4FMDF

Espg-rab1 complex structure at 3.05 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
164
structure length
149
Chain Sequence
KLLLIGDSGVGKSCLLLRFADDTYTISTIGVDFKIRIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG protein
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 36
structure length 149
sequence length 164
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdF00
1IXZA 1CP2A 1XTKA 2HF9A 4HB2A 2IWRA 1LS6A 5FOVA 1G21E 1OFIA 1XCMA 2IYTA 3A6PC 3EIQA 4PTLA 1DPFA 1ZCBA 1R2QA 1ZM2A 3LLUA 4MKFA 5H8WA 4Q1AA 2YYZA 4GBMA 1FP6A 1ONBA 1AA9A 4LHYA 3L0SA 2O8FA 1UADA 1E98A 1E1QD 1F2UA 2QSZA 3NBZC 4QGHA 4ARZA 1N6NA 3I5YA 3QIAA 2JLZA 3I5XA 3IIJA 1UDWA 4M9ZA 3GJ5A 3Q8XB 1X6VA 1UEIA 3AF0A 2IXGA 4P0TA 3LVRE 2DR3A 1P9RA 4NCKA 3VR6A 1Z28A 4KAXA 5DI3B 3IEUA 4JVMA 1AZTA 3W8RA 3K9GA 1KMQA 1ZM9A 2K5UA 1XCPA 4JLAA 4WZAE 2PEZA 5EUMA 3KQKA 4MGIR 5FH9A 4LDJA 1VCMA 4Q4JA 5FL7D 4LC0A 1P62B 1Z0JA 2IYRA 1DADA 1P72A 5FTLA 4Z8YA 4F38A 2ATVA 3CLVA 4GMDA 4LYHA 4GP6A 4Q7KA 2OEPA 3EPHA 3QJYA 4DUGA 4URZR 1R5BA 3VNUA 1DELA 4DLSA 2ZRJA 4HDCA 3ZLJA 1G20E 1S96A 2WWWA 5E3HA 4FW9A 4LC1A 1FOEB 1XRJA 1ZBDA 3ZD7A 2P3SA 1Q0UA 4ESHA 3OIYA 2F1RA 2C04A 4GPTA 3MLEA 4G5OA 4LV6A 2CJWB 4C0SA 1TAGA 4KCGA 4K81B 5B64A 2GJSA 2ZSFA 4KITB 2E87A 4BLPA 1QHIA 3SJZA 4DXAA 2JGNA 4IRUB 2ZRHA 3UWKA 4EPWA 1KSHA 1KJWA 2WWIA 3ASYA 1T8TA 4PPQA 3B82A 4O25A 2WOJA 4IDPA 1T9HA 1SXJA 2HJGA 721PA 2OCPA 1ZNZA 1TUEA 1ZNYA 4X8HA 3GLFA 1Q22A 1HQCA 1UBCA 4DWJA 1XPOA 3SNHA 1YR8A 1P60A 3LNCA 4F91B 3C41J 1EFCA 1ZAKA 4PC3A 2F9LA 4DB4A 2XXAA 2GF9A 4A0GA 3GLHA 2YZ2A 4ZCIA 5IT5A 2W0MA 3FE2A 3UXMA 4A92A 2XZOA 5FI1B 3W5JA 4NCJA 4G1UC 4OHZA 4A0FA 2REXB 2IL1A 1Z6XA 4M8NE 4J0QA 4Q4AA 3U3MA 2JJ2D 3LW7A 3K53A 1TUIA 4D82A 2RHDA 2V8OA 2VHCA 2ZRGA 5JCZA 1E2PA 2RGAA 3FHCB 1U8YA 3MMPA 4B2LA 1UDXA 4AK9A 4ZIRA 4DCVA 1GL7A 2ZAOA 3ONWA 4IW3B 4M1OA 3CX6A 2J5XA 4NCHA 3REGA 4BQSA 1TPZA 2P65A 4CT5A 1E79A 4CYMA 1XD9A 1G1MA 4LZZA 3TR5A 4CGZA 3SBEA 2Z5FA 1WF3A 1P61B 5EP4A 3B13B 3X1XA 4ERNA 4OQLA 3KKMA 1OFUX 3SC3A 3X1WA 2NO7A 3K9NA 2BKUA 3ZS8A 2Z4SA 1ZU4A 2NZ8A 3VR4A 4TLAA 2GNOA 3A1WA 3E70C 4YLGA 1PLLA 4D4KA 1MV5A 4IOLA 4TMKA 1MRSA 4M22A 4HZIA 2V7QD 4II7A 2WPDD 1UFQA 3QF4B 1A82A 3OFND 2QL6A 2XNDA 4GFDA 4C9BA 3LWNA 4CRWB 2IWHA 1T3SA 1FNMA 4Q1CA 4NTZA 4XVQA 2G6BA 4I81A 4KVGA 5DYGA 3RS3A 4OI1A 3K0CA 5JWHA 3K9LA 4XH9B 1W4AA 1MO5A 4KHZA 2ZRAA 3REFA 1EFRA 2ZSDA 4LYFA 1Q57A 3CR8A 3OZXA 2VP9A 4PAMA 4CF7A 3UPUA 3ICEA 3RHFA 5IHPA 3GFPA 4HUQB 3LV8A 4LRWA 5AUOB 2IUSA 2N46A 4PPNA 4CZ2A 3IUYA 3AQ4A 3N5CA 4I1OA 5EE9A 1NLFA 2PX3A 2OBNA 3EIHA 2Z83A 4ASUA 5HKKA 3HYRA 3BFXA 1JPNA 1KIMA 3A8TA 2O8FB 1F2UB 1P9NA 4PZLA 3H4MA 4ARZB 3LA6A 4WIAA 1AS0A 1XZQA 2JIZD 2J41A 3DO6A 4NU0A 5HCNA 3WBJA 1G7TA 3LX8A 1JI0A 2D62A 1G3QA 2R6FA 5J5CA 1GAJA 2EWVA 1A2KC 4EFNA 4NDZA 1NNEA 4BECA 5EZ5A 4BWYA 1YZQA 4M9XA 4JKYA 5LD2B 1V5WA 2GEVA 5GJBA 5AWFC 4A6XA 4B3DA 4CEJA 3AM1A 1QHYA 3DPUA 1W4RA 4TLEA 4BASA 1M2OB 2ZUDA 3OE7D 3KFXA 4Q4JB 2JLQA 1SQ5A 5M04A 3I72A 1UJ2A 5FL3A 1GKUB 4Q1BA 2AL7A 3UG7A 4Q4LA 2ZITA 2CCKA 2X8AA 2FA9A 4B3GA 2R9VA 1Z2CA 5AUQA 1LY1A 3EW9A 3UMSA 3VR2A 2CEAA 3PR1A 4WBSA 2BVNA 4TYNA 1XEWX 2AWNA 1CS4C 4LY6A 1FPMA 4FINA 2VSXA 3PUYA 4N0DA 4NCIA 4EPTA 3AF1A 4DRZA 2WMOB 4I4LA 3QKTA 4US1R 4E5UA 1YR6A 4PZYA 3OAAD 1A1VA 1KI9A 3LQQA 3SOPA 1P73A 2C78A 3FDIA 3HPQA 3QXSA 1E0KA 3HR7A 4M9SA 2X2EA 5FOUA 3BB1A 1E6CA 2JDIA 3I1FA 4NL4H 4B33A 4D4LA 2V1UA 4OKSA 4M21A 2QMUA 3NC1C 3GLFB 1BMFD 2VPPA 1XF9A 2QQEA 1HEIA 1R0WA 2WAYA 2CCJA 3PUWA 3FKSD 2IW3A 1ZRHA 1RYFA 4Q00A 2O8EA 