4FMCF

Espg-rab1 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
73
Chain Sequence
LLLIGDSGVGKSCLLLRFADYTYISTIGVDFQIWDTAGQERFRTISSDVTDESFNNVKQWLQEIDRYASELTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords ROrf2
total genus 7
structure length 73
sequence length 117
ec nomenclature
pdb deposition date 2012-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmcF00
2RGNA 3MJRA 1S0UA 2J0VA 5KSZA 5F3WB 1PZNA 4C2TA 4Q00A 1N6KA 3UWKA 3PVSA 2QE7D 1IN5A 3B13B 1QHHA 2YWFA 3NH6A 4LJAA 1FPMA 3A8TA 5KUTA 4QKQA 2ZE6A 2DFNA 3F5FA 2P5TB 3D3QA 2C78A 2RHMA 4OQLA 5G41A 3ZS9A 2ANCA 4A0RA 4Z8XA 1CU1A 4DCTA 4URVR 2ATVA 4A0FA 4RD4A 3SN6A 1NG9A 2PT7A 4ARZA 4D6PA 2QNRA 3L82B 1P72A 4TMWA 5IK2A 3SZRA 4W9MC 1NMYA 2B8TA 2G1JA 1TUEA 4M8NE 1P2VA 1IN7A 1KNQA 4DKXA 4FMCF 1T0JB 1WB9A 2W0SA 2D4HA 1N6IA 2YZ2A 2V1UA 4IXMA 3RWMB 1Q1QA 4Q1EA 2C9OA 2BCGY 1JR6A 4QJ3A 5BW8A 3LVQE 3GLGE 1A4RA 1Z47A 4DJTA 4HB2A 2Q3HA 4UQOA 4RZ3A 1M1YE 4QXAA 1E6CA 2IYSA 4PO8A 5FUVA 1YJ5A 1M6NA 4RFSB 2VP4A 3BB4A 4DB2A 1P61B 1U94A 2GJ8A 1G5TA 4GFDA 4GP6A 4OHZA 4BEJA 2GK6A 2OM2A 1W0KA 2IF2A 2P2LA 5AWFC 4A0HA 1IONA 2NO6A 4TYYA 2PBRA 2WOJA 3DOEA 4AI6A 1RC8A 4Q1BA 2ZJZA 3FTQA 4GZMA 4CF7A 1J8MF 4POAA 1N3BA 4QNMA 2P6NA 4QGGA 2UZ3A 3NIBA 2QP3A 1KI4A 1OXUA 5EP3A 3GFPA 3I5YA 1FNMA 3AF4A 3IQXA 1E0AA 2QEQA 3K70C 4FINA 5FUYA 1MABB 3CX8A 5EXPA 2WWFA 4P4SB 2JAQA 1UM8A 4LHZA 2A5YB 2LKDA 2V55B 3NVAA 4DLTA 1YKSA 5KTYA 4NH0A 4AKIA 1CRQA 1ZU4A 2P0EA 3WRXC 3QIAA 1W46A 4R98A 1G3UA 3Q5EA 2WJYA 1CJUC 2HCJB 4ASUD 4PC3A 1XMSA 2G6BA 2BBOA 3VR4A 1ZUHA 3B8HA 4HLUA 4D4JA 1TQ4A 4X8LA 2VF7A 3RS0A 4ZDJA 4NCHA 1RYHA 4JJKA 3OE7D 4B3BA 4PO1A 2E87A 3NKVA 3LVRE 1HTWA 1MRSA 4GOXA 1UAAA 2GCOB 3FMPB 3SJZA 3AVYA 1IAQA 3Q7PA 4LYHA 5IT5A 5FR2A 1DARA 1F60A 4ZV4A 1KSHA 3GLGA 1VIAA 1VG1A 3AF1A 1CJTC 1MABA 3GLHA 3C14C 1ZU5A 5JRZA 1EWQA 1JECA 2ZVPX 4H1VA 2C9CA 3X2SA 5JJIA 4IDQA 5JWOA 3JZMA 1FP7A 2JGNA 3VR6A 1KZ7B 1EWRA 2UKDA 2WSSA 3T1QA 2Z4RA 3CBQA 4KLNA 2WWGA 2ZSFA 1ZINA 3REFA 4DLVA 2AWOA 3ZZ0A 5JWRA 4M1KA 4UNPA 2Q21A 3BORA 1N6LA 4HAVA 4TT3A 4YMUA 1FOEB 1UBEA 4OHVA 1E98A 4LOAA 2HLDA 1G7CA 1N2CE 3EZ2A 4HATA 1KMQA 3M4YA 2BM0A 1EX6A 5B58C 3O8RA 2OILA 2ZSAA 2DCUA 1XXHB 2A9KA 3LQRA 2IUSA 1AGRA 3N5CA 1OE0A 4TMZA 3B1WA 1G7TA 3ZH9B 1LFDB 4EPXA 1M74A 4N0DA 5J4HA 5EXTA 2IXGA 4ZIRB 2ZJ8A 2IF0A 4XSGA 4JLOA 2D62A 4CIDA 4JKIA 4A9AA 3KQUA 1D2MA 4LJ8A 5B2ZA 4YMWA 1U0JA 1OH7A 3EZ7A 3THWB 4B3GA 1KJZA 2ZM5A 1NY6A 3SYNA 3WYFA 1G19A 3KJHA 1Q0UA 2ZSBA 2OBMA 5EZ5A 1GAJA 4B34A 2JJ2D 4M1MA 4AYXA 1E2HA 1B0UA 1UBGA 3W3ZB 2XZLA 3BJIC 4JIMA 1AKEA 4JT4A 1EXMA 2PCLA 2WWHA 5IF9A 1KJWA 3EA0A 4Q4LA 4UKDA 3DL0A 4FMBB 5JI2E 2JIZA 4O3MA 4I1VA 1OFHA 2PJZA 4BEBA 1HE1C 1I2MA 2XB2A 2RGEA 3LLUA 1Y63A 4QGHA 2BVNA 1E2MA 3GEHA 1FQJA 1XJ0A 3AVPA 1KKLA 2C96A 1A82A 2XTNA 2O8CB 1Z83A 5G3ZA 2XSZA 4U5XA 2ERYA 5EJEA 2HF9A 4DDVA 4A15A 1CRPA 3LXXA 2H17A 1OIVA 1M7GA 1F48A 3ZVLA 4CEHA 2EFDB 3MWJA 2ODBA 3RVBA 3WBKA 1D5CA 4XIGS 3U60B 1GKYA 3CF2A 2XITA 2O0KA 3RS5A 2GDJA 2CXXA 5CB8A 2D2FA 2E1RA 2BIFA 1OFTA 2GJ9A 2RB4A 5DLQC 3ZVMA 3NXSA 2QN6A 1IN6A 2RGXA 1E2NA 1YR6A 2AXNA 3MLEA 1KI6B 1XJQA 2VP0A 3V9PA 2P3SA 3A58B 4ZCLA 3ZQJA 1E2DA 1P60A 3VMFA 2F6RA 1YHNA 2W6JD 1QF9A 4Q9KA 3CNLA 1II0A 1R0YA 1DVRA 4Q4AB 4RY2A 4DLYA 1IY1A 1R2QA 3IDQA 1GKIA 4QHYA 4JT2A 3UWOA 5KSPA 4KYUA 2UZIR 2MSCB 3PFIA 2ZANA 1G16A 2F3RA 1E9RA 5UKDA 4ABYA 3A36A 1E9AA 2V3CC 5JBQA 4AG5A 3KQNA 3PUYA 2NGRA 2HF8A 4V0NA 3PXGA 4KFTA 1TTTA 4LJ5A 4LYJA 2YNMA 4IDHA 4EFMA 4M4SA 2ZU6A 5FL7D 3EIEA 4RD3A 5KHOC 1UKEA 4LYFA 1N5KA 4PHGA 2JLUA 5SZIA 1X6VA 5SZJA 4FMDB 3HYRA 4LV8B 1OXSC 1GL6A 2KJQA 2XX3A 4LBYA 2Q3FA 2JLYA 4TTRA 5EP2A 1NLFA 4QHTA 1XJCA 2F7SA 3VAAA 4A8JB 1B23P 1SULA 3DDCA 3TGPA 3ICEA 4R7ZA 3TW4A 1E94E 2VSXA 4NCIA 2ZXUA 2DPXA 4G1UC 1NP6A 2AFIE 1OKKA 3A1TA 3AKCA 4LPKA 4C3ZA 2XSZD 1VCOA 3PUVA 3U3MA 3W8NA 2ATXA 4FI3C 2PEYA 4RZ2A 5B57C 1TEXA 2C99A 4C30A 5KU1A 1DO2A 3F3YA 4QG7A 3TSWA 3VX4A 2O8FB 1U8YA 5FTJA 2QBYB 1IJFA 1DELA 1QZXA 4B44A 1MRNA 2ERXA 3IHWA 3TUIC 4OK6A 4Y0VA 1IHUA 2QRZA 2W58A 3K70D 2QQEA 1VHTA 3U3KA 2FN4A 1D8TA 1E9EA 3H2YA 1W4RA 2OCPA 3OAAD 5AR1A 2QGZA 3CNNA 1KI1A 1C1YA 1OPXA 2JJ2A 3X1WA 1LTQA 3B6EA 1KDRA 1A2KC 4LV5B 2FSGA 1W36B 5DHFA 2ZVQX 3K9HA 5J5CA 1G41A 2RGCA 4FWIB 3RS4A 4A6XA 2V8OA 4TN1A 4KI0A 4L8GA 4PAMA 1ESNA 2OFXA 4OK5A 1XCMA 3D6TB 3SJBA 2DY1A 1JAHA 1G8GA 1IXRC 2HXSA 3IBGA 4B3CA 1SXJA 3RSOA 1AS3A 1Q21A 4LHWA 3BD9A 3BFXA 4M53A 3R9WA 1RVDA 1KKMA 4KVGA 1KO7A 3L8YA 1SZPA 1FQKA 1JR3D 2VTKA 3UG6A 1M7BA 5JSZA 1KK0A 3KJGA 5HZKA 1D2NA 3HP1A 4L15A 4XH9B 1G4UR 3SR0A 1JQJC 1Z5ZA 1US8A 1RRCA 3OIUA 4DSOA 5KPDA 4PXAA 4NYMQ 4OBEA 1M7HA 5C4GB 2AWNA 2DHRA 3A6PC 1HA3A 4OQNA 2ZIAA 3B9QA 4TL9A 4KSCA 1ZM9A 3PITA 3SNHA 4BLSA 2V6JA 1GRQA 4KFUA 1TL7C 1MO6A 2JDIA 3GJ5A 4JBXA 3LD9A 4A4DA 2A5GA 3B1ZA 1Q3HA 2V7QD 4A82A 1BYIA 1Z29A 2JDID 4OI1A 1PLLA 3MUFA 4DEYA 3FKSA 2R6CA 2ZJ5A 1LY1A 4I1SA 3MD0A 1TX4B 1W4CA 1TADA 1RFLA 1BS1A 3THOA 2RAPA 1JR3A 1U98A 5AJVB 2R6DA 4GL2A 4BFSA 4Q4JB 1VECA 2OO7A 2P6UA 1S9DA 2ZRDA 2ZRKA 3TKLA 