4FMDF

Espg-rab1 complex structure at 3.05 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
164
structure length
149
Chain Sequence
KLLLIGDSGVGKSCLLLRFADDTYTISTIGVDFKIRIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords EspG protein
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 149
sequence length 164
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdF00
2P5SA 4ACAA 3K0FA 1ESNA 3HDTA 4ZDKA 4E03A 3UATA 1TQDA 1KI7A 1FUUA 1H65A 1UBGA 2WKRA 2JLXA 1A7JA 2C5LA 4A6XA 2MMGA 3GEIA 1GNRA 4TSFA 2O0KA 1Q22A 3U5ZB 4CEHA 2WSSD 2ZYUX 3M1IA 1E1RD 2V4ZA 1P73A 2XJ4A 3H2YA 5DHAA 4JJZA 4B6FA 1G19A 2RGAA 1SHKA 5H70A 1MV5A 2ZJ8A 3K0FB 3JZAA 1P9WA 4AKEA 4MDEA 3IEVA 5JSZA 1P3JA 5BN5A 4M1YA 4EDHA 4FCWA 3VU9A 4Z8XA 1N6NA 2R6GA 4F7WA 2P3SA 1ZD1A 3Q85A 4CEHB 2OXRA 6Q21A 3WYGA 3K53A 1D9XA 1G1MA 5DN6A 4JLOA 2ASEA 2ZI9A 1IN5A 2GTPA 2L0XA 2NZ8A 3D6TB 5EQTA 2OLKA 4HSEA 1ZNXA 2ZR0A 3QE0A 4JSYA 3W3ZB 4BFUA 1Z6TA 2ATXA 2LCFA 2OAP1 3ZJYA 4DIDA 4PQYA 1XF9A 4Y0VA 3MLEA 3RS7A 2QT1A 3HYTA 4QHTA 5JSZB 1WMSA 2ZVQX 2ODEA 3NBXX 4JBWA 2JEOA 1KO4A 3VU9B 3CPEA 4MRNA 1KI9A 1G8HA 2IT1A 2ONKA 4WA7A 1G5PA 2VLIA 2K5UA 5JBQA 3B9PA 1RKBA 4JBYA 2ZRNA 2PJRA 4D4KA 3K0CC 1E69A 4M1KA 4JIMA 4NDZA 2NO1A 4WXRA 4PSVA 2BV3A 1MT0A 1RFLA 1D2MA 3VR4A 4C0JA 3I61A 5JI2E 1KKLA 1XTIA 3SFVA 3DHWC 4DLSA 1RYHA 3AVUA 4DDWA 3VR5A 4BWYA 3WY9A 4I1VA 1CJKC 2QP3A 3NC0C 2AK3A 4E5UA 3BGWA 1W36D 1TEXA 2DWQA 1DO0A 1E94E 4TYNA 1Z29A 4IRUB 4E09A 4IDQA 1KI1A 2RGCA 4PPFA 5A5GA 4ZDJA 1D8TA 1E4VA 3C7KA 4DC9A 3EAQA 4MGKR 2ZM5A 3BS4A 1JJ7A 1M8PA 3DMNA 3W6OA 4B43A 2D2EA 4HLCA 4HDCA 4A9AA 2GF0A 2J7PD 5CLLA 3LFUA 3AP2A 4QJ3A 2W0MA 2W6JD 3O8BA 3K70B 2HT6A 2OM2A 4Q19A 4TT3A 4HI0E 4DEXA 1LTQA 1Z07A 2WIAA 1NF3A 2JJ2D 3A1TA 3UWKA 2YWGA 3MWJA 2V6IA 4PHGA 1T5LA 3GLIA 2IYVA 1ZUHA 3RRNA 2CK3D 3KFVA 2F1RA 1HQCA 2H5EA 4Z1MD 1NBMA 5KDLA 4OI2A 3GLIE 5IHPA 4ZIRA 4LJ6A 3TW8B 1SVKA 2F1HA 4BPBA 3ETLA 4KO8A 3JVVA 1WQ1R 3DOFA 4MRVA 5ELXA 2FN4A 3OIUA 1DOAA 3O8DA 5EE0A 4RD0A 5CK4A 2XOKD 5FTLA 4M4SA 2EWWA 1A2KC 3KL4A 1G5TA 3GLIB 4I4LA 3DMDA 2QPOA 2WMOB 1IHUA 4C0BA 2PZFA 1DELA 2IS1A 1T6NA 3U3KA 2X1VA 2OT3B 3RABA 4ZIRB 5H1YA 5FH9A 2GVZC 3RS4A 4B3GA 1T0JB 1AM4D 4D4LA 2XTZA 5H8WA 2FPKA 4UJ3A 3LBIA 4R2IA 1OKKA 2W2VA 4R98A 1KOFA 1GRQA 3TAHA 2XNSA 2MSDB 5KDDA 1EGAA 3FTQA 1ZNWA 2EFGA 2QROA 4US0R 1LS1A 4G5QA 1XD2A 1U0HC 2CLCX 2FPMA 4MRRA 1E1QD 3PR1A 3AKYA 1XEWX 1TQ4A 1Z5ZA 2XXAA 4G01B 3MJRA 1I2DA 1QVRA 2G88A 3DOEA 3UMFA 2VHQA 2SHKA 4GT1A 3OFNA 1HUQA 3BFVA 1P72A 4B48A 2Z83A 2V8OA 5F2EA 5B2ZA 4ESHA 4A1FA 5J4KA 1QG4A 3FPAA 2Z4SA 4A0FA 4EFNA 4JKYA 4KVGA 1ZNZA 1KI4A 2F43A 5FUXA 1Q44A 2KWIA 3W9YA 1I2MA 3C15C 3PENA 5DE3A 3TSZA 1ANKA 2X8AA 2ZE6A 4IJMA 5AR1A 1OH5A 4PFSA 5FI0B 3QEOA 1XD2B 2JLQA 4NZYA 2WPDD 4IOLA 1U9IA 4DSUA 1KYIA 4D81A 2XXAB 2AKYA 5TMPA 2ZRMA 3F3YA 4OQXA 1OFIA 2ZE5A 4BRUA 2CL7X 3GP8A 4GOJA 4AURA 4U7DA 3CIOA 2F9LA 2OBNA 3FKSA 4WAUA 1MO5A 4YMSA 1E2HA 2ZI7A 3VMFA 1AS0A 5H68A 3NDBB 4UXJA 1CR0A 3GJ5A 4PHTA 4B33A 4GP6A 4HLUA 2REOA 1Y63A 2VSFA 1NLFA 2FNAA 3ZD7A 2QTFA 3VFDA 1G3UA 2DWOA 4M1SA 4PX9A 3SN6A 3H84A 1NJFA 1XPUA 4NYIR 3RWMB 1X1RA 4FD2A 3K9NA 3CZPA 2CMKA 1U8AA 3K8YA 4FCVA 2PMDA 1PUJA 4RY2A 5FTKA 4DDVA 621PA 5DNYB 1QDEA 1GP2A 4A2QA 2CLSA 4OQNA 2DFNA 3ZZUA 1RJ9A 3GLGE 3IPXA 1N5IA 5EXTA 3AKEA 3KQKA 2BM0A 1VPLA 4PC6A 4UNNA 3KJIA 5JFGA 2P65A 3IIMA 4KBFA 3PCRB 3TGPA 2FWRA 1W2HA 2AL7A 1II0A 1G3IA 1QBKC 3B85A 2WHXA 3RWOA 3L8ZA 1ESMA 4LY6A 2A5FA 1IM2A 1VG1A 2QM8A 1SXJE 1IN7A 1ZAKA 3RRMA 5EP2A 4BFZA 1YVDA 2CXXA 2ZR9A 4IEEA 1F3OA 2WSSA 4EQ6A 1VHTA 2NO7A 4TTRA 1E1RA 1RJ9B 4JJKA 4TMWA 1E9AA 1BYIA 3B82A 1R8SA 1TQ2A 1SVOA 1T8UA 5CK5A 3DL0A 4LPSA 4Q1DA 1UF9A 5FBRB 2OBMA 1X3SA 4PAOA 1AZSC 4Q7JB 1UM8A 2IC5A 2P0EA 1HURA 3WXMA 4JVLA 1DADA 5G3YA 1CRPA 4DLXA 4KODA 3MGCA 3BXZA 3LV8A 4ZPXA 2UKDA 1KSHA 4QBFA 1OYWA 2GBLC 4A2PA 1ZM7A 1F60A 1XDBA 4L9SA 4C3ZA 2E87A 5TY0A 4QGHA 4QBIA 4EPXA 8OHMA 1VYVA 4EPTA 3AEZA 4BRWA 4EQ6B 2QPAA 4BFXA 1WBDA 5FUYA 4Q4LA 4OHYA 4LV6A 1ETUA 4WOPA 3LBHA 4LPKA 5F3WB 1NY6A 1Q57A 3DZDA 1N0VC 1ZCBA 4URYR 5CITA 2A5YB 4BEBA 1W44A 1KK1A 2J1LA 1JPJA 3X1WA 3C5HA 3TK1A 3P26A 5JJLA 4DCUA 5KSZA 3IPYA 4R9UC 4L9WA 4ZCMA 4GPTA 4OI0A 1NI3A 4U00A 1A1VA 4TN1A 2EU8A 3R9XA 1VG9B 4URVR 1J8YF 1MO4A 5GVSA 2EFHB 3VNUA 3RS5A 1PLKA 2D62A 4PC7A 4Q9JA 1R0XA 2FA9A 4M1MA 2J9RA 2CE2X 1YQTA 4LRWA 2YNMA 1XTQA 1NG1A 4QOSA 4DJTA 3I5XA 4JT4A 3BORA 2D2FA 5EUQB 1VG8A 3GLHA 1GL7A 3CB4A 2EYQA 2WWHA 4IW3B 3SJCA 2VF8A 2PX0A 4JLMA 3MAAC 4ZCLA 2X2FA 4RCZA 4TLCA 3MD0A 5AJWA 1Q3TA 1JB1A 2ZRFA 4RD2A 1IY0A 3LAWA 2R62A 4Q00A 1ZW6A 3LA6A 5HE9A 3E70C 3Q5EA 3I8SA 4PO1A 2V55B 1NVVQ 2BEKA 3NG1A 1II8A 4DLWA 3U7EB 2CE7A 4HAWA 1XPOA 2JJ1D 1CF4A 2Q3HA 2RHMA 4B3BA 1G21E 2J7PA 1VCOA 2BCJQ 3AKDA 2W6JA 2FZLA 2ZE7A 2YYZA 3A1VA 3DEFA 4XVRA 3GLHB 2IWRA 1JAHA 1N2CE 1W2GA 5E7IA 2JLZA 2IYSA 2JJ2A 2FV8A 2I1QA 3NHBA 1HE8B 3FHOA 2VQSA 3PV0A 5JI3E 1A5TA 1W36B 2CK3A 5BYJA 1W4RA 2HV8A 1LY1A 4M53A 4D6PA 5L3SA 3W5JA 4C2TA 4Z1MA 5LB2A 4YMTA 4TQ9A 3TBKA 4D2IA 121PA 2BBWA 1KZGB 