1FUKA 1KJYA 1UKYA 2W83A 3B6EA 3MWLA 3UG6A 4B35A 2XXAB 1W0JA 2BIFA 2ZYVX 4YDHB 3U2QA 3AVUA 3L8YA 1ZD9A 5IRCD 3EARA 3RS5A 4Q1DA 1KDPA 2J45A 1QDEA 4GL2A 2Q6TA 1U8AA 2Z6VA 3B60A 3ZZ0A 4Q4AB 3ZH9B 4JJKA 2ZSAA 1CULC 1XEWY 3I73A 1H8ED 5AJXA 2V6JA 2KSQA 2P5SA 3AF2A 4ZIRB 1EWRA 1XTQA 4UKDA 2QI9C 1NN0A 2FSFA 5CM9C 2DWPA 3CKLA 3I62A 1IJFA 3KQUA 1D6JA 2A30A 1OKKD 3NC0C 4UXJA 4FWTA 1IBRA 3C5HA 2OUKA 4OI0A 1K6MA 2XB4A 2QMEA 2ZYUX 4N0EA 4P4TA 5DO9A 1E3MA 4ZI3A 3NTUA 2NGRA 3LO5A 2HLDA 4FD2A 1OXUA 3T5DA 4DLRA 1SVLA 5BQ5A 4XWOA 621PA 1Z3IX 3SZRA 2XTZA 3KJHA 2D2EA 3NVAA 3MGCA 3IPYA 4URWR 2IA5A 3GJ7A 3ZVNA 2PL3A 4QHSA 5GJVC 4S2EA 1GFIA 1SVKA 4D0LB 1MABA 4RZXA 1TQ4A 3BXZA 5L3QA 3VNVA 4Y0VA 1HT1E 4LV5B 4Z51A 5BN5A 2BJWA 4LSGA 3HYTA 2JLRA 4JSTA 1Z0DA 2QU8A 4QJ5A 2RGCA 3DEFA 4U5XA 1XU4A 2O8DA 2H17A 1F3OA 4JKIA 4JZKA 2FEOA 3V4FA 4L8GA 2AFHE 3BFKA 1AKYA 1E2QA 3FPAA 3L0PA 3V4RA 2HEIA 1E4YA 3QG5A 4MYTA 1DAKA 2QE7A 2V3CC 2AHOA 2ANBA 1ZUIA 2CK3A 3GJ4A 3W6NA 3MG9A 2AD5A 1XXHB 4MRVA 2NO6A 4PQRA 5FOXA 1VYTA 4AY2A 1Q1EA 1KY3A 2ONJA 1VYVA 2V6IA 5CK5A 4PO1A 4RFSA 4ZKEA 1GG2A 4I1SA 3GCGA 4Q21A 3W9YA 3CRMA 1N6IA 1L4UA 1GL6A 1ZM3A 4LJ6A 2ZUBA 1XNJA 1NY6A 2G88A 1VKJA 4S35A 3WYGA 1OYYA 2ODNA 4RD6A 1E9FA 2LKDA 5F9FA 3SI7A 2XOKA 2XJ9A 1SVIA 2GETA 2VIIA 3ND9A 4URUR 4BFTA 2JATA 4PXAA 1II9A 2KBEA 4PC7A 3TQCA 5K8UA 1JBKA 1JXOA 1DO0A 1OXTA 1XD8A 1XTIA 3IQWA 4ON9A 5J40A 3B1ZA 3ZVRA 1KI3A 4TT3A 3QPUA 4E09A 2ZXUA 3Q3JB 5J4VA 5J4KA 1DE0A 2G9NA 5UKDA 2W6JA 1CU1A 4F93B 1RC8A 2JEOA 4QFMA 3CX7A 2QTFA 5KPJA 5EE0A 1NVVQ 1H65A 2QROA 3CO5A 4FMBB 3EPLA 3SHWA 3EZFA 3K09A 2DFNA 2H57A 2VSFA 3ZIAA 5FOSA 1UPTA 4MDFA 3SYNA 1Q44A 3K0EA 3F3YA 1TL7C 4JS0A 2NZJA 2R6DA 5F3WB 4W5HA 2XX3A 2J0UA 2ORIA 4KFUA 3KTAA 1F48A 1WMSA 2OG2A 1US8A 5FBRB 3U5ZB 1FTSA 4EPXA 3AVWA 1KHTA 4ZDWA 1Q20A 2IX3A 4NCNA 1RRCA 2QTHA 2UVQA 3QY0A 4XSHA 2QMHA 1GNQA 4KU4A 2HYIC 4OJQA 3WP0A 4C3ZA 4FMCB 4UJ3A 1CBUA 3AGPA 1SKQA 3OIVA 4IXMA 3EWSA 4MA4A 4TL7A 4D80A 1C9KA 1VCNA 5LD2C 1SGWA 2WBLC 4GP7A 3P1JA 3OHMA 3JVVA 4NHOA 1JALA 2J7PA 5EXSA 4PPFA 1OFHA 4LPSA 3BJIC 2O8EB 1V43A 3UANA 1GUAA 1CJUC 3NKVA 2IYZA 4QKQA 2O8BA 1ELOA 3TAUA 2B8WA 2XTNA 3PEVA 1Z06A 4A1FA 4A0RA 2ODEA 3J81k 4NYIQ 1KI6A 1YZUA 2B8TA 5FBWB 5JRZA 3W8NA 2N1BA 2VP6A 2VLIA 1BOFA 3KDSE 3X1ZA 1N6LA 3N2EA 4LPKA 3KQLA 3I8XA 1G41A 3TNFA 3RANA 4N1AA 3D8BA 4IEIA 3WYAA 1C1YA 2AK2A 3WMGA 4Z54A 1F5NA 3AKYA 4RD4A 5DN6A 1CR4A 3U3JA 3VMFA 1SXJE 3MCAA 4B3CA 3ADKA 3BK7A 3MSXA 5TV2A 1TF2A 2VF7A 4FMDB 4E07A 3GEHA 5FR2A 3GLFE 5EP1A 5DI3A 4OYHA 5B57C 2ZTSA 2ZS9A 5AJZA 1IN4A 3BOSA 4OK5A 1S3GA 1UF9A 4HZUA 1ZMXA 4X8MA 5FUWA 5LPNA 2WSSD 3FKQA 3GLHE 3TJZA 1EX7A 3U6KA 3DKVA 3K0FA 1ZIPA 3SEAA 2ZJAA 2KI5A 3GPLA 2H18A 2PH1A 4GOXA 1MABB 4A6PA 1CR0A 2D7CA 4V0OA 5L3QB 4RD2A 1COWD 1Z0IA 1U94A 2NO9A 5AK0A 3AVXA 1BH2A 2EYUA 1QVRA 2JJ1D 1QHNA 1VCOA 5E7IA 1JEDA 3EG5A 5F98A 2FF7A 2O8DB 3CPJB 1T4GA 3M4YA 4TSFD 2A5DA 3KKOA 5KDDA 3RRYA 5EXPA 5A4JA 1OIVA 1UKZA 3TVDA 1ESNA 1HA3A 1BYUA 1NIJA 1IN5A 4Q47A 1LW7A 1W0KD 1G18A 2DHRA 2BOVA 2HJVA 3QXJA 1SKYB 1YZGA 3QOFA 3SJBA 4BLOA 3HU3A 2F55A 4CEIA 1SVMA 4RFSB 3K0SA 5BN3A 2GRJA 2WJYA 4PHHA 2NOAA 4XD7A 3RYTC 1QHHA 4Q9LA 4BZPA 1R4AA 2O8CA 3THOA 1W49A 1GRNA 4KSCA 4TYPA 1QG2A 2A9KA 2CLDX 4A4DA 4AIIA 1BO6A 3RRNA 4ESVA 1S0UA 1R0ZA 4EDHA 2ZRBA 4AD8A 2FG5A 2DPXA 1Z08A 2QENA 4FCTA 4UXHA 2QPOA 1N3BA 2PLRA 2ZI5A 4KFTA 4MUBA 2W2VA 4TQ9A 5LB4A 1VG0B 4RCZA 2ZRFA 5EJEA 2L0XA 4P32A 2KBFA 4CW7A 3RSLA 3FMOB 4BFXA 3K70B 3K9HA 5CDFA 2YWGA 4BFWA 4DVGA 3KKQA 3X1YA 4BPBA 1CR1A 4FCVA 4C0AC 5C46F 2GAOA 