4RFSA 1XEWX 3OE7A 3GLFB 2REBA 4FD2A 4HB4A 3RAPR 4B3FX 3U2QA 4JLVA 3A1WA 4JVLA 1U9IC 3WRYC 2H7VA 1XEXA 4A0GA 3GLIA 1DAIA 5JRJA 3QEJA 1G3MA 2ZEJA 1H8HD 2BV3A 3K8YA 5FH9A 5FI0B 3QOFA 2DWPA 3R9XA 3QI2A 1SXJD 4L16A 4P32A 4KVAA 4AYWA 3OIVA 1GNQA 1R7RA 4NPHA 1M34E 4P33A 4FWTA 1NF3A 3ZIAA 4HLUC 2AN9A 1II8A 1HYQA 1RPZA 1CXZA 2FPMA 3FMIA 2WWIA 4YMVA 1RJ9B 4NYJR 1HT2E 2P5SA 1L4UA 2IS6A 1E4VA 5M04A 2NOAA 1J8YF 1JQLB 1S2MA 5EP4A 4JSTA 2IS1A 3MWKA 4XOIA 3WNCA 3J81k 3R9IA 1G291 1I4LD 3QKRB 4ACAA 3MG9A 4MGIR 2ZRBA 4B32A 1SKYE 4DLSA 2WAYA 4HB3A 1KAGA 3RNLA 3K09C 2FMXA 1ZIPA 2D7CA 3E5HA 3VR5A 2D2EA 4ZDKA 3KKPA 2JLZA 5AJYA 3K0CC 2F1JA 2FGKA 2KI5A 4GT1A 2J46A 4RFVA 4ZDWA 2ZI3A 1VG8A 1VG9B 2PZGA 4HAYA 3RRYA 4QM6A 2CMKA 4LCBA 4OYHA 5CM8B 5JEDA 1NRJB 2VIIA 1EFTA 5TV2A 4JLMA 3FOZA 4G5RA 3EPLA 5L3QA 5CDFA 2MMCA 4CYMA 4ZPXA 1E9CA 2ZS9A 1NIPA 3F8TA 4KBGA 5A4JA 1IQPA 1CP2A 3VNVA 3SHWA 2HV8A 4NMMA 5JECA 4NCKA 2H5EA 4KLZA 3LFUA 3DVLA 4DCNA 3U61B 3AM1A 1WP9A 6Q21A 1LS1A 521PA 2EFEB 3VKGA 1R5OA 5AJZA 5B30A 4ZCIA 2QG6A 3TVTA 4JL8A 2XZOA 2IXEA 4E5UA 5IDVA 2FZ4A 2K5UA 5HCIA 1FTNA 4I99A 4FW9A 2EFCB 2IC5A 2W2XA 3TSOA 4B2PA 3EPJA 4RZUA 1NL3A 1ZM4A 3RABA 2BBWA 2G0TA 5K8UA 3QXCA 1ONBA 2ZJOA 2QTHA 1GILA 3DO6A 3U3OA 4ZCMA 4MDEA 3B1XA 1DAKA 2ZYUX 3QENA 2VRWA 3QSYA 4NYIQ 4NCJA 2MMGA 2WJHA 4HLQB 1QHGA 3GJ8A 4F4JA 4B74A 1M2OB 3RRZA 3X1XA 1KI7A 5EP1A 1NIJA 1NJGA 2GF0A 2JJ8A 5FPKA 1KK1A 2YVUA 3FVQA 3FFAA 1WCV1 1Z0JA 1Z6TA 1Z08A 2CE2X 2ZU0C 3CONA 4PAOA 1TU3A 2GXQA 5HE8A 2GNOA 4A92A 3KZ1E 4NHOA 3TSZA 1T5IA 3VHLB 4Q47A 3CH4B 3WNBA 1VYVA 3M0EA 3I62A 3QXHA 3PG5A 4MYUA 2GZDA 3NC0C 1CR1A 4ZDIA 4MKHA 4B73A 1HE8B 2CLDX 5SZHB 2IYLD 1LVGA 2CL7X 2ZUCA 4M1SA 4DLRA 3W6OA 1WBBA 3ZGXA 2NZ8A 4PHFA 1A1VA 3BAFA 1FTSA 1KSGA 3FMOB 4GDFA 3MFYA 4XTRA 2HT1A 4WAUA 2RGAA 5H70A 4MYTA 2IUTA 1YR8A 1UKVY 1XB2A 3GPLA 4E22A 1ZUIA 3CF6R 4C0KA 3ADDA 4JLJA 1XXHE 4N1AA 2GWHA 1KHTA 1CJKC 4XD7D 1XTJA 3ZDQA 2J87A 3IGFA 4D80A 4C0SA 2JCSA 2RH5A 5DH9A 1UDWA 4QBGB 2J7PA 5AUPB 1G7SA 3LLMA 5CJPA 1H8ED 2WWWA 4M1YA 4O0MA 4EPYA 3BC1A 3P26A 1N0UA 4KJZA 2QT0A 2FSHA 1RRFA 3ASZA 3U44A 3IUYA 2N1BA 3OEEA 4M21A 1MO4A 1YZKA 4TT3D 2C04A 1DG3A 4TMKA 2QP9X 1E99A 3TVDA 821PA 2VQSA 2DFLA 3NDPA 2W00A 1T6NA 3O8CA 2Q3MA 1LB1B 1ZC4A 2VP6A 4W5HA 4EUNA 1GUAA 5KDLA 4B35A 1C4OA 2BJWA 4M1OA 4YMSA 2YKGA 1P9NA 3EZ6A 5FOTA 3QEOA 3OESA 2RGDA 1G4AE 1VDZA 4Q9JA 2O8CA 4IDOA 3AQ4A 3TUZC 4F93B 2FF7A 5CJ2A 4LJ7A 4FN5A 1E0KA 4Q4HA 1N6HA 1OW3B 3L0SA 4PTLA 4HB0A 1TEVA 2ANBA 3MAAC 4US1R 2ZS8A 1XPRA 3CLVA 5TVKA 1W44A 3CZPA 3KTAB 3U3RA 5P21A 4XVQA 2NZJA 1KMHB 1RRPA 2ZE5A 4Q9IA 1KI6A 5K8IA 4DLWA 3ZD7A 1XXHA 3HR7A 2GEDA 3B85A 1MKYA 5L3SB 2PX3A 3BE4A 2Z6VA 3UMRA 5CYPA 4Z54A 2ZQ5A 3LAWA 2O8FA 2GCNA 1J99A 4D82A 4HUQA 4F4CA 5GJVC 2YOFA 2FX3A 3AF3A 2R6AA 1T3LA 5DN6A 4NU0A 2IYRA 3CRQA 1JB1A 3FKQA 4ZKEA 2MSEB 4RCYA 3MWYW 3CKLA 5CB6A 1UFQA 1U90A 1W4AA 3FHOA 3AVTA 5DHAA 2J0UA 2NPIA 2OSBA 1Q1BA 2NPFA 2QAGC 3EPHA 3IQWA 4LI0A 4MUBA 1ZP6A 2O0JA 3BRWD 4D0NA 4TTPA 5E4FA 1G8PA 1GWNA 2CNWD 2WIBA 2WM9B 4XJXA 4WBSA 4C0LA 4OHWA 4RD0A 1CIPA 1KMHA 4NKRA 2NO0A 2R44A 2J3EA 1E1RD 4URZR 4CGZA 1T9HA 3LBHA 1DBSA 4LPSA 2ZRJA 3EZFA 5E3HA 2REXB 1GG2A 4AG6A 1Q22A 1P3JA 2ASEA 2FZLA 3SI7A 2QM8A 3U7HB 1E2FA 1P73A 1E9FA 1MR3F 3QF4A 1W49A 1SVSA 4NE2A 4NONA 3OEED 4TL7A 5KPJA 4L9WA 4C7OB 3B1YA 5FPTA 1PJRA 2FOLA 2ORVA 5DNYB 1G5PA 4BFUA 5ANRB 3VX3A 3H84A 3CRW1 4V0OA 5JFGA 1RIFA 4GOJA 2ORWA 3L2OB 1G8YA 2J0UB 5JI3E 4PPNA 1TMKA 2PX0A 4PHTA 5JLJA 2ZROA 4CW7A 3NHBA 3VTKA 4EIWA 3BGWA 2GHIA 2C95A 2R65A 1R5NA 2QL6A 4HLDA 1XBTA 1QG4A 3AKYA 3R8CA 2DYKA 1T3SA 4YC7A 1RRGA 2VP5A 1NI3A 2W6ID 2YC2C 4A6PA 2PMKA 1AA9A 3ADBA 2ZRGA 3Q7QA 4WOPA 1DPFA 2A78A 1KYIA 1Z28A 3ADCA 4L4UA 5HTKA 1U2RA 1Q1ZA 1Y3AA 1ZD1A 2WKPA 4Q21A 3QKTA 1P2UA 2EU8A 2OCYC 3KX2A 4JYCA 4LJ4A 2OLKA 1DAMA 1P5ZB 1GIAA 1Z0KA 2JLRA 1XD9A 1NVVQ 3OHMA 3THXB 3IIKA 1ODFA 1Z07A 4DEXA 5EE0A 3N70A 2VA8A 4Q66C 1ELOA 1KOFA 1R8SA 2YOGA 2ZSEA 4YXWD 1GP2A 2PZEA 2ZRCA 1S8FA 2XB4A 2XXAB 2ZRPA 3ADKA 1VCNA 2QSYA 1W2GA 3LNCA 1Z0AA 1KSFX 3EW9A 1IXSB 5FPHA 5CLQA 2H18A 3IO5A 3SJCA 1E2EA 4YMTA 1JXMA 5JCPA 3CX6A 4S2EA 2PT5A 2GXAA 4BUJA 1WF3A 3WYGA 4LX0A 1UJ2A 3DOFA 2ZRFA 3TJZA 5IK2D 3U7EB 1CEEA 4QBHA 5G53C 3BB3A 5CIWA 3P4XA 1E32A 2VSOA 1GNRA 3Q72A 621PA 4AKGA 2Z43A 3R7WB 5CK4A 1XCGB 3H0KA 1YVDA 4D4LA 3G5UA 5DYIA 4AD8A 2GJSA 2CJWB 1G64A 4WZ6A 2BMEA 2HXYA 4A8JC 2QGNA 2ODEA 1Z6YA 5E7IA 3CRMA 4BECA 1E1QA 1XZQA 4TSFD 1GKUB 3EC2A 3QBTA 4Q4JA 1YZGA 3WNDA 1L2TA 1ZW6A 2QMOA 2ZE7A 4PSKA 1JXOA 5C4MA 5FTLA 4C0QC 1G3QA 1G7RA 1V5WA 2JIZD 4RD1A 5J4KA 3U4QA 5ELXA 5FTKA 2J59A 3HJNA 2Q9CA 1ZUNB 3GEIA 1AS2A 4TLCA 3QKSB 3GLFE 2LCFA 2CLSA 1IOZA 1HY3A 4TQAA 1AQUA 2XNDD 1TQDA 2AFHE 2GRJA 3N2EA 3WHKA 3E70C 1XMVA 4TMTA 1QRAA 4IVQA 1GFIA 2R6FA 1VHLA 1MT0A 5DISB 1TPZA 4A36A 4XSHA 2O8BB 3O47A 1N6RA 1XEFA 1ZNWA 1N0VC 2G83A 3GQBA 3QG5A 1IY2A 2OV2A 2HEIA 4XD7A 4N0EA 4GBMA 1VIYA 3TIFA 1N5IA 3TBKA 1CS4C 2ZRHA 1GSIA 4FCVA 1P9RA 1W0JA 421PA 2GETA 4JYBA 3U6KA 3B60A 4BLRA 1HQYE 1V43A 3CB4A 3IO3A 1JEEA 