4FMDF

Espg-rab1 complex structure at 3.05 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
164
structure length
149
Chain Sequence
KLLLIGDSGVGKSCLLLRFADDTYTISTIGVDFKIRIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords EspG protein
total genus 36
structure length 149
sequence length 164
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdF00
5JCZA 3B5JA 4G5OA 4B3BA 3LX8A 3UKDA 2RAPA 1AK2A 4FD2A 4LC1A 4IHQA 1S3SA 3ZS9A 1Z0FA 2O8EA 5J47A 2R9VA 4D80A 2IS1A 3AKDA 2IL1A 1IY1A 5DO9A 1F60A 3OAAD 2GILA 1F5NA 4MYHA 4UNRA 2IK8A 4RD1A 4GL2A 1EFCA 1Z22A 3CR8A 3PEUA 2IWHA 2BWJA 2D2EA 1F2TB 2W0MA 1RYFA 5UKDA 4TYPA 1DO2A 5SZKB 4JBYA 2JCSA 3H84A 4CEJA 4MKHA 2P3SA 5TARA 3Q85A 1SGWA 2QSZA 4E07A 4MRRA 3SDZA 2ODWA 2VHTA 1NBME 4D0LB 1S2MA 5JWOA 3RSLA 4B3DA 3T15A 3EPLA 5JLJA 2HLDD 2IC5A 3U3JA 3KUDA 3QBVA 5AJYA 1ZUNB 2XSZD 4OQMA 1VG0B 1NN0A 1B0UA 5FBVB 4Q4JA 3K1JA 2IBMA 2R2AA 4U02A 4KHZA 1EK0A 3NTUA 2YOHA 4JYCA 4RFVA 4F93B 1E1RA 1T9HA 1G8PA 5F98A 1DO0A 1XPOA 4Q1DA 4U7DA 4S35A 3LQQA 1U8YA 1XFAA 4FMBB 2RGBA 2JEOA 2GNOA 3K0FA 4CZ2A 3QI2A 3WY9A 1KZGB 1M74A 3QKRB 2CCKA 2GESA 3CWQA 4B48A 4JBWA 4Q1FA 1UBGA 5C18A 4V0NA 4TLAA 1KSFX 2QP3A 1A2BA 2XZPA 1E9DA 2ZJOA 2ZRFA 3MJHA 4O2LA 4QGAA 3G5UA 3OIWA 4URYR 2O8BA 3IBYA 1GNQA 1Q57A 1N6KA 3VR4A 2C95A 2FFHA 2IYQA 3AP3A 4IDOA 2PZEA 2XOKD 1YR8A 4YDHB 2CDNA 1XEFA 2D74A 2MMCA 4QHTA 1CXZA 5M04A 3VX3A 1S4QA 2BBTA 2HUPA 3OEED 3GLIE 1W36B 3AVUA 3A4MA 3AVYA 2XAUA 4F7WA 4HAZA 4PX9A 1GNPA 5LDDC 2C98A 4XIGS 3CRMA 3B6EA 3K0FB 1VG1A 1HT2E 2A2ZA 1KO5A 4H1UA 1KY3A 3LDAA 4H9GA 5AUQA 5GJVC 3RLFA 3B85A 1ZC4A 5FR1A 3KXLA 3JVVA 3THWB 2G77B 4G5RA 1OH7A 3KKPA 5EE1A 4NCIA 2UKDA 1ZD1A 3UG7A 5DN6A 5KTYA 2XTNA 4P4TA 3C5HA 3U60B 3WYAA 1PUIA 1S3GA 2P2LA 2ONKA 4LHZA 1KIMA 4MYTA 3EW9A 1R5BA 1XPRA 3LWNA 4IVQA 2V9PA 4C0HA 2IF0A 1XNJA 1KSHA 4HUTA 4LJYA 4X8OA 4LBVA 3EZ2A 2JLWA 5KNBA 4KSCA 1Z63A 4IW3B 1E96A 4OQNA 4UXIA 1VYTA 1S96A 2BVNA 3PUVA 3QXSA 1Z6XA 1G7TA 1CJKC 1OSNA 3DMNA 1DTSA 2ZR0A 1W1WA 3KJHA 4US0R 3WBJA 2ZJ5A 721PA 5CDFE 4JVMA 2J41A 4QNRA 1Q1QA 3W90A 2C96A 4Q7MB 4TL8A 1JXOA 1NY5A 2YNMA 4R98A 4OK6A 3T5DA 4NZYA 3ADDA 2QN6A 3GJ4A 1M34E 4LOAA 2ZJYA 1Q1BA 3C14C 1GM5A 2UZ3A 1GKYA 1HYQA 2FG5A 2O8FB 2NG1A 1NSTA 2YJTD 2KBEA 2PL3A 2FE4A 2D4HA 2CL0X 4B3GA 4TQAA 2ZM5A 2V7QD 1U2RA 1KJZA 3NWJA 5DYGA 4EPYA 4JLBA 4JL8A 2A78A 2BMEA 4DEYA 1WQ1R 3HR7A 1AS3A 3MUFA 5B58C 5GJBA 2ZI4A 521PA 1G3QA 1Z3IX 2EWWA 1R2QA 1TUIA 3SE0A 1DVRA 2ZI6A 4GT1A 4GMXA 4DRZA 3E5HA 1E2NA 2FEOA 3HJNA 1CJVC 5EE9A 2IHBA 2C9CA 3GEEA 2XX3A 3IIMA 3SZRA 1ZIPA 3M4YA 1AKYA 1E0JA 1NVXQ 3PVSA 2Z6VA 3PUZA 2J3EA 1SVIA 1XD9A 1SULA 4ZDIA 5J4VA 2HCJB 2AWOA 3JZMA 2HXSA 1KSGA 4RD0A 4MRNA 4E03A 2EYUA 5JZVA 3I62A 2OM2A 3P27A 4QM6A 3ADKA 2FOLA 4LJ8A 3W3ZB 2ZI5A 4QGFA 2ZUCA 2ZSDA 4A82A 1N0WA 3K70C 3CONA 2OCYC 3SU8A 1KHTA 3ZH9B 3BFVA 2FNAA 5DHFA 3W34A 1K6MA 2ZSBA 4TLDA 3R9WA 2J0VA 4F4JA 4MITA 3TUJC 5H1YA 2GBLC 2PZGA 2WZQA 3A58B 4X8HA 4KLNA 5AUNB 3EG5A 5KUTA 1RRPA 4Q00A 2OFXA 4IEIA 1YR6A 2JLYA 1YZKA 3VHXA 3R7WB 2R44A 1JECA 4F4CA 3N70A 2J5XA 1N6HA 1NN5A 1KI7A 3W6OA 3ZDQA 5FTJA 5JSZB 3AUXA 4HI0E 4ILEA 1Q12A 4HLUC 4HDCA 4RFSA 2OT3B 4HB2A 1D9ZA 4FN5A 1E2IA 1DBSA 4E09A 2VHJA 4KBFA 1WA5A 2CBZA 4L15A 4CVNA 4TMXA 2O8DB 4CW7A 2GJ9A 4F92B 1E6CA 5TXGA 3AH8A 1VIAA 4BFYA 4AKIA 1ZU5A 3RANA 4JSYA 1BOFA 4WIAA 1US8A 3CRW1 5F3WB 1QHNA 2YOGA 1W7AA 1A1VA 2GEUA 1FTSA 1IOZA 1NKTA 2B8WA 4RKEA 1L8QA 2QAGA 2OXRA 3IQWA 1BIFA 3UATA 2FPMA 5DHAA 3K53A 1X8LA 5FBQB 4DDTA 5BN5A 2FZ4A 1HY3A 1X6VA 4NYJQ 5FOVA 4M8NE 3P32A 4WVFA 3EPJA 3A1SA 5KDDA 1TF5A 3HU3A 3SQWA 5G53C 4RCYA 1Z07A 3NH9A 4OHZA 1G16A 5EE5B 3FMPB 1P2VA 2EFCB 1N0UA 3SYKA 5FTLA 5H8WA 1Q44A 4OI2A 1N6PA 2J45A 4C0LA 3K0CC 5KDOA 3Q7PA 5EP4A 1DADA 3FE2A 1W5TA 3QQ5A 1RJ9A 2OCBA 2ORVA 3OEHD 4B2LA 1G6HA 2XXAA 1KSJA 4UQOA 1IN4A 1ZP6A 1N5JA 5DI3B 1IHUA 4WXPA 1W0JD 3C8UA 1NN1A 1MRSA 2AK2A 2AK3A 4PHGA 5FFMA 4BZPA 2VA8A 4PO9A 1DAEA 4NBSA 2JLVA 1XTQA 2ONJA 1YZUA 2XNSA 1W0KA 3CNLA 4BLOA 4JKIA 2A30A 3RHFA 3AB3A 5L3SB 3GLFB 4PQRA 1A2KC 2IYXA 4PSAA 1LVGA 1I4LD 4C30A 1NVUQ 1TUEA 3THYA 2ZAMA 1DELA 4WZAE 1OFTA 2W6ID 2KWIA 1QF9A 4GZLA 3PJRA 1E9BA 4DCUA 4KO8A 1G5PA 2FMXA 3K0AB 4ZO4A 4AI6A 1Z2AA 4XOIA 3W5JA 4B74A 2ZR9A 3KJIA 3QOFA 1W44A 2XXAB 4C0JA 5L3RA 3Q8XB 3U4QB 3KFXA 1BH2A 1E2JA 2AKYA 4JVNA 1SXJE 2W58A 3RC8A 4Q7JB 1II9A 4JS0A 2PZFA 3V4FA 2FA9A 5J5CA 2VIIA 3RRMA 4PZZA 1P2UA 3TUZC 4CEJB 4Q4HA 4IXMA 3KJGA 3AVXA 3IEUA 3LBIA 1NSFA 4XD7D 3R9XA 1WF3A 1UEIA 4KJZA 1HT1E 3CX7A 1WE2A 2OESA 2XTMA 4QJ4A 4KI0A 3LQRA 2FN4A 3I1FA 3U6BA 2GA8A 2HLDA 2W83A 5J40A 1U0LA 5DYIA 2WMOB 3FVQA 3QPVA 5B2ZA 1JR3D 1OJLA 2IYUA 5IK2A 2VPPA 3KL4A 2NO1A 1T3HA 4XTCS 3A4LA 1T0JB 2ZSFA 2GKSA 1MO6A 3TQCA 1Z0AA 1G19A 1FP6A 3ZGXA 1D2NA 4GP7A 2CVFA 4QBFA 3X1DA 1E98A 3BFXA 4HB4A 3I5XA 1XJ0A 2IXFA 3BH6A 4Q01A 4TMTA 2DB3A 5FOSA 3K9LA 1UKVY 3O8CA 2I1QA 2NO7A 3Q9LA 1ZBDA 3L43A 2CLCX 4PANA 1RYHA 3I3SR 1QHIA 3LBHA 2QE7D 3TQFA 2J0QA 3IIJA 4GOXA 4YDSA 2QT1A 2WJGA 3TNFA 3FOZA 1GAJA 4EAQA 3EIQA 1DARA 4A8JA 1MABB 1G8HA 