3NH9A 4KI0A 1OT3A 1R7RA 2ZI6A 3LW8A 5K8IA 3AKDA 1CXZA 1N6HA 1KI8A 2ZJ8A 2XJ4A 5KUTA 4Q1EA 1I2DA 2NG1A 4BE7B 3CM0A 4JVSB 3CX8A 1W4BA 1CIPA 2EWWA 2LKCA 3CF2A 1DAFA 5FFMA 2CLCX 2QP4A 4PX9A 3GJ0A 2J0UB 3RLFA 4TTRA 1QG4A 1B23P 3KTAB 2GCOA 2IHBA 1SVWA 5LDDC 1US8B 2MSEB 3VR1A 3SYLA 4QBGB 4Z1MA 2IUTA 5CB6A 2DBYA 4YXWD 1E2IA 2OFXA 2ZR9A 4W9MC 1BKDR 2B7CA 2GILA 4MRNA 4NMMA 5AJVB 5KPDA 3FHTA 1PV4A 5KTYA 3RSOA 2CE2X 2HT6A 1P4SA 1QF9A 2O52A 1YJ5A 5L3SA 2ECKA 1U0JA 2CHQA 2R65A 1E9RA 2HXSA 4DZZA 5FTMA 5KSYA 1N6PA 1JR3A 3AUYA 2AFIE 2WVJA 4KBGA 4D4MA 2DFTA 3C16C 3TIFA 2XEXA 3WNBA 4KV9A 4C0QC 5FBVB 1NP6A 4A2QA 1OB5A 2GJKA 3ZGXA 2QUZA 2RH5A 3KJIA 3L0IB 4HUQA 5J4HA 2HF8A 4MRRA 4PAOA 4Q1FA 1OB2A 3ZVLA 3PVSA 4M1MA 1F60A 2OO7A 2O8BB 2X19A 1T0JB 2WJVA 1CKEA 3U7GA 3VAAA 4C0KA 1Z22A 3KB2A 2QBYA 2IYVA 3VQTA 4EPRA 4ZCMA 4JBXA 1PUJA 1RKBA 4F4IA 4PFSA 3OEED 3OESA 1KI6B 1M7HA 2ZUCA 3ETLA 3U6BA 3A1TA 3Q7QA 4JL8A 2AX4A 2A5YB 1XZPA 2BHRA 2RGDA 2EFDB 1AK2A 4QOSA 5IF9A 2ASEA 1IXSB 2E9SA 2HUPA 1IXRC 3PQCA 1YE8A 2GXSA 5H68A 2FMXA 2ZRKA 3AV0B 1YKSA 4GZMA 1XMSA 1J99A 3BWDD 3U7HB 3WBKA 1GNPA 1X8LA 2FEMA 1OXXK 4MGYR 4WOPA 1SHKA 1NBMD 1WP9A 1P6XA 2OXCA 2VEDA 1SHZA 2W6ID 3FFAA 3Q7PA 3PXGA 3ZJYA 1ZP6A 2W0SA 3TUZC 3FVQA 4HZUB 4US0R 3QXHA 1E2FA 3I3SR 5FPKA 1KDRA 3PUZA 1SULA 1KK3A 3K0FB 4NONA 3IKJA 3IBGA 1ZC4A 2P2LA 2WKRA 4LI0A 2AR7A 2G77B 3HWSA 4C2TA 4IDOA 2AK3A 1YR9A 4JBYA 3DDCA 3WXMA 1X8KA 2H92A 5CIWA 3B9QA 4MUAA 1M8PA 4EUNA 2XITA 1W46A 2IS2A 3W34A 4LJ8A 3K8YA 4L9WA 2FFQA 1KAOA 4B2IA 4LYAA 4R98A 4TTPA 2RGBA 2AXPA 2NMVA 3TVTA 1YRAA 2PMKA 1GL9B 5GADl 2EFCB 3PG5A 4TL6A 3RRZA 5LB2A 4DCTA 1GNRA 2OFWA 4CEIB 2VF8A 4OQMA 2GJAA 3C4JA 3FYHA 4QJ4A 1QHHB 4HI0E 4RZ3A 2DCUA 3KXKA 3BORA 1CR2A 2O8CB 1N6KA 4GNKA 4P33A 3VHXA 1KAGA 3MD0A 3GLGA 4JYBA 1T3HA 2FX3A 1N0VC 1CJTC 1G16A 3GFTA 4URVR 3KB1A 2IXEA 4PHFA 3GLIE 8OHMA 1IONA 3FMIA 5J4LA 4JLOA 4RD3A 1DAIA 5D3QA 3TLXA 3DMDA 4HAXA 3KKPA 2ZJ2A 1F2TB 2ERYA 2CCGA 2QPTA 2RKOA 3TMKA 3SBDA 1SKYE 3L43A 3IO3A 4BRUA 4L16A 3BC1A 3KXLA 1P2TA 5SZKB 1S3SA 1U0LA 2WKQA 4A9AA 2F1HA 3EASA 3IHLA 4YONB 4TYQA 3QKSA 4DUGD 2W00A 5GVRA 2HT1A 1WQ1R 1EFUA 3X1DA 1E1RA 1RRGA 3MUFA 3ZS9A 1GP2A 2BKEA 4PPGA 1JQLB 3W6OA 1OH8A 3ZZTA 3A1UA 2GCOB 4HB0A 3KUCA 1NY5A 5GJCA 2ZI4A 3F0TA 2GBLC 4LX0A 2XSZA 4QG7A 4B32A 4Q48A 3GJXC 3AF3A 4HLQB 3GEIA 4IVQA 4MRSA 2FOLA 1I4DD 2YOHA 3IEVA 2GAAA 2ONKA 2X77A 3CPHA 3P32A 4TMVA 2ZYWX 2GZHA 3B1WA 3HDTA 1XDBA 4PSVA 3K70C 1X8JA 5L3SB 1P3JA 1SXJD 2YOGA 3NDPA 4YMVA 3A58B 2H16A 3LXXA 1E2MA 3M1IA 4HEJA 4LYJA 3W3ZB 4B47A 4QGGA 3CNLA 1OE0A 5JFGA 3FMFA 4NZYA 2XNSA 1GZSA 1XXHA 2KWIA 2WKPA 3AKCA 4EFLA 2FJUA 3NIBA 4ITRC 4M0LA 3NEJA 1NVUQ 2GZAA 3K09C 1VG8A 2FSHA 2ZRCA 4M4SA 3M6AA 4M2LA 5JJKA 1Z0KA 2QPAA 1R0YA 4JSYA 4MRPA 4YDSA 4OK6A 4IVRA 5JECA 2HCBA 3DKPA 4B44A 2QBYB 2ZYTX 3U3OA 2ZRDA 1E9AA 2YC4C 3P20A 4R9UC 1ANKA 2H8KA 3PITA 4B3FX 5CM8B 3QKUA 1W36B 4U02A 2F6RA 2O0JA 4GT1A 4Y0AA 3SR0A 2ZRIA 3MJHA 2IXFA 1YU9A 3PUVA 3ZQ6A 5TARA 1EFTA 5DH9A 4EQ6A 2CVHA 2F7SA 3CNOA 1EK0A 1KO5A 3RRMA 1G3MA 2NQ2C 1E79D 3CWQA 1KNXA 1CJKC 1WE2A 2CXXA 1DG3A 3W6PA 2XB2A 1OXVA 2QRZA 1YZNA 4IVPA 1JB1A 4OI4A 1AGPA 2UZIR 4RCYA 3VHLB 4X8OA 4JLDA 3E2IA 4CT4B 2WZQA 5FOTA 3F5FA 1A7JA 5L8VA 4IEEA 4DDTA 1E2LA 2ZJBA 4GDFA 2FDCA 4DLTA 1GSIA 1TU3A 1Z29A 2Q9BA 3DL0A 3DMNA 4RKFA 1IHUA 3BH6A 1ZM4A 2OFOA 4LJ9A 1Z47A 4TMXA 4KVAA 4TQUS 4QM7A 1NL3A 5H70A 1HUQA 5JMTA 2FFAA 1OIWA 2JLSA 3PEUA 2XNDD 3AUXA 3PV0A 1VECA 1Q12A 4IFEA 5K8TA 1LV7A 3B8HA 3QSYA 1NLYA 1MRNA 4ABYA 4NYMR 4KODA 1D2MA 1LF0A 2ZS8A 5EP3A 5KNDA 