4FLCA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
470
structure length
460
Chain Sequence
HGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIPYKRNPMRSECCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 160
structure length 460
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4flcA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4flcA02
2O78A 2O7FA 1Q5NA 1TJVA 2O7DA 1U15A 4FLCA 1FUOA 1K7WA 2FUSA 2HVGA 2PTSA 1TJ7A 5F92A 1TJUA 3E04A 1HY1A 1YFEA 1Y2MA 4V2QA 2X75A 2NYFA 1HY0A 3QBPA 2RJSA 3RRPA 3OCFA 2O7BA 1EB4A 2O6YA 1W27A 3C8TA 1YFMA 2OHYA 2RJRA 3GZHA 1C3CA 4FFXA 2YIIA 1I0AA 1YISA 2J91A 3R6VA 4EFCA 4APBA 5F91A 1J3UA 1RE5A 1B8FA 2QVEA 1DCNA 1T6JA 4V2RA 1TJWA 2VD6A 2PTRA 4MX2A 1GK2A 2PFMA 1FUPA 1JSWA 3GTDA 3BHGA 4NSLA 3RD8A 2NYNA 4APAA 3CZOA 4C5SA 3R6QA 1K62A 2PTQA 3NO9A 1GKMA 1FURA 1XWOA 5D6BA 3UNVA 3NZ4A 4ADLA 1KQ7A 3R6YA 3KDZA 2E9FA 1U16A 1FUQA 3OCEA 3KDYA 1AUWA 1DOFA 3TV2A 4C6GA 4BAAA 2QGAB 4BABA 1C3UA 4CQ5A 1VDKA 5HW2A 5EYVA 1T6PA 1GK3A 4C5UA 4ADMA 5EYTA 4HGVA 2O7EA 4NLEA 4EEIA 1GKJA 4C5RA
chains in the Genus database with same CATH superfamily
2O78A 2FELA 1XMDA 2O7FA 1Q5NA 1TJVA 2O7DA 1U15A 4FLCA 1FUOA 1K7WA 2FUSA 2HVGA 2PTSA 1TJ7A 5F92A 1TJUA 5M0IA 3E04A 1HY1A 1YFEA 1Y2MA 4V2QA 2X75A 2NYFA 1HY0A 3QBPA 5M0JA 2RJSA 2FENA 3RRPA 3OCFA 2O7BA 1EB4A 2O6YA 1W27A 3C8TA 1YFMA 2OHYA 2RJRA 3GZHA 1C3CA 4FFXA 2YIIA 1I0AA 1YISA 2J91A 3R6VA 4EFCA 4APBA 5F91A 2VSFA 1J3UA 1RE5A 1B8FA 2QVEA 1DCNA 1T6JA 4V2RA 3CRW1 3CRVA 1XLYA 1TJWA 1XMCA 4WNLA 2VD6A 2PTRA 4MX2A 1GK2A 2PFMA 1FUPA 1JSWA 3GTDA 3BHGA 4NSLA 3RD8A 2NYNA 4APAA 3CZOA 4C5SA 3R6QA 1K62A 5H8WA 2PTQA 3NO9A 1GKMA 1FURA 1XL7A 1XWOA 5D6BA 3UNVA 3NZ4A 4ADLA 1KQ7A 3R6YA 4A15A 3KDZA 2E9FA 1U16A 1FUQA 3OCEA 1AUWA 3KDYA 1DOFA 3TV2A 4C6GA 4BAAA 2QGAB 4BABA 1C3UA 4CQ5A 1VDKA 5HW2A 5EYVA 1T6PA 1GK3A 4C5UA 4ADMA 2VL7A 5EYTA 4HGVA 2O7EA 4NLEA 4EEIA 1GKJA 1XL8A 4C5RA
chains in the Genus database with same CATH topology