1Q21A 3LNCA 2RCNA 4QGGA 4TZ6A 2PCLA 4OK3A 4PHTA 4PZYA 4NCJA 3B1WA 1AM4D 3K9HA 4R2IA 4C0BA 4IFEA 4C2TA 4LJ5A 4D26A 3GJ7A 121PA 4AD8A 2CXXA 2CNWD 3IIKA 4ZCLA 1E2KA 2WICA 2CK3A 1VYUA 3OE7D 3BFKA 2WHXA 2C9OA 3CZPA 4LV5B 2DFLA 2ZRNA 3LA6A 4Q5IA 1X8JA 5CJ2A 1R8SA 2QMEA 4QNMA 1UM8A 4P3YA 3EZ9A 1IBRA 2Q3MA 4QJ3A 2W6JD 5DGXA 3E70C 3SJBA 4IOMA 1T0HB 1CS4C 1K8RA 4BUJA 3GPLA 2OAP1 1ANKA 4GDFA 1DS6A 1E99A 2BBSA 2ODNA 1TTTA 3IILA 1I2DA 4HAXA 1T6NA 4M1KA 1NG9A 2J9RA 1KO8A 3CO5A 1A4RA 3W8RA 1NVVQ 2FFBA 5HCNA 3A4NA 5B64A 1VECA 4HAVA 3NXSA 1RRGA 4NP6A 1XMIA 1P60A 2QQEA 2OLKA 1E79A 3OF5A 2F43B 3Q7QA 3CF0A 3LW7A 4B2IA 5KOYA 1CJMA 4A6XA 3OE7A 4MDEA 2JLSA 1N5KA 3KTAB 5D3QA 1XTJA 2ZRHA 4LWZA 4JVLA 4V02A 4TLEA 3PG5A 4BLTA 4WZ6A 3TVTA 2OBNA 3QVUA 1C4OA 3AF0A 2RMKA 2W2TA 5E95A 1AA9A 1M8PA 4RD4A 5JBQA 2Z4RA 2QPTA 1KI4A 4XVUA 1Z0IA 4PAMA 1NRJB 3MWJA 4DDWA 2D7DA 4BZXA 4LYJA 1DE0A 3BK7A 1OH5A 4PPFA 4DCSA 5BWMA 2F43A 4DCNA 4LY6A 1DAHA 1OXSC 4JSTA 3BWDD 3BIFA 2IYSA 3R8CA 4KCGA 4B2PA 1N3BA 4OBEA 1ZMXA 2J7PA 2GF9A 1DEKA 4I4LA 1AGPA 2GK7A 3TE6A 1QDEA 1OIXA 2IYLD 821PA 4CGZA 1FZQA 3IGFA 4LV8B 2BKUA 2C99A 3EZ6A 4URWR 3VR6A 3NDBB 2V1XA 2ZI7A 2ZUBA 4US2R 2FFAA 2HT1A 2XSZA 2QENA 3FGNA 3IBGA 1ELOA 1KAGA 3V4RA 4HDQB 2HEIA 2RGEA 4Q18A 1EWQA 4ZI3A 1UADA 3WXMA 1T5LA 1OFHA 1II0A 3BJIC 3GEIA 4X8LA 3BOSA 4Y0VA 3ZVMA 1XZPA 2BC9A 3LVQE 2ZI9A 3T12A 2NMVA 1FW6A 1J7KA 4ESHA 2FGKA 3NBZC 3KZ1E 1XXHB 2QMOA 4LDJA 1RKBA 5FUWA 3QXHA 2LKCA 2V55B 1RRFA 4JBXA 4PC7A 4JT4A 2IUTA 2JLZA 1GVNB 4HLQB 3ZS8A 1ZUHA 4ERNA 2IXEA 2J1LA 3IUYA 1CLUA 1OXUA 4PQYA 4Q9LA 1I2MA 1K5DA 5JRJA 5BW8A 3QXCA 1XCMA 2VLIA 3RNLA 3EZFA 1E9EA 4ZIRB 3G0HA 3B78A 3OHMA 1KK2A 2VTKA 1B23P 1LY1A 2Q9AA 5TV2A 4Q02A 3QF4A 2QMUA 1V43A 3LLMA 4TL9A 4R7ZA 2PH1A 3DEFA 3T1TA 2WSMA 3AF1A 1OXVA 1G8FA 2OCPA 1ZUIA 3B1YA 1FUKA 1YKSA 4IOLA 5J4HA 1TF2A 3DM5A 3IKJA 3ZD7A 1Q20A 3THXA 1U99A 1ESNA 1FTNA 3GJXC 4NE2A 3FKSD 1WBBA 1M7BA 1TEVA 4D0GA 4A6PA 5L3VA 3ZYCA 3U44A 3L0OA 2C04A 3SJAA 5AJVB 2VP0A 1V5WA 4JLVA 1E9FA 2XJ9A 4LGMA 1G291 5CYOA 2FJUA 4R9UC 3NBYC 4ZIRA 1JR6A 4AKEA 3IPYA 1OXXK 4QGHA 4AURA 5HR5A 5H70A 4KSBA 3SHFA 4Z1MD 2DFTA 1TNDA 2C8VA 3QPWA 4JLDA 3CRVA 1D8TA 1G8GA 3WMEA 5J4YA 3VHLB 5JEDA 5GJWC 3U3RA 3R9IA 3MGCA 2HDNB 1WRBA 3TR5A 3GJ3A 3EWSA 1CRQA 1XEWX 4MGYR 3E1SA 1VCMA 2FSGA 3LRPA 4URXR 2Z4SA 2FWRA 1H8HA 5JWHA 4WAUA 5KSZA 3THXB 2QI9C 2WSSD 5JJKA 2ODBA 4OHWA 1DAGA 2FSHA 1VG8A 2IYVA 3ZQJA 3KQLA 2GJKA 3EARA 1OE0A 2QL6A 3F5FA 4EPTA 3ASYA 3BERA 5FL7D 5KSOA 4OHVA 3U44B 5BYKA 4DHEA 2VP5A 3U3MA 2O8EB 1KY2A 3G82C 4AIIA 4X8MA 1E0KA 5FL7A 4Q9HA 1QHSA 2QT0A 4R2HA 3SR0A 4EPWA 5FH9A 1XXHE 4FIDA 1EFTA 1QHGA 4HAWA 2IT1A 3CH4B 1OIVA 1WBDA 2QTHA 4ZCIA 1S9HA 1XPUA 4N1AA 2WWYA 3B60A 4RKFA 3NHAA 4URZR 3QBTA 2BMFA 1QHYA 1L2TA 3VMFA 1Z2CA 3CH5A 3OIUA 4CT4B 2AD1A 1AZSC 1UDXA 3AUYA 3C41J 1G18A 1NLZA 2OZEA 1Q22A 4D82A 1BO6A 2KJQA 3KB2A 3CF2A 4NPHA 4TMZA 3KQUA 2PMDA 2FDCA 4HB3A 4TTRA 2RB4A 3VR3A 1I4DD 1G4UR 5KNCA 2WWIA 3IEVA 2WTUA 1GL7A 2QSYA 1G6OA 2VP6A 1IN6A 2GTPA 4DLZA 3C15C 1S1CA 4Q4JB 1W4CA 3T1OA 4YONB 4AKGA 4EJSA 5JJLA 2JLXA 5KO2A 2Q3HA 2QA5A 2HJGA 2HF8A 4P32A 2V6JA 5JECA 2KI5A 4CRWB 3B13B 5GVSA 1P2SA 2WPDD 3LBNA 4MA4A 2G88A 5FOTA 2ZAOA 3A36A 4OYHA 4FMCF 3TSZA 4C0SA 5TY0A 1N0VC 4M2LA 1OKKD 3THOA 2GXUA 3SQXA 2RH5A 2QBYA 1YR7A 4LJ9A 4DUGA 3CNOA 3MLEA 2JAQA 4TT3A 2IUUA 3MG9A 4BFTA 1KTVA 3CBQA 2D62A 3MJRA 4ASUA 4BASA 2EVWX 1OFIA 4JLAA 4MGKR 5AUOB 3H2YA 2OG2A 1PUJA 4XWKA 1XB2A 1Z6AA 2JJ2D 4LRWA 2RGGA 1E1QA 1XJQA 1YJ5A 3ZIAA 4LV6A 3WRYC 1A7JA 1G3IA 2LCFA 4IXNA 4DDVA 2FPKA 4KITB 3K9GA 5AJZA 4A2QA 1E4VA 4LHWA 2VP4A 3PUXA 3FHTA 1FQJA 3TW8B 5K8LA 2GAOA 4QOSA 4DLTA 1CF4A 2WPDA 1G1MA 2Z0MA 4UXHA 2RHDA 2WM9B 3HU2A 4DEXA 1CJUC 1W4AA 3X1XA 2YV5A 1RVDA 2YYZA 1BYIA 2DR3A 3UWOA 4NCKA 2P6UA 1JEEA 1KMHA 2EFDB 5E7IA 3VQTA 3THWA 4M4SA 4TN1A 2ZR7A 3KX2A 3A1VA 1KK0A 1Z5ZA 4NCNA 2ZJ8A 2ZJZA 4QHYA 5BQ5A 1IAQA 1EFHA 4EPXA 1GRNA 3D7MA 5L8VA 4I1OA 4F4IA 2WMNB 4B6FA 1XX6A 1JPNA 4HZUB 1ZD9A 3D3QA 4RZ2A 1NVVR 3H4MA 4IEEA 5AK0A 2F9LA 1YZNA 4I99A 4UNPA 2GZAA 4GBMA 4PZLA 1Z8FA 4OI1A 4ZKDA 4DB4A 1E2EA 2YWGA 2BV3A 2D2FA 2IA5A 2NO9A 3J81k 3SJZA 4KYIB 4W9MC 3M1IA 3OFND 1UBEA 3CIOA 5FPSA 2ZE8A 3B2EA 1IQPA 2GJSA 1P2TA 1UEJA 2L0XA 5C46F 4EFLA 4OHYA 3W5IA 2J7PD 3KJEA 3VTKA 3ICEA 1PLJA 3BC1A 3O8BA 3KQNA 2FU5C 5E7JA 4II7A 1DG1G 3I92A 2N46A 5IF9A 3ADCA 4DXAA 1EX7A 3KQHA 1JBKA 2ANCA 2XJ4A 4LHYA 3CNNA 3UMFA 1Z08A 3HYTA 3M6AA 3V9PA 1FMLA 2Q21A 1GWNA 3HWSA 1NP6A 1E9RA 3ETLA 2O8FA 3HR8A 3KB1A 1ZIOA 4NL4H 3R8FA 2JJ8A 4PSVA 3VX4A 2CLDX 2GWHA 2P5SA 2YOFA 3B1ZA 3OEEA 3K09C 3Q5EA 3U5ZB 4HB0A 4DCVA 3K70B 1KKLA 3ZD6A 2NPIA 2FV8A 3W3AA 1JI0A 2VRWA 2GVZC 1X86B 4A92A 2DPXA 1OW3B 4A2PA 4N0DA 1HE8B 2REXB 2A3RA 1R0YA 3BB4A 5JI2E 4ZDWA 4RVCA 3CR7A 1E2LA 4B3XA 1AS0A 1JJ7A 3DDCA 4QRHA 2F1HA 5FTMA 1E2DA 2IS2A 2CL6X 4V0KA 4CF7A 2NO0A 2QGZA 1Q3TA 1X1SA 4NMMA 2IYZA 4EKDA 1DAKA 2XOKA 1OT3A 3DOEA 3NVAA 1COWD 2F1JA 3P4XA 3RS5A 3LFUA 1IXZA 1U0JA 2K5UA 3I72A 2QRZA 1II8A 1FOEB 1KGDA 1GKIA 3F0TA 1SHZA 3ZVRA 