1LF5A 3CONA 4RSGA 4IDHA 2MSDB 3IILA 4GOKA 1RYHA 2BDTA 2ZE7A 4G5SA 4P3YA 1F6BA 3T1TA 4LJ7A 2A5GA 1EFRD 2YWFA 3EWAA 1FQKA 3SFZA 3AB3A 4GOJA 1SZPA 1NRJB 2D3WA 2ZRMA 4BUJA 3G0HA 5DIFA 4F4JA 3BH7A 4GI7A 5DNYB 3EAQA 2ZJOA 2ZVQX 2ZI3A 4I1UA 1EFHA 4R2HA 1R0XA 3NEYA 1KK2A 2BMDA 1VYUA 4G5GA 3RS7A 1E0JA 2RGNC 2CNWA 4K8OA 5FPTA 5JCPA 4ASUD 1OYWA 3AVOA 3PIRA 3NWJA 3LFUA 3I61A 4MH0R 1D5CA 5SZIA 2H7VA 1E94E 1M74A 3TUIC 3GLGB 1A2BA 2Z43A 4QC2A 1K5DA 3ECCA 3LY5A 4AKHA 1OIXA 2OBMA 4D81A 3BGWA 2ZVPX 2RAPA 4DLWA 4P4SA 5C2JB 2PCJA 2QAGB 3BB3A 5JI3E 4ACAA 5DYIA 3H0KA 2VH5R 2WJJA 3QE0A 3WRXC 2BM0A 1Q1QA 2GEUA 1TEXA 1U9IC 2C8VA 3EC1A 1OH6A 5CYPA 4HLDA 4HAWA 1ETUA 2P0EA 4NYMQ 2AWOA 5KOYA 4EPYA 3QKSB 1OHHA 1DS6A 2BMFA 2F3RA 4ZO4A 2IYYA 1G3IA 3TBKA 4AG5A 1NMXA 3L2OB 3QKRA 4KBFA 3RAPR 4QBIA 2IC5A 1BIFA 1GRQA 2OXRA 3R9IA 2OLJA 2ZS7A 2FV8A 4Q9HA 3WMEA 1W2HA 2ZE5A 1M1YE 1T3LA 2MSCB 1GTVA 3A4NA 3AH8A 1J7KA 2ORWA 4I1VA 2QN6A 1E0AA 1XJCA 3NG1A 4CIDA 4PHGA 3EX7C 1DAMA 3T5GA 3OEHA 5CDFE 4D26A 5E7JA 5TMPA 2IYSA 1XP8A 2B7BA 2JDID 4DLUA 3DVLA 4B6EA 2ZROA 4LUCA 3HR8A 5C4MA 1RZ3A 1NBME 1TQ6A 4HAUA 4YMSA 3KFVA 4ILEA 1E2JA 1T5IA 3D31A 4U00A 1W0JD 2BM1A 1G7SA 3Q5EA 3EPJA 2YOFA 4A36A 3UMFA 2JJ8A 3AKEA 4D0NA 2R44A 4B3BA 1KDOA 4HAZA 3TSOA 1FUUA 3T34A 3FGNA 1TADA 3RWOA 1PZNA 1AQYA 5KU1A 4OHYA 4NKRA 2P6UA 1K5GA 1EGAA 1ZNWA 2QSYA 5JZVA 3WRYC 4FN5A 3KJGA 4PQFA 4YMUA 3U44A 1IN6A 4Z8XA 4IKEA 3CF6R 3CBQA 2J0SA 2GBLA 1E2DA 3A4MA 4EQ6B 4QRHA 4C0LA 1KO7A 2BMJA 2OHFA 2F43A 2GZDA 3FWYA 3GQBA 1T8UA 4ZCLA 2GEDA 4M9QA 2D74A 2O5VA 3OIUA 2QP3A 4JLNA 2HLDD 5G3YA 2QP9X 3TKLA 1M34E 1M7BA 3IPXA 4QNRA 5CIQA 2C95A 4TYWA 1CLUA 1DO2A 2IEYA 2J87A 2IS1A 4AG6A 1Z07A 2ATXA 1MO4A 2BV3A 2VHUA 5JRJA 1G64A 1ZD8A 5FUVA 4ZDJA 1WB9A 2G1KA 3H2YA 3U3KA 2AD1A 1RRFA 3QUSA 4TZ0A 1W36C 3ICQB 3RS4A 3SE0A 4PHTA 4KYUA 1C4OA 4B2PA 3MAAC 2JA1A 1GRRA 2IS6A 1YZKA 3S1AA 4Q9KA 1P2UA 2BCJQ 1ZCAA 3UKDA 5SZHB 4BFSA 2C96A 1YQTA 2FH5B 2FNAA 4AYTA 5E4FA 2J0VA 2IS4A 2QE7D 3B5JA 4TTQA 4D25A 2CK3D 2VYFA 3EIEA 4DIEA 3VKGA 1S2MA 1XTSA 5DISB 1JJ7A 2CVFA 4DLVA 5AUNB 1B0UA 4BLTA 4C0HA 1ZYUA 1IAQA 1KJZA 4LBZA 5HE8A 2LWIA 2WJIA 4UQOA 4TQAA 3MJRA 1GDDA 2XAUA 4AC9A 5F9HA 4LOAA 3PEYA 2ZSBA 5FUYA 1P7CA 3C15C 5EZ6B 1XD2A 3N2IA 3P4XA 4G0NA 3GFOA 4LBYA 1ZJ6A 4HLUC 4DSNA 2J3EA 3K0AA 2KJQA 5KSOA 2BEJA 5TVKA 2QEQA 4JYCA 3D7MA 5DHAA 2RMKA 1EX6A 1P9WA 4TLCA 5K8LA 4FI3C 2QRNA 4HLCA 4C7OA 1T5LA 2XOKD 2GKSA 4POAA 1XEXA 1AGRA 4NPHA 5JHGB 4Q5IA 3HU2A 4UNSA 1FNNA 1ZIOA 1ZU5A 1G8PA 4EJSC 4IDNA 4P4SB 3K70D 4UXIA 1A5TA 3CNNA 2GHIA 3MWYW 4TT3D 5TXGA 2UZ3A 5B58C 3WP1B 1FZQA 3KX2A 4L5BA 1I2MA 3P26A 2V9PA 2W6JD 1TF5A 1DAHA 2IUUA 4G5QA 3SYKA 1GILA 2B92A 5DI9A 4DIDA 2GXAA 1L2TA 1MT0A 1MOZA 3A37A 3JZMA 5FR1A 3E1SA 3EPKA 3ZIAD 3BD9A 2WJGA 3QKRB 1DTSA 1E9BA 4C30A 1LB1B 4BZXA 3KL4A 2RGNA 3EC2A 2I1VB 2PLFA 4MKIA 5HZHA 2LCFA 4JLKA 2YVUA 4MKGA 1E9DA 1EXMA 5DGXA 5TB5A 2VBCA 2V4ZA 1KY2A 3U4QB 3IIMA 3H1TA 4PC6A 5TY0A 1QHXA 4HYYA 1GVNB 3KQHA 2C9CA 3R7WA 1XWIA 3WHKA 5AJWA 5C1BA 2WSMA 2VSOA 1XMVA 1KO8A 2O0KA 4RY2A 3FOZA 2QAGC 2ZRLA 1L7VC 2WWXA 3Q85A 1W4CA 4HB3A 4US2R 3IBYA 1MH1A 3DZ8A 1KI7A 1N5JA 2KB0A 2ZE6A 2ZRPA 2OCBA 2FSIA 4NYJR 4H1UA 4ACBA 1DAGA 2J7PD 1Q1ZA 4JJZA 4QHTA 4OI2A 1IOZA 1U9IA 2QA5A 4CVNA 2ZAMA 4FMCF 1GM5A 2YHSA 3LVQE 5HE9A 1P75A 4DBLC 4XOIA 1Z63A 1G291 5IK2A 4CDGA 5DE3A 1D9ZA 1FP7A 1XX6A 3CRQA 5FBLB 1LTQA 2A2ZA 3E5HA 4OHXA 2REBA 2VP0A 4QBFA 5FTNA 3DHWC 1CJVC 2F1IA 2GXQA 4OBEA 1AS3A 4Q9JA 3T61A 2ZI7A 1CEEA 2VP2A 3U44B 2EVWX 4AKGA 2PT5A 2GA8A 5DN6D 4BFZA 4JL5A 2EFEB 3I4LA 