2GEVA 4EKDA 4BZXA 3IIJA 1HUQA 4HI0E 4M9QA 3K0EA 2C5LA 2D06A 4CEJA 2ZR9A 1FZQA 3B2EA 3NHAA 3W8RA 1G3RA 4DDWA 2CE7A 1EFHA 1SKYB 1I2DA 4RKFA 3C15C 3I72A 1IN4A 3WBJA 3GLHB 3M1IA 3PR1A 4IOLA 2DWQA 3AVOA 5KNCA 3TR0A 2QENA 4LK2A 2IWHA 4R71A 1X86B 2QU8A 2CVFA 4EPRA 2IEZA 1EG7A 1YZQA 2QY9A 1Q3TA 2VHCA 5JEEA 3ZLJA 4WXRA 1ZCBA 1H8HA 1EK0A 1SVMA 4N3NA 2FFQA 4PANA 1VYUA 2ZI6A 1F2UB 3G82C 4L9SA 5DSZA 2IHBA 2ZRAA 3NWJA 1XDBA 3OEHA 3LA6A 2FFAA 4QC2A 1W5TA 3GLFA 4PZYA 4Q1CA 3T06B 2VO1A 2PLFA 1X3SA 3LBIA 1M8PA 2GA8A 3K0FB 4A1FA 1ZNZA 4LV6A 1EFCA 2J0SA 4HAXA 1RYFA 3C16C 3FKSD 1XPUA 3NBZC 1XX6A 1CJMA 3NBXX 4C0BA 2FGJA 4LZZA 1G21E 2V9PA 2XAUA 2IT1A 5J4VA 2WJGA 1S9HA 1QHYA 1XD2B 3TLXA 1HQCA 2MSDB 3EG5A 4HZUB 1JR3E 1NSTA 3WMEA 4KITB 1Z6XA 3A4NA 1SQ5A 4Z1MD 1Q12A 1MO5A 4DCVA 1YR7A 1OLOA 3MGCA 2WJVA 3ZVNA 2PEZA 1ZD8A 3KJIA 3R8FA 1OIXA 3GP8A 4ILEA 4B2LA 1KK3A 1R6BX 3AV0B 2W2VA 2ONKA 5TB5A 3ZS8A 3U6BA 2Q9BA 1F5NA 1OYYA 4G0NA 1S96A 1KO5A 4P4UA 3QVUA 4JS0A 3PEVA 5F2EA 2GZAA 2ZYVX 1IY0A 3C8UA 3T5GA 4HAUA 2QZ4A 4C4PA 1S1MA 5EE3A 4JBYA 5GADl 3TR5A 2REOA 1KAOA 4R2IA 5AUQA 1NJFA 1XD2A 3E1SA 3LW8A 2GBLA 1E2IA 1JAIA 2QUZA 4BQSA 3TAUA 3TMKA 4PHHA 3FWYA 4AURA 1J90A 2AR7A 3THWA 4XWKA 3OAAA 4MGYR 5G3YA 4K81B 2EFGA 1Z2AA 4GMDA 5DN6D 4E07A 2NO7A 4X8MA 4IEIA 4PPGA 2WMNB 1OIWA 4QNRA 5FBQB 5FBWB 4ESVA 3FPAA 3K9LA 4MUAA 4D0GA 2IYZA 3QG1A 1E0SA 3N2IA 2R9VA 3FDIA 1AQYA 1OF1A 1K8RA 4URXR 1YR9A 4Q02A 3EA5A 4JZKA 5D3QA 1MOZA 2NQ2C 4GPTA 2FSIA 4S35A 3GJXC 2ZR7A 3SFZA 3RSLA 3UG7A 4B76A 4TYQA 4EJSA 3CPHA 3W5JA 2NG1A 1TQ2A 2IYWA 2GKSA 1DAEA 1WBDA 4C2UA 1JI0A 4WXPA 4DT1A 3K1JA 1DS6A 2JLXA 3BXZA 4V0LA 4UXJA 2C03A 2VL7A 2N42A 4DB4A 3HWSA 2WWYA 1Z6GA 4JLNA 2BJVA 3OIWA 2GEUA 1DE0A 4G5OA 4HZUA 2EWWA 3LBNA 4C0AC 4G01B 3NEJA 1YRAA 4PC2A 4EPVA 2IA5A 2AXPA 2E9SA 2G77B 5JZVA 2OT3B 5BYKA 3NDBB 2FA9A 2EYQA 4ESHA 1HV8A 5H1YA 3OZXA 3ETLA 4QFMA 3G0HA 4C9BA 4PQFA 2HDNB 1OFIA 1FMLA 2I4IA 5BN4A 1K6MA 4DLZA 1NSFA 1IN8A 1YZLA 3CPJB 4M9SA 2QRNA 1FUKA 3I73A 4B47A 5F98A 2O8DA 2GJAA 1E4YA 2W6JA 4P0TA 3WXMA 3AVWA 4LJYA 2IK8A 1F2TB 5BQ5A 1VYTA 2J41A 4ARZB 3GLGB 2IX3A 5LPNA 2F3TA 1P7CA 1BMFD 2OXRA 4PC1A 3GJ7A 5FTNA 2WPDD 3RC8A 2FEOA 3QXJA 3C7KA 2V1XA 2ZJ2A 1SXJB 4Q7JB 2WOOA 3QXXA 2O8EA 1ZVQA 2HT6A 2XTZA 3DHWC 3K53A 4QJ5A 1TU4A 3U5ZB 2BEKA 3AKEA 1QBKC 2ZYTX 1CKEA 1DO0A 2GXUA 2XEXA 4DLUA 4MQBA 4OQMA 4WVFA 4ZKDA 3U44B 2W83A 3PCRB 4DSNA 2J1LA 4YXWA 1P75A 2GVZC 1X1SA 3HU3A 4G5QA 3A37A 3ZD6A 3QY0A 4AK9A 4PR0A 1FW6A 2QORA 5EE1A 4IJMA 4DCUA 4JVSB 1EESA 1BO6A 5BWMA 4HZIA 5FUXA 4FCWA 1P9WA 2HYDA 4DZZA 1OB5A 1LS6A 2FPKA 3K0AA 4TYNA 4C7OA 1OJLA 3QPUA 4GP7A 3GEEA 4HDCA 4IVRA 2IYYA 4JVMA 3KB2A 4Q01A 5FI1B 3WHLA 1GRRA 1N6OA 1JJ7A 1KDTA 4MITA 2ZI7A 3UXMA 1XTQA 4EJSC 3VU9B 5AUOB 3KDSE 1L8QA 2AD1A 1N6PA 3LO5A 4D4KA 4BFZA 2O5VA 1IM2A 2A3RA 3DPUA 2BC9A 4KSBA 4D4MA 2VLIA 2XJ4A 1FL9A 1Z3IX 3QBVA 2BEJA 4DIDA 1E3MA 2YHSA 2P67A 2VHQA 3Q5DA 3SQWA 4IOKA 5HE9A 3DMDA 2QTFA 4KYIB 5TDHA 221PA 4LBZA 4MYHA 2PCJA 3A1SA 4IKEA 1E96A 1OYWA 2BMDA 2YC4C 1T0HB 1ZAKA 2FH5B 4Q7KA 4KXFB 3B7GA 1GITA 3WP0A 2WSMA 1SHZA 3CW2A 3T12A 4BLTA 3I5XA 2WKQA 1JALA 1XEXB 2D3WA 2HCBA 3GLIB 3FFBA 4M1TA 3T1VA 4LBWA 1GL9B 1VCMA 3PEWA 3PENA 1TF5A 2YV5A 1R0XA 2GCOA 4IOJA 1XFAA 3U4QB 2QSZA 2ZYWX 3NBFA 5BXQC 3B9PA 5HPYB 2WIAA 4O2LA 2R8RA 3I8SA 2XXAA 2I1QA 1YRBA 3DZDA 2QA5A 1X8LA 4JL5A 4D0LB 1CTQA 3SBDA 3UK6A 2WV9A 3EWSA 1F3OA 2C8VA 4RVCA 3SDZA 4BLQA 5TMPA 2WTUA 1T3HA 1WRBA 3CH5A 1KI3A 1W7AA 1Z0FA 3FYHA 2WPDA 3THYA 2O0HA 2ZPTX 1XNJA 5C46F 3KQHA 1R10A 3RRMA 1VMAA 4BGDA 3GJ4A 1D6JA 2F43B 1QHIA 2KBEA 3K70B 3ZYCA 1TNDA 2ZI4A 5FOVA 3B5JA 4G5GA 4CVNA 3LQQA 4V03A 2YJTD 3I8XA 2SHKA 3TH5A 4URWR 3Q9LA 3DM9B 3AVVA 2XOKA 1OHHD 2GK7A 4MGZR 1NN1A 1E2JA 1A2BA 1OXXK 5H68A 1KDPA 3LDAA 4XVRA 3KQLA 4FXPA 4V0KA 4WZBE 2OLJA 3HDTA 2P6RA 3KL4A 1XZPA 1QG2A 4XTCS 4IHQA 3SE0A 2AK2A 3MMPA 3NH9A 4ON9A 4QGAA 4OHXA 4EQ6A 1AZSC 3K0AB 2G9NA 1E9BA 2OEPA 1W4BA 1KI2A 2PL3A 4HAZA 4L5BA 2B6HA 3EWAA 1NVVR 2JATA 4X8OA 4CDGA 1XWIA 2X19A 4OHYA 1COWD 2VP9A 5TARA 3ZJYA 2R62A 1II8B 2OG2A 4QRHA 5DI3B 3GD7A 2EFHB 3QNUA 2H16A 3BS4A 3MCAA 3TRFA 4OI0A 3IKJA 4OJKA 1OH6A 4GNKA 2CNWA 3TQCA 1RJ9A 2LWIA 5F9HA 2ONJA 1G6HA 3QPWA 3QVVA 4HSEA 1F2UA 2BBTA 3Q85A 1PV4A 5HR5A 4MKIA 4KAXA 4E03A 2O52A 2PZFA 2OAQ1 3REGA 2ZRLA 2O8BA 2AX4A 4OQFA 2WBLC 1VG0B 2KSQA 1DTSA 3TQFA 1RW4A 3EX7C 1NMZA 1UADA 4TLEA 3KKNA 4CT4B 1IJEA 4TL6A 4AIIA 3U3JA 1E0JA 3AUXA 3VKHA 2X1VA 4YLGA 4A2QA 4W5WA 4Q19A 1KY3A 3GCGA 5FOUA 2WKRA 1WE2A 3RYTC 3ZZUA 1ZJ6A 1Z0DA 1QHHB 1TAGA 2WAXA 4PX9A 2FE4A 3RRNA 5JS7A 2JEOA 2CK3D 4UNSA 3WY9A 4DSTA 3UATA 2A5FA 3U7FB 3HU2A 1U99A 4QGFA 3HR8A 1OT3A 5FUWA 4IRUB 5CK5A 4Q48A 1JPNA 2AK3A 2BMFA 4Y0AA 5FPYA 3UMFA 4OI2A 2ZE8A 1NN3A 4TL8A 2VSFA 1CR0A 3IPXA 4DWJA 3EARA 1TUIA 2FEMA 2YWEA 1COWA 1E2KA 3K9NA 1W2HA 4HYYA 1RKBA 2ZREA 4BFTA 3K0SA 2FJUA 2PMDA 4V0ME 3ZQ6A 1L4YA 4MDFA 2A5DA 2GZHA 2UVQA 1DAFA 1NLYA 1KI9A 1HT1E 5JCZA 2DWOA 1W1WA 4PZLA 2QPOA 1I4DD 4LWZA 5FL3A 1G18A 3HPRA 1FFHA 2I1VB 2ZI5A 3SC3A 3A4MA 4KCGA 2QI9C 5CYOA 4K8OA 