4FLCA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
460
Chain Sequence
HGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIPYKRNPMRSECCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 160
structure length 460
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4flcA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4flcA02
1C3CA 1YISA 1U15A 5EYVA 3E04A 2O6YA 4FFXA 3BHGA 4NSLA 1I0AA 2PTSA 1TJWA 1C3UA 4C5SA 2HVGA 2VD6A 3R6VA 2PFMA 1JSWA 1HY0A 1TJUA 1FUOA 1VDKA 4V2RA 3C8TA 2OHYA 1TJVA 2O7EA 1K7WA 4BAAA 2NYFA 1FURA 1GKJA 3R6QA 1YFEA 2E9FA 3RD8A 2QVEA 1Q5NA 1J3UA 1Y2MA 3CZOA 4EFCA 2FUSA 1B8FA 2RJSA 4CQ5A 2O7DA 3GZHA 1T6JA 1AUWA 2QGAB 3OCEA 1EB4A 1KQ7A 4MX2A 1GK3A 2X75A 4C6GA 2RJRA 2O78A 4APBA 4ADMA 3R6YA 5F91A 2J91A 5HW2A 2NYNA 3NO9A 1FUPA 4V2QA 2PTRA 2PTQA 1DCNA 1GK2A 1YFMA 5F92A 4BABA 1W27A 3QBPA 5D6BA 2O7BA 3OCFA 4APAA 3TV2A 2YIIA 3NZ4A 1DOFA 4ADLA 4C5UA 3RRPA 3KDZA 1TJ7A 1FUQA 1GKMA 4HGVA 4FLCA 1T6PA 2O7FA 1HY1A 1XWOA 4EEIA 3UNVA 4C5RA 1RE5A 3KDYA 1U16A 1K62A 3GTDA 4NLEA 5EYTA
chains in the Genus database with same CATH superfamily
1C3CA 1YISA 1U15A 5EYVA 3E04A 2O6YA 4FFXA 3BHGA 2FENA 4NSLA 1I0AA 2PTSA 1TJWA 4A15A 1C3UA 4C5SA 2HVGA 2VD6A 3R6VA 2PFMA 3CRW1 1JSWA 1HY0A 1TJUA 1FUOA 1VDKA 3C8TA 4V2RA 2OHYA 1TJVA 2O7EA 1K7WA 4BAAA 2FELA 2NYFA 1FURA 2VSFA 1GKJA 3R6QA 1YFEA 2E9FA 3RD8A 2QVEA 1Q5NA 1J3UA 1Y2MA 3CZOA 4EFCA 5M0IA 2FUSA 1B8FA 2RJSA 4CQ5A 2VL7A 2O7DA 3GZHA 1T6JA 1AUWA 2QGAB 1XL8A 3OCEA 1EB4A 1KQ7A 4MX2A 1GK3A 2X75A 4C6GA 2RJRA 2O78A 4APBA 4ADMA 3R6YA 5F91A 2J91A 5HW2A 2NYNA 5H8WA 3NO9A 1FUPA 3CRVA 4V2QA 2PTRA 2PTQA 1DCNA 1GK2A 1YFMA 5F92A 4BABA 1XL7A 1W27A 3QBPA 5D6BA 2O7BA 3OCFA 4APAA 3TV2A 2YIIA 3NZ4A 1DOFA 4ADLA 4C5UA 3RRPA 1XLYA 3KDZA 1XMCA 1TJ7A 1FUQA 1GKMA 4HGVA 4FLCA 1T6PA 2O7FA 1HY1A 1XWOA 4EEIA 3UNVA 4C5RA 1RE5A 3KDYA 1U16A 1K62A 3GTDA 4NLEA 5M0JA 4WNLA 5EYTA 1XMDA
chains in the Genus database with same CATH topology