4DCNA 5JI2E 2F43B 1W5SA 3Q9LA 2YINC 5ANRB 4LBWA 3T12A 3TUJC 1VG1A 1XXHE 2N42A 1F2TA 2F1JA 2CL6X 3ZD6A 4B6FA 4DC9A 2ZIAA 1R8SA 1D8TA 4AYWA 3THYA 4HDOB 5JSZA 2MMGA 4LHVA 3FTQA 1CF4A 2WWGA 1GOTA 3CRW1 3CW2A 1R8QA 2BBWA 4UNPA 4DDVA 3F8TA 1KK0A 2I1QA 5JJIA 1E1QA 1U98A 1CTQA 4IOMA 4IHQA 1H8HD 2ZJZA 5B30A 3CZQA 4AKEA 1ZVQA 2WV9A 1XJQA 2GVDC 4BFYA 4NYJQ 3QXXA 4RFVA 5C18A 4L15A 3S1AB 3B78A 121PA 3B85A 2P67A 4WZBE 1Q1BA 2NTYC 2B21A 3DZDA 1AZSC 1N25A 5JS8A 1VMAA 1EWQA 4HB4A 2RCNA 1E2HA 1WDTA 1TQ2A 1EESA 3NXSA 5HCIA 1OXSC 2YNMA 1RIFA 4X8LA 5FL7A 1OF1A 4HUTA 2EU8A 4LHXA 3VU9A 4Q18A 1WXQA 4XD7D 3BIFA 4DSUA 1WCV1 4TLBA 3SJCA 1XD2B 5FBQB 2I4IA 3TW8B 3AP2A 2W58A 3TH5A 3SJAA 2JLUA 2CBZA 5BW8A 1KZGB 1Q21A 1LS1A 1VIYA 2VHJA 3K0AB 4M1WA 1MO3A 4JLMA 4OQXA 4WA7A 1Y63A 4DHEA 1AJEA 1TEVA 1X1RA 1Z6AA 3VFDA 3NBXX 3BRWD 4MYHA 5DHFA 2QMOA 4C7OB 1XPRA 1ZUHA 4YXWA 1XEXB 2XZPA 4C4PA 3HJNA 3GD7A 2NO0A 4GRAA 2WWYA 3QEJA 3UIEA 4WW0A 4PZZA 3T1OA 1KKLA 4UNQA 4N3NA 4OHWA 1U99A 1KSJA 1P5ZB 2PJZA 1S1CA 2ZREA 4TZ6A 3EZ2A 3LH5A 2RGGA 2R62A 1II0A 3O8CA 2YWEA 4L4UA 4C0BA 1W44A 2JCSA 1KOFA 4EFMA 2QQ0A 4MDEA 3CPEA 4V0LA 3QQ5A 1NF3A 2CL7X 4M53A 1DOAA 2ZI9A 3AGQA 4UNRA 2YV5A 3SQWA 2VO1A 3C7KA 2VP5A 2G3YA 4YC7A 4DT1A 4E22A 3W5IA 3SHFA 4QL3A 2JJ2A 1NKSA 1NN3A 3A1VA 4HLUA 4MITA 3ADDA 2GCNA 3RVBA 2WICA 1I4LD 1X86B 4Z1MD 1FTNA 2YKGA 4M1YA 3R7WB 3SU8A 1NI3A 1HE8B 4QGFA 2BC9A 2R8RA 4DCSA 2G1JA 2JLYA 1YHNA 4TLDA 4G3XA 2OE2A 3PJRA 2CL0X 4CEHA 2PMDA 2B6HA 1JNYA 1JR3D 4EJSA 2AKYA 4KLNA 5FPHA 1RE0A 3V9PA 3U61B 1JAIA 2GXUA 2VP4A 3LX5A 2XTMA 2NPIA 3LBIA 4YQFA 4OHVA 421PA 3EZ7A 3SQXA 2QNRA 3IGFA 2ERXA 3BB4A 2WWFA 4BFUA 4KXFB 2J1LA 4JLJA 2JASA 2OESA 4Q66C 3THXA 1HQYE 4QXAA 4DLXA 2V7QA 1G7CA 2BMEA 2OCYC 3MRSA 3PUXA 2WPDA 5FI0B 1W47A 4Q01A 1PVOA 3UMRA 3OFNA 1AS2A 2IEZA 4BZQA 3BE4A 1W36D 4LWZA 1VTKA 4G01B 2FSGA 4OL0A 5CLQA 1QBKC 1FW6A 1N0UA 2OILA 2QM7A 3LBHA 1WA5A 2BCGY 1U8ZA 3EXAA 5G41A 5FOWA 1G3UA 2FPKA 1XEFA 3THWA 1K8RA 2ZU0C 1Z2AA 1KKMA 4UJ5A 1XMJA 4A8JC 1YZLA 2G0NA 4OQFA 3RDPA 3R8FA 2VHTA 2QAGA 1OV4A 3G5UA 3ZVMA 4TL9A 2ZETA 4MYUA 4LJYA 3THYB 2RGEA 1XB2A 4JLBA 1FMLA 3A1SA 5JSZB 4H9GA 2A3RA 4TYYA 2FPMA 1R5OA 1VPLA 1VG9B 3WMFA 3B1VA 3PEWA 4AKIA 4BEJA 5F2EA 3PENA 5FUXA 3QPWA 1RVDA 1R6BX 3UK6A 4BFVA 3KZ1E 3WNCA 1A4RA 4HAYA 1ZUNB 2JIZA 2OAQ1 5EE3A 5KNBA 3LAWA 1YRBA 2DYKA 2Q3MA 1E9EA 1G9XA 1HV8A 3RS0A 1OLOA 3GEEA 4QNMA 3JVUA 2BBOA 3R8CA 1Y3AA 3R20A 2J9RA 2Q9CA 2NPFA 1TU4A 5JS7A 1G8HA 5G3ZA 3ASZA 5HTKA 3AVTA 4XSGA 1YZTA 3WY9A 4EPVA 2DY1A 2REOA 3I32A 3QF7A 2V55B 1AIPA 3VKWA 3OE7A 1UKEA 5BXQC 1T91A 1ZM7A 1JECA 3U7EB 2DFLA 3ZQJA 3DM9B 4JT2A 1BYIA 3VU9B 4BLRA 3HPRA 4XVRA 1UBFA 5IDVA 2FFBA 2PEYA 3A4LA 1LFDB 2R6CA 3WNDA 4C2UA 1G19A 4EAQA 4XIGS 1G5PA 2OLKA 1T0HB 3B1XA 1M7GA 2BWJA 5JEEA 1G5RA 1PUIA 3C5CA 1G5TA 2EQBA 2W2XA 1G4AE 2ZJ5A 4Q7LA 3VR3A 1ZC3A 1NN1A 2FE4A 5KYKA 4O0MA 2Z4RA 2Y8EA 2GF0A 2X1VA 4TL8A 3NBFA 4WAUA 5KHOC 1XTJA 2QT0A 1U81A 1Z6YA 3OAAA 3OF5A 2QG6A 5KDLA 4D0GA 4PSAA 3D3QA 1IN7A 5HR5A 4IFBA 1KDTA 3KJEA 5CLLA 5BN4A 4A0HA 3C14C 2CMKA 4ZV4A 4JT4A 4AURA 3AVVA 2WOOA 3QG1A 5TDHA 4JIMA 5AUPB 1BMFA 1L8QA 1J8YF 1KNQA 6Q21A 1VHTA 1M6NA 4F92B 4QJ3A 1YVDA 3QPVA 1R10A 1IY1A 3FKSA 5AJYA 4A15A 4V0MA 4HSEA 4LK2A 2AXNA 3X2SA 4B74A 2ZR7A 1U90A 1UAAA 2YJTD 2J46A 3GJ8A 4PAQA 3DOFA 5KDOA 1E1RD 2WIAA 2HDNB 2EFHB 4DT1B 1NVWQ 4HDQB 4XTRA 521PA 2OM2A 1G6OA 1W48A 2ORVA 1H8EA 3EZ9A 2R6AA 2P6RA 3T1QA 2XSZD 1KMHA 1DG1G 4BEBA 4DJTA 2QTVB 2RGXA 2C9OA 2FPLA 5E7MA 3O8BA 2HXYA 2RB4A 2WJHA 4AI6A 4TN1A 4CEHB 1OKKA 3AP1A 1NIPA 3FB4A 4EJSB 