2Y7LA 2DLFL 2V3EA 4AL8L 4PJAE 3BQUA 1ZHKA 4HS8L 2V5SA 2H2PD 5IBUB 2P8MA 1KEMH 4LVOB 4OF3A 4I0CC 4NRZA 4CILA 1BVLB 3ULVH 1G0YR 4NOBA 5J4MA 1NBVH 2XWDA 4B9GA 1ID2A 3VXPB 4GS7B 3MJ7A 4Y88A 2B77A 1J1PH 3LEVL 2ODIA 2V2TA 3WGUB 1RD6A 2QVIA 1T22B 2ORBL 1G6RA 3MCKB 5AW1B 4OI8A 3WDJA 3F6LA 3KVDD 3F12A 1AI1H 1OGPA 1QFWM 2EECA 4D8PA 3QFDB 3L5XL 2FJHA 3I2CH 4NFDA 3WUWB 5LNGA 2D7NA 1D2PA 2YEQA 5DJYB 2A4EA 1I7RB 2XJLA 5F96L 4HPYH 4ZZFA 3IMRA 3HN8A 3GMLB 1YEJL 1QHOA 1ETA1 2JB6A 1MQ8A 3QI9B 3WFDH 3BZFB 1E4WL 5LGKA 4LPVA 4DK5A 3U4KA 4G6FB 5EEWA 3NH7L 1M7XA 1XIWB 1YNLH 4ZFZA 4RGMC 3ELQA 3H9HB 4FZ8L 2ZOWA 4Z7VA 1I8AA 3RL2A 4OTXL 4FLQA 5L9DH 4FL4B 2AEQH 4PPTA 4RNRB 4U1IB 2FEJA 3SGKC 3EHBC 3K4ZA 4ZTOL 4U7SA 1JAEA 1YY9C 4H2AA 1PF3A 4WFGD 1BQLH 4WTXA 4ZK8A 1NCAL 5D93B 4F1ZA 4JDVB 4Z3JA 3TYFA 3DXAE 1Z9NA 2WB7A 1IKOP 1KPUA 1A1NB 5IB1B 2AC0A 3WLBA 2WLJA 5CGMA 4AENA 1FJ1A 1V3KA 5IW1B 4KUCF 3GMOA 3WE1A 1OP5H 3L54A 4OCSH 4PJ7F 1WHOA 3A22A 5T1DL 4HSAC 4YE4L 3L5JA 3FQ1A 4GEIA 3TS8A 4QHNA 1MIEH 3Q05A 3ARDB 4OLXH 3LNIA 4XN5A 5KYUA 3RL1A 1X5IA 4XB7A 5TDNB 4HUCA 4TXVB 4X6CA 2YC1A 5E99H 1A7NL 1PKQB 1JVLA 1YEHL 2DJMA 1IM9D 1BP3B 2M26A 5LBGA 4LASL 3WIHA 4ZUUB 3QIWC 4AZ8A 5KOVC 3TFKC 3C5SB 5CINH 1JFQL 5DMKB 3DJTA 1LE9B 1U3HD 3MRIA 4F9LA 1IX2A 4WAFA 3DK2A 3GHBH 3M46A 4JGJA 1JG9A 4YQXH 4WW2F 3TBWA 2W1NA 4WWNA 2BRRL 4YDLC 4U6HA 1MHPH 2VW7A 2XZCL 3V5HA 4XWGH 2GCYA 2GJJA 5ESAB 1W80A 2UUDK 3O0RL 3OX8A 4PW3A 2PWDA 4W9DC 1ZGLM 3BLPX 2FSDA 4YPGB 1NUNB 3TT3L 5E4AA 1TETH 3HR6A 5E9DE 3VE0A 4FXKC 1MCBA 4M8VA 4L1HA 3R1GL 5FM8A 1P84K 2PMZA 5KVDE 1A9EA 3F05A 3VGHA 2QVKA 1OWRM 4L4TD 3HJ0A 2YXFA 3UTSB 5I8EB 2BY2A 4ALAL 4IU2A 4AITA 3LRLA 4NZ8A 3F7VB 4L9LA 4CNIA 5LWYH 4TQEL 3HLKA 2GAZA 5A6IA 2XY1A 5ICUA 5IJVA 4YBHA 4AQEA 1F6LL 3P4OB 3HE6C 1I8KB 3D2UB 2ZX5A 3U9UB 2H8PA 1DZ0A 4L5FL 1FNSH 1KCUL 2GT9A 3D3VA 3LH8A 3MV01 1A4BA 3L4YA 5IOKA 2MKLC 3G5ZA 5DLML 4IKJA 1G7PB 3M88A 5TF1H 3U30C 1I1AB 4UQ2B 1LMKA 2AQTA 1AD9A 4B7IA 2VL5B 4NERA 2OSYA 3BWUC 3E8VA 1KPRA 1LD9A 4A7VA 2GC4C 3ZDYE 4KKRA 3OGCB 3MTRA 3MLWL 3QQ3B 2DD8L 1JZEA 3CN2A 4PJAB 5JXAL 4EEEA 2XG4A 4FCHA 1BOGA 2DIEA 3FKUS 3SE4A 3VSUA 2KZWA 2OZ4L 3ZO9A 3RFZC 1S5HB 2C9QA 5EU3A 1RSFA 1WTGT 3I6KB 5EO1B 4IEFB 1G9NC 4U6TA 3RZWA 3WOVA 3HPLA 5J11C 3ARYA 3M1CA 1L4IA 5C0JA 4ZODA 4PBXA 3S3JA 1TJIL 2RHEA 3D18A 3OKDA 5HPMA 4YHOL 4PIBA 4PWFA 2V5MA 3UTQB 1S7RA 1JJUA 4EIUA 4V33A 4JK0D 3H9SE 3CMGA 3UG4A 5ALBL 3LN4B 5E8EB 3FHQA 4B9FA 1GSKA 3Q3GA 4A2GA 5A1AA 4RBPH 4R26H 3KLSA 3K81A 1TLKA 5F7UA 4EBQL 3NDZE 3DRQA 2P5WB 2WLLB 1DLFL 4KQ3H 3L7EB 3ESVF 3AS3A 4RMQA 4L8SB 4PRHE 3P40A 2NR6C 4Q6KA 4XPGL 2IPKA 4Q7DA 4HZAA 4WU7B 3KXFE 1EO8L 3WN6A 4FNSA 1ZSDA 2H1PL 3FT3B 4M1DL 3Q7JA 4PH8A 4S1QH 3KGSA 4JDEA 1PZSA 5E8PB 1F4HA 2HVJA 4CMMB 3RWEB 3IMBA 3KWVA 3IU4H 3EJRA 1HIMH 3GPEA 1QSED 2W38A 3MODL 4WV1A 4X7EC 2VC2L 1FYTE 1UJ3A 2YK1L 3EOAA 2EVGA 1E43A 4IGBB 3QZOA 2A83A 4LIQL 4DPBX 2DLHA 2AK4D 3TO4A 1OW0C 4UQCA 3FBQA 3OL2A 1X5JA 2CKBA 3P2DA 5DWPA 1JXJA 4RIRB 2P5ED 5IFHL 4DKFL 3JVGC 4JM2A 2A6JA 1KNOA 3W2DL 3IJ7A 3IPBA 1SRDA 1TZHB 2XJKA 3IDGB 3MDJA 1MJ8H 3SY6A 3RWGA 3RTQD 5I17A 1KGXA 2YD0A 2JKRM 2NY7H 2F1BA 3AITA 4IIZA 4YR6B 2YGNA 4KY2A 2E9BA 3J7HA 1LK3L 2ZKHH 1CU4H 1B3IA 1SVBA 3MV7D 1ZS8B 5GRVK 1COBA 3KEHA 1T2JA 3CHOA 1X5HA 2BZCA 5EOCL 4OLYL 4XPHH 2V17H 5IQNA 3DIFB 5JQ6L 1G7HB 4MWFA 1XGPB 2MWCA 4KI5F 4P2OA 2FQDA 2BOCA 4G6AC 2EO1A 2FECI 4P46B 3MJ6A 1T4KB 3Q6FB 1YCSA 4A55A 4OIFA 5F72S 1T5XB 4ZPVA 3B5HA 4KO5A 3RU8H 1QFUH 4LF3A 5JA9A 4P4KD 4MJJA 3JT2A 2VDMH 1NL0H 4GAJH 2G5RA 3NG5A 1JI1A 2J6EL 3NIFB 5A43C 2EE3A 3M45A 5BV7B 7TAAA 1UEYA 2FEDD 4JFFE 3SDXE 1F5WA 2VH5H 4NO3B 1YMMD 2FHFA 1QZNA 4ZYKA 1XGUB 3TO2A 5M94B 2ZYSA 4CVXA 4TS6A 3HLAB 1D6VL 2FJSA 1FIEA 3CBRA 4Y2OA 5CIPH 3MGOA 2WIIB 1QBBA 3WV0A 3PP3H 1NFIB 1NWPA 4OH2A 4ZI8A 1CICA 3ZDYB 4XNBA 3UAJC 1MUJB 4X80H 1RJLB 5A2AA 5CD3A 1FDLL 1NDGA 1INQA 1QUNA 2YXWA 1CD8A 2X4UB 4AIEA 2QPDB 1XX9C 5EZIL 4J8QA 3U1QA 2HFGH 3DRTA 2OYPA 3PS6A 4TL5A 3SQBA 4BYHA 1MQKH 1AQDA 1BBDL 1U36A 1AS7A 3BP5A 3GMQB 4OD2B 1IT9L 1SM3L 3HVNA 4MA8L 5IHWA 5BPPA 5L6YL 1GPOH 1CGYA 2Y3AA 