1I4DD 4TL9A 4JVNA 3R8FA 1PV4A 1II8B 1SVSA 3HJNA 1E9RA 2ZVPX 3NH6A 4DDUA 5KSYA 3R7WA 4KFRA 4FMBB 4CT5A 1EWQA 3KB2A 1TU4A 2V9PA 4A8JA 4LHXA 4RSGA 2R2AA 1U2RA 2CLDX 1LB1B 1UDWA 1JR6A 2XOKA 3TIFA 4TQAA 3UWOA 5EE9A 3SZRA 1CP2A 2GCOA 1Z06A 2HEIA 2QE7D 1NMYA 2ZREA 5L3SB 1Z2AA 3BIFA 3KJEA 1DARA 4LJ5A 1UEJA 3SFZA 4YMWA 4AI6A 3I72A 4PQFA 4KVAA 2OFWA 3U7FB 2ZYTX 4DXAA 1P4SA 2Z0MA 4MGIR 3H0KA 5CYOA 4DLUA 3R7WB 4DLRA 2XSZD 3THYA 1U8ZA 2VP9A 4B35A 4BEJA 3GJ6A 4A8JB 4C0SA 2RGDA 3GQBA 2IYZA 1Z28A 1NN3A 4M8NE 1NVXQ 4E07A 3V9PA 2GCOB 3SJAA 4LBZA 2JJ8A 4D80A 1E1QA 2YINC 4V02A 2IS4A 3QIAA 4EUNA 2BVNA 5JEDA 3U7HB 1X8LA 2VHUA 3BAFA 4JL6A 3T12A 4BLRA 3UXMA 3Q72A 4ZV4A 3LLUA 1IXZA 2F6RA 2A5DA 3RHFA 3THYB 4MQBA 1TADA 4M22A 4NKRA 2FSHA 1Z8FA 1XCMA 1K8RA 4RD3A 3QUSA 3RAPR 3WMFA 4QJ5A 4D82A 3K70C 3NHAA 4LYAA 2R65A 2RGGA 3ADBA 4CEJA 1NRJB 1ZMXA 4KFUA 1TX4B 3AGPA 2FJUA 1J7KA 1Z08A 1OV4A 4GL2A 2B8TA 4G5SA 5J4LA 4R71A 2WPDA 1FP7A 4EIWA 3KJHA 4TYYA 3VR3A 1CTQA 3C4JA 1ZUIA 3IIJA 3KXKA 1N5LA 2AKAB 3Q5DA 5E4FA 1JXMA 4G5RA 1N5JA 5JCPA 1P2SA 2PLFA 3TNFA 4F4CA 2ZJBA 4O25A 3VHLB 2GDJA 3RDPA 3GJ8A 2W6ID 1LFDB 2H17A 1G8PA 3GJXC 2ZRIA 3AKCA 1Q21A 3CNNA 2C77A 2QG6A 1E2PA 5FR2A 4CEJB 4B75A 3RLFA 5HCIA 3OF5A 1W0KD 1UKYA 3AF3A 3K09C 1LW7A 1NNEA 1OT3A 3HR8A 4URUR 5SZJA 2HF8A 3C16C 3JVUA 4EKDA 1Z47A 2QSYA 4M1TA 4OHVA 5FBLB 4XH9B 3U2QA 4LSGA 1C9KA 2HJGA 5EXSA 1G64A 3A1SA 1XEXA 2H1LA 3U44A 2RGXA 4NCIA 4WZ6A 5JRZA 2BBTA 2RB4A 4DDTA 3GEEA 2J59A 5CJ2A 1IJFA 4Q1CA 4E22A 1S3GA 2GAAA 4JLJA 4MGZR 1E2FA 4X8HA 2ZROA 3T5GA 4AYXA 4TLAA 1YZLA 2Q6TA 2JLUA 2J0QA 4Q4JA 3RRZA 1P2UA 5KDOA 4TQUS 3L0PA 4QC2A 5FL3A 3D3QA 5DHFA 3OIYA 2FFAA 4TYWA 4AG5A 2XJ9A 1HA3A 2WAXA 2F1JA 3SYLA 1G20E 1TNDA 1VYTA 3ASYA 1G8FA 1XEXB 3U44B 3ICEA 3HP1A 5IK2A 4WBSA 2BM1A 4H1VA 5FFMA 2XB2A 4I99A 2D4HA 1NN0A 3ZQ6A 2Q9AA 1T8TA 1XTKA 4D4JA 2NTYC 4F38A 1XU4A 4OI1A 3U3MA 2QUZA 3D8BA 4Q4JB 3EPLA 1Q1ZA 3A4MA 2ZITA 1M34E 2DHRA 2FSFA 3FKSD 1U0LA 4KLZA 1KSGA 1GKIA 2GEUA 2DFKB 5FBVB 5HKKD 1N6KA 1XXHE 1Q20A 2IYLD 3U3JA 2QZ4A 1Z0FA 2ZETA 2Q3FA 5HR5A 2ZJYA 3CZQA 4QGGA 1N5KA 2C2HA 4B3XA 3KQHA 4Z54A 4GZLA 3I5YA 3SQWA 3LO5A 4LUCA 1S9DA 3A36A 2WJVA 4WVFA 1TEVA 2ZAOA 2BBOA 3BERA 3NWJA 2EYUA 5CIQA 5J5CA 5IT5A 3CWQA 1EFTA 3NH9A 5CM9C 4XSHA 4DT1B 1O3YA 2I1VB 1NKTA 2RH5A 1OIWA 4JZKA 2QGZA 3E2IA 4GNKA 1K6MA 1KDRA 3ZVRA 1UAAA 3PJRA 4EJSB 1DE0A 1TAGA 4HLQB 4Q9IA 1E98A 1XB2A 4MUAA 3VAAA 1OF1A 3IUYA 4OK5A 2DY1A 1EWRA 1GIAA 1D5CA 2IYRA 1DAFA 3S1AA 2IS6A 1Y3AA 1KHTA 1SXJD 2WSMA 3BH6A 3KXIA 3W34A 2GVDC 1RRPA 2ZJ5A 2C9OA 4Q4AA 5FTJA 2A3RA 2BOVA 2ZRBA 3IQXA 4HUQA 2QQ0A 3FOZA 3PG5A 5CDFE 2C03A 4M1OA 2ODNA 1X8KA 4DLTA 1X6VA 2Y8EA 4HLUC 3DDCA 3T5DA 1S4QA 4LYHA 1Z6GA 1CR4A 1D2EA 1M2OB 4Q5IA 1II9A 2O8CA 5CJPA 1KGDA 3TW4A 2R6CA 3KZ1E 1AK2A 1OFTA 4HUTA 5KOYA 5BN3A 4L16A 1BH2A 1HY3A 3S1AB 4EPYA 2JJ1A 2V7QD 4AKGA 5JJKA 4Q4AB 2VP4A 1CR2A 4ITRC 3AV0B 1KO8A 2QAJA 1HEIA 4HUQB 4IVPA 2ZTSA 1AZTA 1NIJA 3L82B 2OCBA 1NLYA 4KBGA 1WE2A 2C96A 2PCJA 4A4DA 2AX4A 4IHQA 5F98A 4DCSA 4JT2A 2D7CA 1XJQA 2JAQA 4OI4A 1K5GA 2JA1A 1E9EA 3T61A 4B2LA 1GTVA 2NGRA 2YOHA 1C1YA 3KX2A 2OCAA 3T34A 1NN5A 3WNBA 4AYWA 4GDFA 1MRNA 3BH0A 3LXXA 3CONA 4OJKA 4YXWD 3MSXA 4V0ME 3ZIAD 2WWWA 2C99A 2HF9A 4MKGA 2RAPA 1CRQA 2ORIA 4ILEA 2ZPTX 1ZM4A 4TLBA 4JL8A 4A92A 2OO7A 4M9ZA 2R6DA 2DR3A 4AYTA 5J4YA 3DKPA 3Q3JB 3N5CA 2D7DA 2OXCA 3WNCA 1SZPA 4RJLA 5B57C 2QE7A 2IXFA 3CF0A 5KHOC 3A1WA 5BW8A 2IYXA 4TLDA 3VHXA 4H9GA 5JWHA 4KFTA 4BFTA 5TB5A 2QA5A 1N6IA 3AUXA 4TTQA 5HZKA 1QG2A 3B9QA 3FWYA 2CHQA 5F9HA 2GJ8A 3RANA 1KK2A 2XSZA 3IQWA 2QBYA 3EZFA 4KLNA 1TPZA 1FX0A 1DO2A 4Z51A 1VCNA 3L0OA 1FUKA 4YONB 4O2RA 2XTNA 4A6PA 3QKRA 4RKEA 4UNRA 2BEJA 2G77B 3SNHA 1V5WA 4B71A 1G41A 1EG7A 1KI2A 2FGJA 2OFOA 2FDCA 5B30A 1SHZA 2IA5A 3KKPA 3ICQB 1HE1C 1NMZA 4HZIA 1XMIA 2PZEA 3B7GA 1OE0A 1TUEA 4LJ8A 3DO6A 2VO1A 2H16A 3EXAA 4MA4A 2G1JA 5AUPB 1XZQA 4CYMA 4NCNA 1M7GA 2GEDA 2JLRA 3LY5A 4HZUA 4GSYA 1YR7A 3NBYC 3LD9A 4XTRA 4CF7A 5M04A 4CDGA 2QBYB 2FEMA 1XX6A 1DVRA 2FFBA 2QAGA 3EA0A 2W58A 1G18A 3QENA 4JYBA 1FX0B 3WMEA 4QBHA 3K0SA 3B1ZA 1E0JA 3QKRB 5DIFA 1T3HA 4QL3A 4TLEA 4GFDA 2XNDD 4DUGD 1ZVQA 1CJTC 1YE8A 1W36C 5KO2A 5A0FA 3K0AA 1BS1A 4G1UC 2WWGA 2VA8A 5FOUA 4NU0A 3G82C 4LGMA 4A0RA 1EESA 3CX7A 3EWAA 3O47A 4HZUB 2FZ4A 2ZYWX 2W6IA 4ERNA 4NCHA 3UG7A 4W5JA 4XVQA 2OFXA 2QAGB 3U3OA 2OSBA 3KKMA 5K8TA 1E2KA 1S8FA 1ZD8A 3H4MA 3QBTA 4KITB 1U81A 1W0KA 1G16A 5TVKA 1BMFD 1OH8A 2O8EA 1LS6A 3GPLA 4JYCA 1Q12A 2YC4C 4QHYA 3M6AA 521PA 4Q9KA 5AK0A 3NKVA 1AA9A 1CULC 4BFYA 4DHEA 3PQCA 5DO9A 5EP4A 1E9DA 1CEEA 3CF6R 1VIYA 2IBMA 4X8OA 4EAQA 2F7SA 3EWSA 1GRRA 1YKSA 2Q9BA 2WOOA 1KJYA 1DAHA 2YC2C 2H92A 1N25A 3CO5A 2YOFA 1EXMA 4RZUA 1ZM3A 1FPMA 3CX8A 4DCNA 2H7VA 4P31A 1QHNA 3J81k 5SZKB 1PJRA 2QRZA 4XIGS 3W90A 3FHTA 5BN4A 2QNRA 1VKJA 3GFTA 3OIVA 4XVUA 2W2TA 3SOPA 2O8EB 3P32A 2FF7A 3PUYA 4TL8A 1Z3IX 4QM6A 4C0AC 1LF0A 1GSIA 1G4UR 2QM7A 2NMVA 3NBZC 5AWFC 1MR3F 5L3QA 2WTUA 3GD7A 2PT7A 2X19A 4YLGA 5B64A 3SI7A 2MMCA 3LNCA 4P0TA 2IYYA 821PA 4RD4A 2IYWA 2CEAA 