1NLZA 221PA 1CRPA 3QEOA 1E9CA 1X3SA 2NIPA 5G53C 1E32A 3ZYCA 5EXXA 1XTRA 1TF7A 4PQYA 3TGPA 3QNUA 1JPJA 2AKAB 2OCAA 3NHBA 4DKXA 3QBVA 2Q3HA 4F4CA 3THXB 1G6HA 1E0SA 4MGKR 3CRVA 1G8YA 2C9YA 1XCGB 5HZKA 2C98A 3MFYA 1X1SA 4IDQA 1MKYA 2QGZA 2A7QA 3IO5A 2PT7A 2GTPA 3IHWA 3VX3A 5HKKD 4FWIB 2DWQA 4DLZA 3VKHA 3BH0A 4WXRA 5CJ2A 3WYFA 2WMNB 1J70A 3O47A 4Q4HA 2A5FA 2FFHA 1E9SA 1OSNA 4MYCA 1RRPA 1SXJB 2VA8A 4OK3A 1NMYA 2WIBA 4H1VA 4PR0A 5CK4A 2I3BA 3AVPA 3H86A 1NJFA 1JEEA 4LHWA 5J4YA 3LLMA 4R7ZA 3THWB 4XTCS 3CZPA 1HURA 5FPSA 2F9MA 2OSBA 2QGNA 3SN6A 4TMWA 4KFRA 4TWZA 1IQPA 2A78A 3DOEA 1UM8A 2PX0A 4FCWA 1PLJA 5SZJA 3AVQA 3W90A 3GLHB 2PZFA 1KZ7B 4PC1A 3RWMB 1UKVY 1J8MF 1PLKA 1D2EA 3DM5A 1XBTA 4NP6A 4LJ5A 3T15A 3QBTA 3RS2A 1IN8A 2H1LA 3CRRA 4W5WA 2PZEA 4IOKA 4D6PA 1E4VA 1II8A 1JQJC 2ZRNA 4PSKA 2XZLA 2CDNA 2GVZC 2PCLA 4RVCA 5C4GB 4YMTA 2VRWA 1FFHA 3I8SA 1Z6TA 1KSFX 2BBTA 4JLPA 3TR0A 2OV2A 3EA0A 5GVSA 3U3RA 3GP8A 4IOJA 1UBEA 1KSGA 1W5TA 2YC2C 3U4QA 3RABA 3LQRA 3FFBA 2VL7A 3IDQA 1W2GA 4XWAA 1N6OA 5EQTA 5B2ZA 3B9PA 4K46A 4OJKA 1IM2A 2QM8A 3CB4A 5CB8A 3BBPA 4Q19A 2HCJB 1NMZA 4E03A 1E2EA 1KO1A 1Z6GA 4P31A 1QHGA 1Q3HA 3ZZUA 1JJVA 1OH7A 4TMZA 1GKIA 1N5IA 4U7DA 3VTKA 4A8JA 1Z8FA 4R2IA 1N5KA 1RW4A 1NJGA 3L8ZA 1KI1A 5FTKA 1RJ9A 1S4QA 1CRQA 2HYDA 4LCBA 4NE2A 4QGAA 4XWKA 5EUQB 2QORA 3U60B 2CNWD 2JLVA 4V02A 1IY2A 3Q5DA 5DLQC 2X2FA 1LNZA 1NVVR 2PZGA 2FU5C 3TK1A 2ZPTX 3L82B 1N5LA 4RJLA 5L3VA 3A36A 2WM9B 5CITA 2IYLD 4KFSA 3O8DA 1DVRA 4RZ2A 1KI4A 4MQBA 5JLJA 4LJ4A 4QBHA 3GLIA 4D4JA 2PBRA 1D2NA 2HV8A 3HU1A 4UNNA 1WBBA 1Z5ZA 2Z0MA 3QVUA 3R9XA 2DB3A 4DDWA 3QXCA 1QRAA 3PFIA 2FZLA 3BAFA 4D2IA 4AYXA 2JLXA 3SS8A 5LBIA 1HY3A 3RNLA 4W5JA 1VHLA 2IF2A 1YR7A 1JR3E 1KO4A 2A5JA 3QVVA 5CYOA 3QENA 4URXR 3LD9A 1ZNXA 2JLWA 3RC8A 2C2HA 3GMTA 4HATA 2GWHA 2WTUA 3UWOA 4RD0A 4A2WA 3CF0A 1OW3B 1N0WA 1OHHD 1E99A 1Z0AA 3NH6A 5AR1A 3T06B 1E2KA 1TTTA 3V00A 3D6TB 4JLVA 1L4YA 1DARA 1VCIA 2JAQA 1NSTA 3CH4B 3CUEF 2IYUA 4Q02A 1XJ0A 4FIDA 3PCRB 4JBWA 1GIAA 1KI2A 1FL9A 5JEDA 1KMHB 4BGDA 2VQSA 2GK7A 4KLZA 3OEHD 4NYIR 4DEYA 4CEJB 3H84A 2E1RA 1QZXA 3LRPA 1FX0A 3CIOA 3KXIA 5H1YA 5D3MA 4B73A 5EP2A 4Q9IA 2OAP1 4B71A 4Q7JB 4BLQA 2OZEA 4XJXA 3TQFA 2GK6A 1FMJA 1J2JA 1XMIA 5DSZA 1P2VA 2D4HA 2QZ4A 1TMKA 4PANA 4DB2A 2WSSA 4DSTA 5GJWC 2P5TB 1CJMA 1E69A 3AEZA 3C8UA 4V0KA 2YWHA 2Q9AA 4LJAA 3VX4A 4KJZA 5P21A 4B3XA 2G0TA 5JBQA 2BBSA 1DBSA 4LHZA 1COWA 3NBYC 2FN4A 4JL6A 5KSZA 1W1WA 2JJ1A 4Q7MB 5EE1A 5JJLA 1G7RA 2QY9A 2IT1A 4F7WA 3GJ3A 4M1KA 2OT3B 4Q4HB 4YMWA 1OFTA 2FWRA 4AWXA 4O3MA 4TSFA 1KK1A 4ZPXA 4ZDKA 3P27A 5KO2A 4P4UA 1S9DA 4DEXA 2ODWA 1E2NA 1R5NA 1JXMA 1W0KA 5FTJA 3LDAA 2IYQA 1HH4A 3W3AA 2VHQA 1PJRA 4GMXA 2QAJA 4GZLA 1SVOA 1VIAA 4BLSA 2C5LA 1ESMA 1MR3F 1JR6A 5KSPA 1KTVA 2Q21A 3IQXA 4I99A 5A0FA 1DAEA 1SVSA 4DCUA 4B76A 2AN9A 2MMCA 3M0EA 1IJEA 1OH5A 2D06A 2QT1A 2IK8A 1GWNA 1II8B 1O3YA 1KYIA 2WWHA 3FMPB 3U7FB 3TSZA 4A82A 3ADBA 2NO1A 2ZR0A 4LGMA 4JMPA 1UBGA 4B48A 5ELXA 4MKHA 2BJVA 1N2CE 3ND8A 1D9XA 4LBVA 4B75A 1U2RA 4DLYA 4ZKDA 4PO9A 1TNDA 4KYIB 3K1JA 3GLGE 2EFGA 4RZUA 2UKDA 1SXJC 1WBDA 4R71A 1MO6A 3KUDA 1P2SA 3R9WA 3KKNA 1G4UR 1NG1A 4WXPA 3JZAA 3TE6A 2C99A 1T6NA 1RFLA 2TMKA 1GKYA 4BRWA 1ZD1A 1HE1C 1NN5A 3FHOA 4WZ6A 2CHVA 4Q03A 2CHGA 5EE5B 1E2GA 4A8JB 1W7AA 2FGJA 5JHHB 1J90A 1AM4D 2ZQ5A 4MGZR 4M1SA 1RJ9B 4NH0A 2GJ9A 1O87A 1TQDA 3TAHA 3GJ6A 2GESA 5EXTA 1OJLA 1NKTA 1H8HA 3CH5A 4EIWA 3IIKA 4C0JA 1NVXQ 5BWMA 2G83A 3LBNA 2CJWA 2EW1A 1Q3TA 2DFKB 4OQNA 1G8GA 3B1YA 5FPYA 1G17A 1UEJA 2VTKA 5E95A 1I4TD 3HP1A 3L0OA 3I92A 4O2RA 2BEKA 