5KPDA 4L5BA 1P75A 4NDZA 2TMKA 1YZTA 1Q0UA 1IY2A 3W6NA 1G9XA 3FB4A 3TUIC 5JHHB 4ACAA 1SVWA 2VBCA 2CK3D 2FH5B 2J0SA 1PZNA 1YU9A 4A15A 1KKMA 1Q1EA 3C7KA 3PEWA 1SXJC 4HLDA 5HZKA 2ZE5A 1PLKA 4LHVA 4BFUA 5DNYB 1EFUA 3A1WA 1MT0A 2ZRPA 4B76A 2B7BA 1KK3A 2E87A 1ZYUA 1NMXA 3CRQA 2ZROA 4M1WA 3U61B 3L8ZA 3MFYA 4MRVA 3TH5A 3DO6A 2IYTA 2AD5A 5EP3A 1IONA 1W48A 3RS7A 2J46A 1OHHD 5SZHB 1QVRA 3I32A 4JLJA 4RD2A 3ZQ6A 3OAAA 5SZIA 1OFUX 4CEIA 2OBLA 1W2GA 2PEZA 3K8YA 1US8B 3AP1A 3A6PC 1BMFD 2Q3FA 3AVQA 3GP8A 4LBYA 4HAYA 2ZE6A 2G0NA 621PA 2WKPA 3DZ8A 2QUZA 3PV0A 2AHOA 2ZUDA 1FNMA 3ONWA 5CITA 3RAPR 1HQYE 4YXWD 3EA5A 3RS2A 5BXQC 4KFTA 1P62B 4AG5A 4PAQA 2B92A 4K81B 4PXAA 4RZ3A 3O47A 3ECCA 2AN9A 2OV2A 3X1ZA 4A1FA 5CB6A 4BQSA 4PC6A 1ZM4A 1D6JA 1VCOA 3IO5A 1VHLA 4W5JA 1NJGA 2ZI3A 4ZKEA 4TT3D 1XTKA 4NTZA 3PXGA 3W9YA 4I1VA 1SHKA 1GOTA 1NL3A 2G1JA 1T4GA 2EFGA 2FSFA 3SOPA 5KHOC 2CL7X 3QE0A 5FBWB 1BYUA 1T5IA 4NH0A 4D4MA 3BE4A 3MMPA 4FWIB 1KDRA 3Q5DA 1U8ZA 1W4RA 4CEHB 1NBMD 1JB1A 2ERXA 1L4UA 3MRSA 1MO5A 4M9ZA 2GVDC 5K8UA 3S1AA 1OH8A 1AZTA 3VR5A 4KODA 1O87A 2JATA 4IOJA 2EWVA 1XTIA 4KLZA 1OYWA 4M1SA 1CJTC 4XSGA 1OPXA 3REGA 2NO6A 3UG6A 2QM7A 3GLHB 4DUGD 1U90A 5GJCA 3KQKA 1ZM3A 2G6BA 4PSKA 4RJLA 3AF2A 3TGPA 3AKCA 4QM7A 1XD8A 4S2EA 2NTYC 2REOA 1FX0A 3ZVNA 3VKGA 1YZGA 1UKZA 3U7EB 4NYMR 3L8YA 1L4YA 3IHWA 4MH0R 4CEHA 1GIAA 2VH5R 2JLUA 4JT2A 2EW1A 1P72A 2Z83A 3Q72A 1VTKA 4UJ5A 3BXZA 1YZLA 3AVTA 2UVQA 1E9CA 1GUAA 3EAQA 4JJKA 4FMDF 2OE2A 3P20A 1G41A 4GFDA 1NF3A 1HH4A 2RGAA 1OH6A 3QXXA 2GCOB 2AXPA 3ZZ0A 4KXFB 3U6KA 3AGQA 2ZRDA 4HLCA 2LWIA 3K9NA 3RS3A 1Z0JA 3RC3A 2ZS9A 4ESVA 3GLIA 1QBKC 3TRFA 3AVPA 1P5ZB 3BS4A 4EQ6A 1YZQA 4TSFA 2PT7A 3KKOA 1OB2A 4IDQA 4LYAA 2PJRA 3BAFA 4E5UA 2HT6A 1EG7A 1VKJA 2BOVA 1CR2A 1XBTA 2ERYA 4FINA 2IF2A 3NHBA 4EJSB 1U9IC 4J0QA 2WBLC 5H68A 1P4SA 4G3XA 1OV4A 4FMDB 3T61A 2DHRA 4B3FX 3GLGB 3FMOB 2WIBA 2O0JA 4JLMA 5FI0B 3VFDA 1E0SA 2R6AA 3PQCA 5DLQC 3TKLA 4UXJA 1G4AE 5C4GB 2QBYB 2WSSA 4B35A 1CIPA 1KJYA 4FXPA 5HE9A 2NQ2C 1S8FA 3NKVA 2N1BA 3LW8A 4UNSA 4IVPA 4EPRA 4EQ6B 2QQ0A 5FPTA 1NKSA 2DWQA 4WOPA 2VO1A 1G3UA 4A8JB 4KU4A 1MABA 4M22A 4QXAA 4TYQA 4C0KA 1XTRA 2P67A 4XVQA 1U0HC 3D8BA 3F3YA 4Q7KA 3K09A 4YMVA 2WWHA 4JJZA 1U94A 3GLGE 4B47A 2QP9X 1XMVA 4Y0AA 4N0EA 1KK1A 4A0FA 4DIEA 2D3WA 5AUPB 2V54A 3K0CA 4RCZA 4YLGA 4BLSA 4URVR 2G9NA 1P9WA 4MKGA 5A4JA 3FKSA 3GJ0A 2NZJA 3CX6A 2ZANA 5FUVA 4XWOA 3REFA 3I8XA 3QKRA 4Q47A 2DBYA 1N25A 4BFVA 2ZITA 4H1VA 4UKDA 3X2SA 4C7OB 1F6BA 4Q1AA 4RZXA 3SYLA 3QENA 4W7SA 4Q9IA 2C2HA 5HZHA 2BIFA 2ZRBA 1R5NA 1G5RA 3IO3A 3NC0C 4B3CA 1EXMA 4DLWA 5IDVA 1BMFA 2A5GA 5EZ6B 5JRZA 4U5XA 4G5GA 3WRXC 3CW2A 1E2PA 3NBFA 2H57A 4G1UC 2WWGA 1SVOA 2O0HA 2R62A 1W4BA 1TMKA 4M1YA 3WP1B 4Q1EA 4TYYA 1VPLA 4V0OA 4ITRC 2D06A 2G3YA 4K46A 3TVDA 3FMFA 3TAHA 1N6IA 2W2VA 4CYMA 4E22A 2CHQA 4IRUB 4NKRA 4MKFA 2V8OA 1LF0A 4DLVA 2R6FA 1N6NA 1HE1C 4YXWA 1TPZA 4M1MA 4P33A 1MV5A 3KTAA 1YHNA 1GKUB 3RWOA 3ZJYA 2IUSA 3RS0A 4IDPA 2CMKA 2IEYA 3HP1A 5FUXA 1C9KA 4FCVA 4C7OA 4WW0A 1NNEA 4PPQA 1KDPA 5F2EA 3CUEF 2F3TA 3C5CA 2FSIA 5CYPA 4TL6A 1XF9A 4EUNA 4PC2A 3AF4A 2F6RA 2V3CC 5AR1A 1FFHA 4IDNA 2RGDA 3B8HA 4BZQA 1JQJC 3P26A 1QG2A 1JXMA 4M0LA 4IFBA 4PR0A 5EXSA 2EU8A 1QZXA 2G1KA 2WVJA 3KFVA 1NJFA 2RGNC 2VSFA 3PEYA 1G7SA 4OQLA 5TVKA 4O3MA 1ZD8A 2JJ1A 5DIFA 2QROA 2A7QA 3AVWA 4KVGA 2IWRA 3ZVLA 421PA 2HCBA 2N42A 3SBEA 3GEHA 2C03A 3NEJA 4FI3C 1M7HA 2JA1A 1E2MA 3I61A 4ZV4A 4Z54A 4JVSB 4M21A 4GSYA 3U7HB 1LNZA 5D3MA 2E9SA 2QRNA 1WCV1 4PAOA 3I5YA 3PCRB 1R5OA 1XRJA 1NVWQ 1NIPA 3WNBA 1ZNXA 1Z6GA 5KSYA 4PTLA 1CKEA 2PJZA 4OKSA 1W49A 3GJ8A 3H86A 3L82B 1UBFA 4B43A 2QEQA 5P21A 3GQBA 1KDOA 3SYNA 1E2FA 2YWFA 4IDHA 1FPMA 3TW4A 1WXQA 3DMDA 3WYFA 1QHHA 2PX0A 3RYTC 1X8KA 3SN6A 1ONBA 4AYWA 4O25A 1P9NA 1PLLA 2FPLA 1QVAA 2LKDA 4A0HA 4D0NA 4DCTA 2WAYA 2CE7A 1VDZA 4TMKA 5JCPA 1NLFA 1J90A 1OXTA 5AWFC 2OLJA 3B7GA 3CPEA 2CCGA 3UMRA 2F1IA 1JNYA 3GFTA 2XB4A 1LS6A 2ZRGA 4DLUA 2CNWA 2QZ4A 4DKXA 1ZCAA 3K0EA 3GMTA 3EPHA 3IQXA 1OF1A 3I73A 1YRAA 2ZYUX 3N2EA 3A1TA 3PEVA 2GXAA 2QGNA 2JJ1D 5EE0A 1KI1A 2Q9BA 4QJ5A 1MOZA 4KFUA 2IYWA 1OIWA 2VF7A 3DL0A 5EE3A 2PCJA 3DKVA 5FPYA 1ZNZA 4DWJA 4Q4AA 1AGRA 1SVLA 4TQUS 4B33A 1W36C 2YKGA 5CLLA 2ZSEA 2JDID 2YHSA 3GJ6A 1SZPA 3LLUA 5B30A 5B57C 1TU3A 1TQ4A 2BJVA 1F48A 2ZRIA 4LCBA 4V0ME 2YINC 3LX5A 4YMSA 3LVRE 2F7SA 1IM2A 3QNUA 2WJVA 4D2IA 3FPAA 3GCGA 1KZ7B 4L4UA 4B34A 3ICQB 3RRZA 3RRNA 5JHGB 1G64A 2B8TA 4Z8XA 5HPYB 1Y3AA 1DAFA 1Z0KA 3I8SA 3RS4A 1JR3A 4MKIA 5DI3A 3TK1A 2YC2C 2QTFA 1KOFA 4DT1A 1T3LA 3V00A 2O8CA 3OZXA 2H5EA 2WJJA 4OL0A 1XD2B 3MWLA 4GMDA 5IT5A 4RFSB 5C2JB 5L3SA 3GLFA 2OAQ1 2G0TA 1W46A 1QG4A 3QKUA 1CR0A 4NHOA 4XH9B 4EJSC 1R6BX 2DY1A 3CLVA 1NN3A 1Z83A 1Q3HA 2ZU6A 3FDIA 1ZNWA 2F55A 2H16A 2O8DA 4EFMA 5SZJA 5FOUA 2MSDB 5IK2D 2CE2X 3SFZA 2NIPA 3RVBA 3W8NA 1CEEA 2ZJ2A 3DKPA 2BEJA 2BCJQ 2HF9A 2R6CA 1E1QD 2GXSA 4GOJA 5CDFA 5E3HA 1ETUA 1DAMA 2J0UB 1G3MA 2Q0HA 3PUWA 1J2JA 1KI6B 4ACBA 2O52A 5KU1A 2ZVPX 2VSXA 4LBWA 4DT1B 1F2UA 3DOFA 4OJQA 1W5SA 3TSOA 1HA3A 3HPQA 5LD2C 2BMJA 