1C3CA 1YISA 1U15A 5EYVA 3E04A 2O6YA 4FFXA 3BHGA 4NSLA 1I0AA 2PTSA 1TJWA 1C3UA 4C5SA 2HVGA 2VD6A 3R6VA 2PFMA 1JSWA 1HY0A 1TJUA 1FUOA 1VDKA 4V2RA 3C8TA 2OHYA 1TJVA 2O7EA 1K7WA 4BAAA 2NYFA 1FURA 1GKJA 3R6QA 1YFEA 2E9FA 3RD8A 2QVEA 1Q5NA 1J3UA 1Y2MA 3CZOA 4EFCA 2FUSA 1B8FA 2RJSA 4CQ5A 2O7DA 3GZHA 1T6JA 1AUWA 2QGAB 3OCEA 1EB4A 1KQ7A 4MX2A 1GK3A 2X75A 4C6GA 2RJRA 2O78A 4APBA 4ADMA 3R6YA 5F91A 2J91A 5HW2A 2NYNA 3NO9A 1FUPA 4V2QA 2PTRA 2PTQA 1DCNA 1GK2A 1YFMA 5F92A 4BABA 1W27A 3QBPA 5D6BA 2O7BA 3OCFA 4APAA 3TV2A 2YIIA 3NZ4A 1DOFA 4ADLA 4C5UA 3RRPA 3KDZA 1TJ7A 1FUQA 1GKMA 4HGVA 4FLCA 1T6PA 2O7FA 1HY1A 1XWOA 4EEIA 3UNVA 4C5RA 1RE5A 3KDYA 1U16A 1K62A 3GTDA 4NLEA 5EYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3C A;  1YIS A;  1U15 A;  5EYV A;  3E04 A;  2O6Y A;  4FFX A;  3BHG A;  4NSL A;  1I0A A;  2PTS A;  1TJW A;  1C3U A;  4C5S A;  2HVG A;  2VD6 A;  3R6V A;  2PFM A;  1JSW A;  1HY0 A;  1TJU A;  1FUO A;  1VDK A;  4V2R A;  3C8T A;  2OHY A;  1TJV A;  2O7E A;  1K7W A;  4BAA A;  2NYF A;  1FUR A;  1GKJ A;  3R6Q A;  1YFE A;  2E9F A;  3RD8 A;  2QVE A;  1Q5N A;  1J3U A;  1Y2M A;  3CZO A;  4EFC A;  2FUS A;  1B8F A;  2RJS A;  4CQ5 A;  2O7D A;  3GZH A;  1T6J A;  1AUW A;  2QGA B;  3OCE A;  1EB4 A;  1KQ7 A;  4MX2 A;  1GK3 A;  2X75 A;  4C6G A;  2RJR A;  2O78 A;  4APB A;  4ADM A;  3R6Y A;  5F91 A;  2J91 A;  5HW2 A;  2NYN A;  3NO9 A;  1FUP A;  4V2Q A;  2PTR A;  2PTQ A;  1DCN A;  1GK2 A;  1YFM A;  5F92 A;  4BAB A;  1W27 A;  3QBP A;  5D6B A;  2O7B A;  3OCF A;  4APA A;  3TV2 A;  2YII A;  3NZ4 A;  1DOF A;  4ADL A;  4C5U A;  3RRP A;  3KDZ A;  1TJ7 A;  1FUQ A;  1GKM A;  4HGV A;  4FLC A;  1T6P A;  2O7F A;  1HY1 A;  1XWO A;  4EEI A;  3UNV A;  4C5R A;  1RE5 A;  3KDY A;  1U16 A;  1K62 A;  3GTD A;  4NLE A;  5EYT A; 
#chains in the Genus database with same CATH topology