5A5GA 3SFVA 1N6RA 3UATA 3GLIB 1NG9A 3P4YA 1XPUA 1E96A 3AP3A 1ODFA 3O8RA 3TSWA 1GITA 2WAXA 2ZE8A 4DDUA 4EKDA 1HTWA 1Z83A 2O0HA 2Q0HA 1ZINA 3VR5A 2ZM5A 4RKEA 3MWKA 1G8FA 2FZ4A 2J59A 2V54A 3QI2A 4URYR 4PC2A 4B34A 3BS4A 4WVFA 2ZSEA 3WHLA 3NHAA 1QHSA 1S9HA 3CWZA 3AVYA 3KQNA 2XGJA 4ZDIA 2D7DA 821PA 4ZI2A 5JWOA 2J0QA 4O2LA 5BYJA 2F3TA 4M1TA 4V03A 5CJPA 2PJRA 1AKEA 3ADCA 1FQJA 3N70A 3BERA 3OEEA 4FMDF 2IYWA 2IF0A 4FXPA 4IXNA 1RPZA 2ANCA 1S1MA 2ZJYA 1DEKA 1LVGA 4HAVA 1NSFA 1QVAA 1WRBA 2IHYA 2IBMA 3AF4A 3K0CC 2H5EA 5JWRA 1Z0FA 3SDZA 3B7GA 4KSBA 2FGKA 2EYQA 1TX4B 3Q72A 4LV8B 3ZDQA 4XVUA 2DWOA 1FX0B 2ZU6A 4IJMA 4DSOA 1OPXA 3BFVA 5D3MB 1U0HC 1S8FA 2C77A 3NDBB 1VDZA 5L3RA 2ODBA 1NBMA 3TW4A 4RD1A 1G3RA 2R2AA 2W6IA 2CE7A 1KGDA 2J7KA 3LXRA 4W7SA 2CLSA 2SHKA 4QHYA 5J47A 4G5RA 3EZ6A 4V0ME 5BYKA 2IYXA 2D2FA 4JVLA 2GCPA 2C03A 3T1VA 3CR7A 3EA5A 1HYQA 4NBSA 4V0NA 1AQUA 1BS1A 4A2PA 5IK2D 2R6GA 4TMTA 4PO8A 2W2TA 1AN0A 4L9SA 3QF4A 3B2EA 3MWJA 1JAHA 2RHMA 3T35A 2GDJA 2OBLA 4KO8A 4B43A 2V1XA 3G82C 3RC3A 1EG7A 2GJ8A 1ZW6A 5KNCA 1XFAA 2Q3FA 4JVNA 3OIWA 2P6NA 4QM6A 1HT2E 3TRFA 5HPYB 5G40A 2ZANA 1IY0A 4GSYA 2KE5A 2WHXA 2ZEJA
chains in the Genus database with same CATH superfamily
4XIJA 5CEFA 1GPLA 4UULA 3L7BA 4B7XA 5EI5A 4NQZA 5AK5A 1LS6A 4HDRA 4MW0A 3IRVA 4I1PA 1OFIA 1EEXB 4WJKB 1A88A 1LZKA 2IU6A 5IULC 3DVQX 4O6VA 4IF4A 1ZCBA 1ZM2A 1R2QA 3LPCA 1IUNA 1C7JA 2JA2A 1JKXA 4HNAB 1LJLA 2AZTA 4N8EA 5K09A 4Q1AA 3RF7A 4E4TA 1ONBA 3EA4A 4ID3A 3L0SA 1L5OA 4LHYA 4EGFA 5KEIA 2O8FA 1E1QD 1HOTA 4QJIA 1FW8A 4OP3A 3VDNB 4BQNA 3L49A 4Y2XA 1N6NA 4HFMA 1E20A 1ECPA 2CKMA 1Z34A 4J3NA 1V11B 1BWQA 3GNLA 4IJVA 2JLZA 3ICPA 1BW9A 1ZL0A 5BNZA 1JS1X 2PUGA 5K3SA 4EY7A 2EP8A 3UMFA 3GJ5A 1AMNA 1UEIA 3AF0A 3IP6A 4W1QA 4Y2GA 3GGJA 4QNNA 1V3VA 3VR6A 5JLAA 2YXNA 1Z28A 4QQFA 2XYGA 2HIHA 1Q15A 2XVZA 3EFOA 1AZTA 1NVAA 1RPTA 4WACA 1IFXA 3PFHA 4UCWA 1ZM9A 1XCPA 3VKVA 4DNQA 3OP1A 4BQQA 4OM8A 4UDXX 4LDJA 2LD4A 1NT4A 3NIFB 1XA3A 2NT4A 3D1VA 3G5TA 1P62B 2IYRA 1TKCA 1DADA 1P72A 2E3JA 2IOQA 3JQGA 4R9VA 1R9GA 4LDNA 4WNAA 3ROXA 2NM0A 4GMDA 4LYHA 5JAIA 3CVOA 4Q7KA 3HA2A 2AJCA 4BIIA 3QJYA 3F73A 1D1TA 4EY6A 1EVKA 1BXRA 1TVMA 4URZR 2WSBA 3PA6A 1SIOA 5EMJA 4AVYA 1ECLA 4TSKA 3LPDA 4DLSA 3ZLJA 1G20E 2OLEA 4EYOA 2BT4A 3ANYB 3T7TA 1XRJA 3NHKA 5IBRA 3ZVKA 1Q0UA 3BWBA 2F1RA 2C04A 2PX6A 4GPTA 3OECA 2Y1WA 4IQ0A 3VI3B 2SCUA 4C0SA 2IIPA 3KVOA 3TCKA 2IXDA 2J3HA 2VKQA 2ZSFA 1UMBB 2QY6A 4K81B 1F8XA 2AH5A 4QRIA 4QXPA 3SJZA 2WYOA 4OU5A 3AFNA 4GX5A 2ZRHA 4IRUB 4UHFA 1KSHA 4YXWD 1T8TA 5KVVA 4UVGA 3UT0A 1MW9X 3ISVA 3VNAA 1INLA 5IFKA 1Z7WA 3B1FA 4W7HA 2HJGA 3EQ7A 2BISA 4HFRA 2Q1XA 2VJYA 721PA 5KU7A 3HZHA 4KPGA 1QB8A 4QT4A 3C3BA 3A11A 3H2ZA 3M9LA 2KW5A 1KJQA 3KC2A 3GLFA 4B6OA 1Q22A 2GPNA 1VJRA 3B51X 1PFWA 1GUFA 5IZCA 1RWWA 3SNHA 1XPOA 1Q1NA 4RORA 4XQCA 4G9EA 1A77A 2P5YA 1NYQA 4PC3A 3RS8A 2QV0A 3ZV7A 4DB4A 2GF9A 3F6BX 4A0GA 1QOZA 3QU4A 2YZ2A 5IKXA 4L57A 3IP1A 4ZCIA 5EZQA 2H11A 3UF0A 2W0MA 4B3MB 2EJTA 4D3FA 3NR2A 3UXMA 4B09A 2WHEA 4PQEA 3RC7A 1AF7A 2HMTA 4AKTA 1TVKA 3SF0A 3PXEA 3W5JA 4NCJA 3DVAB 4G1UC 4TKZA 4OHZA 4EHJA 1U3CA 1U8EA 5IASA 2IL1A 5CHYA 4XX0B 2AFVA 4DG9A 4IFTA 1P33A 2NU7B 4EG0A 3AHJA 4M6WA 4BVEA 2XWQA 5KOIA 4RK7A 3BTOA 1U8YA 3RBAA 1UDXA 1GCIA 3TL3A 3KE9A 1A5ZA 1V2HE 2CUZA 4HH1A 2M6SA 4N40A 3DVSX 5GONF 2NU6B 3G6WA 1E79A 2HGSA 4NECA 1G1MA 4CGZA 5FF9A 5IJXA 1QK5A 3S5UA 5HKKA 1LBQA 5JS8A 1B41A 1P3DA 1NFQA 5CH5A 4ERNA 4RV5A 4EW2A 4OQLA 3KKMA 1OFUX 2PY6A 3SC3A 1CS0B 4IMIB 1Y4DE 1HYHA 1A04A 1MDBA 2WIGA 1ZU4A 2BPOA 2Z4SA 1YKGA 2OGSA 4ZEOA 