5HGHB 5AW6B 3QUMH 2NXZD 4PY7B 3DETD 4JE4B 1NBYA 1RP9A 5CLYA 2XV3A 4HHAA 1UD4A 3D34A 4AVHA 5EF2A 2IH3B 5B1JC 3NP4A 3SKUD 4UOZA 4K3JH 2BNRD 3SGKA 5LO7A 3GZKA 2OMVB 4Y9BA 4DCQB 1O7SA 1Z7JA 5TK2A 3ZE0E 2KDYA 1CD1A 2D7OA 2Y7NA 1XF5A 3BO8A 1OAXL 4RISH 1Z5LA 4LCVA 2IC2A 3QS2A 2C1PA 1L0QA 1NSNH 1QBML 2X9WA 2ZKYA 4KUZH 4MMZB 5AEAA 3W11C 4PRHB 1U8PA 4NQTA 4JG5A 1KCRH 5IVXB 4PTUB 2JB5H 4HBCL 4YEFA 2B2XL 1CGUA 3KXFB 2D8KA 4KKCC 5ILTL 5J1SC 1OGAD 2YEZB 4GG8B 2E9IA 2J88H 3X3FL 4MNQD 4PCKA 2VB5A 1JI2A 4F8NA 3TF4A 3QPXH 1FVCA 1KLUA 1XGTA 3QIWA 3VXQB 4RMSA 3HAEH 1JF1B 1JXKA 1RPQA 3UJTH 1FYTB 4A7GA 1AKPA 3PWPD 2H5UA 3CVDA 2CJTA 1A6ZB 3RY4A 3AY4C 3UO1H 1GL4B 4JKPL 2P5PA 3DX9B 2E7HA 5FCUH 4ZX6A 3KLKA 2F8VA 2NUTB 5F1NB 3IDJB 1CBVH 1ZANL 2P9RA 3AREC 3M07A 3PPEA 5JIKA 4K7PH 5ADOH 4JRXE 1T83C 1UM4L 1FIGL 3GBNH 2CRMA 1NCTA 3ESUF 1IV8A 3QA3B 4EZKA 4FXKA 3U2IA 2XG5A 5GJTL 3RUGE 1U2HA 2X1OA 3D0LA 4BZ1L 4ZNEE 2OMNA 4NKOA 2WQRA 2A0LC 3FXIC 4LHUB 1CL7I 1XSKA 4Y5YC 4NB7A 3LSOB 4NN5C 4M62H 4NHCL 4LSTH 3FRPA 4YMPA 5I6OA 3KPTA 4L1SA 5JW4M 1JHLH 3N91A 3NK3A 3DBSA 4GH7B 3D06A 3FO9A 3T0BA 4HPOH 1FFNB 2C3VA 4N0YH 3UTZB 5A3IC 5BO0D 1CFTA 2XC8A 3HE6A 2FNBA 3SOBL 3BE1H 1G1KA 4UV4H 4WFGE 4EIGB 1NMCC 3BZ5A 1VRSA 3OAUL 2ZSVA 4ZXBD 3BAXA 2YQ3A 2JLPA 4YXHH 3CK0L 3VXRD 1ZIAA 1WGOA 3ARBC 3RGVC 2PABA 2W9DH 1XHHA 1KYAA 3BPCA 5D9SA 4JJ5A 5JHDB 4YFLI 3P0YL 4L23A 1Z9SB 3BH8A 5T33L 1LP9B 3DJRA 4P3WA 3GSOA 5ESVA 4PJAF 4GG6A 4UQEA 1H3XA 1UB5A 3SDXB 2FH6A 1PX4A 4GAGH 2NNCA 5JNYB 1F58H 3CN1A 3RFZA 2G2RA 2V9QA 3B7TA 2BSED 2BVEA 5KW9L 1U58A 5HY9B 2RIKA 3U4BL 3UJJL 1XMEB 3BKMH 3B9DA 5EBGA 1TQBC 5C3LD 1AZBA 3TVMC 1R1CA 4ATTA 2PO6D 4XT1C 3VO0A 3GRBA 1JK8A 2QADC 3NUKA 2QQKL 5H35A 5B3NA 2YBRB 2OMUA 1L7IH 1S46A 5BZDB 4Z7WA 5DUJA 5L8JB 5EULV 2VOTA 3PGFL 4P2RD 4ZUTB 4MXWH 5MERB 5A16A 3L95A 4KPHL 1SVCP 3GMPB 3EJZC 1YYMH 5FUZH 1XCTA 1Z0NA 2R4SL 1OARL 3QR1A 4Z0XA 3WJMB 1MRCH 2AEPL 2AABH 3DX6A 4WFFD 2PXYD 5TQ0H 5HYSA 4MB5A 4YIQA 4G6KH 3W9EB 5JA8B 1UADC 1K6QL 3OKKB 3QQ9C 3ZHKA 4NZJA 4L3CA 4MA7H 5AVRB 3P3UA 4FE9A 3DBXA 1FVDB 3IDNA 2NR6A 4B9PA 1IJNA 5DJCB 5G4NA 4AEIL 5I1IH 1Y0LB 3BVUA 5FB8A 4IU3B 1CQYA 1DDHA 4LQ1A 2BOBA 2ICWA 2NY2B 4RMUA 5JHLH 4I18B 1XH1A 4XMPH 2EZ0C 1QHPA 5T3XE 3EIFA 4OV6F 3L3IA 5EZOL 1DLHB 2ZUYA 5F7DB 5FK9B 4MMXB 3FUKA 4Z7UE 2HKAA 4S11A 4ZUWB 4DZ8A 4J12A 3WLWD 4GW5A 1L0YA 2H6OA 3GXPA 2YPKA 3S48A 1AZUA 1KCSL 3CGTA 1ZHNA 4AWJC 3ORJA 1NKGA 1Q9WB 1VEPA 5I26A 1UTDA 1KYOJ 1QW9A 1OW0A 1S7VB 3PJSB 4YAQB 2ZUWA 4YWGH 1NFDB 3BVNB 4JRYD 4UM8A 1CVSC 4XRCA 3V0JA 1BA9A 3JVGA 1A47A 3KPOA 3LY6A 4RQQA 4B0MM 3V0VB 1ESOA 3FQYA 3LDBC 1T0MA 3MLSL 2AJVH 3SKMB 2VDLL 5TGBA 1J05A 1DCLA 1E5YA 1HVXA 1K3ZA 4NYLA 5A2LH 4DO4A 4G8GE 4U1NB 1FFPA 3BT2H 4PRPE 5DD3H 5H4ZA 1LEIA 1EDYA 2IMMA 3COOA 2QFPA 3KYAA 2PPCA 3TBYB 2HLAB 2WXHA 3DVIA 4ONGH 3H2WA 1HOCB 3AM8C 5DD5L 1WA0X 3KYOB 1SBSH 2ZNXA 3VXSA 1XCXA 4G59C 3TURA 1M6OB 3RWDB 2AGJL 3ZRCC 4ABWA 4D0DA 4JRXB 2DYPD 2HJLB 2EDQA 5KYXA 5LXGH 5E8NB 4ZSOA 5EU5A 1J9QA 2ENJA 3RUGB 3GXUB 2Y72A 4WSJA 2I24N 3DV4A 5FDYA 3ES6A 4ELDA 4H4NA 5B4MC 3BGMA 3OZKA 1N26A 4B41A 3GSWB 2XXGA 3J27A 4A67A 2YEVB 5AYUL 2EEDA 3MRKB 3IDIB 4HT1L 1S9WA 4NI6A 3G5VA 5GRVL 4WSKA 5K9OA 1FE8H 1VDGA 1GW6A 4PEEA 3NBNA 4JE0A 1W6WA 4XN9A 4AXWB 5IMMA 2VDKL 4JM4H 1J1OL 4UANA 1TNMA 2M83A 2WSPA 5TQ2L 5C71A 4O00A 5IUSA 1N67A 2MCPH 3LIUA 2F18A 3DUSA 3GJFH 3U6RB 2GSIA 2FEEL 3ECBA 2LT9A 1K8IB 2JQMA 3BCDA 4X4YB 2BP8A 2AK4E 3ZDYF 3EYVA 4JZOB 4UOW1 1KC5L 4KDWA 4PR5B 2AXJA 5D7JD 3HB3C 3KPMB 4ODWA 4K5OA 5KVEH 4TQ8A 1AS6A 1HNFA 2R2HB 2Z4QB 3CPLA 1TJHH 5SWQB 2VLME 4LMQE 1MCDA 3M1OA 4PAZA 5CJXC 5T1LD 4BCYA 1ECZA 3RPBA 5C6TL 3FU7A 4GI6A 4FRWA 5F71A 5FDWB 3L5WB 4PCSA 2IADB 3MUHL 3MA7B 4G1EB 4P57A 4APXA 1OSPH 1DR9A 1MCFA 3HS0C 5B1JA 3LS4L 2PPEA 5MEPA 5C07E 1PD6A 4S1DD 4NSKB 1GS7A 4UDTA 4TQHA 4AYMC 3IJ8A 1PLAA 1VFAB 4H1LG 4MJ6B 4Z76B 3GSRB 4JFYB 3X11A 1F90H 5ITBH 3QUGA 5DZOA 5IK3A 4WY7L 1CXFA 2D3VA 3MOAH 3DJZA 2XWTB 5AW8B 1V27A 3VGGA 3WNOA 3G5YB 1AO7E 4PP1C 5D1XE 1E2ZA 5CP7B 3L9EA 3ZKXB 5HJ3A 5ICYB 4FQLH 4PGEA 3EXJA 5EBWA 1OQXA 4FYTA 2NY1C 4Z77B 4IHBA 