3IILA 4OJQA 3WYAA 1E79D 3BWDD 4BRWA 4BZPA 1LV7A 2WZQA 3UMSA 2XOKD 2D7DA 1WA5A 1UF9A 2D74A 1CR4A 2H8KA 3AUYA 3CPEA 3TUJC 2VEDA 5DYGA 5FBRB 5E7JA 4PZZA 2ZTSA 1SVOA 1X1RA 4MRNA 4DDTA 1VKJA 2A7QA 1A7JA 1L7VC 5CITA 4QHSA 3W6NA 4D2IA 2B92A 3PV0A 2Q9AA 4ZI2A 1ZNYA 5IRCD 2NMVA 1UBFA 3JZAA 4B3DA 4TMXA 4EPWA 3ZVRA 4HAWA 5EUMA 1Z2CA 4ZO4A 3EZ9A 4PC7A 4A8JA 5KDDA 2AL7A 3PUZA 1XMJA 2QPTA 1XEWY 2X77A 1UDXA 1ZCAA 3BH6A 2KWIA 3D31A 3H4MA 4LC0A 4UNRA 3MJHA 4HDQB 4C0HA 3C5CA 3W6PA 2IHYA 1SKQA 3RS7A 2NO1A 2GAAA 3FGNA 1ZMXA 2PLRA 3L0OA 4DDUA 3L43A 1BOFA 2BHRA 4GSYA 3AF2A 2J5XA 1S3GA 3UKDA 1FX0A 4CEJB 3CR7A 5J40A 1U8AA 4MRVA 4KFSA 3BFKA 5FBVB 3VR2A 4F91B 3CZQA 3PUXA 1NVXQ 4BRUA 1G9XA 5EZ6B 3CIOA 2FSFA 1JPJA 4ITRC 1R5BA 1Z8FA 1W48A 2JJ1A 1XPOA 1KNXA 1EGAA 4KV9A 5FR1A 3T35A 4LRWA 1CR2A 2R6GA 1NN0A 3S1AB 3FHCB 3A1UA 2QPAA 4TYWA 2ZRIA 4BFVA 3GMTA 3UPUA 2WJJA 4OQXA 1NVUQ 1P2SA 3DMNA 2DR3A 4BWYA 5F9FA 1D9XA 4IFEA 5GVRA 4RCZA 2DFKB 4MYCA 4OK3A 3BB1A 4AWXA 4NCNA 3RDPA 2ZITA 4LBVA 1XTRA 4BFXA 2QMEA 1F6BA 2ZJYA 3BERA 1YQTA 4RSGA 4GI7A 1JNYA 3LY5A 1UEJA 5DO9A 2QP4A 2C98A 1J7KA 2EW1A 1FX0B 4JSYA 3DKVA 3UIEA 3A1VA 1XU4A 4UJ3A 3DKPA 2BCJQ 2BDTA 4IFBA 4BFWA 2B21A 2JLWA 3BIFA 3V4RA 3M6AA 2OBLA 1T5LA 1A5TA 4CZ2A 2QE7A 4NYIR 2ZSDA 2IWRA 4DBLC 1S4QA 3P4YA 4TQUS 2IXFA 2B7BA 4F4IA 2OESA 3RS3A 3IEVA 1Z0IA 3QPVA 4ZIRA 3EC1A 4US2R 3MRSA 5GJBA 2CCGA 4PQYA 3KUDA 4ERNA 3I1FA 1EFRA 1E2PA 1MH1A 4TWZA 1E79A 3ICQB 1O87A 2V4ZA 4GMXA 2JJ1D 3GFTA 2F1RA 4JKYA 3IBYA 1W36D 1DEKA 4V02A 4PSVA 2VP2A 3OF5A 5TY0A 4DRZA 3KFXA 3QF4B 5HCNA 5GVSA 2ZAMA 3VHXA 1S1CA 2DBYA 2XZPA 3VNUA 1UKYA 3CX7A 3EPKA 1J70A 4JLPA 3AVXA 1JBKA 1KY2A 1PLKA 1QHSA 4I1UA 1KGDA 4Q9HA 1EFUA 3T34A 3IEUA 3CWZA 4B3XA 2CBZA 3BH7A 4MKGA 1SHKA 2W2TA 2FFBA 2Z4SA 2QAGA 3H86A 3Q3JB 1ZM3A 5FPSA 3D7MA 3JVUA 3PEUA 4O2RA 1LF0A 1WDTA 4ACBA 3W3AA 4IXNA 5D3MB 3TNFA 5KO2A 1CULC 3AP1A 3ZIAD 3GJ3A 4IOMA 2KBFA 4B33A 4CEHB 4KO8A 4LC1A 4MRPA 1Z22A 4TZ6A 5LBIA 1BKDR 2GESA 4EPTA 1UPTA 5HKKD 3QF7A 1HH4A 1N5LA 4LHYA 2V54A 3VR3A 1II9A 2ZUDA 2AD5A 4WIAA 4NYMR 4HLCA 2Y8EA 5HZHA 1ETUA 1UKZA 3FMFA 1YZUA 4FCTA 4KODA 4TTQA 3SJAA 5FBLB 3RHFA 4DIEA 1U81A 2AHOA 3LV8A 4R2HA 2ZAOA 5CIQA 1T91A 4M22A 3NG1A 4OKSA 5H8WA 1GZSA 2W0MA 1AM4D 2Z5FA 4WA7A 5KSOA 1UEIA 1ZNXA 3GJ6A 2AKAB 4IVPA 4QM7A 4BZQA 1Q20A 1UBCA 5AJWA 2CHGA 2A5JA 1KI8A 4EJSB 3SU8A 5SZKB 1XMIA 2TMKA 4O25A 4M9XA 2IS4A 1Z63A 5D3MA 1YU9A 4DVGA 2XJ9A 4QOSA 1AS0A 2CL6X 1NN5A 3CR8A 3VKWA 3Q8XB 5L3QB 2N46A 4R9UC 1XTKA 1XCPA 4M1WA 4EFNA 2QM7A 5AK0A 2G1KA 5HKKA 1XF9A 4Z51A 5LB4A 2X2EA 2ODWA 2OCBA 1X8JA 2RGBA 1NG1A 5DE3A 1AJEA 4FMCB 2OCAA 2QMHA 2CJWA 2CK3A 1DAGA 1ZM2A 2VHUA 1YZNA 4NP6A 1VPLA 4OL0A 3T15A 2FWRA 3P32A 4TYPA 5JJLA 2FPLA 5JJKA 1DG1G 3GJ0A 3SBEA 3TK1A 5CLLA 4XWOA 1HEIA 5KDOA 1KTVA 2IL1A 4KFRA 3SYLA 1KO8A 3AVUA 1LNZA 1G20E 2GBLC 2GF9A 3LX8A 5A5GA 4UXIA 4BPBA 2O8DB 1H8EA 2RHDA 1ESMA 1YE8A 4URUR 1OKKD 1N5JA 3E2IA 4EAQA 4IDNA 2OXCA 2EWVA 1U0LA 4I4LA 4LUCA 3RLFA 3ASYA 4EQ6B 3SYKA 5LDDC 3ECCA 1OSNA 5AJXA 1MV5A 3W34A 3X1DA 1J2JA 2FFHA 2WWXA 3ZZTA 4B48A 1NNEA 3W5IA 121PA 1VTKA 4RD6A 1E1RA 5JWHA 4LY6A 2ZI9A 1OH8A 2CDNA 5LB2A 4BE7B 4DXAA 2Z83A 3VR1A 4NDZA 5E7MA 4A2WA 3RANA 1Q44A 3KKMA 4QBFA 1E2LA 4PSAA 2BBSA 3A4LA 2DFTA 3I61A 1KZGB 5J4LA 2HYIC 2RKOA 3B78A 3RWOA 3THYB 3HU1A 3C41J 1GVNB 4NL4H 2IW3A 4LHXA 3GLHE 3L0PA 1BIFA 1SVIA 3LX5A 1GL7A 3BK7A 1BYUA 2BM1A 2IYUA 4GRAA 4HEJA 5J4YA 2GILA 3CNOA 5CM9C 2CEAA 3R20A 5JHGB 1GNPA 1P6XA 1P4SA 5G40A 1TQ6A 4Q18A 4MRRA 2IS2A 1N25A 4G3XA 3TAHA 2G3YA 4E09A 1BH2A 1TF2A 2I3BA 1SXJC 1MO3A 1N0WA 1OHHA 1XP8A 2FG5A 5JSZB 4Q1FA 4Q7MB 1D9ZA 2CHVA 4HUQB 1NBMD 3LXRA 3C4JA 1R0WA 1W47A 1OXVA 1AN0A 4DLXA 2F9MA 4GOKA 3P20A 5JMTA 1ANKA 3SHFA 4A2PA 1NVWQ 2CVHA 4BFYA 1SVLA 4D81A 1ZBDA 2BMJA 4BASA 4Q9LA 3MWLA 2CCJA 4QBIA 1G17A 3NEYA 5DI9A 3D8BA 3TE6A 1IBRA 3KKOA 4EDHA 2ZUBA 4CEIA 1NKSA 3EASA 4KBFA 4JLAA 3NC1C 3WMFA 4Q5IA 2CHQA 5DI3A 2A2ZA 2DB3A 1NMXA 4M9ZA 2RGGA 4YDHB 3L0IB 3T61A 1KDOA 4MA4A 1Q1EA 2EYUA 2IUUA 3VFDA 3KFVA 4D26A 1G8HA 2VYFA 3I32A 1ZM7A 1GDDA 1WMSA 4URYR 1RE0A 1PLJA 2ZS7A 3SOPA 1JJVA 1DAHA 1U8ZA 2EVWX 3MSXA 3P1JA 5GJCA 3V4FA 1O3YA 2HUPA 2NIPA 5KNDA 2C77A 2V6IA 1HURA 1Q57A 2W6IA 3AKDA 2CLCX 2WICA 4FIDA 3KJEA 3L8ZA 4NZYA 3CRRA 3QE0A 3SS8A 2LKCA 4DUGD 4NTZA 3LH5A 3F0TA 3KKQA 3K0CA 4GZLA 5EE9A 4P4SA 2B8WA 3TW8B 2H57A 4LJ9A 1KSJA 3RC3A 2AKYA 4K46A 2WMOB 2QMUA 2GCPA 2FDCA 1ZC3A 3K09A 2BWJA 2NO9A 3KXIA 2XNDA 3ND8A 5LD2C 1BMFA 4ZI3A 1FMJA 1XTIA 3AGPA 2FV8A 2FU5C 5JHHB 2F55A 2WHXA 1AKYA 2R2AA 4AKEA 5J47A 3QKRA 4BLOA 5KOYA 3ONWA 5E95A 5EE5B 1CJVC 4U00A 2VHJA 4W5JA 2JASA 2QAJA 1AIPA 3LW7A 4MKFA 4Q1DA 3EIQA 4TSFA 4H9GA 2NTYC 2XTMA 2C9YA 1T4GA 2GTPA 2HLDD 4HDOB 4TZ0A 5EXXA 2G88A 4JJZA 1KIMA 1E9SA 1PUJA 3DZ8A 3PJRA 4UXHA 3O8BA 3DEFA 3NBYC 1U9IA 1NBME 3IPYA 1ZIOA 5C2JB 4RKEA 4B2IA 1P2TA 3FE2A 4TLDA 4W7SA 4YDSA 2OFOA 4JLKA 5FOWA 5BN3A 4PO9A 4Q1AA 3R7WA 3PEYA 1YZTA 3AP2A 2ODNA 4LHVA 1E9DA 1XTSA 2HJVA 1E2GA 4U7DA 3BOSA 4U02A 1WQ1R 4DUGA 2Z0MA 2RCNA 3HYTA 2QTVB 4JLBA 4JLDA 3X1ZA 