4M53A 4HEJA 1D2MA 3KXKA 1OB5A 4EIWA 4XTRA 4GI7A 1GTVA 5EZ5A 4TYNA 1IXSB 4UNNA 3T35A 4QG7A 5KPJA 2ASEA 2GAAA 2QG6A 1RIFA 2OFOA 4G01B 4DIDA 3ZLJA 1JAHA 4URUR 3ZIAD 4ZCMA 2KBFA 1R8QA 3C4JA 4WA7A 2VQSA 2JJ2A 4RD6A 1LF5A 5DE3A 2Q9CA 2O5VA 2R6DA 4FMCB 1A5TA 2AX4A 2Z5FA 4MGZR 1RJ9B 2ZRCA 2W0SA 1Z28A 2FFQA 3VAAA 5FUYA 4BEJA 5FL3A 3SHWA 5EP2A 2X77A 2FEMA 1RFLA 3SNHA 3WMFA 5FOXA 1KI9A 3BH0A 1RPZA 3TMKA 1UAAA 5JFGA 1LFDB 1SKQA 3P1JA 4BRUA 1ZM7A 4UJ3A 4KBGA 3WNDA 5CIQA 3SC3A 6Q21A 5K8IA 2W6JA 4NYJR 1G7RA 2JGNA 3B9QA 3RABA 3U2QA 4YQFA 1ZJ6A 3VNUA 3PIRA 2Q6TA 3KKNA 4JIMA 1RRCA 3QY0A 2JASA 3M0EA 3QVVA 3NH6A 4TLCA 2ZEJA 4BEBA 1BKDR 5FTKA 5L3QA 3AKEA 4EDHA 1N6OA 4DLXA 1FMJA 1VIYA 2PEYA 2PX3A 4WZBE 3K0AA 3FFBA 1X3SA 2YZ2A 3GLHE 2EQBA 2P0EA 3SJCA 4C0QC 1KO4A 2HJVA 2KSQA 1LB1B 2RHMA 2XZLA 1BS1A 3ADBA 3ZZTA 5FBRB 3GLGA 2ZS8A 4LJ6A 3X1YA 3U4QA 2ZXUA 5CJPA 2IEZA 1OLOA 5EXXA 1SXJD 4Q9JA 4IKEA 4JLKA 3KXIA 2HYIC 2I1VB 1XMSA 3GD7A 3OFNA 4IJMA 4KVAA 3KKQA 5AJXA 5EQTA 1DG3A 4QBIA 2QE7A 4M9XA 2GK6A 1CBUA 1Y63A 1ZAKA 2GZDA 2H8KA 4MRPA 1ZM9A 4P31A 5FPKA 4LBZA 2WKRA 2WIAA 2I3BA 4U00A 4Z1MA 3WBKA 2HYDA 2A9KA 2NZ8A 5IRCD 3CWZA 4LHXA 2AR7A 4DVGA 2ZVQX 2OXCA 2OO7A 2QM8A 3I4LA 4BFSA 4B75A 4NYIQ 4O2RA 3AKYA 3BB1A 1P7CA 1LS1A 4MYUA 2EYQA 4ZPXA 3WHKA 1IN7A 1UBCA 221PA 3TIFA 3FFAA 4IOKA 1TF7A 1UKYA 2RKOA 2CJWA 3CZQA 4JYBA 4YC7A 1X1RA 2JLRA 1M1YE 1XDBA 1R0ZA 2P5TB 5KSPA 4RY2A 4KFSA 4GPTA 5EXPA 4YMUA 1G3RA 1MH1A 1AS2A 1YVDA 5FPHA 8OHMA 3VR1A 2GJ8A 4W5WA 5KDLA 2BEKA 2X2FA 1SVKA 3L0SA 4AK9A 4B6EA 3LAWA 3TSWA 1XMJA 3BD9A 4LX0A 4HATA 3RRYA 5C1BA 5CM8B 1KI3A 4Z8YA 1HQCA 4DDUA 5TB5A 2B7CA 2PLFA 3KUCA 3T5GA 4LJAA 5HKKD 5CK4A 4DB2A 4KAXA 2C78A 4G5SA 4F38A 4GRAA 2YC4C 4KFRA 1T91A 4Q1BA 5HKKA 1E2HA 2DFNA 1G8YA 4XSHA 3AGPA 1GITA 3BH7A 1GRQA 1ZC3A 3CM0A 3QEOA 4V0MA 1Q1ZA 4OI0A 5LB2A 1NLYA 3ND9A 1ZCBA 2HV8A 2V7QA 4PC1A 2BDTA 3UWKA 4AY2A 3LY5A 3FTQA 1RW4A 1NY6A 4QC2A 4PPGA 5C4MA 5IHPA 4MUBA 1XJCA 4OQFA 1AN0A 3LXRA 4BECA 1LV7A 4L8GA 3TR0A 2VP9A 1ZW6A 3EA0A 4BPBA 3QJYA 2ORIA 4QHSA 2ATVA 4DBLC 4QBGB 2A5DA 4A36A 1WB9A 1JQLB 3OEHA 3ZZUA 1TL7C 4TMWA 4LPKA 3BBPA 1KNQA 1SXJA 2W2XA 3A8TA 2VF8A 4MUAA 3BORA 3PITA 5JMTA 4RZUA 1KDTA 3NIBA 4CIDA 4POAA 2SHKA 2CEAA 2Z43A 2RGCA 5ANRB 1UFQA 3W6PA 4XJXA 3UIEA 1R0WA 1VCIA 2ZRJA 2ORWA 1R0XA 2D7CA 1MR3F 2O0KA 4R71A 4UNQA 2OHFA 2WKQA 2P6RA 2OCAA 3D31A 2FGJA 2ZYWX 3SI7A 5D3MB 4OK5A 2WWFA 2V1UA 4XWAA 5FBLB 1KO7A 1Z47A 2DWOA 2ZYVX 5FR2A 1XEXB 3QPUA 2FZLA 5FI1B 1N5LA 3UK6A 1E0AA 4GZMA 4DJTA 3NEYA 1MO3A 4DSNA 4F91B 1EESA 3L0IB 1TEXA 1P9RA 1XCGB 1HEIA 1UKEA 2IW3A 3NG1A 1L7VC 1U81A 4MQBA 1JALA 3MWYW 1COWA 5KNDA 3EX7C 3P4YA 4W5HA 5EXTA 5CK5A 1NI3A 3PR1A 1Z06A 1EGAA 4NU0A 2GHIA 3HDTA 1QHHB 1MKYA 3QUSA 5G41A 2B21A 2ZE7A 2VHUA 1Z6YA 3E2IA 2IYYA 3WNCA 4RD3A 4HYYA 2J7KA 3AV0B 3DM9B 5KYKA 1N6LA 2YWHA 3BGWA 4A2WA 4DSUA 1HUQA 2GRJA 2V4ZA 3BRWD 4LZZA 3AVVA 1GDDA 3QKSA 1TQ2A 4PO1A 1AQUA 4FWTA 2RGNA 2BBWA 1TADA 2DYKA 1NBMA 2GZHA 4G5QA 4AC9A 1XEXA 3NDPA 5J4LA 1CP2A 2WOOA 4GOKA 5DN6D 1JAIA 1E2QA 3MAAC 1D5CA 1TU4A 2PBRA 4FCWA 5JJIA 1R4AA 2J59A 5LB4A 4OI4A 1GZSA 5BN3A 1PVOA 1JEDA 4LJ7A 1XXHA 1AJEA 2BM0A 3JZAA 1E32A 2QY9A 3TBKA 5JSZA 1E3MA 1KMQA 2H18A 4C4PA 4DZZA 1TQ6A 1MO4A 3VR2A 4P0TA 4Q9KA 2REBA 1A82A 4Q4AB 4I1SA 1N6RA 4C3ZA 5A5GA 1ODFA 3VU9B 2CLSA 2H92A 4AYTA 4JLPA 2CHVA 1ZM2A 2XTZA 3KKMA 3LD9A 4A0RA 3QSYA 1SQ5A 1IXRC 1I4TD 1Z0DA 2GBLA 1EFRD 1W47A 1VG9B 1Z6TA 3HU1A 2H1LA 2BJWA 2AFIE 4O0MA 3KDSE 3U7GA 2XEXA 1VHTA 4BWYA 2GCPA 2J87A 1TAGA 5F9HA 2ZETA 3S1AB 1CR1A 5EP1A 1KJWA 2EFHB 2AXNA 3EIEA 1YRBA 1FNNA 1ZU4A 3K0SA 1E9SA 1EX6A 4BRWA 3SS8A 3MCAA 4BE7B 1J99A 2QAGB 4GP6A 5LBIA 2AKAB 2O8CB 2BBOA 1WMSA 4A8JC 2ZRMA 1XD2A 2ZTSA 1F3OA 5HE8A 3B9PA 2F3RA 2OSBA 1N5IA 2BMDA 1G17A 2ZJBA 3RDPA 1FX0B 1GSIA 2YWEA 4DSTA 5DH9A 4PHFA 2WJHA 5GVRA 1E1RD 2QPAA 4LPSA 2WAXA 3QXJA 4M1OA 4D4JA 2FX3A 3X1WA 4ON9A 2GEVA 5CIWA 4TTQA 5E7MA 3PFIA 1VYVA 3R20A 1U8AA 5JWRA 2CVHA 4JL5A 1M7GA 1U9IA 1F2TA 2H7VA 1P73A 1KI6A 3GJ5A 3T1VA 5LD2B 2JIZA 4XD7A 1E9AA 1P6XA 4P4SB 1F2UB 2AWNA 2GCOA 2I4IA 4MDFA 3TAUA 1S0UA 1XZQA 2ZQ5A 3OESA 4MRSA 1XCPA 1GNRA 5CLQA 3WYGA 2XGJA 2IX3A 3OIVA 5EUMA 3O8RA 4M9QA 2WV9A 3GFPA 3GLIB 1IN8A 1M6NA 1FP7A 1HURA 1GL6A 2ZRAA 4OQXA 4AYXA 2R65A 5FOWA 3THYB 3AEZA 2MSCB 4GNKA 3FMIA 2QAJA 4HSEA 4LYFA 1J8MF 4BFWA 5JS8A 2Y8EA 4ZI2A 3BB3A 4RSGA 4BLQA 1W2HA 3TLXA 4ASUD 1S9DA 2UZIR 2W00A 1T8UA 1CRPA 4P4UA 2ZJAA 2VEDA 4CT5A 1IY0A 1KYIA 2VHCA 2QPOA 1DAIA 2GCNA 5A0FA 3U3OA 1ZINA 3L2OB 2GETA 4TZ0A 3CKLA 1OKKA 2KB0A 5G3ZA 3C16C 3QIAA 4JLOA 2GJAA 2QTVB 4BFXA 4JKYA 4P4SA 2A5FA 2BKEA 3EIHA 2ZU0C 4YMTA 1FUUA 1HTWA 2OBMA 4LJ4A 4Q4HB 2QAGC 3ASZA 1EWRA 2R6GA 3AVOA 3EWAA 3MSXA 3NBXX 1QHXA 2ZPTX 4DLRA 1UJ2A 3IPXA 5TMPA 1MRNA 4B73A 2B6HA 1ZRHA 2IS6A 4AKHA 4QKQA 5LPNA 1IJEA 2W6IA 2ZS7A 4HAUA 1DPFA 4Q66C 5L3QB 4C2UA 3IDQA 3WP0A 3MD0A 2O8BB 1UPTA 2C77A 3EXAA 1P3JA 4Z51A 4NYIR 5DSZA 1N2CE 2VP2A 2YVUA 5DI9A 3UXMA 2ZSAA 3CB4A 3HYRA 3LH5A 1H8EA 5E4FA 3WHLA 1FQKA 1VMAA 1G7CA 4LI0A 4Q19A 4V03A 4DSOA 1NMYA 4Q48A 