 1C3C A;  1YIS A;  1U15 A;  5EYV A;  3E04 A;  2O6Y A;  4FFX A;  3BHG A;  2FEN A;  4NSL A;  1I0A A;  2PTS A;  1TJW A;  4A15 A;  1C3U A;  4C5S A;  2HVG A;  2VD6 A;  3R6V A;  2PFM A;  3CRW 1;  1JSW A;  1HY0 A;  1TJU A;  1FUO A;  1VDK A;  3C8T A;  4V2R A;  2OHY A;  1TJV A;  2O7E A;  1K7W A;  4BAA A;  2FEL A;  2NYF A;  1FUR A;  2VSF A;  1GKJ A;  3R6Q A;  1YFE A;  2E9F A;  3RD8 A;  2QVE A;  1Q5N A;  1J3U A;  1Y2M A;  3CZO A;  4EFC A;  5M0I A;  2FUS A;  1B8F A;  2RJS A;  4CQ5 A;  2VL7 A;  2O7D A;  3GZH A;  1T6J A;  1AUW A;  2QGA B;  1XL8 A;  3OCE A;  1EB4 A;  1KQ7 A;  4MX2 A;  1GK3 A;  2X75 A;  4C6G A;  2RJR A;  2O78 A;  4APB A;  4ADM A;  3R6Y A;  5F91 A;  2J91 A;  5HW2 A;  2NYN A;  5H8W A;  3NO9 A;  1FUP A;  3CRV A;  4V2Q A;  2PTR A;  2PTQ A;  1DCN A;  1GK2 A;  1YFM A;  5F92 A;  4BAB A;  1XL7 A;  1W27 A;  3QBP A;  5D6B A;  2O7B A;  3OCF A;  4APA A;  3TV2 A;  2YII A;  3NZ4 A;  1DOF A;  4ADL A;  4C5U A;  3RRP A;  1XLY A;  3KDZ A;  1XMC A;  1TJ7 A;  1FUQ A;  1GKM A;  4HGV A;  4FLC A;  1T6P A;  2O7F A;  1HY1 A;  1XWO A;  4EEI A;  3UNV A;  4C5R A;  1RE5 A;  3KDY A;  1U16 A;  1K62 A;  3GTD A;  4NLE A;  5M0J A;  4WNL A;  5EYT A;  1XMD A; 
#chains in the Genus database with same CATH homology
 1C3C A;  1YIS A;  1U15 A;  5EYV A;  3E04 A;  2O6Y A;  4FFX A;  3BHG A;  4NSL A;  1I0A A;  2PTS A;  1TJW A;  1C3U A;  4C5S A;  2HVG A;  2VD6 A;  3R6V A;  2PFM A;  1JSW A;  1HY0 A;  1TJU A;  1FUO A;  1VDK A;  4V2R A;  3C8T A;  2OHY A;  1TJV A;  2O7E A;  1K7W A;  4BAA A;  2NYF A;  1FUR A;  1GKJ A;  3R6Q A;  1YFE A;  2E9F A;  3RD8 A;  2QVE A;  1Q5N A;  1J3U A;  1Y2M A;  3CZO A;  4EFC A;  2FUS A;  1B8F A;  2RJS A;  4CQ5 A;  2O7D A;  3GZH A;  1T6J A;  1AUW A;  2QGA B;  3OCE A;  1EB4 A;  1KQ7 A;  4MX2 A;  1GK3 A;  2X75 A;  4C6G A;  2RJR A;  2O78 A;  4APB A;  4ADM A;  3R6Y A;  5F91 A;  2J91 A;  5HW2 A;  2NYN A;  3NO9 A;  1FUP A;  4V2Q A;  2PTR A;  2PTQ A;  1DCN A;  1GK2 A;  1YFM A;  5F92 A;  4BAB A;  1W27 A;  3QBP A;  5D6B A;  2O7B A;  3OCF A;  4APA A;  3TV2 A;  2YII A;  3NZ4 A;  1DOF A;  4ADL A;  4C5U A;  3RRP A;  3KDZ A;  1TJ7 A;  1FUQ A;  1GKM A;  4HGV A;  4FLC A;  1T6P A;  2O7F A;  1HY1 A;  1XWO A;  4EEI A;  3UNV A;  4C5R A;  1RE5 A;  3KDY A;  1U16 A;  1K62 A;  3GTD A;  4NLE A;  5EYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...