5KNBA 1NY5A 3KQKA 2ZRMA 2GJKA 2YWHA 2OUKA 1AK2A 2WSSD 1RZ3A 2V7QA 1N6NA 4MGKR 5EUQB 1ZD9A 1I4TD 1X8KA 1T8UA 4AKHA 1SVWA 4B6EA 4C0JA 1D2EA 4RD2A 3B1VA 5KYKA 4OI4A 4WW0A 2JLSA 3KXLA 3S1AA 5AUNB 2J7KA 4FMDF 5BN5A 8OHMA 1XD8A 3T5DA 4LYAA 1KJYA 4QJ4A 3HPQA 5B64A 1NKTA 2ORIA 2FNAA 4PPFA 4PQRA 3QXSA 1AGPA 4KHZA 2PH1A 4AC9A 2IYVA 4G5SA 4XVUA 3P27A 2BKEA 2GAOA 4WZAE 1U0HC 5A0FA 4YQFA 3V00A 1G8FA 3THXA 1NBMA 2OBNA 4UJ5A 1OV4A 5FOSA 4HUTA 2QAGB 4AYTA 1OXTA 3U7GA 1SXJE 1K5GA 2J45A 1S3SA 2JA1A 3KB1A 3PUWA 1GM5A 4Q03A 2ECKA 4YONB 2VF8A 3WMGA 3T1TA 3CWQA 1GRNA 2F1HA 4P4TA 1Z06A 721PA 4XWAA 1OB2A 4LJ6A 4ASUA 4LDJA 1R0ZA 4V0MA 4DT1B 3VQTA 3JVVA 2J0QA 2KB0A 3LWNA 1QHNA 2O8EB 1PVOA 2YWGA 2IEYA 3CF0A 4J0QA 4Q4AA 3FHTA 4F7WA 1W0KD 3AVQA 4B71A 3RS2A 2IBMA 3EAQA 4PAQA 1G5RA 2QT1A 2OFWA 4B43A 2JLVA 1C9KA 4RJLA 2BKUA 4CT5A 2A30A 1FP6A 1OFUX 1G1MA 4IEEA 3SEAA 3UANA 1CF4A 1KO4A 2H92A 5L3SA 1R8QA 2F9LA 2XNSA 3AGQA 1CLUA 1QDEA 1QHXA 3H1TA 4RZXA 2ZJAA 3AH8A 2Q6TA 3CUEF 1FNNA 3PIRA 5DGXA 5K8LA 5KSYA 2B7CA 2YINC 5L3VA 1US8B 2CCKA 3T1OA 3C5HA 4CRWB 5EQTA 2BOVA 4JL6A 2WJIA 2VBCA 4II7A 4B75A 4NYJQ 4Z1MA 3QKSA 2HJGA 1F2TA 3BH0A 1LF5A 1SGWA 3CRVA 4MRSA 3GLIE 1QVRA 2GVDC 3PQCA 2OE2A 1ZYUA 3AEZA 2P65A 2IYTA 1KK2A 2VPPA 4Q4HB 4I81A 2CL0X 3BBPA 1Z6AA 3AB3A 1SVKA 3W90A 4JVNA 1G6OA 3GFOA 3WP1B 3KTAA 5TXGA 1E69A 1GOTA 5DIFA 3DM5A 1W0JD 4PC6A 4TQ9A 4X8HA 5C18A 3I92A 4DCSA 3EXAA 1KO1A 1LW7A 4Z8YA 4P31A 4AY2A 2OZEA 5K8TA 1T8TA 3IIMA 3SQXA 3OEHD 4B6FA 4PPQA 2VH5R 2VHTA 5L8VA 1NLZA 1PUIA 2J9RA 1R4AA 3B82A 2QQ0A 4TLBA 3W9YA 1OH5A 4D25A 3I4LA 2C2HA 4M2LA 1H65A 3QJYA 4JBWA 5JS8A 1EFRD 5BYJA 2PJRA 2J7PD 5C1BA 5FFMA 2KE5A 3CM0A 3QUSA 3CO5A 3VU9A 4DHEA 1E2QA 1XRJA 2F43A 4UNNA 4DC9A 2JLQA 1IXZA 1WXQA 2Q0HA 4I1OA 3K9GA 2ZJBA 4DSUA 3ND9A 4F92B 2XGJA 5EXSA 3SFVA 2EQBA 4Q7LA 5CDFE 2ZRNA 4M0LA 2X8AA 4H1UA 1ZRHA 1E1QD 4JMPA 1AZTA 1G3IA 3OFND 2F1IA 4MH0R 1DOAA 2WVJA 3EIHA 4F38A 4LGMA 2IYXA 1CBUA 4NBSA 5IHPA 3QQ5A 4P3YA 1GTVA 2RGNC 2QROA 1TF7A 3OFNA 5FOXA 5LD2B 2IYQA 3QKUA 3AF0A 4TMVA 3KXKA 1EX7A 2YYZA 5FTMA 3K0FA 2QBYA 3O8DA 3IHLA 4KU4A 2L0XA 4TLAA 2G0NA 2YOHA 4EFLA 1JEDA 1K5DA 1P62B 1VCIA 3AP3A 2ZR0A 1W36C 2X2FA 2H1LA 3KUCA 4IW3B 4PFSA 1DADA 2GXSA 3NTUA 2OAP1 4IDPA 4QL3A 5L3RA 3X1YA 1W5SA 2RMKA 3FB4A 3OIYA 4CEIB 1FUUA 4US0R 5FL7A 4LSGA 2OHFA 2ZETA 3LRPA 4UNQA 3I3SR 1QVAA 3BFVA 4BLPA 5GJWC
chains in the Genus database with same CATH superfamily
4OKNA 2RGNA 5A4DA 1XZGA 2D00A 2D1TA 1ZN7A 1N32B 3HBAA 3KHTA 3DEAA 3AV3A 1J39A 3PVSA 1W4LA 5IWAB 1J1IA 4YGXB 3WGLA 1MW9X 1Y8QB 5KUTA 4M98A 4L57A 4F45A 1F51E 1O97C 2QSUA 3GELA 4ZCSA 2H4FA 1K63A 1YOVB 2VT2A 4I8XA 3I8OA 1QAOA 4LKOA 2X5NA 2RHMA 4WLEA 5G41A 3ZS9A 5KWVA 4Z8XA 1OFUA 1ECJA 3F6CA 1J9ZA 3PRKE 5BR8B 2IUFA 1T9CA 1ZESA 2XDAA 4OB7A 4A0FA 2WW8A 4DR1B 2FZGA 1DUVG 2JPDA 3R6LA 4OXXA 3WJAA 4XGRA 4D6PA 3SZRA 4TMWA 1NG9A 5DNCA 2B8TA 2HJWA 1ZW1A 2X9GA 3FN4A 3LY8A 4NVRA 1I80A 4ZXPA 3VU9A 1ZK0A 1KNQA 3NWEA 1BCRA 1WMAA 2ZKLA 2N9UA 1BXRB 1JS1X 2D1YA 1XRMA 4QYWA 3E2PA 1A5BB 1DBRA 4R9NA 3RQIA 3TYXA 3WB1A 1DWPA 1Q1QA 4DMUB 5H83A 1RWBA 1AMNA 1T25A 4OSEA 3LQ1A 5IN5A 3K30A 1NWHA 4OHOA 5BW8A 3SDSA 4XGNA 4U0KA 4F2GA 4HB2A 2Q3HA 3M1AA 4QU8A 5GQSA 3G8YA 1RWWA 2IYSA 4UDXX 2IPXA 3FXAA 3PFCA 2FUKA 3ACDA 1WB6A 2O59A 3TLGA 1NQAO 1M8KA 3BB4A 1GG9A 1P61B 2GJ8A 1G5TA 3H8SA 1MB4A 1R9GA 1TYAE 4GFDA 1U7PA 2OM2A 1XZBA 2IF2A 3NM5A 3RYFA 3UHAA 1IONA 4G8BA 1OXKB 5BN1A 4W8OA 5CT5A 3K35A 2PN1A 1RC8A 4Q1BA 3WGHA 1V48A 4GZMA 4C1BA 2IOFA 4POAA 3HCDA 4LHEA 5AKKA 3D4NA 1SXQA 3L7YA 3EPRA 1UM9A 1YQEA 4MR7B 4R1OA 4YRMA 1I94B 1DKQA 1IATA 1VSTA 1JLSA 2DE0X 3NIBA 3AF5A 1PCXA 4ZRMA 1EHIA 1CUUA 3IP8A 5PGMA 1E0AA 1JFSA 3K70C 2NX2A 4AMZA 1SIBE 4NPCA 2NZUG 4B6QA 4LHZA 1AHIA 1WTAA 2Y71A 4DLTA 1J06A 1M8JA 1YC2A 3GLVA 1YQ9A 1RHMA 2O7QA 2V5VA 3QIAA 2P62A 3A70A 4IIJA 4PFJA 1QGED 1XZ8A 5B1EA 1B2RA 2WJYA 2X42A 1XNHA 1EBBA 4CKZA 1TW3A 2BI8A 3WV4A 3VR4A 2YS7A 1J9EA 4L1KA 1SU6A 5LM3A 4PGAA 1JH8A 4ALNA 1VSQA 3MAGA 2R00C 4I6GA 2PUEA 2VF7A 2C8JA 3KT6A 4I55A 4JJKA 4GYKA 1EGHA 4E31A 3ZXYA 5CBKA 2PVCA 5B58T 1BKYA 3OUTA 2CVQA 3W6ZA 1CRLA 4QLBA 1QFZA 4PLYA 1H6CA 2XV1A 4PONA 2ODTX 4TRJA 5HJ5A 3IBCA 5C1DA 3FMPB 2H31A 5HIJA 1WABA 3BCHA 1QTRA 4ROSA 5DTMA 3SJZA 2O3SA 4RLHA 3AVYA 3QSGA 4GECA 4IZIA 3ROKA 1GY8A 4ND6A 1EJ2A 3UK1A 4BFLA 3MHTA 4PYOA 1PK7A 3BSFA 1CJTC 1MABA 2FP4B 3C14C 1ZU5A 4NG4A 5JRZA 1F0NA 1W96A 3X1MA 4F6LA 3X2SA 2P4HX 2ZT8A 1M1YA 3QE4A 2JGNA 4LZWA 3VR6A 4JI2B 3T1QA 2EATA 2WSSA 5AQ1A 3CBQA 4ALMA 4KLNA 4MO9A 1FZTA 2C3YA 3P0RA 4XB1A 4DLVA 1RJDA 2AWOA 4M1KA 2ZBEA 4NZ9A 4BGVA 1N6LA 2E49A 4AMGA 1YKGA 4PYLA 1FOEB 1S02A 1C4XA 1F4VA 4JITA 1DXQA 3N2GA 3GXBA 3P5BA 5DASA 1UBUS 5TT0A 4WECA 3V1LA 3P96A 2BM0A 1EX6A 1Y81A 4K6GA 4C3UA 4GF5A 5B58C 3O8RA 1SHUX 3IIIA 2OILA 2XA2A 2ZRQA 3L05A 3ZK7A 1J8FA 1XXHB 2FE1A 2A9KA 2GPYA 2B2CA 3LQRA 3UH1A 4AO8A 4RVFA 2GPJA 3N5CA 1W73A 3WGVA 4GPAA 2HWUA 2B69A 3B1WA 4TMZA 3JQFA 4RK0A 1YVPA 5J4HA 1U2TA 2R60A 1ENPA 4F5DA 1BMTA 2PR2A 4YQYA 1NDHA 3MGKA 3I42A 4MJLA 2R3SA 2WYIA 1ODJA 3ZYZA 