3HPRA 2XITA 1W0JA 2C5LA 3H1TA 4I1UA 5J4KA 1IN5A 4QBHA 5JS7A 3T34A 5EUQB 1XWIA 2H17A 4V0LA 4AWXA 2VHQA 4TSFD 4DC9A 3QKTA 4ZDKA 2CCJA 1M2OB 2F1RA 1CR4A 4AG6A 1D2EA 2JLQA 2WOJA 4HDOB 2WWWA 4Q1CA 1XP8A 1J8YF 3FWYA 3D6TB 5G3YA 3T06B 1RE0A 1R10A 2XZOA 4QFMA 1K5GA 4OHXA 4BFZA 1OYYA 1T3SA 2X19A 2A5JA 5AJWA 2OFWA 3PENA 2JIZD 3FKQA 2XB2A 1XEWY 4B32A 1SKYE 1KO1A 5HCIA 5HTKA 3LXXA 1ZVQA 4LSGA 1JPJA 1KI8A 1GP2A 1XTSA 2CJWB 2VSOA 1YE8A 1LW7A 3AP2A 3TJZA 2NOAA 3FHOA 1R7RA 1E94E 3QG5A 2PLRA 3RSOA 4KV9A 1GRRA 1KMHB 4KYUA 2VYFA 5CB8A 2G83A 1UDWA 3OIYA 3N5CA 3UMSA 4PHHA 1SVSA 2OEPA 1O3YA 4Q7LA 1J70A 4BLRA 2IXGA 4HLUA 5FTNA 4TWZA 4HZIA 2X2EA 3AQ4A 3CPJB 3B1XA 4MYCA 4HZUA 1NG1A 2IYRA 1IJFA 4NONA 4G0NA 5G40A 1E69A 4YMWA 1SVMA 1XU4A 3JVUA 4K8OA 1YR9A 4A0GA 4BGDA 1E4YA 1GG2A 1RC8A 2BM1A 5ELXA 1E2GA 4EFNA 3DVLA 3WMGA 4PC3A 2WJYA 4N3NA 4TL7A 1GL9B 4I81A 2DCUA 3SEAA 3GLFE 3SFVA 4D25A 1EFRA 2EFEB 4LYHA 4OJKA 2QMHA 1H65A 1T8TA 3QF7A 1RZ3A 4JLNA 2P65A 4Q21A 1PV4A 2XNDA 1QRAA 2AL7A 1TX4B 2QU8A 2HXYA 5EJEA 5GADl 2CHGA 3RWMB 4D81A 5BN4A 3EC1A 1WP9A 1G20E 2RGXA 1AIPA 1SXJB 3VNVA 2R8RA 1G5TA 2ATXA 4LK2A 5BYJA 4ARZB 3LO5A 3DHWC 3B82A 4NCHA 3K70D 1W0KD 4TYWA 1CULC 2ODEA 2V6IA 2A5YB 1D9XA 1Z29A 4L16A 4L9WA 2PMKA 4A4DA 2ECKA 4D4KA 3ND8A 3N2IA 1OHHA 5TDHA 3EASA 4B71A 1HV8A 2ZRLA 4D6PA 2GDJA 1SKYB 2GEDA 4TLBA 4CEIB 2KE5A 2QP4A 3U3KA 3AM1A 4PFSA 2DFKB 2NGRA 2QNRA 2IS4A 4WBSA 1WDTA 3F8TA 3R7WA 4LC0A 1ZNYA 4TQ9A 4PPNA 3SBDA 3T1QA 1W36D 3H0KA 3U7FB 4EPVA 2DWPA 5K8TA 4ARZA 3FHCB 3DZDA 4DLSA 3EZ7A 1GILA 4B44A 1H8HD 3CPHA 2C9YA 4JMPA 3B1VA 4C9BA 2JDIA 4L9SA 4M9SA 4FW9A 2MMGA 1C1YA 1FL9A 3FYHA 3CRRA 1II8B 4BLPA 3PUYA 2BHRA 4NYMQ 3QKSB 5DISB 2VL7A 1NMZA 1H8ED 2OILA 3EC2A 1TQDA 4D4LA 4Q03A 4QL3A 4PQFA 4TTPA 1PJRA 3L0PA 3O8DA 3QF4B 1P61B 2NPFA 3AF3A 2P6NA 3GFOA 4A9AA 1KAOA 2ANBA 4ZDJA 1YQTA 1CU1A 1AQYA 2X1VA 4WXRA 4DLYA 4HUQA 2F9MA 3CX8A 1E79D 1AKEA 2GF0A 3GLHA 2MSEB 2ZYTX 3QEJA 5JI3E 3A37A 4JL6A 4FCTA 3VU9A 2ZRKA 4ABYA 1KI2A 1G21E 4TMVA 3CF6R 1JJVA 2FF7A 2WJIA 3NC1C 1ESMA 2BCGY 2GXQA 2X8AA 1DOAA 1VCNA 3DPUA 4IVRA 3UPUA 2ZIAA 3QG1A 4M1TA 1JR3E 1U98A 3VKWA 5JEEA 2WWXA 5CM9C 4PO8A 3IHLA 3UANA 5F9FA 2J0UA 2XNDD 2QORA 4JZKA 3LV8A 4XVRA 2E1RA 3MWKA 1LTQA 2OUKA 4Q4LA 4C0AC 1GFIA 1KNXA 4HUQB 3VKHA 3A1UA 3Q3JB 2ZREA 4LUCA 2IHYA 2AFHE 4CDGA 1S1MA 4MGIR 1UF9A 1CTQA 1NIJA 3EPKA 4US1R 2PT5A
chains in the Genus database with same CATH superfamily
3E9CA 5JCZA 4G5OA 2RAPA 2QRHA 1AK2A 1EGMB 2Q5IA 4IHQA 3V3TA 2ZKLA 3FIJA 1SNYA 3ZS9A 1GNTA 3FF1A 3FRIA 4DYHA 3VPFA 1EXDA 3AKDA 4RIIA 4O4JB 3OU6A 2WYVA 4RQBA 4WWHA 1F60A 1K5HA 1TVMA 5DO9A 3RFCA 3TKAA 3WL4A 1NQWA 1F5NA 1GPNA 2R7LA 4GYKA 5K0NA 4LNUA 4KAAA 1G66A 3NR2A 3CR8A 3ML1A 3PEUA 3EGVA 2VZEA 2HDOA 3DMTC 4PZCA 1TLLA 3FNQA 2IWHA 3T9AA 4K87A 3KEGA 1XKQA 4W7IA 4QG3A 5EHNA 1UDAA 4ZYTA 4BE9A 3R44A 4P5DA 3IAS1 5UKDA 3KPJA 4TYPA 3SDBA 3TIGA 2O54A 1YR2A 1LKZA 3N9IA 3H84A 4CEJA 3G8DA 4MKHA 5JE8A 1C8VB 2J32A 2ZBQA 2LCQA 3RTCA 1JEYA 2PZKA 5MN5A 2N0SA 5JWOA 3WJ7A 1NP3A 3SMVA 5ISMA 2HF2A 4OA8A 1KAMA 3QBVA 1ZUNB 3HDYA 4XX1A 1JB9A 1JR2A 2QV0A 3KZOA 3DHVA 1B0UA 1HSOA 4BNIA 4QTTB 3DLBA 2FMIA 4OQDA 3K1ZA 4H3HB 2R2AA 3OOWA 4KHZA 4KR2A 1H0RA 1X87A 3DF9A 1T9HA 4JIGA 4HRVA 1FLDA 1WX1A 3IP5A 3C3EA 2DPYA 4LY0A 4BC0A 5F98A 1DZ3A 2PLNA 3DV9A 2Q5HA 1XFAA 4FMBB 3L8GA 1UQTA 4WBNA 2CXOA 1N4DA 4C0WA 4DA6A 1QAMA 2ZJ4A 2ARKA 4XLLA 5K8JB 4KO4S 1C0EA 1NAIA 3KFLA 1M74A 4M1EA 3RM3A 1IWPB 1DEXA 4NOJA 2CCKA 1QQTA 4L8WB 1DJLA 4NBRA 1YQUA 4ZXPA 1BMQA 1HTTA 2FWIA 2P3LA 4JBWA 3Q15C 4IQ0A 5AQEA 1L5FA 1DKLA 1HNWB 3N39C 4G0OA 1D03A 4MIYA 4RVGA 5A5EA 2AQHA 3MJHA 2B78A 1MXHA 2RHRA 1UT8A 2HMVA 2VP3A 4WKCA 4NBKA 5AW5A 3OIWA 4E94A 4BXOA 3GYBA 3N8HA 4P54A 4YWHA 2P0AA 4EOGA 3SVZA 3NTVA 4S1OA 2JGDB 2FFHA 1TQ8A 4IFIA 2NXJA 3S5JA 1E61A 3P0JA 4B7AA 2XOKD 4DL9A 3TLEA 2MMCA 1XEFA 1EP9A 2BGJA 2D74A 4ZQBA 3KSBC 4DPMA 3OEED 1W36B 3NIGB 3NV9A 3BXXA 3AVUA 4EKYA 3RBVA 4PLZA 2QLBA 3P71T 4F7WA 5J23A 1WR8A 2DH5A 4GOND 3WZLA 2JNWA 5LDDC 2C9MA 4GE0A 3SBXA 3CRMA 1G6KA 3UCXA 2QJRA 4TX1A 2RGWA 3AI2A 3QOYA 5AXCA 1OAOC 1KERA 2FUCA 3GZ4A 4NR0A 4EL0A 3KXLA 3JVVA 5GONA 2G77B 1ZJWA 1RRKA 4G5RA 4QQFA 2C2OA 2JJYA 3KKPA 3FZQA 4N12A 5K20A 3M5DA 5LDGA 1NP7A 1L1RA 4HT3B 3C7AA 3KAPA 3KP1A 2SECE 3K7EA 3UAGA 4CR8A 2PXXA 2Y1XA 2YHAA 2XMCA 3C5HA 1Y4UA 4GPAA 4DV5B 2XYQA 2W98A 2FSVA 1KP2A 3L1JA 1ECPA 2ONKA 4LHZA 2FQQA 1GZ3A 2CDRA 3LF2A 4DGQA 4E51A 2IGTA 4LXHA 5CT6A 5CFLA 3EW9A 5T57A 4BNLA 3SNKA 1I1NA 2V9PA 2GD6A 3OE4A 1Y0BA 1IY8A 2IF0A 2XHEA 4DR6B 2WV7A 4HQ0A 1OC4A 1F14A 2CGEA 2J33A 3NTLA 1UBLS 4IIJF 5ITZB 3MEQA 4KSCA 1FYWA 1BMTA 5D6OA 1E96A 3TL2A 3PCTA 3I58A 4O4IA 5IBQA 1H5QA 2Q62A 3EK2A 4HGPA 1OT5A 1V2HE 1Z6XA 2GBFA 2VPZA 4ZEOA 5ECGC 1G7TA 4GPIB 4EB0A 1CJKC 1SJ9A 1RMYA 4US0R 1NQXA 3W6ZA 1A9XA 1ZX1A 3KWMA 4X7BA 3OZBA 4PCVA 1W59A 3WDSA 5EKDA 1NY5A 2YNMA 5FLYA 2RH9B 3B36A 3T5DA 2PIDA 2DETA 3UW3A 3HCCA 5LC1A 1M34E 3KYIB 1EBBA 4XJVA 3OE5A 3C14C 4G65A 3CVVA 4ETNA 2ZYRA 1GKYA 1LC0A 4DUZB 1AB5A 4RLHA 2CBGA 4UBOA 3RR2A 4GUDA 