4LFHG 5GS0C 3QNXA 5GGVY 4UILL 1Q0YH 3QJFB 4ZAKD 1WFJA 5HYJD 2F5BH 3NRQA 4FG0A 4FI6A 1D7CA 4GT0A 3C2AL 5EIIA 1CT8B 1NPNA 2FIKB 2EXYD 4XOCA 3KVQA 1FCCA 4JO3L 5AKSA 4WNQB 2OW7A 2CNZA 3UBHA 4Y4FC 1QVOB 3ULVC 4QHMB 2BWQA 3FB8B 2GJ6D 4U1SB 3AY4A 4MSWA 4CN1A 2XXFA 1XZ0A 1AXSA 4I13B 1GGCH 4JY6A 3WIIL 3NJFA 4Y8AA 2FBOJ 3AS0A 1RLBA 4OBRA 3L3OC 3AREA 4GUPA 1M05A 4P5KB 3VWKB 5CZRA 3WMQA 5KN5A 1T83A 3CAFA 5HDOA 2CGRL 5IESH 1HHJB 2PYFA 1NCHA 3CVHA 3ESNA 1JZ8A 4HUUB 1JGVL 2WQUA 1ADQA 1R24B 5DEGB 4UQBA 3OJDB 2PUQT 2XA8H 3L9RB 1WS8A 2XPGB 5FW7A 1AP2B 3MGAA 5CLWA 3HE7C 3IPEA 4QI3A 5D7LD 3CZFB 3JV6A 4Y4HD 5G4OA 4WF7A 4PRPB 4M4RB 4XC1L 5HVHC 1INEH 4JG0L 3CFUA 3D39D 4I48A 2IGLA 4PMFA 4UT9L 1AOZA 3BAIA 3NN8A 2FHBA 1L9TA 1CE6B 1O6TA 3CUPA 1C08A 4Y5XB 2V8LA 2VXSL 1XR9B 3V4VB 2B59B 2NMSA 4G9FD 4NAQA 4U0QB 1N64L 5EWIL 1JFHA 3NYKA 2VMCA 2E6PA 2F7OA 4ACPA 1RQ5A 5H8DA 3AXHA 3HC0B 4HV8A 3A6OA 2HUHA 4JFPB 5EO9B 5I2IB 3ARBA 4FNPA 3RGVA 1MFBL 2AXGA 1DZBA 1FFRA 4HG4K 4DGYH 4PJIA 2GFBB 3RG1C 2XVGA 3WENA 4G7SB 2LLNA 5MEQA 5DUML 5CO1A 2VXTH 5TF0A 4KAQH 5K9JL 2BNQA 4F7CB 1JTOA 2LE9A 3IF1B 2GBTA 4NS0A 5TFSL 2GB2A 2PETA 3QIUC 3SDXF 4OIBA 4I4WB 3KAAA 4NPYB 2W9EH 1QSEB 1YEEL 1JHTA 3DYMA 3K6FA 3APCA 1NC2D 5AALA 5AVVB 2BP5M 1JPEA 2D7MA 1QKZH 3PWPE 4MB1A 2W81C 5I1GH 5KEZA 4A38A 2IWFA 3L3HB 4B7LA 2AK4B 2LVCA 2Z31C 4N90E 1I3UA 4I3RL 2P24B 2AV7B 2P5EB 4HJJH 4X99B 3C09C 4D0BA 2A3TA 2X4TB 1JWSB 3L2LA 3N04A 4JQVC 2EIDA 1KB5A 3VFUB 4JR9H 4G3YL 3MO1B 4WNJA 4RMVA 2CHXA 2J1WA 1A6WL 3W1ZA 4DVBB 4DESA 1CXIA 3L5HA 4HUVB 1EBPA 1NCBH 2YFOA 2A6DA 5I75B 1XF2A 2UZPA 5T1JA 3KYNB 4JQXA 1KZQA 1AXTL 3MV7B 2EIEA 3FAXA 4GAYB 4G83A 4ODVH 2EEBA 5BOZG 4JFED 5AOIA 2LU7A 4CGTA 2FYVA 4YHZH 1YPZE 3U79A 4RMRA 4TNGA 5AKVA 4AMWA 2Q7YA 3KGUA 4GMTL 3FFOA 5F9JA 3TCLA 3S2CA 1NINA 3KDPB 1I4FB 3O45B 3RWFB 3SPIA 3FC8A 1A1OB 3D0VA 5AWNL 2F54A 1LEKA 1PLCA 3ZE0F 1X5AA 2G3XA 2APWA 4P4KB 4ZPTB 1FF5A 5D1XB 1HX0A 2X4OA 3CXFA 2DKMA 1ET8A 3QAQA 4K9EL 1AGFA 4XN4A 4L29B 3AWEA 4MNGA 1EJOL 5BVPL 4MDRA 3X17A 4OD3H 3E9UA 3CFMA 5CEYA 3AGVA 1H3TA 2WZ6A 3QHZH 5BJTB 4QHUA 4O58L 5FHAL 1ZVHA 3FH7A 3CSPA 4G42A 3DO3A 1GGBH 3PXLA 5AVQB 3BW9B 4MAUH 3EYUH 4EUPG 3ZTEA 1VSCA 3QDME 4JFDD 3VH8G 5IROD 3LKQA 1AKJB 5AZ2H 5GGQH 1ZVSA 1LDPH 2R2EB 3MBXH 4MA3B 1KTDA 3AM8A 5A2KH 3EJUA 4Z5RA 2OMTA 3ZW3A 5BQDA 5CM1A 1A6TB 5F88B 3B3IA 4ACTA 3B7RL 3HZYA 5FYKU 2CO6A 3IGAA 5E8OA 5FO8A 3MRLA 2DI9A 1JV5A 4NPJA 2XLLA 3FTUA 1DBBL 3F5WA 4N0FA 4R0LC 3VFGH 4K55A 5I6KA 3L1EA 2WLZA 5IGXH 1WLHA 1U8JA 3RUGF 4A6YL 4QLRA 2NXZB 1EGJA 4W9IC 2YRPA 1KLGA 1DSFL 2CBOA 3BIBX 4CVZA 4YXLL 1FWXA 3QULB 4HD9A 4UYQA 3VVWA 5ISZA 5GGVL 4HQQL 4ZMNA 2AXHA 4NAMA 1P5VB 4FQQA 4H0HB 4Y2LA 1C1EL 2BNRB 3DOSB 3H56A 2J4WL 4W9FC 3T0ED 1I7ZB 4OZGB 4WZ9A 5C0GA 3D4CA 1I3VA 1HHKB 1AIFB 1FGVL 3Q0HA 3R4DA 2VZTA 3P3RA 4Y89A 2Y5EA 1CG9A 1N2RA 2ALWA 4HKXB 5EUKB 4HU8A 3EW3B 2L8AA 1DQLH 1J11A 2WNXA 3TFBA 2O6DA 2WQVA 1NCNA 2XTJD 3ZSTA 4IIQB 1N59B 4LSSL 4RAUB 5JOEA 3NMEA 3FFCE 3QHFL 3RB5A 2DDQH 4QF1B 4G1MA 3CFTA 5I74B 3RI5K 4RWHA 5JW4N 3FAWA 2B4CL 4A7QA 3U7WH 5EH1A 2J57A 4MNQB 1DQMH 2O5XH 5C8JA 3WTXA 5D72L 3U9WA 4I0KA 2R0LL 4F2MA 2CDEA 3QJXA 5F6IB 3CFDB 1SLWA 3MMEB 2X88A 1W91A 3DX8B 2X4PA 3IMWA 5DC4B 4LSPL 4WI5A 3LMJH 1AGCA 3FMGL 3NCYP 3Q2VA 2IDSA 3IJSB 3SPVB 1Z9PA 3PWPB 1AR1B 1AR2A 2CM6A 4QJ4B 4LU5H 3FSWA 5E4OA 1HTYA 2EINB 3AJ7A 3X3GH 4AUUA 2CRIA 1UKSA 2VR4A 3HS0A 2XIIA 5C0AE 1FVEB 2RFXA 4B60A 1BJ1J 2NSQA 2R23A 2X2IA 4FNRA 2KZBA 1H3PH 5ECGA 3P0VH 4XX5A 5I24A 2JKLA 5DQDL 1OXYA 4OGXL 1DL7H 1KPVB 4LGSB 2ZG1A 3PABA 4B0MB 1G7QA 2NY3C 1FG2B 1PG7W 2MEJB 3FF8A 3O3DA 1MJJB 5JO5B 4M9PA 4UV7H 3LHPH 4F27A 4HIQA 4HS3A 4JFHE 3V9EA 3V5KB 2DTSA 4UTBA 2XETA 5IP4A 1ED3B 1TZOA 3CSTA 3I3EA 3EYOA 4J1UA 4L0PB 3QJHB 3T77B 5E5MB 4HVBA 3P73B 3DO7B 4I87A 1KJMB 4BFFA 7PAZA 2MTPA 2Z3FA 1NUFA 1FL5A 3H7LA 1BIIA 2NQ3A 3EJYC 5HGGS 1SXSA 3T5WA 3VXRB 2ZICA 2CK0L 1G0XA 2WXLA 2Z7WA 4Z7UF 5KSAD 5DI8B 1UWEL 1YEIL 3D85B 4J3WA 4Y4FA 1HWGB 5I73C 2AZAA 2EUWA 4AYFA 5BV7H 4HIIA 5KBNC 3JWNE 4K3EH 2LTQB 5HDBB 2VN7A 5FYJH 1E50A 1UEMA 3O3EB 5EBMA 3ATEA 3L3OA 4BCZA 4HFUH 