3KQUA 5U4XA 5CNIA 1H0SA 5B2ZA 3UV6A 4CBVA 2GI4A 3BA1A 3PPXA 4NEQA 2NUTB 1JTFA 3VR6H 2BSXA 3E8SA 3ILVA 3JD3A 3KJHA 3JRNA 2O2YA 3NVMB 5J5VA 3UPDA 3K05A 2DH6A 3THRA 3BTSA 1JIJA 1IHOA 1UCFA 3E3NA 4Y2VA 4G0XA 5EZ5A 4ADSG 4B34A 4FE3A 3MS2A 4MLZA 4D02A 1B0UA 2PNFA 3ONVA 3W3ZB 1AXRA 1YUNA 4EG5A 2XZLA 3I3OA 5EKSA 4GQAA 2BMVA 2PCLA 2WT9A 2XUOA 3EA0A 3D8NA 3H5RA 5FNZA 1HKUA 1L3IA 2P3OA 2DPLA 3TKYA 4BNLA 3WVNA 4CF5A 4BEBA 1E3WA 3VV2A 2FPGB 4H1WA 1IVSA 3R40A 3LLUA 3JZIA 2XB2A 3R6GA 3Q0EA 4OUDA 1AF7A 1F8FA 3DDNA 1L7MA 1T2EA 4N01A 5L6LB 4JJ4A 5E9WA 3UTDA 4R0MA 3A26A 3KE8A 3DQZA 3RBZA 3MBIA 4UD2A 2JAHA 2VTBA 3WNDA 3S2EA 3RV3A 3MJCA 4GYJA 2XTNA 2O20A 3LDHA 2FPWA 4RPIA 2O8CB 1XU7A 2XSZA 1IG3A 1V8BA 4ZQFA 4Y2SA 4U5XA 3A3OA 2IH5A 2FN8A 4IG9A 1JU4A 2G4CA 2JBAB 4P7JA 1ADYA 3I52A 1OCEA 4JUBA 4PNEA 3MWJA 1TAUA 2ODBA 5DBEX 3C1AA 1OROA 1K3TA 4MUJA 3RVBA 1GKYA 3E35A 3RS5A 1U7WA 5AICA 2ZJ0A 1OFTA 2RDMA 5DLQC 3LYLA 4K1LA 4D7AA 1JHZA 3KZXA 1E2NA 2RGUA 3IMGA 3V9PA 2HW8A 4FYXA 3HWRA 3D2CA 4IZ6A 3RUDA 3EMDA 9LDBA 1HZZC 5DYNA 1RYYA 3ABRB 1D1QA 3JWGA 1S2GA 3DWEX 7GPBA 3HXMA 5JD5A 2JGRA 2W6ZA 4CG1A 1SU4A 3A10A 4YAOA 4AN4A 4HV4A 4OLBA 4TOIA 5EJ8A 4EJ0A 4KYUA 2R1VA 1VIDA 1NM5A 3PFIA 5BWNA 5G1OA 4MIEA 2F3RA 1E9RA 3ZHQA 4TV8B 3P8ZA 1K6XA 4ZYXA 5CCXA 3KYJB 3SK0A 4R9RA 1KR2A 4MHSA 4KWEA 3KQNA 2HF8A 4BX2A 2Z6QA 1VOTA 1TTTA 4G5FA 1BU5A 2YJ3A 4KK4A 4Z53A 2YNMA 2ACEA 1C30A 1PFWA 2CBXA 1HE3A 2JVJA 4M4SA 1E3DA 1U28A 2G71A 2IZ0A 1WW2A 2O2EA 5K4AA 2BHTA 1VKZA 5FL7D 3EIEA 4F60A 2A1TR 1JF8A 2DGDA 4WT7A 2YFYA 5BSGA 1Y3FE 5IT9A 2BLNA 2DKFA 3FF4A 4IAOA 1IZ0A 5SZJA 3IT1A 3IV6A 5LU8A 5KEIA 4MW6A 2JLYA 3R0VA 5TGDA 4TTRA 4UTNA 2BUBA 4G84A 4WK4B 3IULA 1XJCA 2EGHA 2F7SA 3DTNA 3WRWA 3DDCA 5BYBA 3GMDA 5KAMA 1BMDA 4R7ZA 3TGPA 3VGPA 3TW4A 1XHFA 2VSXA 1S8OA 2DPXA 3AKCA 3A1TA 1N9GB 1KZ1A 2R86A 4LPKA 4G1BA 2XSZD 3PUVA 4C3ZA 3J7AC 1KBZA 2JGAA 4FI3C 4RKQA 1EAYA 4YP7A 4LDRA 4F21A 4C30A 5B57C 1A96A 3G6KA 1RM4A 2FJPA 3WRYA 4G86A 3F3YA 3TSWA 3NTXA 3VX4A 4ETIA 2O8FB 3T5CA 4RE6A 5DHTA 5GINE 1UK8A 1VHJA 5CXSA 3OTIA 4B44A 1MRNA 1ZKDA 3JQPA 4RTQA 4Z4FA 2Q1YA 4H4DA 4AT1A 5CB0A 3W5DA 4GZ5A 4D3XA 4JUCA 4ZC8A 3U3KA 1Y1LA 3F6RA 2FN4A 1D8TA 5LZ2A 1O97D 5KCMA 1KI1A 3X1WA 2RJNA 3B6EA 1KDRA 1T10A 2A94A 3RCBA 5CH8A 2D1RA 3NIDB 3QMWA 4HF7A 5J5CA 3ROPA 1Z18A 3V3TA 1GSOA 3WQRA 4QAJA 4TN1A 3WK9A 4PAMA 3QMMA 1H93A 3D6TB 4KN9S 3PI7A 4L02A 4TLLB 2VAWA 2LXNA 3WLEA 3KLBA 4DM4A 1IXRC 1GGEA 4DLLA 1AS3A 2DQKA 4JKOA 3BD9A 1WO8A 3LPMA 4LHWA 3WISA 5K8CA 4HEA6 2BISA 3H11A 1KO7A 2GSDA 2HV9A 4KEAA 3ZQ4A 3GLGE 3B6IA 1M7BA 2YJ4A 3QGMA 4RMHA 4L15A 2H51A 4ZXFA 1Z5ZA 1RM0A 1US8A 2NSLA 1YRHA 5DHPA 3OIUA 4DSOA 4NH4A 4M0PA 1M6VB 3BWYA 5IAGA 4Y2GA 3WKBA 2P9HA 4ENRA 3FDZA 1M7HA 4OBEA 3WMWA 5KJFA 4WY2A 4LW8A 3ONNA 5J1TB 2ZFUA 3SKXA 4G9EA 1HA3A 1I1OA 3BKWA 3R0XA 1I0IA 3AIOA 4KSCA 4TL9A 1YTUA 1ZM9A 5AVVA 3KOMA 1GRQA 1ULHA 4EFKA 1T6ZA 4P7KA 1IUKA 1R6AA 3E6AA 4J7XA 3V9AA 2C2ZA 4FHDA 4RXUA 4UBMA 3ILXA 3IE0A 3STTA 1UBRS 1RI2A 2A5GA 4L2IB 4TYMA 2RHGB 5TLSA 1XAGA 2VJNA 4A82A 1CE8B 2JDID 2XTJA 1TQHA 5K99A 4CDRA 3L07A 3N05A 3FKSA 3KO8A 4QBTA 4XIJA 4DW8A 1LY1A 3M5CA 3OZBA 3ZE1B 3MD0A 4RFLA 3C98A 2HFJA 1A27A 1TADA 2C2KA 3G5TA 3QPBA 1D0VA 2AYZA 1JR3A 3KB6A 3IQZA 5AJVB 2FPIB 1VE6A 1I13A 3UCXA 2OO7A 5KMGA 4MW5A 2ZRKA 1F06A 3ELWA 4J3NA 1V6AA 2YUIA 2R4QA 3ELYA 3IUMA 3SBXA 3T99A 1DOHA 4FD2A 1YC5A 4RGVA 3RAPR 2QMZA 3OY2A 4B3FX 4EBBA 5IJ0B 2AFHB 5KQMA 4IS3A 1MC4A 2OV3A 4AZ0A 4UAJA 4UM7A 2J30A 2C8KA 1CNFA 1XCBA 2TRSB 3PX7A 3BGDA 2JZOA 1ONSA 2AQKA 2XNCA 4HADA 3T54A 1BDMA 5HGJA 3H5OA 1IEVA 4DIMA 3T1HB 3QI2A 4L16A 3VTAA 1ZITA 3COJA 4N0MA 1AMOA 4OAQA 3RIMA 2OBXA 1R7RA 2I76A 2LRHA 2QRHA 1RXEA 4FFRA 1II8A 3CYFA 2DUMA 5CT9A 2GUWA 2HR1A 1CXZA 1QLWA 2GWRA 3FMIA 4LY0A 1A8QA 2WWIA 3AFNA 5TQ0A 4C06A 4EW1A 4YMVA 4NYJR 2Q45A 4BIMA 2P5SA 3WRXA 5CDHA 1ULTA 1SM4A 1MH9A 1VLJA 3T41A 3OZRA 2IS6A 4B31A 1MFPA 3HKEB 1VFNA 1J8YF 1WPQA 4NFLA 3TQHA 2EP7A 2IS1A 3TCKA 4LTMA 9ATCA 1M2WA 2Y4NA 3WNCA 4PV7A 3R9IA 3BFPA 4JROA 4CM6A 5HF6A 2ZRBA 1C0EA 5C5DA 2JHAA 5ED4A 1ZZEA 5DHRA 2WAYA 1V11B 3Q6MA 4MVJH 2FMXA 3E5HA 4JJ8A 5CHYA 4EHLA 1Y5LA 3T8YA 1M6EX 4D4HA 1NJ5A 4O1MA 1P0IA 4ZDKA 2BJHA 4XEHA 1HNWB 4ZYYA 3FZQA 3K5WA 5DRYA 2XVAA 2ID7A 3BF8A 5AJYA 4ARIA 2WTMA 4GT1A 2J46A 1P4AA 2B1IA 2QLMA 4HAYA 3K7EA 3TM4A 1XZKA 1G8JA 5JASA 3CVXA 3T0GA 1RQLA 3E22A 4LNUB 1EFTA 3RYHA 5JEDA 3Q3GE 5JADA 2PKQP 3JAKA 1E9CA 5FUBA 3GCDA 1L5QA 3F8TA 4MK4A 3N0TA 3VNVA 3SHWA 3IRVA 1L7PA 1M2JA 1XWWA 4I8DA 4YJ2F 4YRLA 4Z5XA 1P31A 1Y8RA 2G80A 4KLZA 5EZSA 5B1YA 2JK1A 2UUAB 3U61B 1O6ZA 2PMFA 1D09A 2YXNA 2L18A 3RKRA 1J0XO 4O1HA 3SCZA 4KVZA 4EF6A 2OUIA 4MA5A 3IAS6 3M6VA 1JLMA 2V96A 4WK2B 1NV8A 1XNRB 4ZCIA 2QG6A 4JGBA 4IZHA 4Q05A 3U1TA 4PTYA 2XZOA 1GZ4A 5LQRA 1ST3A 1YB6A 1YUMA 1OQAA 1DKNA 1YS9A 3MCVA 4MWTA 4TXJA 5FLYA 5IDVA 3TPZA 3IEPA 1QORA 1P1IA 5CVJA 3UNXA 3VHXB 1XMQB 2B37A 4OYYA 4D98A 2IC5A 4QQNA 1IOWA 3AJRA 4KNYA 3W2EA 3WLJA 4XIYA 4K8RB 3O26A 3RABA 1M6HA 4J0KA 4GHWA 3WO1A 3L41A 3QU9A 2P9QA 4U6NA 3R77A 4WCFC 5AW4A 