2HDNB 2ZSEA 5E7JA 2J87A 3B5JA 3KFXA 2ZQ5A 5K8LA 3A8TA 3QPWA 2EFCB 4QRHA 2J0VA 1AJEA 1JPNA 3NVAA 4JS0A 2AWOA 2FGKA 3CLVA 2IUSA 4GOKA 1P9NA 2GK7A 2IX3A 1MO6A 1VECA 3B13B 2KE5A 3KQLA 3OZXA 5DLQC 4AK9A 4Q01A 5GJWC 4HAZA 1IOZA 4PPGA 2F43B 4WXPA 3QNUA 2FFQA 2XGJA 5CLQA 3FDIA 2GAOA 2ZI3A 5JS7A 5HKKA 4U02A 4ZKEA 2W0SA 1MKYA 1OFUX 3A37A 3NBFA 4MYCA 2GJAA 2NIPA 3KUCA 4QNMA 5JHGB 1UFQA 3FHCB 3A4LA 5C1BA 4ZI2A 4DIEA 3HWSA 4NYJQ 3SC3A 4M0LA 2EFDB 4G5GA 5TARA 1G7CA 2AXNA 2Q9CA 2QSZA 1G8YA 1SVIA 2RGEA 4ZO4A 3GLGA 1P75A 2PEZA 4QBGB 4LWZA 4ZKDA 3AP1A 3LQQA 1CS4C 3B60A 3I8XA 2E1RA 1PZNA 1JQLB 2UZIR 1SULA 1D9ZA 2WWFA 3P20A 4DKXA 4XWKA 1QHIA 2WJHA 5FOSA 3UMSA 3K1JA 2RKOA 1E2MA 1SXJA 5EUMA 1UADA 1KK3A 5CB6A 3BB3A 3H1TA 3KQNA 5AUQA 2FE4A 1S0UA 3QQ5A 1JAIA 1W0JD 4LV8B 3VQTA 2AXPA 1FNNA 1QHXA 5IK2D 1G3RA 2YKGA 3GLGB 3KXLA 3Q8XB 4DB2A 5EJEA 2OBLA 3TR0A 3DVLA 3QKSA 2WWYA 4D0LB 4W5WA 2ORVA 3FGNA 1CJMA 4D4MA 1OYYA 3CRQA 3ONWA 3PFIA 1QF9A 1VCMA 4POAA 3AVTA 2AN9A 3L8YA 4CZ2A 1DG1G 1ZM2A 3PUWA 4NHOA 1QHYA 2R9VA 2CHVA 4NBSA 4PZYA 2BKUA 1YRBA 3GFOA 3ZH9B 3ZVLA 1SXJB 5LB4A 2WJGA 1NP6A 421PA 2A7QA 2V7QA 3HPQA 1OXXK 2NPIA 4NE2A 3MCAA 3AVVA 2VSXA 3I73A 1WDTA 2O0JA 3EZ2A 2OG2A 1X1SA 4JSTA 3OE7D 5GJVC 3IGFA 2IL1A 3TVDA 3VR2A 1AGPA 2PX3A 1F5NA 4FCTA 1YJ5A 2QMOA 2LWIA 3RC3A 1BO6A 1CJUC 3BRWD 4JLVA 2B21A 1E6CA 4YXWA 4ABYA 4Q7LA 3U4QA 3ZIAA 4FMDB 3WBKA 1XP8A 4OHWA 3SE0A 2AD5A 2ZAMA 3FYHA 2GA8A 4LBWA 3L0SA 4B3FX 3AM1A 3VR1A 1ODFA 4KI0A 2PEYA 2WM9B 2DFLA 1COWD 2ZRPA 3R20A 3HPRA 5D3MA 3MWLA 4G5OA 3ZDQA 4A2WA 3PUZA 2OAQ1 3NIBA 4EJSC 3ADDA 1CBUA 3CW2A 1MABA 2X77A 5EE5B 2ZSAA 4V0LA 4IXMA 4LBVA 1J2JA 1E3MA 4TZ6A 3WRXC 1KI3A 3U4QB 3TKLA 3AF4A 1Z0KA 2FX3A 1XEFA 2AFHE 2IYTA 2IW3A 3DZ8A 4NL4H 4AKHA 2VP6A 3EARA 4C7OA 2FU5C 5FR1A 3AVYA 2PH1A 1E9BA 1KJWA 3MUFA 1HH4A 4WIAA 4LDJA 3SJBA 3W6NA 2EW1A 4C0HA 5D3MB 4NYMQ 2QQEA 2ZIAA 1G7TA 2ERYA 2VHCA 3U6KA 1MABB 1E9FA 4DB4A 1R0YA 2C8VA 4IKEA 2JCSA 3ZD6A 2QENA 1JR3E 2Q21A 3PUVA 3QOFA 1H8ED 4BGDA 2IF2A 4OJQA 2PJZA 1DAEA 1XD8A 1ZU5A 5FPHA 2N46A 5C46F 3I62A 1M1YE 5KUTA 5AJXA 2WOJA 1R10A 4C7OB 1OHHD 4NONA 1R2QA 1XMSA 4GBMA 1ELOA 1KNQA 1XMVA 2NO0A 5BWMA 3VNVA 4FINA 1JEEA 2XNDA 1YZQA 2YWEA 1IY2A 1RZ3A 2NO9A 3BB1A 4QGAA 5EP1A 2ERXA 4DUGA 5JCZA 3IKJA 3ZS8A 1WF3A 3QBVA 1QVAA 2BKEA 5E3HA 2GJKA 1G7RA 1NY5A 4B32A 2ZS9A 4LYJA 2QL6A 1IN8A 5KTYA 4LC1A 1HV8A 4X8LA 1OPXA 4PC1A 3SQXA 4RVCA 4QGFA 1G17A 1PVOA 3GJ3A 1MO3A 1NG9A 5F9FA 4IXNA 3FFAA 2GEVA 3NDPA 3IO5A 2FH5B 4TMVA 3EX7C 4PZLA 2KBFA 4NMMA 1KNXA 4P3YA 1OIXA 5DGXA 2EWVA 4M21A 1BMFA 4QHSA 3EPKA 4MYHA 3TLXA 4S2EA 2VEDA 1Q1QA 1M7HA 3ZVNA 1E0AA 4MKHA 1SVLA 3N2IA 3QPVA 1E2GA 3EC1A 1F2UA 1E99A 2Z4RA 3REFA 2QI9C 4K46A 4Q48A 4P4SA 3WBJA 4GMXA 2P6NA 4HAVA 5GJBA 2KBEA 4FMCF 4URWR 4XOIA 1FMLA 4CIDA 3KKOA 4DCTA 3UKDA 3AVWA 4V0NA 1ZD9A 3TR5A 4MRSA 1DAIA 2QORA 1TTTA 5CYPA 5C18A 4EPWA 3SJZA 3LX5A 3C5CA 1T4GA 3TSOA 2VRWA 3RVBA 3LW7A 4FMCB 5HPYB 1F2UB 2GZDA 3AH8A 5B58C 4FW9A 5ANRB 3TMKA 4P4SB 4M9SA 4RZ3A 1L8QA 2Z43A 5EE3A 2AFIE 4XWOA 2ZYVX 1ZCAA 3ZQJA 1XD9A 1RRGA 2ZJOA 3SHFA 2O52A 2OLJA 1XTSA 4LBYA 1V43A 1DTSA 2C95A 4Q1AA 5HE8A 1XNJA 3TAUA 2DYKA 1N6RA 2AHOA 2IHBA 1RE0A 1IN4A 3FMIA 2Q3MA 3OAAD 1R0ZA 4BZQA 3A4NA 3QEJA 2VP2A 5L3RA 5C4MA 1Z0AA 4IFEA 1T5IA 2ZUDA 5JHHB 2D06A 1JECA 3P1JA 4DSOA 3AVQA 3THWA 3IHWA 4KAXA 5E7MA 1E9CA 5FPSA 3V4RA 2IF0A 1G4AE 1TF7A 2KSQA 3D31A 5CIWA 1PLJA 4JVSB 3ZZ0A 5BXQC 2HLDD 2BJWA 2H8KA 4AC9A 3MWYW 3FB4A 5KNCA 3QSYA 4MUBA 4TYQA 1CIPA 4LHVA 2IEZA 4KU4A 1GG2A 1WCV1 4V0KA 2G0TA 5JEEA 5GADl 1Z0JA 2FG5A 2HCBA 3I4LA 3UIEA 4OKSA 4CGZA 3BFKA 2J7KA 1E79D 2QP4A 3THWB 1E2EA 3LVRE 2WWIA 1U90A 4Y0AA 5EXXA 4BECA 5JLJA 4AY2A 2VIIA 4LCBA 2ZSBA 1W4BA 2ODWA 3AF0A 3SHWA 1S3SA 1G9XA 4UNQA 5UKDA 2MSEB 4QXAA 2WAYA 5EE1A 4JLKA 4LJ7A 3EPJA 1GZSA 1L2TA 2P5TB 3B6EA 4UXIA 5AJZA 1E2JA 2BMEA 1KZ7B 3AQ4A 1W0JA 1ZUNB 3BBPA 5LD2B 5IDVA 1KI8A 4IOMA 4HEJA 2IHYA 3X1XA 3ND8A 4HDQB 4LZZA 1G6OA 1Z63A 3OEEA 4WZBE 2ZU6A 2N1BA 4GMDA 1OXVA 4I1SA 2QTVB 2G9NA 1NSFA 4CW7A 2O8FA 2GXAA 4PO8A 4F93B 5KYKA 3GCGA 4HAUA 1OXSC 2OCPA 4DSTA 1X8JA 4YDHB 4KHZA 2A2ZA 2IXEA 4PZZA 1XXHA 5AJVB 2WVJA 2QGNA 2GXQA 4S35A 1JBKA 4XTCS 1ZP6A 4PR0A 1N6PA 4QM7A 1FMJA 1P62B 1FW6A 1KAOA 3LBNA 3QF4A 3ZS9A 1GOTA 2REXB 4DLZA 4JL5A 3LQRA 2VHTA 3LH5A 1J8MF 4A36A 4OBEA 3FKQA 2G83A 3U6BA 2AR7A 3OE7A 2LKCA 2VH5R 2BIFA 1LF5A 3FFBA 3KQUA 2O8FB 4HATA 1CJVC 1DAKA 4Q1EA 1AN0A 1WRBA 3P4XA 1FOEB 4D0GA 4OQLA 1KY2A 2XTMA 2O8BA 1VG0B 1OJLA 3T15A 2YWFA 2CCGA 1FL9A 2VL7A 2C78A 1XXHB 1U9IC 4OK3A 4CRWB 3OEHD 2MSCB 4UXHA 5G40A 1UJ2A 1ZIPA 3QXCA 3QF4B 4US1R 3TQFA 1TUIA 1YZTA 3REGA 1IONA 1S1CA 2QEQA 2GWHA 1Q1BA 3V4FA 1GM5A 1COWA 4NYIQ 1QZXA 4KSCA 2ANCA 2ZRHA 1RVDA 5CDFA 1TQ6A 4CVNA 5JJIA 4I1UA 4MH0R 1YR9A 2RGBA 2ZRGA 3IO3A 3PEWA 3OIWA 4DEYA 3CH5A 2IUTA 3BC1A 3AVPA 4LI0A 2O8BB 1Z6XA 5J4HA 1E2DA 4G3XA 1J70A 2AWNA 4FWTA 2GZHA 3I3SR 2VHJA 3SU8A 1VHLA 1XBTA 3CF2A 4D26A 4BASA 4TWZA 3RS3A 4Q9HA 3R9IA 4BFSA 1ZINA 1S2MA 3H86A 2V1UA 3Q7QA 4LX0A 1K5DA 1JI0A 4TYPA 5KSOA 1L7VC 2J41A 4L4UA 