2VSDA 4FQCH 2FBRA 3FT4A 4DNLA 1UXWA 1MAKA 2P8PA 3VI4E 2CE6A 2WBWB 2VLRD 3S0PA 2G60H 2Y7SA 4GY4A 2DI8A 4Z9KB 1UGNA 1T0NA 1NMAH 1KG0B 4HCIA 4WU5A 3HE7A 3H54A 2JK5B 4NO2B 2GTQA 1W0WB 3QDMB 4ZQKA 5CUSH 3VXUD 2QELA 2X4QB 4GYBA 4P5TD 1UM6H 2VXVL 4NZTL 3P1VA 4ONHB 1OSZB 4Q2ZA 5AG9A 5MHSE 4ES9A 4NJ9H 2FJGA 4XHQA 3QFJA 3I50L 1NAML 1FNHA 4Y0GA 2BHFA 4JPQA 4JQIH 3P9MA 1H5BC 4NKMA 1ZLWH 2PXYB 1KJVA 4IOFD 4ANWA 3HI5L 4OCXH 2IPUG 2XQYA 1U33A 4QKXB 4XZUB 2IDCA 4KKNA 1A6AA 4PJFB 5KWYC 32C2B 1Z0MA 2ERJB 3MNWB 2PPDA 1TTUA 5JLZA 4J4PC 5HHMD 4BH7B 2XKSA 5F2FA 4M4PA 3MJ8A 3NCJL 1RZ8A 5EN2B 2BVPA 1PZUB 1ZT4A 4L1DA 3EXLA 5HI4C 5CMAB 1BFOB 3ROOA 5C7XH 5SWSD 3D69B 3FN0H 3QIUA 4FJ6A 4LCWD 1X9UA 2HN7A 4O5LL 1NBZA 1XGYH 3HI1A 5EF0A 3KPPB 3RA7L 4YSAA 4DK6A 5BVJB 4S0TD 2VLLB 2DQIH 1OF2A 4RA0C 3RP1A 2Z31A 4I8DA 2DWEA 5E2TH 4JRYB 1GH7A 1HHHB 4Y4KC 3CFBB 1UC6A 1SEQH 1FL6A 4L3ED 3ZGIA 4QNPE 2X53A 3I6GA 1M7DA 4JQVA 1OCRB 3EGXB 4IDJH 5EC1B 1VFUA 4IMLB 1DQQB 4FKHA 1OAKL 4P9HL 3GRGA 1SN5A 2FVNA 4Y1SA 4OZIA 1WEJL 3I3BA 1R17A 2L3BA 4WIQA 2ADGA 1GKOA 2Z91B 5KUMA 4E41A 2BVOB 3A4FA 3CXDL 1NJ9A 1G84A 4ODTH 3IKKA 3PAYA 3HFMH 5D96B 5C0AB 3HIZA 1OOAA 4PBWD 3QXAA 4JFQA 1BF8A 2BZ7A 3KDMA 4YDIL 2I25N 4AK1A 4UM9B 4GW1A 1Q1JL 4OM1H 3RILA 1BBJA 1P5UC 4ONFH 5HTSA 4P23C 4HC1L 1RU9L 1SDDA 2FO4B 3SJVA 2SEBB 3VRJA 3DV6B 1HJBC 5ID1A 5AVYB 5C2UB 1JS4A 1TG8A 6FABL 4X7SH 3P11H 2B9AA 4XH2B 4LE8A 4XOBA 1JYVA 3L4CA 1OTTC 1W8EA 4H25A 1U3NA 1QFWH 3CQPA 4WTZG 1EHKB 3MNMA 5AVZB 1P6WA 3FW6A 4ZW5A 4PJDE 3O6FD 2JI2A 4HLEA 4ZO6A 5F0PB 3GM8A 5GISL 4ABVA 2LABA 1EEQA 2CWRA 3LQAH 5FGBC 1LEGB 4RRPG 1JZGA 2WAQA 2BJML 5DTFB 4PI2A 4TOYL 1E5CA 2PW1B 3DX0A 3MA9L 3MLTB 2WC7A 4X4KA 4M6OL 4MKTA 4NKDB 2WM0A 3SO3B 1G7JA 2GG1A 4R8WH 3TZVC 4DP6X 4F7PB 1AZNA 2CIIA 4XWOC 2BDNH 2ZX8A 4WWKC 3QO0A 3FTYA 3QUXD 5D7JB 4R7DB 2HLFC 3BN9D 3DROA 5DYFA 3S36X 3MRCA 3VI4B 2FQEA 4FHKA 1IBDA 1INDH 4UDUA 4V1DA 2VQUA 4R0LA 5T1LB 4GQPH 3GK8H 2BOLA 1XMWA 2VXUL 1HILB 2FT8A 3PJLA 2CDFB 3BKYL 4FQHA 2HKFL 2XN9E 1T1WB 2IAND 3C5JB 4KJWC 4LPXA 1I9IL 2VDOB 4OZFG 1X5ZA 4PG9A 1KN2L 4OCYH 4HJUA 2ICWJ 3CCHA 3MNZA 5J6SA 4J3OF 4X4XB 3CC5A 5IW6B 1NIEA 4I2XE 4X8JA 3S37X 3CDZA 2P80A 1N10A 3KR3L 2WNWA 2Y6SC 3MOQA 4WW1A 2DQUH 2FX9L 4JHAH 2VDRL 4QHLB 1EHLH 3US9A 4RZCA 3VWJD 1B2WL 5HJDA 1MCWM 2Q7AA 5J57B 1C8PA 2ZOKA 5TE4L 3O6LL 3CN3A 1CO1A 4QRFA 2V9TA 1I53A 1R6VA 3JZ7A 3QCTL 1XQ4A 2ESVD 5EO0A 3UABA 1YJDL 5I82A 1P4IH 1QFWI 3LEXB 2G3ZA 2CBQA 1XGQB 4NQVA 5BCAA 4MX7A 4P5MA 3PNWA 3ML9A 4HAGA 3FZUC 4ZAKB 1KFAH 4BFIB 5IFAL 1NDMB 2ZCHH 1XCQB 4IRJC 3F04A 4OAWB 2FBJL 2VDLB 3VXOB 1HEZA 3HTLX 4G7RB 5FO9B 2PYEE 4JFDE 2GJ6B 5F7HA 4QJ3B 1RUKL 1A0QL 1TU2B 3DPDA 2XOTA 3C6SA 5HHVH 3DX4A 3WNIA 4P07A 4AVJA 3WY4A 1DBML 3X1NA 4ODXB 2J20A 5I1CL 2A1WL 1YYLL 3GRWH 4PVBA 4LK4A 3V4PH 4ZD3H 2VZ3A 1NGQL 3LIZH 4XMLL 4X98B 3V7AG 2Y36H 5D7LB 1RPKA 1IQWL 4LFHD 2EDTA 1IO4C 4JLRB 4FNQA 1QD0A 4XVTL 4R4FH 1QASA 2WVUA 2Y4SA 3AXLA 4N2IA 2WUBL 2ZONA 3IE4A 3QCUH 5C0IB 4KRPC 4B5EA 3QUYB 5D2NC 1IL1A 2NZIA 3ZPDA 1A6UL 4G9FB 4HKZB 3Q8AA 1BVKA 2COQA 4NT6B 1YPZF 2PN5A 3WCYA 3S97C 3ZL4H 5JQHC 5TH2B 1UH2A 5LUMA 3MCLH 3SDAA 4ONOA 4KKAD 3N1PC 3ALXA 1N6QL 3HG1D 2X1PA 2YRZA 4HWZA 4I1NB 4M03A 1D6EB 1KBVA 3HZKA 2BINA 3C60C 3WEXB 4FKKA 2MCMA 2R29H 1E9PB 4QUOA 3BWAA 3QDJD 4G9DB 1S5IL 2WMPA 2YD4A 5HGDB 1JNLH 1YNTB 2O5ZL 4A2DA 5CIPA 2YPLE 3BLKA 4JW3A 4PJDB 2ZJSH 3HPJA 4LSRL 1U8QB 3D25B 5BZWA 2BFVL 1YEKL 3SGEH 1M53A 3MRRB 3BOVA 3QZMA 4ZRGA 4HUXB 5T3ZL 1I1YB 2W91A 1NC2B 4JMNA 1ZA3A 4U1LB 1YECH 3HUJE 4YDVB 2CZNA 1YN7B 1ZIBA 1YQ2A 5GSVA 4DGIH 1TYJA 3FTXA 1WZMA 4K3DH 1YEFL 2WCSA 4FTVA 4ZW8A 3TIEA 2J1XA 2DQHL 4R3SB 4NDMB 2JTDA 4DN4H 15C8H 1HAWA 3FB6A 2WBJB 4KROC 1CFSA 3NCBB 4G8IA 4WO4D 2WXRA 3LZRA 3BAYA 4MRBA 1L5GB 3QUMA 2B1HH 4N3TA 1QA9A 3AROA 5E6YA 1H5BA 2P49B 3B2UD 3CDYA 1GZQA 1YC7A 4YSDA 5AD0B 5FLVA 3DWTA 2H2SD 3U36B 4OFIA 5I15H 3P4MA 4OUOA 3OKOB 2XN9B 2ZE0A 5IB5A 3T08A 4NQDD 4YDJB 5T1MA 4DIXA 4PBDA 1DEEA 4J4PA 4MDJA 4MJIA 4PW4A 2X41A 5DVNA 3FQUB 3P3SA 1RHHA 1MFEH 4KNSA 3MTXA 2DQFB 4R2GC 4R7LA 1LQBC 3MRBB 3U1SH 3KPSD 3RIFK 1ML0A 1U3YA 