4MPJA 4TQAA 4B3GA 4X66B 2HPAA 2WM8A 3PPVA 1U3WA 1OUMA 3NWJA 1FVFA 3EGDA 3LQYA 3KTFA 1ORWA 1AS3A 1XTZA 3MUFA 2ZI4A 1RQNA 2Q3BA 5F12A 4FXOA 2ZI6A 1TZMA 3GUVA 4GT1A 1E2NA 5JYCA 3DWFA 3WNQA 1T5DX 3SZ3A 3X2EA 4XUCA 1CJVC 1HZJA 1O7JA 4MVWA 3GEEA 3TCXB 4CKZA 1XP5A 1E5DA 4LXTA 4YO7A 2IH5A 2P9GA 1AKYA 1RMTA 2XVXA 3O4FA 4QWMA 2VTVA 4UZFA 4CLRB 1ZSNA 1DMSA 4OXKA 4DJFC 1SVIA 3C43A 1UXOA 1M33A 1XLTC 3JWPA 1YAJA 2HXSA 3OKFA 2GWRA 2NUTB 3DUFB 4B4UA 1C7EA 1S02A 5BUQA 3I2JA 1P80A 4QT0A 4YRAA 3VU0A 1ISRA 2EYUA 3F73A 2OM2A 3B7WA 3PKJA 3PE3A 3ICWA 4J0EA 4QGFA 2RHCA 1H5UA 3RT1A 3Q9SA 3WB0A 4HQOA 2D0IA 2I6UA 1DT3A 4MI6A 1OWOA 1EK5A 1ZXLA 2JIPA 3K70C 7ABPA 5IT4A 3I23A 1R3UA 3ESRA 2C2XA 3RIYA 3ZH9B 4UOEA 3L41A 4A8TA 5DHFA 3W34A 4INOA 3RC2A 4TLDA 2P5UA 3QKIA 1EVEA 2BEVA 2RBGA 4U2EA 2J31A 3SC4A 2QRJA 4C4YA 4UM9B 5H1YA 2KLBA 1IHDA 3DBRB 5AUNB 1T34A 3DA8A 3OEYA 4Q00A 1BWSA 2JLYA 2EQAA 3QNWA 3F6RA 2X6TA 2FR8A 1FVOA 3N70A 2XUHA 1GU0A 3D6NB 3UJ3X 2WYWA 3I9JA 2B36A 2P9ZA 5IANA 4K9SA 3HXOA 3ZDQA 4HNGA 4ETIA 1JX6A 4YP5A 3KUKA 4S1NA 1G9SA 3A4IA 2CMFA 3JVDA 3HJTA 1WVGA 2C5GA 3JYPA 4IIVA 3A0UA 4K88A 2OT3B 1M8JA 2BGNA 4HB2A 1JVBA 1D2CA 3FYDA 3U31A 1CUEA 4MV3A 5J1TB 2ODQA 2HFJA 1LX7A 4H7EA 4E09A 4I3HA 1XVVA 3D5EA 4J16A 5MGNA 4ZJYA 3OQ6A 4CLHA 4CW7A 2GJ9A 3HZOA 3AOEA 4LGYA 5FRDA 3V1YA 3TLJA 1E6CA 3C3MA 3AH8A 3N74A 3CZCA 3PD0A 3ND7A 5EIOA 3RANA 4JSYA 1XYVA 1US8A 5CW1A 3MQ2A 1PAUA 4H4DA 1L9KA 4NBTA 3VO2A 5AVQA 2AOVA 3MWFA 4LZAA 3DAPA 2CY0A 1A2OA 1H1LA 1IOZA 1Z4OA 1J9EA 1H0SA 1NW9B 3H5RA 3OHSX 4RKEA 4UU0A 3A4VA 4MV7A 2DX7A 2XYPA 4G4SP 2ZQZA 5CNIA 3UATA 2XNCA 4DDTA 5K3BA 3U9SA 4E5YA 5IW8A 4GVPA 4DQVA 4WVFA 2VHWA 4UVHA 4UMVA 1I1HA 2DSNA 5H02A 3SHTA 3TI9A 4CL0A 5KDDA 4R84A 3C97A 1TF5A 1N5OX 3HU3A 2WKSA 3MFQA 2AFIA 2Q5FA 4BMVA 3F1KA 4KQ6A 4XUGB 2PGLA 3BMNB 1NUPA 3WL6A 4YX9A 1P2VA 1KARA 3F7NA 1M0WA 1Y3IA 1WZNA 4V3CA 4XCXA 3SYKA 4CM7A 1N6PA 5B7NA 5I9IA 1EYZA 1O94C 5EP4A 1DADA 1O89A 1X9GA 4NK4A 3WWZA 3O8NA 4B2LA 1ENZA 4WVLA 2E48A 1AUPA 1ZGZA 2Y4OA 3HKBB 5DI3B 5JVDB 5I7HA 1CQPA 3NT4A 1W0JD 2QG4A 3E1KA 3NAZA 3R3VA 4TVSA 1V8DA 3C8UA 4LN1A 1M10A 1UMCA 4QDUA 1L1QA 2AMLA 3AUFA 2Y67A 2E4VA 3BMOA 4NIMA 3R3JA 2R1TB 1XTQA 5C3UA 4HL6A 4OB8A 5SICE 1W0KA 4O5OA 4YV7A 3CKMA 5BR7A 2H31A 4G4IA 3T7AA 3VC7A 2OHIA 4BIMA 2IYXA 4PSAA 3NQ41 3G1TA 2VZ8A 4IXTA 2YQ4A 4C30A 3FLEA 1HGXA 2ZAMA 3O4JA 2ZBRA 3F9CA 4KIUA 5ITWA 3OA0A 2WTEA 3CEAA 3GDOA 3GPDG 4IDAA 4DIUA 4DWWA 5C32A 2AQIA 5JSKA 2V6BA 4PN3A 4KO8A 5IP5A 2FMXA 3M5WA 5HMLA 1XTPA 1Z2AA 3GLVA 2ZR9A 4RY9A 3QOFA 3ZHRA 1M73E 1HQDA 3CJQA 3JAKA 4LISA 3Q8XB 3RYFA 2YMMA 1BH2A 1E2JA 2AKYA 4GMFA 1SXJE 1YA8A 4JVNA 4JX9A 1UAYA 1GADO 4Q7JB 4M0MA 2C4HA 1TUBB 5LLDA 5L6LB 3RLIA 2WYOA 1RS0A 4PZZA 1P2UA 4GU5A 3ZKWA 3TUZC 4Z3OA 1ZQ9A 4CEJB 4Q4HA 4RA6A 3KZMA 3KJGA 4ZVMA 3LBIA 1BX1A 3OZUA 2V9ZA 3QLVA 4XD7D 4PIPA 3CKYA 1WF3A 1OZFA 4GPEA 1Y3FE 3FZNA 3SXUA 5AVYA 4YN3A 5JISA 3CX7A 4CM3A 2XTMA 2HSDA 3KT8A 1P4JA 4PGFA 5EFOA 1R8YA 4KRGA 2FN4A 1HLPA 2DTXA 2GA8A 3L40A 3AFGA 1Y6QA 4FHGA 1WVIA 5KX5B 3FUCA 3HCFA 1OJLA 1SXPA 5IK2A 1SCUA 3KL4A 5EZYB 2NO1A 3AR4A 4XTCS 3A4LA 1IEXA 2ZSFA 4KFCA 2EP7A 4ZQEA 1MO6A 4I6JA 1NXVA 3GIDA 2QTNA 1V7PC 2PVSA 3TQCA 4YJDA 3TLAA 1OLXA 4EUHA 4B7CA 4BKQA 4H17A 4FFWA 4OX9Y 1ZVJA 2VDQB 4FOLA 4M46A 5JXWA 1Y37A 4WZAA 2JK1A 4D9NA 2DB3A 1YDMA 5FORA 4H0FA 3VM6A 2GRAA 3O8CA 5KQMA 3L7AA 4JUCA 2ZZNA 4PANA 2EG9A 3NTXA 1QIGA 2FW8A 4MV4A 1G20A 2G7ZA 2QE7D 3TQFA 4A5SA 4GOXA 5DX8A 1F1BA 2G67A 4YDSA 3SVTA 2AG6A 2XE7A 3UK1A 3DL4A 3TNFA 3FOZA 1GAJA 1G4HA 3IE2A 3IAUA 1V1RB 3UTDA 1SPBS 5I7EA 3ET5A 3LNCA 3M4JA 2RCNA 2WT8A 2EGHA 3AZQA 2PCLA 3NTQA 4PHTA 3VH4A 4FJ0A 5GAJA 5A4FS 5K8CA 3FVVA 3WK4A 3H5WA 2SBTA 4PX3A 1OD6A 3COJA 1YA6A 3VUEA 1UFVA 2Q1SA 2PKQP 1KYYA 2OWDA 1V4BA 3DTVA 4J94A 3FNFA 3IIKA 3WSVA 5JS6A 2P40A 4D45A 4NXMB 2HMUA 2ACVA 2E3JA 3DCIA 3G2KA 4WECA 3OE7D 1JZTA 1V96A 3C7TA 3A05A 3V7FA 2VNSA 4HTFB 4FYKA 1PNQA 4HWTA 3HRHA 3LA6A 2G6TA 4RHXA 2EOAA 3GCZA 3EXHB 4FEAA 1H2BA 4QNMA 5K1ZA 3UZUA 3Q12A 4Y2TA 2WPNA 5AICA 1MDFA 3B3AA 5YASA 4WK4B 1N36B 1A9YA 3D5QA 4KQGA 5E1OA 3SXJA 1KR2A 1W93A 2AI2A 3E5NA 3IBFA 1ANKA 4RKRA 2FZVA 5CJJA 2JKZA 2ODNA 5ICCA 3DMHA 1R0LA 1NDUA 1U8TA 2AS0A 4ZQHA 1TTTA 1XN4A 3ZN2A 1I2DA 5AKIA 5FWYA 4YCBA 3ELWA 1BSVA 1ZQ1A 2GN8A 3UHJA 4Z7QB 1NG9A 3NM5A 5IZCA 1KO8A 2QYOA 1A4RA 4F3TA 1KEEA 1EUCA 3A4NA 1KYQA 1VECA 3DR3A 4NZZA 4RA9A 5A4DA 5B64A 5HX7A 2OLKA 3OF5A 1PJQA 2D5BA 3GLTA 3Q7QA 3CF0A 2N9UA 4M88A 5EGNA 3VC2A 2OCKA 1QIIA 4O1HA 1R37A 1CJMA 2J9ZB 1N1MA 1G8SA 3EZXA 2O3UA 3FR7A 1H2AS 1E7WA 2AUMA 3PDWA 4IIHA 1FFYA 5D3QA 1T8YA 3LUAA 2QNBA 5MN6A 4V02A 5E1MA 4BLTA 4BQRA 4WOCA 5L4SA 3TVTA 2Y2UA 1XFDA 3KD3A 3QU7A 2BE9A 2DU8A 4AMZA 3W9BA 1JFFA 4DBVO 2W2TA 4WKNA 1M8PA 5AI8A 1YBVA 3CE6A 5EIAA 1A5ZA 5BV1A 3LX4A 4MR9B 2YWRA 4NWIA 4ZEXA 4OUKX 5CPBA 2Q5EA 4KPUA 5EEGA 5GMOA 3TQTA 3MWJA 2MYPA 4DDWA 4LOLA 5DX0A 1X7XB 6GPBA 1EXVA 3SR3A 5A9RA 1N9GB 4PPFA 4ZT6A 1GA6A 3JQFA 5F35A 1PKXA 4LY6A 3GD5A 4N3BA 3RJMA 1Q5PA 1RWNA 2POQX 2Y1OA 3PL1A 5HKOA 4IZ6A 3R8CA 4I50B 