1LV7A 4O2LA 3CUEF 2TMKA 1NVVR 1ZC3A 2QTHA 2CL0X 4P4TA 5E95A 3L0IB 5L8VA 1EFHA 3HU3A 4M1WA 2CHGA 3WRYC 3ADCA 4NYMR 3W8RA 3SYKA 1R4AA 1P61B 2B7BA 3CKLA 4QJ4A 4D25A 1GFIA 1ZRHA 2J45A 4D0NA 1H8EA 3T1QA 4L8GA 1FZQA 2WZQA 4JLAA 1H8HD 1SXJC 4KYIB 2KJQA 4XWAA 3D7MA 4KV9A 4V0MA 4MDFA 2UVQA 1OHHA 3AF1A 3CWZA 1EK0A 4JLPA 3M4YA 4JLDA 4LOAA 3PIRA 3ASZA 2GCNA 4FN5A 1B23P 1RRFA 3TUJC 4IDOA 2CBZA 1W4AA 1GNQA 2DCUA 1KJZA 4QFMA 1KO5A 4C0LA 1XWIA 2V1XA 1I4TD 1E9SA 3F5FA 5FL7D 2CVFA 2KB0A 4NCJA 4N1AA 1OB5A 2F55A 2OUKA 2EFEB 4PSKA 3ZYCA 3EZ6A 1E2NA 4K81B 4AKIA 1MOZA 5JMTA 1VDZA 3I92A 3U3RA 2VP0A 4BFVA 5JWRA 3PEVA 1SQ5A 4LJAA 2IS2A 1SKQA 5GJCA 3UANA 1RIFA 1W5TA 1QHSA 3B1VA 1GL6A 2B6HA 1UEIA 1Q0UA 2ATVA 1KMQA 2OV2A 4NPHA 4DSNA 4DLVA 1S1MA 3FMFA 2J0SA 3CR8A 5DISB 2R44A 4UNPA 4TMZA 5JWOA 2B7CA 2BMFA 3HU2A 1L4YA 3KTAA 1N6LA 3W6PA 1S96A 1G5RA 5DI9A 1AS2A 4KYUA 1JR3D 5J4VA 2NZJA 5G41A 2FPLA 1RC8A 1YR8A 4LC0A 1Z6YA 5IF9A 5CM8B 1ZBDA 1TU3A 2ZEJA 3EASA 4ZCIA 1JXOA 5FPKA 1ZM9A 3LWNA 2I3BA 2BDTA 1SKYE 2W83A 4AG6A 2RGNA 3SS8A 3QJYA 2FSIA 2FSGA 5JECA 2W00A 3FE2A 1AKYA 4KXFB 4RFSA 2ZRCA 4ZI3A 3R9WA 4B6EA 3QPUA 3TUZC 1M74A 2VTKA 1A4RA 1UBEA 3KTAB 3NEJA 2F1IA 3VX4A 5IRCD 1U94A 2GNOA 2OESA 3O8RA 2P67A 3EZ9A 5A4JA 3VKHA 2R8RA 1SKYB 1HT2E 3ADKA 3CM0A 3QXSA 3TH5A 4A82A 4PAQA 3I1FA 1A82A 1D2NA 4C0QC 5FBWB 3Q9LA 1S9HA 2QP9X 4M9XA 2GCPA 2V6JA 3K09A 5FTNA 1R0WA 1KMHA 2CNWD 2OEPA 4ARZA 4JLBA 3X1YA 3PUXA 1O87A 3OAAA 1KSFX 2G0NA 1OXTA 3A58B 1AIPA 4RFSB 3WHKA 3CRMA 3QG1A 1NBME 2QU8A 3AP3A 4Q7MB 4NCKA 4W7SA 3EPHA 2ZRDA 3FMPB 2YWHA 4C0KA 5FUVA 3PITA 2WBLC 4PAMA 4DLYA 1RPZA 3K0AB 2FEOA 1TF5A 3G5UA 5FBQB 4C4PA 2HLDA 3U7GA 1F2TA 1HTWA 1A2BA 4W9MC 1E0KA 1FNMA 2OILA 2ANBA 4IVRA 4PHHA 3TVTA 3CBQA 1IAQA 1DG3A 1OXUA 3KKNA 4JLNA 5HTKA 3KJGA 1C4OA 1KMHB 1QRAA 2JDID 2LKDA 2NO6A 5BYKA 4MGYR 4ARZB 4IDPA 4YQFA 1G3QA 2IK8A 5SZIA 1R7RA 1W49A 2YOGA 4WW0A 2A30A 1VMAA 2XZPA 5EZ5A 3AVXA 4A8JC 3ECCA 4P4UA 2VPPA 1E79A 3P4YA 1FTSA 1NVUQ 2D3WA 3T06B 4H1UA 2ZJAA 4WZAE 2ORWA 4Q4HA 4Q18A 5DYGA 1OH6A 2H18A 4IOJA 4JVMA 2ONJA 1E0SA 3SBDA 4ASUD 1EFCA 4GZMA 2GK6A 2PMKA 5G3ZA 1P9RA 2IYQA 3RYTC 3W5IA 3CH4B 3SDZA 3G0HA 1F2TB 1OSNA 3BOSA 3TQCA 3BJIC 3CPHA 1OIVA 1XPRA 2BBSA 3WYAA 4IOKA 2Z5FA 2GZAA 5JZVA 4BQSA 1N0UA 5KPDA 1GWNA 1T0HB 2O8CB 4F91B 2FOLA 3WMGA 1QHHA 1KO7A 3EA5A 1FP6A 4Q7KA 1JNYA 2WKQA 2ZRJA 1G8GA 4B2IA 2JASA 1EFRD 1YRAA 5FPTA 4B3DA 1CXZA 1Z83A 4RZXA 3K9GA 3U60B 3UPUA 4PO9A 1N6HA 1JALA 2YJTD 3CX6A 4Q4HB 4C30A 3EW9A 2GF9A 3QVUA 4LYFA 3K9HA 4RCYA 3I32A 1IQPA 1KDTA 5L3QB 3EIEA 1BYUA 4KSBA 2O0HA 2ZRAA 1UKVY 1WP9A 1GL9B 4KCGA 4BLSA 1QHHB 3F8TA 3QVVA 3ZVMA 3B1WA 1GAJA 4B74A 4RZ2A 4EFMA 2WJYA 2IEYA 3BB4A 2GILA 2BMJA 2WJJA 3GMTA 3WNDA 5DYIA 3PEYA 1NN1A 1U0JA 4OQMA 2G1KA 3KUDA 2PBRA 4MKIA 4MYUA 3OEHA 4O3MA 2CCJA 3GJ0A 4N0EA 2PCLA 3B1XA 2Z6VA 5D3QA 4Z8YA 1W5SA 2CVHA 2BWJA 4YMUA 2YHSA 3NXSA 1NIPA 2ZANA 3TRFA 3L43A 3CPJB 4HB3A 4YC7A 5FOXA 3KB1A 2BC9A 1MH1A 1WA5A 4FI3C 2GKSA 3PXGA 4CEIA 2JIZD 2NG1A 1VIAA 1Z6AA 1P2TA 4GI7A 3IIKA 5EP3A 4EPRA 3EZ7A 1U99A 4XD7D 2KI5A 2QY9A 3FMOB 4MKFA 2YZ2A 2I4IA 4L5BA 3QXXA 2ZU0C 2ZUCA 1EX7A 1T91A 4BLQA 2HXSA 5G53C 2QRNA 2CDNA 4TZ0A 4PPNA 1AKEA 3OEED 3T1OA 4A0GA 5LPNA 3LVQE 1OH7A 3WYFA 2DWPA 4P33A 2D74A 2QT0A 2CJWA 2W2XA 1OW3B 4Q02A 4GP7A 5FPYA 2JLYA 5LD2C 1G6HA 2ZRLA 4OK6A 3N2EA 1RYFA 2ZI4A 3JZMA 3P27A 2A78A 1JJVA 2XITA 3QG5A 3THOA 4DZZA 2AD1A 3TSWA 4CEIB 2B92A 3AF2A 4HLDA 2ZS7A 1OLOA 1UDXA 3SBEA 1HT1E 2E9SA 1YR6A 1AQYA 4DWJA 3QXHA 5TXGA 4LHWA 4V03A 1W48A 2Q0HA 1EFUA 4FMDF 2REBA 3QKSB 1H8HA 2J5XA 4OL0A 2IUUA 2HUPA 1R6BX 1Z2CA 4GRAA 2CJWB 4PC3A 4NP6A 2JATA 3SR0A 2WKPA 5K8UA 5FI1B 1WBBA 1FFHA 1N6OA 1BKDR 1N0WA 1VYUA 2GHIA 3K0CA 3W8NA 4BLPA 5FTMA 2QMUA 1GKYA 4ACBA 2PZGA 3B2EA 4LHYA 2B8WA 2WICA 3KDSE 1Z22A 2A5JA 5FL7A 2ZI5A 5EZ6B 5L3VA 1XTJA 5TDHA 1GKUB 2X2EA 2ZUBA 4HB0A 1UBFA 1MRSA 5AUNB 1XEWY 2PLRA 4O0MA 1CLUA 1E4YA 1PUIA 1US8A 1YZUA 2GJSA 1WB9A 2XZOA 1CKEA 3MJHA 4BLTA 1I4LD 1YZKA 5DI3A 1KO1A 5BQ5A 2IYUA 2J46A 1ZYUA 1OFHA 3TE6A 1TL7C 1FQJA 1CU1A 1SVWA 4P32A 4AIIA 2OZEA 4I1OA 4TL7A 2RHDA 3NEYA 4JMPA 1SGWA 4ON9A 4QG7A 5DSZA 4UJ5A 1XRJA 3FVQA 3MRSA 4Q03A 4DVGA 1E2IA 3PEUA 1KDOA 4OHXA 2WMNB 3BK7A 5SZHB 3IBYA 1DAGA 4HAYA 4RFVA 3TJZA 3QY0A 2P6UA 1T9HA 5KNDA 1AS3A 4GOXA 3LDAA 4X8MA 1KSJA 5K8IA 1US8B 4LJYA 2XEXA 1JR3A 3VR6A 3E5HA 4DBLC 2QMEA 5J40A 3MFYA 4TSFD 3U61B 1IY1A 3C8UA 3IDQA 2IWHA 4A15A 2NQ2C 5HCNA 1Q3HA 1LVGA 5DI3B 4IFBA 1XZPA 3ND9A 1U8YA 1FQKA 3NTUA 3GLHE 2OHFA 4PXAA 4UNSA 1P6XA 1KY3A 3M0EA 4L15A 4DRZA 2RCNA 3B78A 3MG9A 4J0QA 1GNPA 3UG6A 4URZR 2C9CA 5FUWA 1ZIOA 1WXQA 1R5OA 4B34A 2CCKA 4Q66C 2WIBA 1NSTA 2VSOA 1DS6A 1R8QA 3KKQA 4Q1BA 4HDOB 1YZNA 2O8DA 3ZGXA 4FIDA 3RSLA 1XCGB 2G3YA 4LK2A 1E2QA 3GJ4A 3X2SA 2JLVA 2ZRKA 3UK6A 4KJZA 3VX3A 5FOVA 1IXSB 3NC1C 5DN6D 1YU9A 3BD9A 3E1SA 1KI6A 1XTRA 2GESA 2CNWA 1DPFA 4W5HA 5KNBA 4C2UA 1KK0A 1TF2A 1NMXA 1ZC4A 1CR1A 4JBXA 2XX3A 5C2JB 4HB4A 4QNRA 3N70A 4KFSA 4PPQA 3R8CA 3GFPA 4LJ9A 1P2VA 2ZS8A 3CRVA 4NTZA 3LRPA 1BOFA 2O8DB 3B8HA 1R5NA 