4U1MA 2JJSC 4BH8B 3S34H 1IC0A 3GEWB 2A74C 1A4JB 2GITB 4PGBB 1E6JH 1OF0A 3JV5A 1IB5A 4EDXB 5IMLA 2NNAB 5FX3A 3FCTB 1ZT1A 1N4XH 1OPGH 1PSKH 3ARGC 3FU3A 1RV6X 3OJ2C 1GA2A 4GQ9H 3VDCA 4AL8H 5IVZB 4K2UL 2A9AA 1FA4A 2X2YA 4XCNB 3NCCB 5ANME 2N0KA 3QQDB 1EZVX 3ILDA 1AYRA 4Y4KA 5DHVB 3HAEA 4IBWA 1QSZA 3RPIB 3GS7A 4F7EA 4PJ8D 4MB4A 1HI6A 1Q9OA 4I85A 1B0RA 2WW8A 2R2BB 4LVOC 3LEVH 1VGKA 1OCZB 4M5ZL 4PVLA 2Y2TA 4I5BB 2LLGA 2ORBH 2QGCA 3SDYL 2PYEB 3G04A 4JFDB 5CEXB 2G5BB 3PWUB 4PGDB 1O6SB 5EZPA 1KYOK 1IEBA 3BEVB 4GS7C 1HYSD 3MBED 1VFBB 2DMHA 1OP5K 2LAGB 4IBUA 3L5XH 1BX2B 4O2EB 5F96H 2V9UA 1FO0L 1JMZA 2ITCB 1L3NA 3GI8H 1U8LA 1P5UA 1E4WH 1DUZB 2ZYRA 5E8DL 3WN5B 2QSQA 2DEWX 2J8OA 3NH7H 1Z3GL 5F7EL 2ZUUA 3W57A 1ZK9A 3F7YB 3IPFA 4W9ZA 2IVFC 4UIMB 3D52A 3BSZL 4YHKL 3RZCD 2ICCA 3QQ4B 4FZ8H 1LE5B 5PCYA 5EHFA 1GYWA 1T7WA 3JVFC 3QI9C 5HHME 3PP4L 1OM3L 4DTGL 1CLCA 4OTXH 3IGKA 1F2QA 3T0AA 1XIWC 1WCBB 3NJGA 3VMPA 2WWMD 1LO2L 1MCLA 5ADPL 1ORSB 2Q86A 3D0AA 1NCAH 1QEWA 2NZ9C 3UG3A 1JPFA 2C3HA 1ITCA 4KK6D 5FGBA 4FL4C 3ZE2E 2RMNA 5DXWA 3IMTA 2XTJB 4W68A 4HCFA 5T3ZD 3TZVA 4C83A 4S0HA 5T1DH 5D93C 4YE4H 3G7TA 2X1XR 1CB4A 1J9RA 1E8YA 1JOIA 2K0RA 3EYQC 4WWKA 3WY2A 4QHKI 3SY0B 3AQXA 2K6YA 1OTSD 2YPLB 7FABL 3WTYA 1NUGA 2QVFB 3GZQA 4RDQF 2VISB 1A7NH 3DNKA 4ZO9A 5IJBC 1YEHH 3OKLB 4MB3A 4LASH 5IB2B 1U92B 2AJUL 4YLBA 1U91B 5DDHA 1JFQH 4QRQB 3O3BB 3ARDC 2BY0A 5DFVC 3VI4F 4GUQA 2EVFA 1EXUB 1T5WB 3TXAA 3APMA 5EEZA 2XU9A 2LW3A 1JGDA 2WTRA 4ORGB 3VFRA 4ETQB 4E5XA 3VD4A 4QTIL 2BRRH 2BWDA 1U6AL 2HG5B 2XY2A 2XZCH 2WO4A 4FMKA 1SF3A 1U9KA 2IAMD 3IXTA 4HZ1A 5MEND 3O0RH 1G7MB 2W60A 2P7TB 3UZVA 2B3RA 1ZHBB 4D0CA 3ZKNC 3TT3H 1KV3A 3N41B 4G8FB 4W93A 4XP1L 4FFWC 2OMWA 3MRFA 5AUMA 5FLUA 4DQOL 3B9EA 1TPXB 3R1GH 2BS71 3KGRA 4FS0A 1IAIM 4RETB 4DFIA 3NZSA 3D5OF 3GXDA 4JHVA 2BP0B 3Q5YA 4GP4B 5EU4A 4ALAH 3DUUB 4XC3H 5JHLA 4PWGA 5C0FB 2XNAA 4BSWB 2CO4A 4TQEH 1VLXA 4Q6IB 4HUWA 2G75B 4F80A 1Q9KB 2QR0A 4L5FH 4HJGB 1KCUH 3ASNB 2ED6A 2AEOA 2X05A 4N26A 1QSFE 1DTUA 1WJ3A 4GRLD 4QRPD 5DLMH 1NC4B 3UACA 4FZEL 4DKTA 5BQ7A 2CKNA 2OK0L 2LFGA 4IRJA 1QLRB 3O4LD 1WITA 1PMYA 3PUUA 4DPAX 1W72L 2A0LD 5DC2A 5T5NF 4Y19A 5KSAB 2ZCKL 5LGHL 3MJ9L 2F19L 3OMZA 3NK4A 1TCMA 3QQNA 3VACA 5HGBA 3MLWH 2DD8H 5IEKB 3DSFL 5JXAH 1I1AC 1DDTA 1CGTA 5I1EL 5IVNA 3AUWB 5H37A 4ENEC 4NC1E 4GKSB 3QC5X 4CKQA 4KFMA 3X12A 1R3KA 2R59A 4PGCA 4QNPF 3HCVA 3T9WA 4AJVA 2UWEA 4G43A 2MJWA 5KSUA 3HBQA 5TDPA 4M8QA 3U46B 4HJSA 4PQXA 3IU3A 5TE7H 4OV5A 3PREA 1CLVA 1ZLVK 4A6YB 4DK3A 2Z65C 4YHOH 4PJ5A 1UH3A 4P5TB 4YHIA 2A6IB 4Y8DC 3CLFL 1MVUB 2Q20A 4LPYA 3QIBD 3VFPA 5ALBH 4LMQI 1BG1A 1IM3D 4GB9A 3BZEA 4PJ9C 4NX0A 2RQEA 2FWLB 3TNNA 3BIAX 4ZX5A 4U6YA 3ARVA 1KGUA 1KEGL 3RNQB 4EBQH 4DSYA 2IOMA 3JBG7 3ZDZE 1PYWA 1DLFH 4K7FB 2YR3A 4HEME 3P69A 1VAHA 2OXHA 1NA8A 2BC4B 1DVSA 2XZQL 5C08E 4XPGH 5HHMB 2CQVA 4BUGA 4MQXC 3S4SA 5DZPA 4NUMA 1EO8H 1QLFB 4FGMA 1BXXA 2DQEL 3UC0L 3OM3B 1SJXA 5DHEA 1PLGL 4M1DH 2I7OA 3BYTA 3EJZD 5SWSB 3BUTA 5F89A 5HDRA 1ZY9A 4N0RA 4CVWA 1S7WA 3GJFA 4PJDF 5F7BA 2NY6D 3VA2C 4M1CD 2I07A 3ZE2B 5FW6A 2NOYA 3MODH 1JPGB 1UASA 2MHAB 3L81A 1S9YA 1WAAE 4JFXB 4KC3B 1WISA 5EZJA 5B1BB 5HHNB 2YK1H 5IHBA 4NQSB 2D7TL 5L2KE 4P06A 5I0YA 1PZ2A 4HAFA 5LAXA 2IPTL 3QDGE 4KV5E 1F3RB 3QAZB 4KXZH 3QXDA 3FB5B 3UAEA 3ZKMD 3I9IA 4AGMA 3QJOA 2GHWB 3TH4T 5IFHH 2UZXB 2XVLA 3FO0L 4DKFH 4F2FA 1ROWA 5B39G 3W2DH 4IGBC 5MEOB 2RAMA 4LLDA 1S3KL 3MRPB 4LRNL 4QY8A 4NCC1 4LLQB 4HPHA 4UCFA 1ODAA 4JHWL 3M1BB 2R0ZL 3MNDA 3MV9E 1A8ZA 4RGND 4XPTL 5DS8B 1JRHL 3C8DA 1A1MA 1N12A 5LNDA 4NFCA 1Y7VA 1YVLA 1HN1A 3JV4A 1ND0A 1SYSA 3GXNA 4GBXD 1TCRB 1Y18A 2GIYA 4XNUH 4MS8D 3NJMA 3IBOA 2AVFA 5EOCH 2A73A 4FFTA 4M61B 4PM1A 1MFCL 3PP3K 3V0AC 4HS6B 3WFBL 2A38A 4AIZA 1MAMH 3E80A 4F5CE 3TN0D 4ZMPA 4JDZA 1E28B 4P2QE 3LH2L 2YJQA 4G70B 2ZKWA 3PDOA 1YAIA 5DJ2B 4ZDHB 5GRJL 2VDPB 3UYRL 4O4YL 1E0OB 4UOW0 3FQTA 3SBWC 2AP2A 4M48L 1DSWA 2JJSA 4Q9QL 4QLWA 4KQ4L 4NP9A 2A74A 3GIZL 5AZUA 1IGJA 3UTTE 2F8OA 1B4TA 3ARGA 3SCMC 4P46C 5IJKA 2FK9A 4NKIL 1JGEA 2C9PA 2V0AA 2J6EH 2BK8A 4GXVL 4HH9B 2QGBA 1OSYA 5FUOL 2CNYA 3SYAA 2HT4C 2GKIA 3QISA 4DKEL 