1ONBA 2ZJOA 4X41A 1ZCZA 2PGDA 1QGUB 2QTHA 1GILA 3G79A 3LM8A 1XNGA 4KWCA 4L5YA 4XA8A 3RODA 4MDEA 3B1XA 2ZYUX 1NP3A 1PEKE 4F4FA 1FFYA 1OLUB 5DF1A 1C0LA 3ESDA 1ZICA 2WJHA 3DDWA 4HLQB 5AW6A 3DT9A 2YWDA 4E0BA 4DMRA 1NIJA 4REQA 2JI6A 5DGHA 4UHDA 5FPKA 3GDFA 2PX6A 4KXUA 3FFAA 1Z0JA 1JQ3A 1W85B 2CE2X 5EZYB 1JL3A 4GPZA 3KZ1E 4NHOA 3NAQA 4A10A 4FNAA 4L8LA 5KQSA 3GV0A 3VHLB 5T3UA 4EA9A 3CX4A 3GDWA 3CH4B 3HJRA 4Q47A 3WNBA 1N36B 3M0EA 1H0RA 3ENVA 4MQFB 4F6CA 1LC3A 3Q3HA 2GZDA 4KO3S 3UJNA 2KHZA 4OXNA 3HG7A 4O5OA 3UHJA 5SZHB 4M1SA 4YREA 2IY8A 5E0OA 4MUIA 1ONNA 4PE5B 5EFZA 2ZSUA 2ZWVA 1A1VA 4X6LA 5DCLA 5LLTA 1A1SA 2G9UA 1KSGA 3RIHA 4GDFA 3OM9A 2HT1A 2P2SA 2VTBB 4KRXA 4MYTA 1Q1NA 2ZIUB 4ZODA 3TZQA 2GZSA 1Q2UA 3WBFA 3BRWA 4MO2A 1V71A 1XB2A 1CX9B 4KLAA 1W8IA 3I2IA 3BGIA 3GPLA 5JSHA 4E22A 2O7RA 2VCEA 2OOSA 2NO5A 4FZRA 3VBCA 4DDKA 2RE8A 1J6UA 2RG1A 1MJ5A 1D2AA 1DI0A 4H17A 3GRPA 1L1FA 1U7OA 1TKCA 1XQ9A 3GG9A 1Z5VA 4IH1A 2Y1CA 2I2CA 1JKFA 3MW8A 2H1SA 1WL8A 3R0IA 4DN6A 2R8EA 3QLJA 3BJZA 4QBGB 2J7PA 4AS2A 3BWCA 1R0RE 5AUPB 2CXSA 4DXHA 5AESA 1W9MA 5AM2A 1PJTA 1MGPA 3ZHZA 1AHHA 1JG4A 5DEOA 1IZ8A 1UPBA 4IQGA 3W8FA 4JXZA 3DTVA 3Q9NA 2JFHA 3UHPA 4M1YA 1EI9A 4NJEB 4HVCA 4DAEA 3Q41A 1HQKA 1U2PA 2EBWA 4FYVA 1G0OA 4QYIA 1MX1A 3AEYA 4ZV9A 3V55A 2VK4A 4DZRA 2CXPA 4DWVA 1N3IA 2VHWA 2SKCA 1GZ6A 1MB0A 3RWBA 2CC2A 5ELLA 1AK1A 2QS9A 4M21A 3MERA 5U9CA 4TT3D 4J76A 821PA 1AE1A 3TVDA 2VQSA 4MS3B 4NDNE 4NR0A 3O38A 4D43A 1WTCA 2Q0XA 3E4DA 2VP6A 4W5HA 3EOAI 2PPVA 5EWLB 4YPFA 1T2AA 4MROA 5LYYA 1YACA 3N53A 4WOKA 4UHEA 2XHZA 4FWBA 1ZL2A 1YO6A 3LWBA 2X3UA 5K0TA 1ZJ4A 3EZ6A 1Q74A 5FOTA 3VZRA 1HDXA 4XVHA 3RTAA 5CB4F 2EFJA 5JNRA 1POWA 3G7NA 2MSLA 4P5DA 1VDZA 2PKWA 3F7TA 4Y1GA 1Z8HA 4YJHB 5JY6A 3CNBA 3OTOB 1XC7A 3DB2A 1HSZA 4HD8A 4P22A 5IH3A 5M3BA 3NHRA 3H7IA 2J9YB 5FHRA 4F93B 3O2NA 1L5YA 3QUTA 4IBOA 4JJIA 5CJ2A 4LJ7A 3CXUA 2I6SA 3W2TA 4D3FA 4Q4HA 4PTLA 3L5OA 4QOGA 3RRJA 2C2WA 2DU8A 3I0ZA 4LRXA 1EAMA 5AT1A 3ZBPA 1XPRA 1GPLA 4J0GA 1SUIA 5F5LA 3S0JA 1W44A 2WF7A 1MNQA 5IVPA 1SBIA 1YK0A 5LQJA 3OF2A 4FYJA 5IH7A 2DX7A 3HGQA 4XVQA 1HG0A 1KMHB 7ABPA 3ONDA 1CJSA 2LR0A 2GYWA 3P9PA 4MIOA 1XXHA 1N7JA 3ITKA 3PT9A 3E18A 2H52A 3DTVD 3EFBA 2EOAA 3BE4A 3IL2A 3UMRA 5ESXA 2FZKA 4JJGA 1E20A 5AKEA 4D82A 5GJVC 1WOYA 5FXMA 2D3TA 3C6YA 3Q4GA 2G8LA 1GA4A 1K8YB 4EG0A 4I6EA 3V4PB 1EBFA 3CKLA 3D64A 5KVCA 3E9EA 4K2HA 1BDJA 1CUWA 1U90A 1WUKS 4MLDA 3SSMA 2FPPA 2OSBA 2NACA 2FZEA 1Q1BA 2NPFA 1V26A 3EPHA 2PS1A 2R1ZA 4WINA 3BRWD 1N77A 1SOVA 1FXWF 3NBUA 2VYVD 1QONA 5CD1A 1IM8A 2WM9B 1QIMA 1E58A 1OMOA 1V1RA 3TLCA 5JXHA 3DTYA 1UK9A 2A86A 2ACKA 4KAFA 2AOWA 2I6TA 2YHUA 4URZR 3LBHA 1YOBA 1DBSA 4LPSA 5E3HA 2OP0A 4FYYA 1NP7A 4AG6A 1Q22A 3L40A 1U9YA 2FZLA 1LZKA 1OWNA 1B4DA 1E9FA 1ETHA 1M66A 1MR3F 4HY3A 3FB1A 2GZ3A 4X5OA 3B9RA 4NE2A 4NONA 5CCDA 5A4FS 3CHYA 4IIDA 5JT1A 3UT5B 4BJ1A 1BHJA 3B1YA 3KE9A 4PZEA 2XUJA 1GAWA 1PJRA 3DHEA 3JRWA 2ORVA 3K96A 4DQKA 1G5PA 1UT5A 1ONOA 4CLHA 4MRMA 1HE2A 1OYVA 2QJWA 3GH1A 4ZRDA 5AXAA 2JA2A 3ZH2A 3VX3A 1YDWA 4JBHA 1TJ3A 4GOJA 3L2OB 5F78A 4YIKA 3AI2A 2G9ZA 2BTOA 2Q4BA 2PX0A 2ZPUA 1WXDA 2X0NA 2ZROA 3NHBA 4U2EA 5CVVA 4EIWA 3BGWA 2GHIA 3IDOA 1BD3A 3GPBA 2ZTUA 3NHYA 5E7QA 5EWMB 3M1YA 2JJQA 3AKYA 2W7TA 3H2ZA 4KWTA 4MTCA 4KH0A 3UJPA 5C5IA 4CNQA 1T3SA 1K8ZB 4YC7A 5I8WA 1NI3A 2ZT7A 3N59A 4A6PA 3F4LA 2JGMA 1EFAA 2Y9MB 3NM6B 3EF1A 5HQ3B 4KR7A 2ZRGA 3W7BA 4WOPA 3R6WA 2A78A 5G1PA 4EG8A 1J49A 1E5VA 2VUUA 3A1FA 5HTKA 2WKPA 3R76A 2EU8A 5TNXA 2FPIA 1DUIA 3CURA 1W30A 3OZFA 4KO8A 4L0MA 4MW9A 4BKOA 1NVVQ 4KN6A 2PU7A 4X6XA 2OKGA 4ZQGA 4R7TA 2JFBA 2LNDA 3IR7A 1A5ZA 5BVHA 1R8SA 2ZSEA 4I9NA 4PAGA 4G23A 1GP2A 3I64A 2YZNA 3SIRA 2V65A 3I04A 2XB4A 1UBMS 3ADKA 2R5WA 2ZB7A 3OZGA 1C30B 1B43A 4RPGA 3V46A 2PKRA 1PBTA 1HRKA 3O3OB 4S1WA 1IXSB 5BNTA 4BP9A 2XQJA 3DDSA 1Q11A 3PYMA 4N12A 4PQEA 4RM3A 3KVVA 1RDFA 3S68A 3IO5A 1JHAA 2NUAA 3ZDXB 1P45A 1JIXA 3LPAA 4C07A 4YMTA 1B15A 1LWNA 2VJMB 2UZ1A 1WF3A 4GD3Q 1PW7A 2PT9A 3FI9A 3GQVA 2BGGA 3TJZA 3DOFA 2ZRFA 4Z6KA 2UYYA 1AU9A 4WN9B 3ZWAA 1O5IA 1OI2A 1SD1A 1T5HX 3NOXA 4FYPA 5CIWA 1T9DA 6REQB 3OM1A 3P4XA 1C7ZA 1KJQA 3VZDA 1F5SA 2JC3A 3OO0A 3A9TA 3MTDA 3R7WB 4EJMA 1PX2A 2I29A 1YVDA 1JLHA 3G5UA 3OM0A 5C9ZA 4FT4A 2Z8YM 2HXYA 4A8JC 4LSZA 4Y2XA 2V6GA 2ODEA 3I23A 2WP8J 1Z6YA 2QXUA 4HH3C 3CRMA 2BFDA 3G2LA 5KNBH 4C4ZA 1VMDA 4TSFD 2I22A 3DV9A 3U4GA 1XP5A 1GKUB 2FKNA 2K4MA 2ETVA 4RNCA 2R6R1 3EC2A 4E4TA 4JXXA 3QUQA 4Q4JA 5CA0B 3SWWA 2YVKA 2B6NA 4MV9A 3H16A 2PJDA 3A1CA 3FDXA 3TJMA 3WGZA 1PYGA 3I2JA 1V5WA 1FUYB 4ER3A 3O4VA 4DPLA 2DY0A 2J59A 1JUDA 3T4XA 1ZUNB 4KXWA 1AS2A 2PY6A 4E09A 2CFSA 4AS3A 3V4VB 1HY3A 4OB8A 3PDIB 3JAMA 2YVAA 1EBUA 2AFHE 1G0NA 1NU6A 4XXHA 3RKUA 4BMXA 1R12A 1VBMA 1XYGA 4TUYF 1SBHA 2GRJA 3ESQA 4DGSA 3G9TA 2VRCA 1C3VA 3UMGA 1P5JA 4KW7A 4IVQA 1IYZA 2R6FA 1N1GA 1U3UA 1KAHA 3R4VA 2VPYA 1V2GA 2O8BB 4EH1A 3O47A 1H5QA 5ECGC 5ER9A 4PSUA 5AW0A 3FZGA 1DRVA 1DMRA 1KMNA 2HEIA 2OV2A 4BVGA 3EOBI 4G0WA 4N0EA 4CQLB 3TIFA 3G0DA 1N5IA 5DEIA 2G1AA 3N39C 4KXMA 3A6KA 1J07A 5D2CA 3KV1A 3U6KA 1JEQB 