2O78A 2O7FA 1Q5NA 1TJVA 2O7DA 1U15A 4FLCA 1FUOA 1K7WA 2FUSA 2HVGA 2PTSA 1TJ7A 5F92A 1TJUA 3E04A 1HY1A 1YFEA 1Y2MA 4V2QA 2X75A 2NYFA 1HY0A 3QBPA 2RJSA 3RRPA 3OCFA 2O7BA 1EB4A 2O6YA 1W27A 3C8TA 1YFMA 2OHYA 2RJRA 3GZHA 1C3CA 4FFXA 2YIIA 1I0AA 1YISA 2J91A 3R6VA 4EFCA 4APBA 5F91A 1J3UA 1RE5A 1B8FA 2QVEA 1DCNA 1T6JA 4V2RA 1TJWA 2VD6A 2PTRA 4MX2A 1GK2A 2PFMA 1FUPA 1JSWA 3GTDA 3BHGA 4NSLA 3RD8A 2NYNA 4APAA 3CZOA 4C5SA 3R6QA 1K62A 2PTQA 3NO9A 1GKMA 1FURA 1XWOA 5D6BA 3UNVA 3NZ4A 4ADLA 1KQ7A 3R6YA 3KDZA 2E9FA 1U16A 1FUQA 3OCEA 3KDYA 1AUWA 1DOFA 3TV2A 4C6GA 4BAAA 2QGAB 4BABA 1C3UA 4CQ5A 1VDKA 5HW2A 5EYVA 1T6PA 1GK3A 4C5UA 4ADMA 5EYTA 4HGVA 2O7EA 4NLEA 4EEIA 1GKJA 4C5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O78 A;  2O7F A;  1Q5N A;  1TJV A;  2O7D A;  1U15 A;  4FLC A;  1FUO A;  1K7W A;  2FUS A;  2HVG A;  2PTS A;  1TJ7 A;  5F92 A;  1TJU A;  3E04 A;  1HY1 A;  1YFE A;  1Y2M A;  4V2Q A;  2X75 A;  2NYF A;  1HY0 A;  3QBP A;  2RJS A;  3RRP A;  3OCF A;  2O7B A;  1EB4 A;  2O6Y A;  1W27 A;  3C8T A;  1YFM A;  2OHY A;  2RJR A;  3GZH A;  1C3C A;  4FFX A;  2YII A;  1I0A A;  1YIS A;  2J91 A;  3R6V A;  4EFC A;  4APB A;  5F91 A;  1J3U A;  1RE5 A;  1B8F A;  2QVE A;  1DCN A;  1T6J A;  4V2R A;  1TJW A;  2VD6 A;  2PTR A;  4MX2 A;  1GK2 A;  2PFM A;  1FUP A;  1JSW A;  3GTD A;  3BHG A;  4NSL A;  3RD8 A;  2NYN A;  4APA A;  3CZO A;  4C5S A;  3R6Q A;  1K62 A;  2PTQ A;  3NO9 A;  1GKM A;  1FUR A;  1XWO A;  5D6B A;  3UNV A;  3NZ4 A;  4ADL A;  1KQ7 A;  3R6Y A;  3KDZ A;  2E9F A;  1U16 A;  1FUQ A;  3OCE A;  3KDY A;  1AUW A;  1DOF A;  3TV2 A;  4C6G A;  4BAA A;  2QGA B;  4BAB A;  1C3U A;  4CQ5 A;  1VDK A;  5HW2 A;  5EYV A;  1T6P A;  1GK3 A;  4C5U A;  4ADM A;  5EYT A;  4HGV A;  2O7E A;  4NLE A;  4EEI A;  1GKJ A;  4C5R A; 
#chains in the Genus database with same CATH topology