4APQD 5CCHE 1ZRUA 4YGAB 1VPOH 2DL9A 2VIRA 3EO1A 3HG0A 1QSFB 2IAAC 4S1SL 4NO5B 1D6VH 2CO7B 3B9KD 5CP3H 3GB7B 5BV7C 3JTSB 4POUB 4IYKA 4B9KC 3GIVA 1PEZA 2JJUA 4OCWH 2ARJA 1E2WA 4YC2B 4KK5D 4OLWL 4AQ1B 4KFZC 3U4EB 2AJ3A 1FDLH 1JK9B 3VXPA 4LLUB 3C5ZC 3CFKA 1SOQA 2R2CA 4PP2B 1QI3A 1ZT7B 1Q38A 4IJ3B 5EZIH 3MACL 2E9JA 5GGUA 1DVFD 2ZUSA 3MCKA 4URKA 3S36L 2YGVA 4QYAA 1EZVY 2J6WA 1BBDH 4XNQA 1IT9H 1SM3H 5DZLA 4MA8H 5SV4A 1FNEB 3VG9C 2YN5A 2EYRA 3QFDA 1Q1PA 43C9B 5L6YH 3WUWA 1WT5C 4KOBA 2Q6WB 4GOSA 5DJYA 3TM6A 3V8CA 2IANB 4FQPA 3GDCA 3GMLA 4OVUA 3QI9A 4KHTL 3EJTA 3O11A 2ZXDA 3T2PA 3S37L 5IQ9A 4X5LA 5IMKB 4N2KA 1RFDL 2C34A 3H9HA 3ULUE 2PWEA 3E0GA 7PCYA 1PX3A 1X7TA 3MPCA 3NIDE 3CSYB 3F7QA 4HIJB 1MIEL 1PD1A 5EFIB 4F15C 1OAXH 1WD8A 4WJ5B 3RAJL 2VLKE 1SGKA 1EMTL 5HHPA 4L8DA 1QBMH 5DRXA 4DETA 1OP9A 2L7QA 4YHYB 4QMEA 4UB0L 1OE2A 4JDVA 4JPIB 2ESVB 4HBCH 2B2XH 5ILTH 1NMBL 1RI8A 5IHHA 3RWIB 3KJ4B 1B9KA 3X3FH 2E86A 3R7RA 4MMZC 1SOXA 3RPKA 5LLIC 2EDDA 5I1KH 1MHPL 2D2OA 2D9CA 3CJJA 4P9MH 2J43A 4ZUVB 1C5BH 3HHMA 2CJSA 4M3HA 3ARDA 5E6SB 3KS0H 4BV1A 3SKNB 1U93B 1RZKL 1I3RB 2ZUXA 5AAWC 3GQFA 4L4VE 2ZOOA 1P4UA 3ZZLA 5C9KA 4KX9A 5L2KB 4PP1D 1SXNA 4ZFFA 2HRPL 4AW7A 3IK2A 3HUJF 4H1LB 5DMGC 4JKPH 1JUFB 2FJFB 3EUDA 1EFXD 5DMKA 3OLGA 5HI5C 1LE9A 1DEDA 1CE1H 1JF5A 5D1QC 1ZANH 4M7LT 4OB5L 3PFUA 1VADB 2DWDA 2ICEB 1UM4H 4GO6B 1FIGH 3EH5B 4F24A 1QW8A 5GJTH 3N41F 2TRYA 2C1OB 4BZ1H 2DLGA 5E94B 4K5LA 35C8L 2OTPA 4YPGA 1JXFA 4NHCH 5I6MA 2NW3B 3HI6L 2ZKMX 4G82A 2RALA 4ODHL 3ULSB 1H19A 4NKQB 1E7UA 3RKDD 2GUOB 1IFRA 2YMXL 4FX5A 3RIAK 4PJBB 1D7FA 3S35X 4P2QB 3SOBH 3X14A 3QUZD 2UUDH 5I8EA 1MCWW 2VAAB 1KENL 3OAUH 1T04B 4NO0B 1KLFA 3CK0H 4HGWB 5F3FA 1HEJC 4NQUA 2X10A 2BSRA 4ZFOL 3OKEB 5CSZA 3S3CB 1J9CT 3WNKA 2HT3C 3MRHB 3P0YH 1AGBA 5IFJB 3CXHJ 1IFGA 5GS1C 2CLRA 4UQ2A 4WDIA 4QRTB 2P46B 3LQAC 1MHHB 4G8EA 5FYLL 1X4ZA 2VL5A 5FEBA 2H7WA 4KKBD 5DD0L 3L3KB 5ACZB 5BNXD 1T6VN 3TWCH 1MH5B 4I2XA 3B2MA 5KW9H 5ES4B 4Y16D 1WRFA 3U4BH 3WFHB 3UJJH 4AYBA 5ERWB 3GUFA 1HCZA 1H6TA 3JT0A 2N0MA 1GOFA 2GHZA 3QWOB 4R7NB 4WK4B 2K7PA 4RRPM 3CD4A 5KUKA 2QQKH 4C54A 2FECL 4S1RL 2C9SA 2C7UB 3ZMRA 1PLBA 2I9TB 1F02I 3OWEA 4IEFA 1IUZA 2B15A 5F21B 3E3QE 3PGFH 2YHGA 3QUHA 3MYJA 4KPHH 1I7UB 2K3HA 1NIAA 1SMDA 4J6RL 5C2BH 1RL1A 2FGZA 2MH4A 2ZYIA 3P2TA 1IVLA 4LOUD 3TGXA 2R4SH 4PJ9A 1OARH 2ZQKA 3WEAA 3NCYS 3X1BA 2AEPH 1KJ2L 2L7UA 4OJAA 2VKWA 3W37A 3WUZA 2O61B 3IGUA 1MNNA 4O02A 4OVVA 4KXBA 2R8SL 1K6QH 4XPFH 5T1KD 1R34A 4TSAL 2FLBT 4AEIH 1W0YT 1X3DA 1YY8A 2IXQB 4I3GA 2KLRA 3R4RA 4CU6A 4F7KA 2P5WA 2ALAA 3ILPB 3L7EA 2K1MA 2LV4A 2SODB 3KPSB 4OQ1A 2FR4A 3G3LA 3Q6GL 3A47A 4N28A 3LN5B 4LHJB 2B1AL 3MNVB 3NIDB 1CYWA 1LTXA 4HX1B 1NKOA 1KXTB 1WWAX 1R3LB 4WU7A 4NXSA 5B8CA 3DECA 2VLKB 2NY2C 1KCSH 4I18C 1YYCA 4HBQA 4PJCE 25C8H 3UCRA 5E8PA 4MMXC 4PFEA 2DM7A 4D2NA 1MRDL 1RIUL 5IBUG 5D4QA 4YVNA 3RHWF 5D1ZC 2EDBA 2TSBA 3VGFA 2A99A 2K4WA 3V5DB 2B16A 3FQWB 4IRZL 1S8DB 4IGBA 5E9NA 4TUKL 4PS7A 1VENA 3MLSH 2DW5A 3L16A 4PJ8B 4KZCA 1IU1A 2H2PC 5IY5B 5IT2L 3O2VL 3VXTA 2VDLH 1WZ1L 2DQGL 4RIRA 4BWTA 1ZHLB 4AE1A 4FYRA 3ZYZA 3DDFA 1RZ7L 4EKJA 4Y7MA 2VITB 3AXIA 3MLPA 5BXFA 5BRZD 1QPPA 4L2LA 4MD0B 1RZGB 3W9DA 5DD5H 4OCNC 3MBEB 4LSVL 3EADA 5D7HA 5J13B 2AGJH 3C8KA 1KZYA 1I8MB 2QHRL 1GZPB 5LGJB 1KIUA 4N1EA 1T4WA 1ZS8A 1MEXL 3QEQD 5JPMB 1NL0L 3MV11 1KIPB 1BAWA 3WL9B 4NQED 2R0KL 3BSHA 1H8OA 4O51A 5C9JB 1XGPA 4HK3J 5JIHA 4Z0BL 4XNXL 2Q3ZA 1PY9A 3TBBA 1MDAA 2ETWA 3SCMA 4JFSA 5AYUH 4F7TB 5DUBA 4HT1H 4DF9A 5I6LA 3FK3A 1MF2L 3K8MA 1T5XA 3PQYE 2EE2A 4HKJA 4RA3A 4U3SB 1YA5A 2Z0BA 3FQXA 1DQKA 5FYLD 3O41B 2C3WA 4GJTB 4LDEB 2OL3L 1NCOA 3IDXL 4XXWC 2VDKH 3VQMA 1J1OH 1EANA 4IDLA 3UAFA 5GGSB 5TQ2H 4P04A 4EI5D 4DP4X 3T0VA 4LLAA 2Z4TA 3I6SA 5EC2B 3QARA 2DQTL 4UU9B 5K33A 3BFOA 3ZQWA 1PFOA 2ZD0A 3HLAA 2WVVB 4K5PA 2QKIB 3C5ZA 4C4KO 4CADB 5D7IE 1KC5H 5J89A 3GSQA 2WIIA 2LHAA 1CL7L 2W07B 3B7SA 3V0IA 1MUJA 2LGNA 4OSUH 1RJLA 5B38G 5HHOA 2A5UA 3BD5A 2E8ZA 5AKRA 1ROCA 1AQKL 1MN4A 3LKNB 4ZX3A 5IOPB 3B2DC 4N8PA 5C6TH 3WFZA 1DUYA 1WT5A 2HX8A 4JKKA 4R5VA 4WHDA 4GNKB 3DMMD 1L9PA 1BVNT 4NUQA 4OD2A 5IMOB 