3IHLA 1AGRA 2GJ9A 2ZJZA 1W1WA 2ODBA 1W4CA 1Z0DA 3LLMA 5KSPA 3HU1A 1YHNA 5EXPA 3T1VA 2ZE8A 2BMDA 1KI6B 4C9BA 2HYDA 4R2HA 2GRJA 1GDDA 1T3SA 2JDIA 5FOWA 3K70D 1OB2A 4K8OA 3K0EA 3AUYA 1HYQA 4IVQA 4TMTA 4BLOA 3O8CA 1RW4A 4TTPA 1G3MA 2NPFA 1SVMA 2H57A 1NLZA 3EC2A 2QMHA 1ZJ6A 1KAGA 1RRCA 4TMXA 5LDDC 4YMVA 4HAXA 3RS0A 5AJYA 4PANA 2JLWA 4ASUA 2OE2A 3IEUA 1KTVA 3AVOA 3BWDD 1G291 3CRRA 5CB8A 1AQUA 3CNOA 3MMPA 2OCYC 5J47A 2P2LA 3Q7PA 4MYTA 1Z0IA 2ZR7A 3HYRA 4PC2A 2WJIA 2GXSA 2RMKA 2VBCA 1W7AA 4TT3D 3C14C 5HZHA 3IBGA 4BZPA 1Q1EA 5JS8A 1ZNYA 4F4IA 3CR7A 1PLLA 4U5XA 1EFRA 1GRNA 4R7ZA 4Q1FA 1GITA 4B73A 4BZXA 1HQYE 2F3RA 1IBRA 4B44A 3L2OB 1DAMA 3VKWA 4URXR 2VF7A 2BJVA 1P60A 1JEDA 3BH7A 1NBMD 3WHLA 4ZDIA 2G6BA 1IN6A 4US2R 1VTKA 2XAUA 1D6JA 1TMKA 4MRPA 4Q9LA 3CRW1 2XB4A 3OHMA 2V54A 3QI2A 4AWXA 2RGNC 1J90A 1GUAA 2QPTA 3OESA 4M2LA 5GVRA 1EX6A 4OQFA 2A9KA 4BFWA 5TV2A 3EG5A 3HR7A 2C9YA 3RS2A 2EQBA 3MWKA 1XMJA 3WP0A 1L4UA 2QAGC 1QHGA 2ZI6A 1XJCA 2CL6X 3BFXA 2FFHA 3QKUA 2FMXA 2YV5A 4MITA 4N0DA 2YVUA 2ZJ2A 4PHFA 2PT5A 4NYJR 4PQRA 1IJEA 1W46A 2UZ3A 3CNLA 3AGQA 4II7A 3QXJA 1NL3A 3V00A 4F4JA 1GVNB 1XJ0A 2R6AA 3GJ7A 4M9QA 721PA 4FXPA 3UMRA 4CT4B 3EIQA 3EIHA 3PVSA 2DPXA 1OKKD 1XFAA 4BUJA 3WP1B 4PTLA 2A5GA 2DFTA 1DBSA 4AD8A 2QN6A 2IXGA 5KPJA 4DCVA 1UKZA 3C41J 2JIZA 2HJVA 4XJXA 4A0HA 1BIFA 4BE7B 3THXA 2R6FA 4NH0A 4XD7A 4ESVA 2HT1A 2HYIC 1KDPA 3ZZTA 2V3CC 2N42A 2VP5A 1UBCA 1KIMA 4LJ4A 3GLFA 3OFND 2GBLA 1DEKA 4EFLA 1NJGA 3DPUA 1E96A 2F3TA 2WWXA 3RNLA 2JGNA 2PL3A 4PSAA 2DBYA 3GLFE 1J99A 2BHRA 4UKDA 3X1ZA 1GILA 3SYNA 4N3NA 2HXYA 4I81A 3RRYA 1F48A 4B47A 1XCPA 4TL6A 5P21A 1VCIA 4LHZA 4LV5B 2XZLA 4RKFA 3ZLJA 1FTNA 3VTKA 2P6RA 1M6NA 1KKMA 1NVWQ 3THXB 2ZSDA 4YDSA 1UPTA 1E32A 1P5ZB 1N3BA 1ONBA 4G0NA 2EVWX 3DKVA 221PA 4HB2A 3QF7A 4TMKA 5FOTA 1YZGA 4B76A 5JRJA 1P7CA 2JLSA 1LNZA 3GLFB 2J0UA 4IEIA 3GEHA 4DT1A 4EPVA 2J3EA 3IILA 4UQOA 1B0UA 3F0TA 2AK2A 4FWIB 3RSOA 1X86B 4Q47A 2C98A 2O5VA 3AB3A 4IDNA 5C4GB 3SEAA 4OHZA 3T35A 4B2PA 5KU1A 1W47A 3QKTA 4B3CA 4EJSA 2DB3A 1JQJC 2ZSFA 2GXUA 4RD1A 5DH9A 3TUIC 1UKEA 2C04A 4ZDWA 4JKIA 2ZXUA 2VYFA 1R5BA 3LW8A 1NKSA 3DM5A 3W3AA 4Q21A 3BE4A 4V0OA 2WV9A 3B1YA 1ZU4A 1F6BA 4IDHA 1T3LA 2BCGY 4XSGA 2J0UB 4QKQA 5AUOB 3T1TA 1M7BA 3K9LA 3DM9B 2F9MA 3LX8A 3VKGA 2ECKA 1E2LA 3A1UA 4F92B 2NOAA 1G7SA 1IXRC 1U98A 4OYHA 3RC8A 2GETA 3X1DA 3A6PC 4HYYA 3LXRA 5LBIA 2HCJB 4RD6A
chains in the Genus database with same CATH superfamily
2NSYA 3HRIA 4BMDA 4ADSG 1MAAA 3OPYI 1I01A 4PAWA 3IL2A 1NC3A 3HDTA 5KOIA 3EGDA 4E03A 1U65A 3TZKA 3UWDA 3HB4X 1GZ6A 5FLEX 2G7ZA 1QTIA 3U7QA 1F0PA 2NXJA 1FUUA 1H65A 3QK7A 3C5WP 4HDSB 5KBYA 1O6CA 3R40A 5AK6A 1TO2E 2JH3A 8ATCA 1I1NA 1L4EA 1IPEA 1Q22A 2O0KA 3HKEA 3U5ZB 3HI6A 4LF5B 3QELA 4MI6A 3M1IA 4BO8A 1R6DA 4IVNA 3GUUA 4XI9A 4HYTA 3PDCA 5DHAA 4IDDA 5H02A 4IHKA 5HRCA 3B9RA 1X7HA 1XHLA 3BGDA 3FNIA 2HIGA 3WHIA 1K75A 1MV5A 1P1RA 3BQMB 3Q7IA 1EA7A 2ZB2A 3CNBA 4B5LA 2OTCA 1FNCA 2CFCA 1RAIA 4X63A 4A3SA 4EHAA 1P77A 1K8ZB 1VLHA 4MCIA 3N2YA 3O75A 4N9WA 3A9RA 4G0QA 1L1FA 1Z82A 5IJXA 2Z4TA 4G26A 1DAPA 2QR3A 5AK4A 4E5YA 4JFRA 1ZD1A 1JT2A 5T5QA 1JDZA 3IXQA 6Q21A 2QHXA 4TS1A 4KO1S 3MGBA 2P75A 3K53A 2C7RA 1TYCA 2I3ZA 2HQOA 1BXRB 3O8NA 1N9GB 1VIMA 2C4HA 3HUFA 5DN6A 1ADJA 2ZI9A 5M29A 2L0XA 4WKBA 4OMDA 2C2WA 4ZVSA 1MF7A 3UJ7A 1ZNXA 4XYMA 4JSYA 4Y6RA 4K9OA 3U80A 1LLCA 1UBKS 3TDMA 5HSGA 2IVZA 2AUNA 4JJ7A 2Y9MB 3ANSA 1STOA 1WMSA 3DTYA 4ER6A 4FYKA 3K31A 1J2RA 3NBXX 3RUAA 1YV9A 2HTFA 4FFVA 1KO4A 1TJ4A 3VU9B 3C6QA 3CPEA 4EARA 4MRNA 4RJTA 4RWZA 4FZJA 1P45A 4JOBA 1BD3A 1R6AA 1P2DA 3T7KA 3EFHA 3T1NA 4BL5A 1GPJA 1D5WA 4FFLA 3K0CC 4DREA 3ZWBA 4JIMA 1ORVA 1XEAA 3S5JA 4WJLA 1D2MA 2LE0A 3VR4A 3JQAA 1V6AA 3NCHA 3I9V1 3SFVA 5IT9A 2DQKA 1Z36A 3QX8A 3T7DA 4DDKA 3D8TA 1UK9A 2XMDA 4BWYA 4REQB 3WY9A 1CJKC 1T9AA 3HCDA 2PFGA 4B7CA 9LDBA 4BP8A 1SG9A 5JCJA 4M60A 1R1DA 4FR5A 1HT0A 1PQPA 1TEXA 1KU6A 3GHHA 3HJFA 4B7AA 4TYNA 4IRUB 2I91A 3OE5A 4E09A 1MB0A 5KKNB 1K92A 1E4VA 3C7KA 3MIIA 4ZVLA 1BJRE 4LTDA 5IKEA 3PFFA 3TCNA 3KSAC 1XRMA 1M72A 2HHLA 1K6IA 1V1RA 1Y3FE 3INNA 1JLHA 1CC1S 2D2EA 3L6BA 1X7ZB 2O3QA 2J7PD 2SICE 3R0VA 4RADA 4YPFA 5TGDA 3WLPA 3J7TA 1P5FA 3AETA 2BW0A 3O8BA 2PMWB 4Q3AA 2OM2A 4R69A 2VAMA 2WIAA 4M9UA 1NF3A 1B0PA 3CEAA 2FEPA 2YWGA 3MWJA 4RL6A 3SZGA 2V6IA 3UWKA 3NS7A 3ZDXB 3PGA1 1SBQA 2TRSB 4IZ6A 3HDJA 5TMEA 4F97A 5BOSA 1YCGA 3RRNA 2CK3D 4JBLA 3RU2A 4PZUA 2Q62A 1NBMA 1VKHA 3S2IA 5DZSA 3GLIE 1CUHA 4V0QA 2B99A 1PDWA 1JPUA 4LJ6A 2TECE 1DBVO 5KVAA 2BHLA 1DRVA 2FEWB 2FPOA 4KO8A 4F84A 3EY9A 3R41A 4LJSA 1IN1A 3DZBA 3K9BA 4Q6BA 4S1PA 1UXKA 2AJ8A 4MRVA 3HSSA 2R1TB 2FN4A 2JW5A 4B8YA 5ELXA 1DOAA 2YIMA 3QTTA 1K97A 4CGYA 1FU8A 2CVZA 1NULA 3KC2A 4E5KA 3DOOA 5KC9A 3TCXB 3TWOA 3LL4A 5FT9A 4H3VA 3QEAZ 4BWVA 4RDCA 2JIPA 3KL4A 1AXEA 1M8GA 3FPSA 3FDJA 3GLIB 3DMDA 3RU9A 3G0BA 1WM1A 3HBAA 3KAJA 3VHQA 2VF4X 7REQA 3HJTA 4RUKA 4C0BA 3MJTA 1WNFA 4MPTA 3U3KA 4MV1A 5ALGA 3IESA 4WXHA 3N6VA 4DSAA 3RS4A 4AW9A 2WINI 1L5VA 5FH9A 4MJ7A 1KIAA 4B3GA 1T0JB 5TMDA 1AM4D 4AJNA 3Q87B 1GAWA 2PKQP 