2DKOA 4C21A 4CMGA 1HQYE 4FIZA 4JGIA 2GEVA 1RLOA 3MAJA 1M2NA 4BZXA 5EEGA 2EDAA 1V47A 2M6SA 1HUQA 2Q4TA 3NTQA 4CQMD 2C5LA 2D06A 2MIIA 4CEJA 2ZR9A 5EHIA 2QRMA 3NHAA 4GGPA 4JP2A 3W8RA 2FCRA 1UBKS 4FJ0A 1G3RA 2GO1A 2C0CA 1CD5A 2D4AA 2A0XA 1ZXBA 2H4XA 2HBZA 2V3VA 1Z9BA 3AFGA 4JHXA 2FLKA 1PSZA 4FFOA 3I72A 3IKTA 4E1BA 2FMIA 4QUJA 3Q3CA 3WGGA 3RS8A 4ETWA 2RK6A 4HP8A 4MAMA 1T8RA 1V5IA 5ENVA 1T9BA 1MPTA 2C9ZA 2PL1A 2YQ5A 1A4IA 3OWHA 5HUJA 2XADA 2CVFA 3JALA 1XTTA 1YZQA 3NOQA 2HHAA 4LKRA 4EPRA 1CUVA 2AEMA 4R31A 4CMEA 1Q3TA 1M73E 2GARA 2QZSA 4PBTA 4BNVA 4JQSA 4QUHA 1QYCA 3ZLJA 2ZB4A 5A2GA 1H8HA 1SVMA 3QVGB 4N3NA 3DZKA 4PANA 2OCDA 4KNWA 1F2UB 3G82C 3TQQA 4C2BA 3NAZA 1SR8A 2CD9A 4GIBA 4ALKA 3ITNA 3LA6A 4EA8A 1I2CA 3H19A 4QC2A 4BIIA 1DKOA 1IFXA 5JXJA 3PF8A 4GM1A 1R8YA 5I9SA 3OPNA 2BEVB 3IDFA 4Q1CA 2VSNA 3TB6A 3CKYA 2A8YA 1TCBA 2VO1A 2XD4A 4K03A 4C4TA 3G5MA 3LBIA 5ADWA 3NHSA 5FADA 5JC1A 1QVZA 3GAAA 5DBOA 4BB6A 4CMCA 2PAAA 3QLEA 1RYFA 4M3NA 2X8BA 2NXCA 1WD5A 5KWJA 3EVDA 4RL4A 5KX5F 1CJMA 2QL9A 4BQPA 1BXZA 4OMFG 2V9PA 2XAUA 4DR3B 4ROTA 3IV9A 5DW3A 2OGSA 5ADHA 2WJGA 3AF6A 1S9HA 1QHYA 2K2WA 1QLHA 4I2VA 1F8UA 2IHJA 1J0CA 4FTWA 4KITB 1UANA 2W98A 5KQGA 4ZVRA 1Z6XA 3A4NA 5DT2A 1KU6A 1C9JA 2NM0A 5BUQA 4Z1MD 5BT9A 2G5PA 4HVLA 3M2PA 4NXNB 3V4OA 3GEGA 1OLOA 1KOLA 2WJVA 2FEKA 4MI1A 2NP6A 3HCWA 3T52A 2W6MA 1XALA 2GM9A 1KH2A 2MYUA 3HCBA 3MJDA 3L7BA 5EOVA 3GP8A 1F7VA 5A04A 1AGYA 1SC1A 4KXQA 5E6SB 4B2LA 3AV0B 2QYSA 4D3YA 1F5NA 1WUIS 2QZJA 1KO5A 4ND4A 1F0KA 3GOHA 4JS0A 3PEVA 1MIOA 2GZAA 1O96B 2ZYVX 4UHJA 3PGVA 1MQ9A 3PYXA 2CWWA 4BAZA 1F8XA 3MYYA 4QA9A 4DUYB 4ESOA 3TR5A 2I3GA 2WABA 1KAOA 3QEMB 1J0AA 4KJXA 5CVCA 5AUQA 1LX6A 1CDEA 1L4MA 1YDMA 1XD2A 2QRGA 3L7KA 3LW8A 1X1EA 4C08A 3GFVA 3QVWA 4YJHA 4EI9A 2BW0A 3N0VA 1U5BA 4I19A 3TL3A 1XVAA 2YN4A 4BQSA 4DXDA 3TMKA 2UUPA 3KOZA 5EQJB 1SQSA 2ON6A 1YBMA 1D2HA 2AR7A 1J90A 2D13A 1LJLA 4JSRA 2AG1A 4XWKA 3OAAA 1NW7A 1B1CA 1R0CA 3THWA 3ESXA 5G3YA 4ZVNA 1K1EA 1PDOA 4K81B 4AAYA 2EFGA 3LC7O 4HR7A 4INZA 5BOVA 5BMVA 5KYNA 4C7MA 1FYWA 4IEIA 4ESVA 1G63A 5HDQA 3PC6A 4D0GA 1KE2A 2IYZA 1I5RA 3IOMA 3QG1A 4UDOA 4CKCB 2XBLA 1JFTA 1N2SA 3OCCA 1AQYA 2GS9A 1NUSA 3A2NA 3LL7A 3M49A 4GX2A 3FTNA 3RG2A 1ORTA 3WLPA 3IEMA 1YR9A 2NZ2A 2XVYA 2A1TS 5KYXA 1Q83A 4JFRA 1NW5A 4A03A 3A3YA 5D3QA 1EP1B 2XMRA 1E5XA 3PX3A 2FSIA 3C7DB 2JBWA 2ZR7A 3L01A 1NONA 4RKWA 3ZD9A 3X44A 1QZZA 3WXBA 3UG7A 1KH1A 3CPHA 1YXMA 4EJSA 1PJSA 3W5JA 2NG1A 2ODQA 2BSAA 2I3AA 2Z56A 5KZMB 2IYWA 3BDAA 3VJRA 2JEYA 2C7BA 2Z30A 4J9UE 3M3HA 4NRDA 4RV9A 3OECA 3E81A 2RH4A 2HJ9A 5TPWB 5J58A 2ZTMA 4DIFA 4V0LA 4DB4A 1X7WB 3C74A 1AQNA 3KZCA 2H59A 4UTZA 1IVYA 1OGIA 1QO0D 2BJVA 3FRHA 1DE0A 3LDFA 1TM1E 3R3WA 4HZUA 4RU1A 3LBNA 4PVCA 2WHRA 5EHNA 4AG3A 2CB0A 3K2IA 3O73A 3HNRA 2QDXA 4TMYA 5K1ZA 1YRAA 4O8ZA 4LG1A 2AXPA 4U2CA 1PNRA 3AR3A 4UUMA 2Z58A 1U9JA 3W1VA 4XLLA 5AI6A 4BNYA 4NLLA 4I9GA 5IABA 2A0YA 2B94A 4AP6A 4QFMA 2PKXA 1O2DA 2HDNB 5FB3A 5BN4A 2B1QA 4TXLA 1C7RA 1NSFA 1PSWA 3UT5A 3PC8A 4F0JA 4ZQBA 2R4UA 3CPJB 4IGEA 4M9SA 1G8MA 2ZBRA 2L69A 3I73A 1AKMA 4XDZA 2FZWA 2GJAA 2W6JA 2YHAA 1VP3A 5ICSA 1G8KA 2PQMA 1PR6A 2YS6A 3HKDB 4ZVOA 1ZO8A 3PD1A 3NPMA 5JCOA 4QOEA 5I7HA 4OGKA 2QRVA 1Z8NA 4L6IA 1F2TB 2PANA 1B0PA 4JEUA 4K9LA 5BQ5A 4B4WA 5JCOC 2D7JA 4I55F 5AXCA 4AL4A 3A4YA 3FG9A 4WUTA 3EH2A 1XJWA 2DSNA 1X38A 4WCVA 3WQQA 5EJ4A 5AW1A 1AG9A 1FPQA 1CVRA 4YRKA 4PC1A 5TEVA 3S1SA 2LCIA 1FTGA 3R1IA 1MUUA 3RC8A 4IGAA 3QXJA 4L0QA 2QZZA 1OI7A 1PR5A 1SXJB 4Q7JB 2WOOA 3SKVA 3ER9A 1ZVQA 1DTWB 4Q1VA 1QE3A 5JH7A 3DHWC 3NX4A 3CUWA 2BEKA 3QZUA 1OTYA 1E6MA 2VAMA 1PR3A 4ZKDA 2PWPA 3K73O 3U44B 2XMQA 4FGWA 1FDTA 3JCZA 2YY5A 2CNDA 3UJ6A 3DC7A 1RQRA 1X1SA 5FHQA 3ZD6A 5KJCA 4LOLA 4QUGA 4G1MB 5AJTA 4AK9A 1T1RA 1YA4A 3BD6A 2XBMA 1SB8A 3DXYA 1QPGA 4PFQA 2QORA 4F8EA 8GPBA 3KKZA 4CFSA 5BWMA 5K4GA 1KYYA 5J23A 2QD3A 1T24A 3G8DA 4WLOA 3I30X 4DCPA 4MS4B 4TXMA 1LS6A 3GWGA 2ZSJA 4TYNA 4D9BA 4HDCA 2QVLA 2RD2A 3GEEA 5K3SA 4JVMA 2ZT6A 3A6DA 3EZXA 3R5HA 1WMDA 1YH3A 4H1TA 4NZNA 1N6OA 3WHLA 5IJAA 1JJ7A 3KYDB 4UVHA 4WNAB 4MITA 4ZVMA 2ZI7A 2JFUA 5IDQA 4FQ7A 3ZE7A 3RYCA 2IEBA 2CZQA 4W1PA 3VNBA 4EJSC 4C5BA 3MB5A 1ODLA 3KDSE 1L8QA 1DKUA 3W79A 3H17A 4AZWA 4D4KA 6CHYA 2A3RA 2UZ4A 2BC9A 2IXBA 5TF0A 1OAOC 3UJBA 1QXSA 2XJ4A 1YQUA 3QBVA 3FCUB 3UXEA 3JQEA 5T3YA 5K03A 4MVJF 2ZG6A 4Z3OA 1LRLA 3ABIA 1YB1A 3MWEB 3Q5DA 3A7DA 4I4TA 5K5EA 5H02A 3W8DA 5TDHA 3WNVA 3CX3A 3E1KA 3GD5A 4LBZA 4ENVA 4LY3A 2UXCB 4IKEA 3TNDA 2PJUA 1OYWA 1SPXA 1SU8A 1MORA 1T0HB 1ZAKA 2NU9A 2WG1A 4KXFB 3MSCA 4W5OA 3IP9A 1HTTA 1C7JA 2JBHA 2QX9A 2WSMA 2GHRA 1SHZA 3CW2A 4Y6QA 3T12A 3RK4A 2D3WA 3GLIB 5IPFA 4MARA 4Q3LA 5DN9A 3NDRA 4DFDA 3VPXA 4HLNA 2O2HA 3T1VA 3PENA 3UJDA 2YV5A 4ZQCB 2GCOA 2V7BA 3KOXA 3LCRA 4KQHA 3T4UA 2Q3LA 1QM5A 2ZYWX 3IT0A 1RWOA 1XMPA 3JQQA 3NBFA 4FB5A 2WTBA 3I8SA 4CLRB 4DR5B 1YRBA 4R3NA 1X8LA 1U2DA 3PICA 3ENWA 5AKJA 5LFAA 2WV9A 4WFQA 3SDZA 4II3A 4M7RA 1KI3A 4OP1A 3FYHA 4HQRA 4TTVA 4BNDA 1F0PA 3DOOA 1NBIA 2ZPTX 1XNJA 2FK7A 4XB2A 2BTEA 3ZGYA 4OMCA 4DPMA 2H2AA 2ZWOA 2Q4OA 3GJ4A