1JXDA 2EQDA 1U3HC 4JQIA 2R1XB 2GK0B 2XV6B 3LS4H 3I75A 2ENQA 5IG7A 5FA4B 2XX1A 3K3QA 1BM7A 5SWZE 4PY7A 3GSVB 4C56D 5DO2D 5F97E 3AB0B 5I8OH 2GK2A 4KNTA 2RCSL 1G1CA 1KCRL 5FYKE 3UOAB 1EPFA 1JWMA 3JUZA 1TDQA 2IH3A 1E6OL 1BZ9A 4N3UA 1OEZW 2M1KA 3I3DA 4JRFA 1FL3A 2J3SA 4WY7H 5C0CA 4TUOA 4XODA 3B9VA 3ZTNL 5IEHB 3T4AA 3T8XA 3PAUA 1QEXA 2APFA 2E74C 4PN6A 1M7UA 3ZDZF 2OCFD 2NNFA 3OR6A 4CC4A 4DCQA 4R6UA 4XMUA 3MLRL 1OGTB 3H3PL 3K7UA 1FFTB 2ADJA 2NY5L 4PS8A 2V3DA 2J25A 5FPIA 2WP3T 4KJPD 3EJCA 3A4EA 4QRPB 4ICXA 2MSPA 3OF6A 3VM7A 5IVXA 4AL8C 5EU6A 1BIHA 5CCJA 3C2AH 3O4LB 2XXMB 5JDSB 5FV2A 1ZTXL 4JO3H 2JLLA 1W8OA 2ZZUT 1KXQE 3CFEB 4GG8A 3A21A 2GC7C 4PJCB 3VFTB 2YN3A 2O5YL 1WAAF 1QHQA 1WYJA 4BDVA 2DQ6A 2NDGA 2OBGA 2VL4A 4NNYA 2ZWKA 3MCYA 5KOMC 2OQJB 3PL6B 3MXWH 2CDGA 4XN7A 1BCIA 5D1QA 2FATL 4Q9CA 5HSFA 1ORQB 4KV5F 3MX0B 4L0YA 4HLZG 2CGRH 1G0DA 3CFJA 3V95A 1JGVH 3WS3A 3DX9A 5F1NA 3IDJA 3VWKC 4OCRL 2V6HA 4XC1H 3BVVA 3PIQA 2F53D 4JG0H 3VXME 4I0PD 1RJZB 3QA3A 4R4ND 2BIHA 2J8UE 1HC1A 4QOKA 4UT9H 4FEMA 4NAJA 1MELA 4P2YA 4X0KA 2UYLB 1KCLA 2OXGA 3QIBB 4ELMB 3MRJA 2VXSH 1N5YL 4XMVA 1N64H 3QJVB 5EWIH 4QEGA 1BJ8A 1AH1A 1EVTC 4JN2B 1IBHA 4IBZA 3UO8B 5CF3A 4FHJA 6PCYA 2APBA 3P4NA 4WCYL 1UT9A 2JIXA 1A3LL 1KUMA 1AMXA 2VERA 1R3JA 4U0RB 5FKPB 4QT5B 2WQWA 5TDOB 2E47A 5CR1A 1MFBH 2L0DA 3OXSA 1K8DA 4ANKA 3CDGB 5FKAB 3LXUX 5GS1A 3PQYB 3QE5A 2P26A 3QZWA 3TCTA 5DUMH 3VI3B 5K9JH 4ZZKA 5TFSH 2H47C 3PUCA 5JHDA 3LCYA 2AJZB 2FLMA 2WAHA 4AI7A 1YEEH 1EAPB 2GJZB 3F7LA 3FDWA 3GM0A 3J2PA 4GXUM 5TE6L 3D4ZA 4EE2A 5JNYA 4NLHA 1SHXA 1T03L 2YBGA 1JPTL 2CLVB 2HJFA 4OJFL 3ARZA 2OTUB 5DHYB 2H6PA 1PS3A 1T3FB 4I3RH 2EO9A 4PJGA 1U95B 5D7IB 2HCZX 3JTTB 3UZQA 2GW5A 1MCRA 5CEZE 3IM1A 3E38A 5GSRB 2O6EA 4G3YH 3NZ8B 3GXIA 2XRAL 1A6WH 2AQSA 1BZ8A 3HZMB 3VFSA 1LO0L 3VFMA 2CO3A 4RGNB 3AQZA 2JI1A 5MERA 3CMOH 2VW4A 2YGOA 3OLIA 4DP9X 2JXMB 2O1AA 4KJYB 3TA3B 2L04A 3KGTA 1RIVH 4XMPL 1AXTH 1Y6MR 1EEYA 2B08A 3RTQC 4PJ6A 3S9DB 1E9QA 3K72A 5GRUL 1ZJAA 3WJMA 2B5IB 3RZCB 4EVNA 4N5ED 3S96A 3W9EA 2XWZA 5SWZB 3EDFA 4GMTH 1NGZB 1HSBB 2G30A 3T04D 1PL3A 4ALAC 4MD4B 1QNZH 4ZT1A 4PJXE 4U1KA 3BMVA 4QO1B 1S2EA 3HC4H 4IU3A 5AWNH 3V8OA 3HBZA 5B7FA 1E90A 3ULUF 3NIDF 4I18A 5C97A 1DLHA 5F7DA 1WBXA 3L7FB 4MMXA 2NTFA 3Q2CA 2MQ3A 4K9EH 5FK9A 4HETA 1X9QA 5D1ZA 4ZUWA 1EJOH 4ZS6D 5BVPH 5AL0A 4N2AA 5DO8A 1P1VA 4P4KC 1OE1A 3IKCB 4WI4A 1Q9WA 1QTPA 2EACA 3ETBF 3O6KL 5E0FA 4LL9A 4ZFQA 4AEFA 1RK1A 5L0QC 5D5ME 3B9KB 1G5GA 2Z35A 5CN1A 3PJSA 3WO4C 4Q97A 4F33B 5K59E 4QAMB 4O58H 1NFDA 2RACA 5FHAH 2FEDC 3T3PB 4G80A 1IBZA 4Z7NE 3V0VA 4WWID 5DYOA 5DJDB 2Y23A 4O2FA 4NN6C 4S2SB 2VLJD 4BGLA 2HB0A 4UNIA 5C09E 5L4JA 1WAEA 3L8QA 3GRWA 3V4PA 2OTWB 2E8YA 4PSRA 1DVFB 3VSVA 3LIZA 4TUJA 4U1NA 5FGRA 2MCG1 4LL1A 3TO4D 4AYGA 3FONA 1T89A 4X0NA 1DJZA 4TLTA 3SPCA 3TBYA 1T1YA 1XF3A 1NEZG 1DBBH 1FORL 3KYOA 4Y1AD 5E00B 4BKLA 3BWSA 3F7KA 4O2CA 3U0TB 4FLSA 2COVD 4A6YH 3VFOA 1Q4NX 1TO5A 4CMHB 2AITA 1DSFH 4YXLH 3VXMB 3RURA 2J8UB 2EVHA 3ZZQA 3OMNB 4WI0A 2JMRA 3FN3A 5GGVH 4X5PA 4HQQH 4MJ5B 5CGYD 4KUCD 1G5AA 3R7QA 1C1EH 3QDGA 2NXZC 2J4WH 3BP4B 5D4JA 3UL4A 3CTTA 3M86A 5J5EA 2K8QA 2PCFB 2Z7UA 3DETC 2X2JA 3U0PB 1MWAL 2CHDA 1M71B 3HMWL 4NUJB 1FGVH 4XXWA 5FOJA 2R29A 3P4LA 1GAFL 4P2OD 3ETTA 2B8OT 3VGBA 4JANA 3V6ZA 3ARSA 1U2CA 3RVVD 1BSIA 2EP6A 3T6VA 2XFXB 3D6GA 4LSSH 3MUY1 1TJHL 3H9ZA 3QHFH 3SYCA 2WNGA 4BFBD 3FPXA 1SY6L 2AERT 3IT8D 4UQDA 4QXUL 4X7CC 4GI9A 1MRFH 2B4CH 5CLZA 1CFNB 1RY7B 4XMWA 3X1GA 4IIQC 3U6RA 4WUUE 5D72H 2R0LH 4H8HA 1BWWA 5C92A 1K8IA 4OZFB 2GEEA 5HDLA 1AG6A 4LSPH 1A7QL 3LYRA 3FMGH 1BLNB 4YFDB 3H9YA 3X13A 1AHWB 2R69L 2GBUA 4WTQA 1P7QB 3BD4A 1R3HA 3HHSB 3TOPA 2Z4QA 4NHUA 4PJHB 3H0TB 1IM9A 4GLRI 2C4FT 1J8HE 1EFXB 1YMHA 1O7DE 2IQAA 2VZ1A 1CICD 1U3HA 4JY4B 2VZSA 1PDKA 2EE9A 1YEWA 4AH2B 4XBPB 3GMNB 2R51A 5KBDA 5DQDH 4FNLL 3P9LB 4OGXH 3UYPA 4IHOA 1GZHC 1DN0B 4FQLL 1GOHA 1QRNE 1HHGB 1WHPA 4WKZB 4LHUG 3KPQA 2TSAA 1EFQA 4KJQD 3UDWC 2OCJA 1JL8A 4UTCA 1VFAA 4X8XA 1JZ7A 1HH9A 2A4CA 4MJ6A 5EBLB 4YBLB 1VACB 4U2ZA 4XVUD 1C12B 3S35L 4XOEA 5ICZB 1A66A 2OSLB 3HS8A 4AT6B 4D9QD 2H9GB 4L4TA 3UBXA 