 2O78 A;  2FEL A;  1XMD A;  2O7F A;  1Q5N A;  1TJV A;  2O7D A;  1U15 A;  4FLC A;  1FUO A;  1K7W A;  2FUS A;  2HVG A;  2PTS A;  1TJ7 A;  5F92 A;  1TJU A;  5M0I A;  3E04 A;  1HY1 A;  1YFE A;  1Y2M A;  4V2Q A;  2X75 A;  2NYF A;  1HY0 A;  3QBP A;  5M0J A;  2RJS A;  2FEN A;  3RRP A;  3OCF A;  2O7B A;  1EB4 A;  2O6Y A;  1W27 A;  3C8T A;  1YFM A;  2OHY A;  2RJR A;  3GZH A;  1C3C A;  4FFX A;  2YII A;  1I0A A;  1YIS A;  2J91 A;  3R6V A;  4EFC A;  4APB A;  5F91 A;  2VSF A;  1J3U A;  1RE5 A;  1B8F A;  2QVE A;  1DCN A;  1T6J A;  4V2R A;  3CRW 1;  3CRV A;  1XLY A;  1TJW A;  1XMC A;  4WNL A;  2VD6 A;  2PTR A;  4MX2 A;  1GK2 A;  2PFM A;  1FUP A;  1JSW A;  3GTD A;  3BHG A;  4NSL A;  3RD8 A;  2NYN A;  4APA A;  3CZO A;  4C5S A;  3R6Q A;  1K62 A;  5H8W A;  2PTQ A;  3NO9 A;  1GKM A;  1FUR A;  1XL7 A;  1XWO A;  5D6B A;  3UNV A;  3NZ4 A;  4ADL A;  1KQ7 A;  3R6Y A;  4A15 A;  3KDZ A;  2E9F A;  1U16 A;  1FUQ A;  3OCE A;  1AUW A;  3KDY A;  1DOF A;  3TV2 A;  4C6G A;  4BAA A;  2QGA B;  4BAB A;  1C3U A;  4CQ5 A;  1VDK A;  5HW2 A;  5EYV A;  1T6P A;  1GK3 A;  4C5U A;  4ADM A;  2VL7 A;  5EYT A;  4HGV A;  2O7E A;  4NLE A;  4EEI A;  1GKJ A;  1XL8 A;  4C5R A; 
#chains in the Genus database with same CATH homology
 2O78 A;  2O7F A;  1Q5N A;  1TJV A;  2O7D A;  1U15 A;  4FLC A;  1FUO A;  1K7W A;  2FUS A;  2HVG A;  2PTS A;  1TJ7 A;  5F92 A;  1TJU A;  3E04 A;  1HY1 A;  1YFE A;  1Y2M A;  4V2Q A;  2X75 A;  2NYF A;  1HY0 A;  3QBP A;  2RJS A;  3RRP A;  3OCF A;  2O7B A;  1EB4 A;  2O6Y A;  1W27 A;  3C8T A;  1YFM A;  2OHY A;  2RJR A;  3GZH A;  1C3C A;  4FFX A;  2YII A;  1I0A A;  1YIS A;  2J91 A;  3R6V A;  4EFC A;  4APB A;  5F91 A;  1J3U A;  1RE5 A;  1B8F A;  2QVE A;  1DCN A;  1T6J A;  4V2R A;  1TJW A;  2VD6 A;  2PTR A;  4MX2 A;  1GK2 A;  2PFM A;  1FUP A;  1JSW A;  3GTD A;  3BHG A;  4NSL A;  3RD8 A;  2NYN A;  4APA A;  3CZO A;  4C5S A;  3R6Q A;  1K62 A;  2PTQ A;  3NO9 A;  1GKM A;  1FUR A;  1XWO A;  5D6B A;  3UNV A;  3NZ4 A;  4ADL A;  1KQ7 A;  3R6Y A;  3KDZ A;  2E9F A;  1U16 A;  1FUQ A;  3OCE A;  3KDY A;  1AUW A;  1DOF A;  3TV2 A;  4C6G A;  4BAA A;  2QGA B;  4BAB A;  1C3U A;  4CQ5 A;  1VDK A;  5HW2 A;  5EYV A;  1T6P A;  1GK3 A;  4C5U A;  4ADM A;  5EYT A;  4HGV A;  2O7E A;  4NLE A;  4EEI A;  1GKJ A;  4C5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...