3MINA 4D4LA 2L17A 3FETA 3D5TA 3W2FA 2PT6A 2PMBA 5ED0A 3LBIA 2Q2NA 4R2IA 5K6TA 4MB2A 1N78A 1Q1GA 1KOFA 1RAHA 3FFXA 1FLVA 1XSEA 4HD8A 4BV2A 4E11A 1Z38A 5BWNA 3FTQA 4LOHA 2GBPA 4RULA 3CKMA 5JANA 1PGQA 2YW2A 1U7ZA 3E9CA 3K1TA 1LS1A 4G5QA 1XD2A 1SU8A 3QFHA 3VZSA 1Z4OA 2OO5A 2A0YA 1JBQA 3IAHA 3AMVA 2OFFA 7ABPA 2NV6A 3PR1A 4GRIA 4XX1A 4KSYA 1Z5ZA 6PFKA 3E15A 1W5BA 5SYAA 2WFLA 4B6OA 5JCOC 4KVZA 1AK1A 1ZMRA 2A1UA 3M49A 1JQ5A 3OH8A 1H2RS 4K3VA 4P7JA 2I76A 4ESHA 2ZP1A 3M89A 4XDYA 3WLAA 4A1FA 5J4KA 4INOA 1HFEL 5H83A 2O1EA 1M6VB 2IPXA 4NPCA 4A0FA 5KZMB 4UBJA 4D97A 2VJPA 4KO3S 1MNAA 2ZIUB 4BGIA 3NM4A 1UBUS 3BXGA 1EGHA 4I50A 5FUXA 2AG8A 2KWIA 1H5NA 1LI5A 2H08A 1I2MA 3PENA 4RDXA 3K6SA 3TSZA 1ANKA 2D5AA 2ZE6A 4X9XA 1K4KA 3OIFA 4MEJA 4PFSA 5DMHA 5FI0B 3VUEA 3JWGA 4RETA 4XGNA 5I5GA 5J63A 1W30A 5SYMA 5AVWA 4NZYA 1USKA 2QVGA 4IOLA 1QG6A 3NOXA 2E7ZA 5FWXB 1QLJA 4C5BA 1ATIA 1Z4PX 3IPLA 3S2FA 3IEPA 1E3QA 4I50F 4Z5XA 5ALSA 4LZOA 2ZRMA 3MT0A 3L4KA 1KZYC 1OFIA 2LPMA 1XDUA 2WTAA 4GOJA 5MHTA 1P0QA 1PNQA 2DWUA 2XMCA 4X44A 1KBOA 1WPXA 2F9LA 2OBNA 3BTVA 3ORQA 3RUPA 5CM2Z 4UMVA 3WQQA 1DTEA 3DTNA 3GVHA 2YV2A 4ALIA 1MO5A 1YVPA 1VSUA 4CR7A 3VM6A 2VPXA 5HTOA 4F9EA 2HDHA 4F9GA 1XKQA 3QVTA 4RIEA 3NDBB 8AT1A 1K6XA 1BKSB 3GJ5A 4LVNA 5DW0A 1FQOA 4D8XA 1Y63A 3DD5A 3TBHA 3ZD7A 1QUFA 1G3UA 4RWEA 3KUXA 3EA4A 2DWOA 2EWMA 4JBIA 4M1SA 2Z6AA 4PX9A 4IUBS 3HNOA 1CQIB 1NF9A 4XWTA 3U16A 5ALDA 1GCAA 1NJFA 3X3HA 4D43A 3IV7A 1DIOB 3ABSB 621PA 2IZZA 3K8YA 3GT3A 4FCVA 5AXCA 1GZDA 1L7XA 4X64B 4A2QA 1C4KA 3IOCA 3NOQA 2DFNA 4OQNA 3ZZUA 1YB6A 3IPXA 4KEAA 4WK2B 1EWTA 1HLPA 2XIQA 3WRYA 2I7VA 2BM0A 2C83A 2CF6A 3C3EA 3FOAA 5ER9A 2AT1A 1NZFA 3HKDB 3OPXA 1E9VA 1VRCA 4CMIA 3C3PA 3L92A 1ZNQO 4RH1A 1SJ9A 4P3NA 3UMCA 4WCVA 1SELA 3TGPA 4ZC1A 5TR9A 1GPUA 2AL7A 1QX3A 4HPJB 1L1EA 4OHKA 3BWEA 3TRIA 3JD4A 1HNZB 3NDRA 3O9ZA 2VAWA 3V42A 3A0UA 5F1KA 3E3MA 1V3VA 5AI0A 3SVTA 3A28A 3D0QA 2HY7A 4I1RA 1Z75A 5EP2A 1YVDA 2YRXA 3E0QA 5DBIA 5CVEA 4LF7B 1O6FA 5KNLA 1BDIA 3A6JA 3DL4A 2WSSA 4EQ6A 3NV9A 1AD2A 5TT0A 2NO7A 1L5QA 4P82A 1JWAB 1GTRA 2WFMA 1MB3A 5CK5A 1TQ2A 1T8UA 3RKRA 4LPSA 4Q1DA 3HA3A 2H5LA 2P78A 1X3SA 1XCOA 2P0YA 1E8DA 3G9ZA 1UM8A 2IC5A 1QAOA 3Q3GE 4NOJA 1B93A 3WXMA 4BKPA 1DADA 4QLBA 2FPUA 2HWXA 3MGCA 4KODA 4R1TA 4R0MA 1FK8A 1OD6A 4Y0NA 4YT5A 4AUKA 1J2EA 5K3DA 1MU0A 3V1KA 4XYEA 3E4CA 4FOLA 5D86A 1A50B 1ZM7A 1XDBA 2BKAA 1QFXA 1Q16A 4L9SA 2VBGA 4PNHA 4H0FA 1ARZA 4WOKA 2HOQA 3STYA 1DQSA 1MNQA 2HSEA 4IIJF 1FYFA 1T2AA 2WQ7A 3IAXA 3G89A 4LI3X 2QPAA 5CDUA 2PS9A 1NDHA 1TZMA 2EG9A 4AZ0B 2GBFA 3Q3CA 1ETUA 5A5VA 4ZARA 3LBHA 1H2WA 2DUNA 4LPKA 3AL0C 5K4GA 4A91A 3E5NA 3DZDA 1KZ6A 2J09A 1JFRA 3QUCA 1JPJA 3EYWA 3X1WA 2ODPA 3QLJA 4DCUA 2X4GA 2RHLA 3CMMA 3IPYA 1ITZA 3IQHX 4LMAA 4R9UC 4ZCMA 5KAPA 1PVVA 1ZSVA 1A1VA 3RVPA 2Q2WA 3PQDA 4TN1A 4FZ3A 1VG9B 5IAKA 4UU8A 1C1DA 1IXYA 1ECLA 4GPBA 2OCXA 3IP6A 3P0RA 2JD1A 3HYSA 3RO7A 3SX0A 1EUDB 1MC5A 1M1NB 4AO8A 1SBZA 2YNMA 5KJ1A 2QD5A 3MCUA 4DJTA 3JZFA 4FFDA 3KJFA 1HETA 2P6OA 3OURA 4K3UA 2LVBA 1WUIS 4I5EA 2NU6A 5EUQB 1LQTA 2UYHA 2CB0A 3WLNA 2WWHA 1O94D 1Z39A 2VF8A 5ALOA 5CH5A 3QX3A 1XYVA 3MTGA 1QH1B 1HQDA 1T8PA 2XMQA 1PJSA 3MAAC 4WOJA 4ZCLA 3ZDYB 2YJGA 1HDGO 3WYCA 2VYND 3CSDA 4L75A 1PV2A 2ZRFA 4OU4A 3GNQA 4RD2A 3W2GA 4TYMA 3LAWA 1AV6A 3EXFA 1QP4A 3MHTA 3HWRA 3TI7A 5B6JA 4HDKA 3PWTA 2ZWPA 4O2BA 4XOUA 4AJHA 4B46A 1S7CA 4BQFA 1YWGO 3PGLA 5K6RA 3EXIB 1Q84A 2BFBB 1ZGBA 2RHMA 3G85A 1KS2A 1AGYA 1G21E 3IRUA 3O0TA 4Y9UA 2FK8A 4UHHA 4XVRA 4O2BF 3GLHB 3C4QA 1JAHA 2G07A 3Q5GA 4BS9A 2FLVA 1VKRA 4DR5B 4CM3A 2JJ2A 1PFQA 3M81A 3OLVA 2FV8A 3NHBA 2WUWE 2VQSA 5PGMA 5JI3E 2AQ8A 1RPAA 3CB2A 1UR5A 2X86A 5IBCA 3VBCA 3L1HA 1X0VA 4EY4A 13PKA 2FPIA 4YMTA 3KHSA 121PA 2QY6A 3T4UA 4NS1A 1E5LA 4G37A 4QUAA 4UMEA 1Z68A 5C1IA 4YMIA 3NKFA 4ARIA 3TDNA 1HZZA 3VR5H 1NW8A 4P08A 1MO2A 1EWQA 3FFTA 1U8EA 1IQUA 2V9PA 3N3AC 1Z8DA 4RLHA 2Q27A 2C5BA 3D2LA 2PXHA 3X2FA 3KP1A 3IOMA 1X7XA 4CF6A 3FYTA 3WL4A 1XVAA 4ZZ0A 2HMSA 4Z86A 5EE9A 2B98A 3LHDA 4L7QA 5HGXA 1GO2A 2ZJ4A 1Z06A 2C88A 1L7QA 4ND4A 1Z2DA 3X0DA 1NTOA 4Y2XA 3RYCA 3BIFA 3SFZA 3ZBQA 4QYMA 3CT6A 3W2IA 2ID4A 1ZD3A 1JG3A 3RFCA 5E0KB 4JH0A 4RVSA 1JQAA 5JQGA 3R7WB 2DG2A 5CYOA 4DARA 1KL7A 5JAQA 4N0MA 3THYA 2VP9A 1OY1A 2YW9A 4Q9NA 4N40A 1SG6A 3D6AA 2JBAB 1G2IA 2GN1A 3JALB 2RGDA 3WGZA 1NW6A 3GQBA 2ZBEA 3OLCX 3KG2A 3CLTC 3KWFA 4FJ0A 2B4KA 2XA1A 1OASA 1U7HA 5EN4A 4E07A 5I7RA 5JQGF 5ALZA 4ALLA 2GCOB 3HYNA 5LFAA 2WIFA 1FU7A 1QKKA 1U28A 4O4IB 3VSBA 1E1QA 2YINC 4GR9A 4QICA 3QIAA 4QODA 3IAFA 4V02A 1ISIA 3A6DA 4MUXA 4YBZA 1SOAA 3RR2A 4EUNA 5K3OA 2FR1A 2OWEA 4L7VA 3EOAI 3I6ZA 4QUKA 3KD2A 3HXTA 3JQQA 4X6LA 2MSWA 3BAFA 4JL6A 4Z6KA 5L3ZA 4BLRA 4HH0A 1J20A 5HRAA 1YUBA 2B35A 3H5LA 3QPCA 4FOOA 3RHFA 4QUHA 4W6ZA 2ZIXB 4MQBA 3ODGA 4NKRA 4ARBA 5ADWA 1DKPA 1KJQA 4RD3A 3WMFA 1P2GA 3QUSA 1DIAA 3DEKA 4D82A 1CW2B 1G42A 1L8LA 2ZCUA 2R65A 3FR7A 4JEHA 4FIZA 4M0FA 4LYAA 2AFRA 2BFWA 2X4DA 3WDSA 1ML4A 1TX4B 3H9BA 3T3HA 4S24A 1EZ4A 1T8SA 1DBPA 5BOVA 1CS0A 1JVSA 1L1QA 1YFZA 1A8HA 1DC7A 2WFAA 2XKJE 