5K9KB 4WI8A 1MI5D 2EKSA 3V0HA 3L5IA 4GW4A 1D5ZB 1HL9A 4X6DE 5CP7A 3GSXB 5ICYA 4X9IA 4PJXB 4M43L 3CZGA 3DX7A 1NANH 2CK0H 5FFLA 4AV5A 1CXEA 5IJCC 1UWEH 1UWGL 1D5RA 3PHQA 5DD1H 4PRIA 5ANHA 5IESL 4H5SB 3QJFA 2JCCA 2ZWSA 4ZXBC 1WS7A 4DAGL 4NZFA 4PJCF 2CHZA 3JSSA 5CJXA 2XA8L 2FIKA 1CGVA 3BP6B 3H42L 4WNQA 3S98A 3SE9L 4OCMC 4RLDA 3W39A 1DBKL 2LFEA 1GXEA 4Y16B 3HZVA 5D5MB 4U1SA 3ESPA 2UZYB 3KE0A 5DVLA 2CIKB 1NZRA 5D2LB 4J7RA 3ZRSA 2WXFA 5C09B 1JN6A 2VXVH 4FXGC 4NZTH 5DEGA 3OJDA 4HJ0D 5E56A 2BCKA 5DZ9A 5FWQA 1T66D 2XPGA 4XOAA 43CAB 1UZGA 2IALA 2QPSA 4DQAA 2PO6C 3I50H 3STBA 3GLDA 3OR7A 4HZLB 3W82A 1NAMH 1QX1A 4M4RA 4EPSA 5LKNA 1OL0A 2ZSWA 3BC9A 4MCYB 1QACA 3HI5H 1N0XL 1IKNC 1YZZA 2HUEA 2B59A 3N44F 1Z2KA 1FH5L 3UPAA 2C9AA 2PXYC 5KBLA 3HC0A 1FZMB 2F1EA 2W9EL 2F2HA 5DMJB 4D9LL 2ICES 2VDQB 5KYYA 5I2IA 5I28A 5GXBB 3CHRA 4Z7VE 3EYFB 3NSXA 5ID0B 2ITFA 3DSNB 3S3SA 4Y5VC 1NCWL 3MUGB 4O5LH 2GTZA 5JW4Q 3V0WL 4IBLT 3QZNA 2EH7L 4BUHA 3RA7H 3BJ91 1J8RA 3KL3A 3QORD 1S7UB 3I6LD 4WGWB 1X7QA 5JPNB 4XP5L 5ACLA 1JCVA 5IB3A 1EK3A 5AG8A 1BF2A 4N8VA 2ZWYA 2ZXCA 4HIHB 4NPYA 1W0VB 4ZNCD 1QSEA 3MRDB 3EOTL 3MLVL 3NQIA 4ZTEA 5D7IF 3IXAA 4WUUB 3SKOA 1HL5A 1H8SA 4JZNA 3F64A 3L3HA 1UT1A 4X4ME 1OAKH 4PREB 4KI5D 1BVOA 3IETA 4P9HH 1ZE3H 4X6CE 2P24A 2AV7A 2GBVA 2P5EA 3GMRA 3KNBB 3DI2B 3SZ6A 1WEJH 2W5PA 4PRAB 5E6UB 5BRZB 2X4TA 3KVPA 4FKEA 4ADJA 1JWSA 4MCNA 3VFUA 4H40A 1KGIA 3OWRA 3RTQA 3CH1B 1CZ8L 3CXDH 3NJVA 5KVGE 3BEWB 2NX5D 2N1TE 2WKOA 3NIGB 1ZSHA 3CQFA 1BFTA 3MJWA 4LCCA 3OKNB 3KYNA 4R83A 3MV7A 4YDIH 1WD9A 3II3A 2X9XA 1L9QA 1Q1JH 4GAYA 2K45A 1H3GA 3K1KC 2WXIA 5E70A 3QH3B 5D96C 1AD0B 4NQEB 3QO1B 4TLUA 4HC1H 1N0LA 5FM5M 4E9SA 3K0YA 1RU9H 3WHXB 1Z9LA 1XSIA 1ASPA 3TBTB 5L7XL 4PRBA 2FLRT 2QLYA 4LLYA 3GUTA 3O45A 4LBAA 3RWFA 2OX5B 6FABH 1ACYL 1X9RA 2VQTA 3KWWA 4AGLA 5EF1A 4FF9A 5F7MC 1JV2A 4P4KA 4ZPTA 5GISH 5DRZB 3F01A 1D9KB 4OUUB 5GGQL 3EOBA 3UPCA 1DQDL 2XKNA 1TJXA 4L29A 2BJMH 4PRNA 5IQLA 4EI5B 2XHNA 4TOYH 3D3VE 2PPAA 1ES0B 1XR8B 3MA9H 3KPRE 4YJZL 1CI5A 4M6OH 3VRLE 1YMMA 4KBPA 4MQ7B 1HCVA 3REWB 1UXSA 2OZ4A 3K2UH 2XBZA 4WEBL 3EG9B 4AM0A 5BZXA 3GJEB 3VFGL 3BVTA 4JO1L 4G6FD 4ISVB 1CLYL 4L9DA 5TJWK 4HFWA 2K6WA 3BQUB 1SMOA 1ZHKB 3SO3C 2P8MB 1A25A 4N1HB 3LZPA 3O9WD 2E7BA 2K9UA 1GGTA 4HAKA 3AMLA 4MA3A 4BKSC 5D7JC 1RXLA 4K4KA 2X9ZA 4OFYD 4YHPA 2VXUH 3ZTDC 3UC2A 4XBEL 1K4DB 1MNUL 4LOEA 3BKYH 5DJAB 1FYHB 3ABGA 3GEFA 4E9VA 1I9IH 4G5ZL 4KVNL 3G5XA 1KN2H 3L9BA 3NSFA 1G6RB 2J8UF 5AVSB 2DF3A 5C0DB 2EE6A 2OR8A 4ANUA 3KR3H 1BXVA 1FRGL 1KT2B 1M4KA 2YUVA 3IS0X 4U05A 3TIDA 4C56B 2IOOA 4D8PB 1OAZL 2VDRH 5E03A 5SX4I 3CFQA 1PG7X 1B2WH 3WSQL 5HDWA 4S1DC 2BNRA 3DOSA 4EN3A 1I7ZA 4OZGA 5GJSL 4F1SA 4Z1PA 4JVPA 2OYMA 1U8OA 5TE4H 5I6XC 3O6LH 3EF4A 5C0EA 3QCTH 5E08L 1J86A 3MUJA 5AB0A 4ZFZB 5JOPE 1YJDH 1KACB 5EUKA 3QRBA 4HIXL 4EI0A 3D7PA 5AW2B 4PYGA 4IIQA 4FFYL 4RAUA 5IFAH 1NTDA 4QF1A 1RZIB 1ZLUK 2Y2WA 1OGAA 2FBJH 2JJVA 1M1SA 1FSKB 2X6CA 4B6ZA 4MNQA 4QWWD 4AG4L 3TYFB 5HI3D 4FFVD 4ZAKC 1RUKH 1CDCA 5SV3A 3QW9A 5ABZA 3WLBB 2IGTA 1A0QH 4AENB 1FJ1B 2I9LA 2O6PA 2JV6A 2EXYC 1V7ML 1DBMH 1PKOA 2EYTB 1DQVA 2VR9A 3KWUA 4UV7L 5JORB 1AE6H 3UTSD 4XAKD 1YSOA 2A1WH 3VXNB 5I1CH 1YYLH 4HWEL 3NFNA 5KVFE 2NRDA 5LBSL 3RL1B 1OZTG 1GZHA 2C3XA 3ARFA 3M7OA 2G2NA 1NGQH 1TT6A 2YC1B 1FVEA 4XMLH 1DQJA 3D2UD 1C16A 1GJIA 1IQWH 2FL5A 5LDSA 2Y07L 4NXKA 2F53B 3F85A 3UDWA 4AZ8B 2V5TA 4I0PB 2NW2A 2VWEE 1KPVA 1QABA 5D8JL 4XVTH 5HD8D 4GFXA 5KVDL 4GXUN 2WUBH 1I1AD 3TBWB 4XI5D 2WXGA 4N0CD 2C7FA 5H4YA 2DMGA 1SJEA 1FG2A 1GC1L 4U6HB 1A6UH 4Y4HC 2Q87A 3ABMB 3OX8B 1MCPL 2P43B 3NPSB 1N6QH 5CU9A 3QJHA 4L0ZA 3T77A 2J6EA 2BW4A 4HFUL 4PJXF 4AKOA 3P73A 2J2ZA 5I66A 1KJMA 3EJQA 1A9EB 1MZZA 2X89A 4W9CC 4ZXBA 1S5IH 1WC7B 3H1ZA 4CJ0A 1O0VA 1UZ8A 2O5ZH 4OGYL 5CP3A 4EUPH 3VXRA 1GTNA 4WO0A 5DI8A 3NVQA 2RD0A 4LSRH 5IM7A 5IJVB 2BFVH 3OC8A 4AQEB 4JUTA 1YEKH 1UM6L 1DCEA 3BH4A 1IAII 3PDDA 2WXKA 4HH8A 5D5MF 5T3ZH 4PW9A 4DJMA 4EZMA 3WTUA 4NJ9L 4K5MA 5K59F 3G5ZB 1FV1A 1XSOA 2BSEA 4XVJL 1P0SE 1YEFH 1AD9B 1FNGA 1R3IH 3II2A 2OPCA 3FQRA 4Z7NF 1LD9B 2IO5A 4FXGA 3DX1A 3EBHA 4FP8L 5KSBA 1WFOA 2PO6A