1N3BA 2I6GA 1S4MA 2H9IA 1ZMXA 3DDWA 2GF9A 3FTCA 2QVGA 4V38A 4FFOA 4MLCA 2WP0A 5I7RA 2RCYA 3B8EA 3D1LA 1QDEA 5I3CA 3CSDA 2WAMA 3RVJA 3TDMA 3KVNA 1G2PA 1Z0UA 2FZCA 2NU9A 5AD1A 1NXXA 2O7RA 3EZ6A 3QFSA 4U2GA 4URWR 2V1XA 1Y9JA 3ZIDA 1BWPA 2ZUBA 4HDSB 4MWBA 5BQOA 1Y48E 4F06A 3PQDA 2HT1A 3EFHA 4JR1A 1A9PA 3V4RA 1ELOA 1ES9A 3EVEA 2VBFA 3W2GA 1JZQA 3I9V6 5AVSA 1CUAA 1MVOA 2J5QA 4CLRA 1DI0A 1BA2A 1PQ4A 1XZPA 3L0YA 4PCUA 5DW0A 3VKUA 4DG5A 2QRUA 5BWOA 3BA6A 3ESQA 3T12A 1PK9A 5K0BA 2JA2A 3SZLA 1XRNA 3VBCA 5HNKA 3GQBB 1RKBA 2I4OA 4HDKA 4A16A 1M1XB 3WADA 1VLHA 2VF4X 2YN2A 2V55B 2DT5A 3A31A 3L49A 4JFRA 1X8XA 4JBXA 1VL6A 1UH5A 3WQQA 3HABA 3SF0A 4R83A 2JLZA 4K03A 3ZS8A 4R1NA 1JHZA 1BU8A 3V8RA 1I94B 4ERNA 4R40A 2IXEA 2IFTA 1OXUA 1TAUA 4WX2B 3DYIA 1I2MA 2QV7A 4C88A 4ZYUA 5JRJA 1YVPA 5BRJA 2PS0A 4MB2A 3X2FA 4ZIRB 2XZDA 5CHYA 3G0HA 1E8MA 1QOPB 2CYCA 3OHMA 3BWMA 2VTKA 4OO3A 4K28A 4WD3A 4RFLA 4ZZ2A 1X7ZA 2Q9AA 4FFLA 2C9BA 1BE8A 2PUAA 3O84A 3B89A 2QMUA 3DEFA 3IODA 4HVLA 3T1TA 2O7NA 3AF1A 4GR4A 3LDHA 1BTOA 3B1YA 5EGSA 1YKSA 3VSBA 2P9TA 1NYTA 1T4CA 4EQZA 1JDNA 5F5XA 3LLCA 1DRWA 3THXA 1BCRA 1G38A 5F5LA 4UDNA 4XQCA 1U99A 3TLYA 3T7DA 3TNJA 2C2YA 4IO1A 3ET4A 2PZLA 5EWMA 2IYPA 3AWDA 1ZDMA 3EBLA 5DTJA 5LP6A 3U44A 1ILWA 1NC3A 2Y1KA 3ONFA 5ILQA 2VP0A 2IKSA 4Q24A 3OBBA 1AMNA 1VL8A 2XJ9A 3NDJA 2FZ5A 1XCLA 2Z2IA 1G291 3MOGA 1S8NA 3R74A 1U0RA 5AKYA 1U7HA 2CFCA 5TEVA 2DQSA 3IPYA 2ZBDA 2WJ3A 4O33A 4FI3F 3MTEA 4LF6B 2C8VA 2AG8A 2HWYA 2XUZA 1D8TA 2I55A 1GQYA 5F3DA 3TLGB 5ALIA 4WY2A 3VHLB 1XALA 3OTGA 3MGCA 4XAQA 1IDN1 5LYJA 4LQ4A 4Y2UA 1WRBA 2IV7A 4MP8A 4AVYA 5K8VA 3ED5A 3AXSA 1BU5A 1RHMA 3D8UA 3GJ3A 3H6KA 2XDQA 4Z86A 4D98A 4HNVA 3AESA 2XUOA 1J33A 3DT6A 3ZU3A 2FMTA 1CVRA 3BSWA 3D6FA 2WAOA 2O19A 3D0KA 4L95C 2JGFA 2WSSD 3K9CA 5LLSA 1U8FO 4L8LA 3WTBA 2VC2B 5KI6A 1M1YB 1ZOLA 3N2KA 2FSHA 3KSDO 4BO8A 4R41A 1SY7A 5B1YA 4EPTA 1MC5A 2QL6A 2YQ5A 5FA8A 1GA1A 3BERA 1HT3A 2H5LA 2BGLA 1TKBA 1NQAO 4HNSA 1LK7A 4WRRA 1SBNE 4EPWA 2W22A 4X8MA 3HDJA 3A14A 4JT8A 4II3A 4KX5A 4G1VA 4G0PA 2WD7B 1ADGA 3N0VA 3KL2A 3NHYA 4FIDA 1EFTA 5AK4A 5HBRA 3RKUA 3CUWA 2BF7A 2IT1A 1OIVA 2V8BA 4UUOA 4P98A 2C97A 1TIKA 3HVJA 3KNZA 4JUIA 4N1AA 1V9LA 2XKAA 3B60A 3HKBA 4KE8A 3EXFB 4IIUA 2NSHA 3NHAA 4ND2A 2PR2A 5EI5A 2B0JA 2WC1A 4IGEA 4YRCA 3HM2A 1GAQA 2CLKB 4RVUA 3KLMX 4D3FA 1UDXA 2A6PA 2HX1A 2UVPB 1EM8B 2CXTA 1SB8A 1EJ2A 4UVDA 1TC2A 3KB2A 4OJMX 3NKLA 3EE6A 3EODA 3QU2A 4MW9A 4GX2A 4G5FA 4RL6A 4TTRA 3ZLUA 4P93A 1G4UR 1AF7A 5EJFA 2WTUA 1GL7A 4JA0A 2BW0A 2XYGA 5F1OA 1IRXA 3FM9A 2PUFA 2Q41A 4LE0A 1AHNA 3C15C 3VR0A 2D59A 1OX5A 2J6IA 4PQEA 4Q4JB 4YONB 2CMDA 3EAFA 4J1TC 4LYYA 2DVMA 2PPLA 3DL7A 1UMBA 2OV6A 3IMKA 3PSAA 4NBVA 2KYRA 2QA5A 4BAUA 3NIDB 2O2IA 2WF7A 4DABA 4PRYA 4AXXA 1NA5A 4I7EA 5JCOA 1IG0A 3AKZA 1H85A 2JFZA 2JGIA 1GGMA 3R3SA 3RASA 4UUNA 5FOTA 2ZAOA 1UUFA 3P9YA 5KJEA 2PNJA 2NUAB 4HPXB 1HYHA 4RZIA 1RCFA 1OKKD 1I3NA 3THOA 1RE1A 2GXUA 2AUTA 1YR7A 2X8BA 1SK9A 1TQHA 3R3ZA 2JAQA 4TT3A 3QP9A 1A71A 3LHDA 4BFTA 1RHJA 1KTVA 3ZDBA 1ZIYA 3F9RA 4RABA 3K0KA 4XIFA 4JLAA 4ASUA 1QQ7A 3EVNA 4X63A 3H2YA 4XWKA 1IPHA 1M2WA 1ISMA 5FL7D 5FLEX 1KEPA 3PPYA 1E1QA 4U5QA 4AUEA 2I76A 1VHDA 2ILVA 1D2AA 2H2HA 2YY7A 3IQHX 5ENDA 3NIWA 3UV6A 4X1YA 3CMCO 1N77A 3EWIA 3Q0EA 3L1VA 1J5EB 4RPIA 2PSFA 4A2QA 1IXYA 1P1HA 4KR7A 2BDEA 5LWQA 4EI7A 3TW8B 3IX7A 3UGKA 3NVMB 3KB6A 5LA6F 4UCQA 1PE0A 1CDEA 4FONA 4WZAB 1YVEI 3FAZA 3PNKA 1RWWA 1JH9A 2ZIFA 4KK3A 3SQNA 5B3JC 2JEZA 1W4AA 3X1XA 3ABZA 2F64A 3G0BA 1N9ZA 5CVEA 1O96B 1R00A 1AUOA 1JEEA 2AX3A 5JAQA 4A8HA 2EFDB 3VQTA 2CHFA 4TN1A 3IQGX 3U7QA 4JJ6A 4PV7A 4YALA 3A1VA 3CLTD 3KBBA 1NQTA 3OJXA 4HNHA 4JBLA 4OLJA 2Q0XA 3K2QA 5JD5A 1KL7A 2OQIA 4GKAA 4TVBA 2PBZA 2DKNA 1ICEA 3HN2A 3ZEIA 5BSFA 4IDBA 5CCXA 1ZD9A 4RZ2A 1ZCFA 2X5XA 1FB5A 1C80A 1MEEA 1YZNA 4I99A 1PW5A 2GZAA 2R48A 3GT0A 4ZKDA 1HQKA 1J0AA 1NWCA 3HADA 1PL8A 2YWGA 4HTFA 5FAKA 1CR6A 2D2FA 3I83A 4A6EA 3IT1A 3QVOA 4EAAA 1XOIA 3G6KA 3J81k 3SJZA 1MF7A 4K1XA 3F90A 5TQ0B 4WFIA 2EERA 1H69A 1UBMS 4FNAA 1PJ2A 5FPSA 2ZE8A 4BNUA 3AG6A 2WF6A 2VYNA 3CO0S 3PZRA 2FZKA 4DJJA 3EFEA 4FYXA 3CKKA 4G1CA 1YVUA 4OHYA 3W5IA 2J7PD 3KJEA 3UO8B 3VTKA 3FWZA 1O2DA 4TS1A 4X60A 5AKEA 1ULHA 3NTOA 2B2CA 3B3QA 3HA5A 1MT3A 4DLKA 2X13A 5IFKA 3ADCA 2G1UA 4B3RB 1TFUA 2WNHA 4FS8A 3KQHA 2JCVA 1P7ZA 1BS9A 2J4FA 2GX6A 2WTXA 3O3MB 4HWPA 3RIHA 2Z57A 1NUUA 3UMFA 3OC6A 2ODAA 4I55B 3PRHA 4MVJG 4M99A 1GWNA 4QAQA 5BSTA 1NP6A 1E9RA 2WF5A 2QMQA 3PA8A 3K05A 3HR8A 4X71A 1CUDA 3SEZA 4CE6A 3JWEA 4Z9BA 3TLCA 2A9VA 1ZIOA 5JFOA 3OMXA 4PSVA 3ILHA 2YOFA 1UJ5A 2PMFA 4HWSA 1V16B 4FB5A 2X1MA 3K70B 1GTL1 3FLBA 3GJZA 3ZD6A 3CXUA 3QHQA 3LL4A 2FV8A 3W3AA 1YDWA 4EI8A 1EUYA 2MSLA 2OD9A 1KFBB 1MJNA 2JKVA 5A7GA 1JQDA 1HE8B 1UBJS 2A3RA 1DQPA 2QLJA 3BJMA 4IIBA 1C30B 5HMMA 2XXJA 4RBNA 2YWBA 4L9RA 3FNEA 2QZPA 5C81A 2JAHA 5E2AA 3OPVA 4CUJA 3ZY3A 2XNJA 4XCVA 2KS6A 3UQZA 1GY8A 3RHZA 5LVAA 3DDCA 4QRHA 1X80B 3FVWA 5I4KA 5CCBA 4NBUA 4I5EA 4B85A 2CL6X 5BMVF 3FWKA 4YUWA 3VXKA 1NW8A 3D02A 2NO0A 3U26A 4GL4A 1NBOA 1X1SA 2J6BA 