3CXUA 2WPDA 4G5SA 4ZVOA 2AJLI 3D6HA 3BCSA 3VR3A 1JU4A 3FCOA 3KXKA 4X3OA 5G0WA 2QRJA 1N5LA 3CUKA 1SH7A 4EATA 2VJOA 1JXMA 1J23A 1YDMA 1SBYA 2O2IA 3PD7A 4EHKA 2PN1A 2YN4A 4F4CA 1TVKB 2QT9A 3G2HA 4O25A 3RDPA 3GEGA 4YBRA 3UPTA 1BE1A 2H17A 2HGSA 3GJXC 2ZRIA 4KOEC 3P8ZA 1Q21A 4DXHA 4ZHQB 2QG6A 3B2QA 4CEJB 3IAUA 3RNOA 4B75A 1O4WA 4R3NA 5CXUA 4RFLA 3RAEC 4CDMA 1W0KD 2DHDA 2ZBUA 3ZCPA 1EAYA 2GHTA 3QXGA 1NNEA 1FTQA 5SZJA 4URUR 5BSRA 4EZIA 2HF8A 3JVUA 5LYYA 3T0IA 4EKDA 1ZWKA 3UJHA 2VCYA 2PIDA 4RA6A 3D5QA 1QE0A 2Q7DA 1UDAA 1RQPA 2PKXA 4LSGA 1C9KA 3NKLA 4EG6A 5T3YA 1G64A 3LTNC 1MQ8B 2IV2X 3HWX1 4GI5A 1OFGA 1YAHA 1GZ3A 3WL5A 1L5ZA 3A1SA 3DCYA 4FC6A 1N2SA 3AUAA 4TSRA 3M6IA 2H1LA 1TM7E 1FQWA 1QIMA 4JQYA 4K2HA 4ZCQA 5JMOA 4WNCA 4DDTA 4QO7A 2DPMA 5JRZA 3SVZA 2G5GX 2J59A 5FULA 2LIPA 5CJ2A 3C85A 3SX4A 1YL6A 2J5RA 3DTVA 2GAAA 4MGZR 3QPAA 3KZOA 5EFZA 4BMPB 1XC7A 1X7DA 2DLDA 1TZ2A 3EGEA 3PNBA 1XL1A 1YZLA 3ACBA 4NARA 5AMXA 1PCXA 2YXBA 1NAIA 3ZLVA 2QLTA 4B09A 1P2UA 2INGX 2I2BA 4UHBA 5KDOA 1LBTA 2EIXA 5KVSA 1L6IA 1H6CA 5CFZA 4C6HA 2YYSA 3OIYA 3CUTA 5E6UA 1T6XA 4MJXA 4AG5A 4BMYA 1E2BA 1XCBA 3UT5B 1HA3A 3LUHA 4BNDA 5BQXA 8ADHA 2QSUA 3ASYA 4CCSA 1D03A 4UC0A 5FUBA 3HP1A 4FMPA 3W7VA 1X14A 3S55A 4O5AA 4QDUA 4RM3A 2SBTA 4Z99A 3ZQ6A 3CTPA 1QAQA 3G2KA 1NQXA 2PZMA 4MV0A 4LNUB 4OI1A 4AT1A 2AOUA 5EHNA 3K73O 5D84A 4Q4JB 3EPLA 1Q1ZA 1BSVA 1TKCA 2F48A 2VI5A 5EWJA 5F2OA 1N33B 4R0NA 3FKSD 3OT5A 4YACA 2FJ0A 1OZGA 1RBZA 1U0LA 2FUG6 3WLMA 4KI7A 1KWKA 3IB6A 1FXUA 2VKTA 1OX4B 1GKIA 3K6RA 4UUAA 1JHUA 5FBVB 3IUJA 3KS9A 2IYLD 3CC8A 4JI1B 3H75A 1M8FA 5HFNA 2ZJYA 4ZO8A 1N5KA 4M0KA 4Z54A 2Q6KA 721PA 2PE5A 3NALA 3A36A 3EZYA 4WVFA 2ZAOA 2I0FA 1KU0A 5CLHA 1NQTA 1RP1A 4ZO6A 1WB6A 3UJDA 5IT5A 4R8MA 1NBWB 3BA6A 1N8SA 3CWQA 4YCLA 5CM9C 4DT1B 3PC4A 4RJ2A 1NKTA 4Q9AA 1B43A 2RH5A 1OIWA 1P19A 3Q12A 4CKWA 3TNJA 4HADA 4JZKA 1LI4A 1QRSA 2BMVA 5HUQA 1KE2A 5CDTA 4RPLA 4YUYA 2W42A 2IZ5A 2Z3WA 1KFBB 3DKKA 4KGVA 4B3RB 1SG0A 3PTAA 1E98A 1AOXA 1XB2A 2E3JA 2RKWA 4MUAA 1ODLA 1OF1A 3IUYA 3T9BA 3G5AA 2C7GA 3DPSA 3TZBA 1Z17A 1ECFA 1KXZA 1T2CA 2PTGA 2R5NA 1P4HA 2CV1A 1C1HA 1XWWA 3S1AA 2IS6A 3RVQA 1EFPB 1D7AA 3KV1A 4XD2A 5H3LA 3W34A 2GVDC 2CKDA 3E7WA 4Q4AA 2A3RA 2ZAGA 1TJNA 2BOVA 2LDBA 4HUQA 4HS4A 1RTTA 3MMNA 1TT7A 2YJ5A 5CDFE 2OBXA 4JKOA 1E20A 2WF5A 1GQQA 3MQ2A 3KVVA 1UMKA 4MAMA 4AJ4A 1SHLA 3DDCA 4JI6B 3SEFA 4KYVA 1Z6GA 2YXDA 2G82A 1II9A 2PLAA 3PRKE 4KXYA 3VAYA 1T0BA 1KGDA 2LCIA 5CJPA 2O8CA 2ACKA 3ENNA 2R6CA 3GPBA 4ISBA 4KWHA 5ITWA 5LWHA 2AX3A 4V3BA 4IM7A 3V1LA 4UAVA 1FYEA 1O95D 3OIGA 4Y9DA 4YCNA 1ZW1A 3WAKA 3GCXA 2D0IA 2PDAA 4G0UA 9GPBA 4ZEWA 4ZT3A 4K26A 1IHXA 4R1MA 1PFKA 4IQFA 2C2ZA 4AKGA 4PBSA 1URPA 3PC6A 1W96A 1I7QB 1JKMA 1OBFO 3L82B 5I4KA 3IAS1 4KIJA 4XUGB 4Y9TA 1T36A 4H7KA 5ECYA 3UHFA 4A4DA 4H7FA 3E22B 2HIAA 1MX1A 2HEGA 2G1PA 5HOEA 4HQKA 2C97A 5F4BA 3AFGA 1DKUA 1K5GA 2JA1A 3KQWA 3KV3O 4X6XA 5E3JA 3U7IA 1C1YA 3WV5A 5BSKA 3VZQA 4DR7B 4N8EA 1WULS 2XDQB 2L42A 3CJTA 2AYZA 3I09A 3M82A 3RB8A 1Y3IA 5BN3B 2QRHA 5GTDA 2DEUA 4EYQA 5AW8A 3GEBA 1B8OA 1WY5A 2C99A 5E4TA 4BNZA 4TZKA 1XTBA 1WD7A 3B12A 1PT7A 4MKGA 1YZ3A 5HA5A 4AX4A 4HTFB 4D9MA 3I3OA 4HJRA 4I55F 2JFGA 2C31A 1HRKA 1NJ2A 2PZ8A 4ILEA 4MVJE 1WW3A 1LPPA 1ZM4A 4JODA 4JL8A 4G5FA 3FNHA 2CYCA 2OVFA 3JR3A 2X15A 4U7TB 3MJEA 1HEUA 4NNPA 3L7AA 4AYTA 4C7KA 3MUOA 2FLWA 3ETJA 1D4AA 3O5AA 4RJLA 3A2LA 2EJVA 2ZBVA 2HQ1A 1QO7A 5TF4A 2NVUB 3T7RA 4BFTA 4N47A 2AC2A 1HSZA 2QA5A 4QQFA 4JB3A 3AUXA 3I2KA 4ZK6A 5IG2A 1KR2A 2GN2A 4JA0A 1ACLA 1QH0A 1AB5A 2ZKLA 3LP5A 3NIFB 3GJTA 3WIDA 2POCA 4NOKA 3IQWA 3JS5A 5ALXA 2QXTA 4J3NA 1R9NA 4XE5A 4CXMA 2FK7A 4DSZA 1JEQA 1FX0A 1DO2A 1WZIA 2QTGA 1FUKA 3I2IA 1T2UA 3OOSA 4YQYA 2AMFA 2BEJA 4MWGA 4PLZA 4QQKA 2G77B 3AG6A 4IJUA 3DKRA 1XRRA 3WLIA 3DULA 2FOIA 3F2VA 1KI2A 4OFXA 4FQ7A 4R83A 2OFOA 4R68A 2X4LA 3E35A 1CJCA 3H8SA 4MR9B 2QVBA 4AF8A 4BMSA 1YASA 3RK4A 3WZLA 1HE1C 2EJBA 4NH4A 3EEQA 5CT5A 3VHXB 1ZA2A 2PZEA 2ST1A 3B7GA 1FEZA 4NU8X 4R9VA 2C9BA 4B5KA 4EGQA 3DZGA 1T5SA 3U26A 4B85A 2OENG 3IC5A 4MA4A 4RTLA 3AT1A 4EMTA 5ER6A 1HC7A 1KH2A 5AESA 3W5AA 1R12A 2JLRA 1U2DA 3D1VA 4HZUA 4GSYA 1YR7A 3BRSA 4QLOA 2QBYB 2V7TA 1R5JA 2OOSA 4CDGA 1XX6A 1NQUA 2OO3A 4O63O 4QEZA 5DHSA 1T5HX 4JX8A 4EKIA 4F86A 4DOMA 1E0JA 3EN0A 3QKRB 1W8IA 1WCWA 4TLEA 1MLDA 5BSTA 5DBEX 4MWOA 3ZWWA 3DE3X 4DDHA 1W36C 1F12A 5A0FA 1JJAA 3RC1A 3ZE8A 2POQX 1R6TA 1U3GA 2C2MA 4HQRA 2FPGB 2WWGA 2PGLA 4ZTZB 5FOUA 4PLPA 3A2KA 3CLRD 4N7MA 2XUFA 2QIOA 3OX1A 1YJCA 3CX7A 3IP7A 4WESB 1HNXB 4WBNF 3JD3A 3O47A 4GOND 1PDVA 3DC7A 4NENA 1JX6A 2OSBA 4RANA 5D6OA 5D01A 3ZBPA 1QPGA 2P9EA 2ZWVA 3H6KA 3VRHA 1BCSA 4OH1A 2NUAB 3H4MA 4V1CA 1QS0B 2DKOA 5ALPA 4I1YA 4LWOA 4LY3A 4OQYA 3FCEA 4EHJA 2P69A 1P7YA 1MVOA 2O8EA 3NPMA 1XDZA 3HY4A 1IPFA 1Q6YA 1WPGA 2J48A 3GC6A 3M6AA 3PCXA 4XUDA 1DC5A 3HCAA 2GAJA 2P2NA 4HVTA 4EHHA 1XL0A 5E8RA 1HTTA 3S70A 2BI4A 2IYAA 1DEXA 1XDSA 3CJRA 1E9DA 3PQCA 5AKXA 1UUFA 2A14A 3D0OA 4QULA 3A4YA 4CR8A 3GPCA 1HZZC 3AK4A 3R5FA 5DBFA 4ZRDA 4HQOA 3EWSA 3IMEA 5DTRA 5CFRA 1KJYA 1O4VA 4QPDA 