1Z2NX 1Y42X 4ZC8A 3JQDA 1SA0B 3ONDA 1BAPA 1OT3A 2CL5A 3ZHXA 1XNGA 4J1TA 3T5BA 2O8EB 4ZA2A 3C5WP 2P9EA 3RS5A 3W06A 3IHTA 4KWIA 1O08A 2O2SA 4OAPA 3O3CA 1UXKA 5DM70 1U2TA 2YXEA 1MB2A 4L57A 4QUBA 4BQFA 1D1PA 1YBAA 4YBRA 1QE5A 4PN7A 3FYUB 4ZOLB 3RTDA 4LNAA 5LU9A 3DONA 3UT5B 3TOXA 2CDAA 4L5BA 4RHYA 2F3PA 4HDSA 1RZUA 4MMXB 1QP0A 3PICA 2QTGA 2WQZA 3W6NA 1G9XA 1U3VA 4IHAA 4IIJA 4QTXA 1Q50A 1TKAA 2VBCA 1ZBQA 3ONEA 3T9EA 1KKMA 2Q0QA 1Q1EA 2O48X 3DQZA 4ALKA 5C31A 2ZE5A 1J5PA 3PXEA 5I7UA 3CV3A 3F7OA 2HJWA 2ZRPA 2R25B 4KZPA 2E87A 5DYYA 2FN9A 3FZGA 5CG1A 2O07A 4GX1A 3U61B 1V37A 3MFYA 3ORRA 3Q0IA 3W1VA 4I1IA 5JNUA 3AX6A 2QPLA 2AD5A 3Q5GA 1L6IA 4COKA 2NNLD 4WEOA 3RS7A 4XX0A 4QNNA 3H2IA 2EKQA 4KX3A 4WLOA 4A5OA 1ZGBA 1V0JA 3B12A 3EVTA 3O73A 2X9GA 3TMAA 2XNKA 3LYLA 1R64A 4L0MA 1D2HA 3OAAA 1Q15A 4RD2A 5T64A 3ZQ6A 4E7OA 1OFUX 4MRAA 4CEIA 1QCZA 5HBGA 2DHCA 2LIPA 3G8BA 2UYOA 3PYLA 2MINB 4WCFC 5AI5A 3ZHCA 3WLFA 2P5YA 1ZAYA 2I87A 1QIEA 3H83A 2APJA 4OHCA 1V9SA 3LUBA 1ZESA 2BM9A 3PV0A 3ER8A 1YBFA 1FXWF 4PG4A 5CXXA 5E2BA 3SPXA 4J0FA 5IULC 1XQVA 4MKZA 4Y9UA 1J9GA 2Z58A 1HQYE 4NOKA 4DV4B 5BXQC 1P62B 4AG5A 4PAQA 4K81B 4PXAA 5KNCH 3X1ZA 2HHJA 2IGBA 4BQSA 4LRQA 5JD4A 1JLHA 3T7KA 5CIYA 3R4VA 1VCOA 4G67A 2VDNB 3P96A 3PYMA 2JG3A 1CE8A 4G0VA 1XTKA 4NTZA 3GAAA 5K5EA 3GFGA 3M4NA 4CIAA 1Z88A 1DJOA 2YY5A 4EZEA 4HXYA 1QC5A 1ZGJA 2Z30A 2IIVA 4S1TA 1FTYA 1NU8A 3S7TA 2CL7X 3SOPA 2E7ZA 3CLUC 3D54D 3WBBA 3WAGA 4TV8A 3ORYA 4QPCA 3NONA 4A6PA 1D6MA 2D13A 4ISBA 1JB1A 1EBFA 1I36A 3B38A 4R5MA 5ED0A 2XA2A 3ZJ4A 1KQPA 1ZKDA 5SYMA 4N54A 1KPIA 4HTAA 1PL0A 3MSCA 4V39A 4EKNB 5AM3A 1O87A 5FCDA 5CEEA 4CDNA 2CYAA 4IOJA 2EWVA 1XTIA 2WB2A 5JAMA 1U28C 2YHUA 1K3UB 1OYWA 2YZ7A 3Q7RA 1CJTC 3WXMA 3ETCA 4XSGA 1M34B 1OPXA 2PT5A 2WD9A 3PWKA 1NYQA 2QM7A 3GLHB 4BJ3A 4WESA 1B0PA 4DUGD 1EFVB 4E0BA 1M1YA 3N2KB 3KQKA 4YUXA 2R7NA 1OROA 2PXCA 1ZM3A 4RJLA 2PE5A 2ZXFA 5KOJB 5EFZA 3GFVA 3D9QX 3AKCA 3USZA 4S2EA 3L7KA 4BN4A 2QR3A 3M7IA 3E23A 3U17A 3U7EB 4Z2YA 1L4YA 1KY5A 2VPIA 4QUDA 5G1PA 2TS1A 3A26A 4CEHA 2VH5R 1Q0RA 2JLUA 4MQFA 4JT2A 2Z83A 4JWTA 1VTKA 2UVDA 3BXZA 1YZLA 2HM7A 1J8QA 2UVQA 1GUAA 3HZHA 3IBTA 3IR5A 4IINA 3R76A 4EG6A 1G41A 2XEDA 4Q4CA 1PR4A 3UXEA 3QE2A 4QOHA 1E92A 2WE7A 1A8PA 1ZZGA 1MFZA 2WYUA 4GD3Q 2C3OA 2WY2D 3LP6A 4WLVA 3ZBPA 3TOZA 1GSHA 3Q0TA 2AXPA 3RYIB 2J08A 1EVIA 2AZDA 5EAIA 1WXEA 1YF3A 4YA6A 3UB2A 3O74A 1K4YA 4CLXA 1OI7A 2ZS9A 2H8GA 3Q6IA 3PFKA 3UJ8A 5JNSA 1QBKC 1I1QB 3AVPA 3FETA 3KKOA 2P4HX 4IDQA 3WB2A 1USIA 4E5UA 5C52B 4RGQA 3UENA 4UU8A 2HT6A 1NHGA 4EF4A 2GZMA 1VKJA 2GCGA 3HMQA 4HPWA 2UYGA 4FINA 1RI1A 3F6YA 3IOMA 5AK6A 4CQLB 2IF2A 4UHEA 1YDHA 2QW8A 4KO2S 4L5CA 2MHCA 2WBLC 5H68A 1WJGA 4KW7A 5IWAB 1O95C 1T9CA 3T61A 3GA0A 5G4KA 4YT5A 4YCMA 1NOJA 2XH8A 2O0JA 3CYFA 3GFQA 3JSXA 3M81A 5FI0B 3VFDA 1E0SA 5CU7A 3WK6A 1Q7CA 4CMHA 2J85A 2IJGX 3OZCA 4EG7A 4G0MA 1WHTB 4C87A 1JG7A 1DC8A 2HB6A 1SCDA 1TIBA 3GRFA 4NMXB 1G4AE 3TKLA 1B43A 1E8DA 1P33A 2B69A 2WJZB 5F7ZA 4PU0A 4YPFA 1XDSA 3R7NA 5AW8A 3M1LA 4I3GA 3DEYX 2HBYA 3A2LA 3GNTA 4MUGA 4I6EA 3KS9A 3CTPA 3LW8A 3M2TA 4NQZA 4EF5A 3OU2A 3E7PA 2F8SA 2HA4A 4GLOA 4EQ6B 1AF4A 4COOA 1ZI8A 4HNAA 4WOPA 1CJSA 1G3UA 4A8JB 1MABA 5K99A 2P67A 2EBUA 1P4HA 3F3YA 4L8FA 4AJ2A 1YOBA 4B17A 4MARA 2BPOA 2CN1A 2DBZA 2HLPA 2PYDA 3CUVA 3F8SA 2TMYA 2Q4DA 3O93A 4UVEA 5DNWA 3QMMA 1E1YA 2ADOA 2IKQA 5COAA 3UAYA 4E1BA 4B47A 1IUOA 1N7IA 2E4WA 3K5HA 3L05A 3R5JA 5ALSA 5ECWA 4Y0AA 1KK1A 2G1PA 3PFBA 3EUEA 3MTAA 1WOMA 2G72A 2D3WA 4AW9A 4RMHA 4YLGA 3FPJA 3HVIA 3AJ8A 3F6SA 3KR9A 1RP1A 3PI7A 1PQYA 2FE1A 3PNQA 3HWWA 5F7XA 1P9WA 3WYDA 4MKGA 3B2NA 1SQGA 5C8XA 3LPNA 1TVCA 3LZ6A 3SYTA 2WYIA 4ZREA 4F4FA 4EY6A 4W5QA 1N25A 4BFVA 4H1VA 3CVJA 2YHBA 4UKDA 1PKEA 3QWHA 2QX7A 4QT4A 1LLDA 1GZ7A 4OP2A 4C7OB 2VFAA 3CS3A 2C2HA 5HZHA 2O2GA 5H4HA 3L7DA 2NM0A 5K3OA 2ZRBA 4JI6B 2P3QA 4O08A 4JYAB 3TOVA 2GA9A 4QYMA 1VRVA 4D5GA 3AFOA 1RC0A 5LUBA 2XMZA 3WRXC 1MAVA 1UBRS 1E2PA 3CW2A 3T0FA 3DVAA 4L5YA 5TJHA 4G1UC 2WWGA 4RANA 2R62A 3V7WA 3AR9A 3WP1B 1TMKA 3ZW9A 2B3TA 3NIFB 4Q1EA 5K0GA 2X76A 2IEBA 1MA0A 2DJIA 2OO5A 3WDKA 2G3YA 4K46A 3FMFA 3K6RA 1N6IA 1KBOA 1R15A 2P8JA 3QM1A 4MWCA 5BQFA 5KNBH 4GI2A 4NKRA 2O0LA 4AJJA 4C1BA 2F8TA 4RCVA 2I2CA 3KCQA 2YCLA 1TPZA 2DM6A 4P33A 1MV5A 2ZJ3A 5AJTA 1GKUB 1X2EA 3DBHA 4DNPA 2DERA 1CRLA 4MVYA 4GM4A 2X9LA 1L5RA 3DE6X 5DJ5A 1TZBA 1NNEA 1NW4A 3OA2A 4LK3A 4HNUA 1JIQA 1KU0A 3CUEF 1W73A 4Q3CA 1Q92A 5HDQA 2ZIEA 3DFUA 4EUNA 4PC2A 1U5CA 2Z2ZA 3F97A 4BKUA 2F6RA 1E5LA 2I8CA 3C8MA 1HNNA 2P9YA 1J0DA 4E1AA 3K1TA 1TDJA 4EHLA 2FUKA 5FQOA 1Y1QA 2B3DA 5JD3A 4R1LA 1NPTO 4KQ9A 4XFKA 5F9MA 1AMUA 3PGMA 4M0LA 2YWJA 1ULSA 3HEBA 3HV2A 4IFBA 5IDYA 3EXIA 3FHJA 2QI9F 1QZXA 2G1KA 3ZCSA 1UWLA 4EKEA 2VCYA 4FGJA 2RGNC 4QQNA 1D2GA 1XR3A 2H48A 1G7SA 2VSFA 3JQGA 1THGA 4CF3A 4F84A 4B6OA 2A7QA 3KOWA 2PL5A 3AVWA 4KVGA 5CHEA 1V16A 2QJTA 2HCBA 3V46A 4QZVA 1VKOA 3NGMA 1CK4A 1VIVA 3CF4A 2CF6A 1DB3A 3IIIA 3NEJA 2M9MA 4S24A 3AHCA 3RTGA 3J7AC 1U0TA 1P1JA 5DBEX 4ZV4A 3H16A 2R84A 2HSWA 3HDVA 3NHKA 4M21A 4QPNA 5KAPA 2PGIA