1GPBA 1SU4A 3A25A 2YOFA 3WAJA 2SCUA 4OHFA 3CX8A 2I4OA 4TMYA 3OP1A 1QV6A 3E2MA 4NPAA 3IT1A 5GZ6A 1P5HA 1CQJA 5J5VA 3SEQA 3J81k 5AKZA 3AI2A 3MWEB 4AY3A 3AHJA 5ISMA 1I5OA 1NVDA 4O4LB 1VKJA 3GFTA 1PGJA 4E70A 3OIVA 2HHCA 1VL5A 2W2TA 3R6GA 3P32A 1AV7A 4WTOA 1LLUA 3QMVA 1GSIA 2BZGA 4JGBA 2O3SA 5HF8A 1MR3F 1TJ5A 3VYTB 3GD7A 4NICA 1UQRA 2PT7A 2VXOA 3VO9A 1U11A 3ZLUA 2HI0A 2ZPUA 2X19A 2H2AA 4YLGA 2ZTUA 4YO8A 1WSDA 2VP3A 3TQOA 2AV6A 4GECA 2CEAA 4FGJA 1OZAA 2HWYA 1PDOA 3HJUA 3B38A 2RGYA 4IHJF 5K8LA 1NV9A 3A8TA 3F6RA 1E3DA 4QRHA 4JYZA 2ZYHA 2AVNA 4KWIA 1JPNA 3BX1A 3UZUA 2QJWA 5I7FA 1ZK0A 2AMLA 3I4FA 3U0VA 5I48A 5BN4B 4GOKA 1AGNA 1FBNA 1EP1B 1G0OA 5MF6A 4ALJA 2GK7A 5EIBC 3RKUA 3S40A 2GDZA 2MJLA 3B13B 3C3MA 2WSBA 3KQLA 1LXCA 4Z4CA 2GZ1A 2NUTB 5GJWC 1XKLA 1GCIA 1EUCA 4PPGA 2A9JA 3QNUA 3TE7A 5IU6A 3AU8A 3IEXA 3FDIA 4K03A 4S2UA 4BMXA 5JS7A 1PTJA 4CM4B 1MKYA 1LNQA 3JWEA 1A4IA 1RI1A 4G8JA 4PWZA 3E82A 2HTEA 3HLYA 4I66A 1YMUA 5K3BA 1QH8B 3JQPA 1KQFA 1UFQA 3E8SA 3A4LA 5EZSA 4DIEA 2F3SA 4TXJA 3RODA 4YHBA 3ILSA 4CMBA 5H3HA 2VWGA 1YFJA 3G5LA 2IY7A 3PIDA 1UC4B 3JYOA 2LV8A 4GU5A 4LX8A 4ZO4A 4YJDA 5I8ZA 2PEZA 4QBGB 1IB6A 1RYNA 2I2DA 3GLGA 3MZ0A 2MTBA 4IDAA 5IAAA 3AP1A 4IBOA 1VL1A 2AZ4A 3ZCXA 1U0OC 2I6UA 3I8XA 3MB5A 4ND5A 2BHSA 1AK9A 1NA5A 2UZIR 3TKYA 1H6DA 2PIAA 2QKYA 4AIRA 4IFIA 4DKXA 1XTUA 2FRVA 4QGSA 3BMQB 3MW8A 2IH2A 4BAGA 5K0GA 3D5EA 3O8LA 2RKOA 5DKFA 1QVWA 4ZTBA 2B4QA 1DQPA 4TUYB 3WKEA 2CSXA 4YTEA 3ROMA 5KKAA 2XQKA 2I78A 3QQ5A 3ZLTA 4BNUA 4DG9A 5IK2D 2QJTA 1QKIA 4BX2A 4DB2A 3HCPA 5EJEA 1YFLA 1MB9A 5H3CA 4DZRA 3WGQA 3TRKA 4DGSA 5E4JA 2R47A 2I4MA 1LTKA 4AWAA 1ZR2A 3W3AH 4AO6A 2GM4A 2A7XA 5EOVA 3VTAA 3PX7A 1XPJA 3KT8A 4D4MA 3LYLA 1T6YA 3RUEA 3ONWA 1YS4A 1X1CA 2DBVO 5FXMA 4XFDA 1Z6QA 2AN9A 4CLOA 5DN9A 2R9VA 1EHCA 1SCNE 5K51A 4PZYA 1I6LA 1VSTA 4HXYA 5KYUB 1SQ6A 3ZNOA 3KQMA 4HF7A 3T5AA 1DX9A 5CT8A 5A6SB 3PUJA 3UXYA 1JKXA 1NRXA 1RMTA 1ZVKA 3PXBA 4MA5A 4HNVA 4RTNA 2NPIA 3CRNA 4ZOLF 3T7IA 3MCAA 3RRFA 2C5AA 4WI1A 3T0GA 1N34B 1JTVA 1GPAA 4ZA2A 2O2GA 5AM5A 1VBFA 2O0JA 5LOVA 4X95A 3W5BA 5GJVC 4CTOA 2IL1A 3VR2A 1FMFA 1ZIYA 1S2GA 1DC4A 1UWKA 3FNGA 3KEOA 4NJMA 5AW5A 5AVVA 3RVRA 1LWNA 2A4KA 4MV9A 2J85A 1YGYA 2FMIA 1DU4A 1M10A 4R8KA 5DBOA 3VNQA 3VDRA 1CJUC 3GJZA 3ESZA 3BRWD 4JLVA 2B21A 1E6CA 3MJFA 3U4QA 1EPUA 4JC0A 4FMDB 2OD7A 4W7HA 2IUFA 4W8GA 2C1XA 4X6YA 3WBKA 4C07A 2HBZA 5JNUA 4M6WB 2AD5A 2H85A 3FYHA 5ITVA 2GA8A 3EGOA 5E9QA 4LBWA 1GGKA 3MD9A 1CEXA 3ET5A 1Q91A 2HRDA 3T3GA 3VR1A 1ODFA 4KI0A 4MWZA 4PLHA 2HWWA 5EIOA 2I87A 5G4LA 4KR2A 4ARCA 3G2LA 4CF5A 5DHRA 3EGIA 5LBUA 3NIBA 4MWTA 2O5RA 4TM7A 1MABA 4F7DA 3N05A 2O19A 1IJKA 2ZSAA 1KFJB 1VE9A 1J33A 2HMTA 4NAVA 4DR1B 4PZ9A 3K2EA 4Q4DA 1E3MA 5LP6B 3INGA 4G81A 4F8YA 3TKLA 5HUHA 3P9SA 1Z0KA 2FX3A 3WB0A 4AKHA 1EVYA 1N5OX 2VAXA 1EDZA 1T6BY 2ZK7A 4NL4H 3KK0A 3LZDA 4DWOA 3FBGA 4GPEA 5JSYA 3RWBA 2PH1A 1E9BA 1KJWA 1QIDA 3MUFA 4WIAA 4LDJA 5FFNA 2BEVA 1TVCA 3RSHA 3R9XB 1H4QA 4F12A 3N8NA 2JIDA 3BJRA 4OUDB 2YBEA 2H2DA 5KJEA 2QQEA 3GEDA 1VMEA 3GHYA 2FZWA 3BHNA 1XZNA 3UGTA 2W71A 1RYEA 3TN7A 3EOZA 2R7AA 4M83A 5J2UA 2OGSA 4LMBA 1N9KA 3PUVA 4PY2A 1E6MA 3KZXA 4OM7A 5K6AA 1Y6JA 2J6BA 2IF2A 3F7TA 4L9AA 4TV9B 1BQEA 3WADA 1DAEA 1PJZA 1XD8A 3NETA 1PEDA 2WPNA 5FPHA 5C46F 1EXVA 3GL9A 1U6KA 3MC1A 1ABBA 1OHHD 1TJPB 1W5FA 3KVRA 3HGTA 1P1FA 3A6ZA 5I45A 1LK7A 1N5MA 4MVJD 3VNVA 5LZ5A 3BE5A 5E2IA 1YZQA 1RMQA 3R3HA 5JCZA 1JG2A 4MDHA 2DX7A 3ELDA 1H2HA 4RK6A 3QBVA 5KSOA 2WA2A 1SIOA 1NE7A 2GD6A 2BKEA 3KNZA 4H59A 3S0JA 3ZOKA 3HV2A 2ZUVA 1AHPA 2ZS9A 1E58A 4LYJA 4BCDA 3TIGA 3TLKA 3N75A 1DBRA 1FRFS 2G09A 2QL6A 4QA9A 1UBRS 1EUQA 5E1MA 2DHQA 4I2NA 4MQEA 3KSUA 4EUSA 3V3TA 3SQXA 1B3RA 4QGFA 1C2TA 2O48X 2WWTA 3LC1O 3LWZA 5F9FA 5EKDA 1X15A 1HYEA 2AN5A 3U19A 4OREX 1F1JA 2RAUA 3OUTA 2EKLA 3PFNA 4NMMA 4PM4A 2I29A 3VAZA 4HVLA 1OIXA 1O5IA 1JVNA 2JHPA 4KZPA 1BMFA 1TKBA 3LDUA 1JDPA 3IVGA 4MYHA 3ZU3A 4S2EA 3OVMA 5KMGA 1Q1QA 5EMHA 1M7HA 1E0AA 3W77A 2VK1A 3I04A 2I7XA 2V6FA 4YWJA 2WC1A 3ZCQA 3WXBA 1E2GA 2WM2A 3EC1A 4HVAA 2Z4RA 3TTUA 1J9GA 3UCFA 3L7IA 4IDGA 2LBPA 1D2GA 2H51A 2QI9C 4G41A 5AOVA 1I7SB 4EB6B 3TF5A 2BAGA 1UFVA 1UBHS 2VJMB 5EJGA 1EP3B 4PZEA 1K66A 5LYJB 2P6NA 1TZBA 4XCQA 4J4HA 1GLVA 5CFQA 2KBEA 2VDJA 4CMKA 1K8XB 2ISSD 2IBSA 4XOIA 3OCZA 4J0CA 4V24A 1FMLA 3FWKA 2OCGA 4S05A 2CMHA 3Q4GA 2EHJA 2PRYA 4MRSA 5DEIA 1T2NA 2PFKA 4CMEA 4HGZA 4B9EA 2VHWA 2KHZA 3EF0A 2EFYA 5MDHA 5DTJA 1CD5A 4CV0A 4K0KB 2JS7A 2A9RA 1OLUB 2VRWA 3I45A 5DK4A 1XUOA 1QRDA 2H0AA 5C31A 5IC5A 4BQNA 1RAFA 1H1TA 4BE9A 2FWPA 1SKMA 4CQLB 1T4MA 4BO0A 3RS9A 1TKRA 3T38A 3BPSA 4HN4B 3SC6A 5KQGA 3BZWA 3BTOA 5BW5A 4IZIA 1KEPA 4P4SB 3TMKA 2AFIE 2B4YA 2R7KA 1E3WB 4B17A 3S81A 4BXOA 3GI1A 3PYLA 3V2GA 4GQBA 3SHFA 1J0CA 4LBYA 1V43A 4PN7A 5AVQA 1P1KA 1W6UA 1EK5A 5J59A 2ZM6B 2DYKA 1J8VA 2IY9A 2AHOA 4Q39A 3RVSA 3ZHBA 1IN4A 1BE6A 4BAUA 4BO6A 4D4IA 1M5RA 1EJ2A 2Q3MA 3HFJA 4OXXA 1WDKA 1FUIA 2XE8A 3JQRA 1N2EA 2BFNA 4QDKA 3UBMA 1BHSA 5L3RA 2ZYIA 2ZUDA 1T4CB 2VJDA 1XGKA 3THWA 3N07A 1OCEA 5E7MA 1NZDA 3RYFB 1YHYA 1C3EA