3K0KA 1FIUA 1VJTA 2CZGA 2QQGA 3HWX1 3H5IA 1GNLA 4IX9A 2Y6UA 4IOLA 3PIIA 4KVFA 1U1FA 3CCBA 3F6RA 3NXKA 2I2AA 4DIUA 5LQAA 1GTG1 5CA0B 4LXQA 4CM8B 1WTCA 2YIMA 1U0TA 2YJZA 3OFND 2XNDA 1DMSA 4WXHA 1UJ6A 3L04A 3O90A 4HFNA 3ZX5A 2F48A 4CRWB 2B3TA 1EVYA 5EJIA 4YJ2F 5DM0A 4FNMA 3U49A 3EGWA 4K2HA 4ZAVA 3VPGA 1DBPA 3IIEA 4EG1A 1Z0ZA 4BQPA 4I81A 1EUDA 1HEUA 4RPKA 4OI1A 3IEXA 3U7QB 3VSDA 5H9WA 1R1DA 2R1TA 2JZOA 1W4AA 4A8HA 1K75A 3IV7A 2P69A 2ZRAA 5EA2A 4CMAA 2J3JA 3AMVA 2WILA 5AW8A 1O9GA 2FP4B 3EVGA 5GOTA 3IJRA 4PAMA 2ASVA 3RUAA 2PU5A 3I5AA 3EXIB 2HADA 1YRYE 3GFPA 3LV8A 5BUSA 3BT7A 5JD4A 5EJGA 5CCBA 3VUEA 3BXPA 3TIGA 3DXXA 3COZA 5FULA 1A7KA 1IK4A 4CN8A 3PEEA 3C87A 3MT8A 3EGVA 3IUYA 4C14A 4FNGA 2PK3A 2K2QB 3N5CA 4LE0A 4AM8A 4X91A 1KIAA 2ZGVA 2YXDA 3NS7A 1EP2B 3I4CA 3LIIA 4O4LB 4ASUA 4J0DA 3HYRA 3BFXA 3JQ9A 4PLTA 1KIMA 4TS1A 5I51A 3N2LA 3ADPA 1F2UB 1B0ZA 5DCUA 1XKTA 3TZEA 1ZHOA 2O3UA 4PZLA 3PX3A 4ZZ2A 3DHVA 5KB3A 2YMPA 2VCYA 4YRMA 1EFVB 1XZQA 4WEQA 1TK2A 2J41A 3JZIA 3LHFA 1VSBA 3PLNA 2VDJA 4E51A 1RS0A 3LX8A 3QKIA 4PSUA 3FLAA 3KAKA 3FJ1A 2WVHA 4OGKA 3O26A 1D0VA 3FDZA 3M5CA 2X58A 4DLPA 1B76A 5BQOA 4IXTA 4MTCA 1BXZA 3D8SA 5L40A 3ELWA 3NETA 3SS9X 5KX5A 1SNYA 2G9ZA 4B3DA 4CEJA 3AM1A 3OQVA 3JQAB 3O8OA 1HMPA 1QHYA 3U3DA 2JCGA 4OLHA 4TLEA 1SUIA 1M2OB 2PG3A 4R5MA 4BNUA 1P3Y1 3OZTA 4Q4JB 2QSJA 4O8ZA 2IGTA 3RVQA 4JK3A 1J0CA 5C37A 3L7LA 5BSKA 2QG9A 4JA0A 3N76A 4AULA 1BJTA 2FCAA 1T8YA 1SXIA 5IC6A 4BV2A 4B3GA 5KQGA 1BE0A 5AUQA 3NM6B 3JQCA 3LQ2A 4B7CA 3VR2A 4BO9A 1T2DA 1YQXA 2E4AA 3E7DA 2BVNA 1U0EA 3EBLA 4TSRA 1Z4LA 1N0HA 2J31A 3Q12A 1U6IA 2WT4A 2FSUA 4N5IX 3CGWA 4FINA 2VSXA 3NWEA 3O1HB 1ZICA 4N0DA 4ZZIA 2WMOB 1FJGB 4LECA 3HSYA 2YHBA 4FFBA 4FLEA 1LW6E 1XZAA 1R27A 4DPLA 1YR6A 1DQZA 2XPCA 2XCTB 3OAAD 3C8DA 1KI9A 4RQBA 4E15A 2J9GA 1WKBA 1NC3A 3V2IA 1P73A 5GZ3A 2RKWA 1LJ8A 2VPWA 1RNLA 3QXSA 1E0KA 2YMMA 4LYEA 2X2EA 3WNVA 3GUCA 1Y98A 2AN3A 3UGKA 3FN4A 3ZDAA 4ZO7A 1GTMA 1YL6A 3L8FA 4NL4H 1T2AA 3EHEA 4OKSA 3L0DA 4LDZA 3P7MA 3NC1C 2WQZA 2V5AA 3SSMA 1BMFD 3WC4A 5A5FA 2VPPA 3OC0A 1GD1O 3ENQA 4LFBB 2WAYA 5ICGA 2NSLA 4KQJA 5LUAA 3IR5A 3QELB 3FKSD 2OZLB 1HETA 2XRMA 3ASUA 4RHFA 1UKYA 3L0CA 3PGVA 2XXAB 3L8DA 3MWLA 1V7ZA 3UWMA 4WCDA 3U2QA 1O97D 2R8PA 2WUEA 3SVTA 2YVLA 1LPSA 3L8YA 3AERB 1VL5A 3SC2B 3RS5A 4Q1DA 1XOIA 1QDEA 2X4GA 3D3JA 4GL2A 5JD5A 3P9QA 3B60A 3PFFA 1B26A 4DR6B 3WRYA 2GTIA 3GAAA 4RK1A 5C32A 1R6DA 1X7HA 4R8SA 4FZ3A 4YJGA 3M1YA 5BXQC 2KSQA 1XCOA 5I45A 1WF6A 2IP1A 4UAGA 3CYFA 5CM9C 3KUXA 4CMGA 4RJ2A 1E6KA 2Q27A 4MAFA 2D5AA 1HQKA 2YWJA 2YIVX 2VK8A 1DHRA 3DOUA 3LUHA 3I62A 3G2PA 4N3GA 3SEFA 3OLXA 5EIBD 4G1CA 4UU8A 3C5HA 4U7PB 4OI0A 2XB4A 4PLFA 4J1NA 4ONEA 1JTVA 5IYZF 3BZBA 4BWGA 4K03A 3ZTYA 2NSDA 4MV6A 3AM4A 4DLRA 3IVAA 5EJ5A 1SVLA 5BQ5A 3SQXA 3Q87B 4CN9A 2QL5A 2XTZA 3KJHA 5E2AA 3CLSC 4FI3F 4G5FA 4IV0A 4Z0TA 3IPYA 3IYLW 2IA5A 4RLHA 3BMCB 3AJDA 4Y18A 4J90A 1HYBA 1KBOA 1QIKA 2A7XA 2EBWA 4FR2A 4ZTBA 1RLJA 2JAUA 3FWHA 4DQDA 3KD2A 5GJVC 1GFIA 5IAAA 3OOEA 1ODJA 1K27A 2BZSA 2FXVA 1FLNA 1ZD5A 3TTUA 1MABA 1I14A 4GZ6A 3L18A 4X54A 4F8JA 3W7VA 3RAEC 1KE2A 4KFCA 3VNVA 1L7PA 3U4AA 3SKVA 2K7ZA 4LSGA 3HYTA 4JSTA 2QJTA 3O21A 1K3TA 2QU8A 4QJ5A 2NV6A 3FRIA 3DEFA 4Z9YA 2DM6A 2LDBA 1XU4A 1Y6ZA 4EVQA 1L8XA 2F3UA 2HRCA 4YJKA 1V7CA 4C07A 2C9BA 4JKIA 1MTOA 1P18A 2VYND 3PC8A 3C5WP 4FDAA 4NJEB 3WSWA 4EJ6A 3DCIA 2RH4A 4L8GA 3BFKA 1E2QA 3V4RA 3I9NA 2HUNA 4L5CA 1H4VB 2BELA 1QIIA 2PH5A 4UUBA 4ER0A 5JS2A 4MYTA 3R6TA 4KN8A 1Q0SA 2AHOA 2AD5A 1XXHB 2NO6A 1LTKA 2C9MA 2NAPA 5T3YA 2FDXA 1NOIA 4REOA 5IAKA 4R3NA 4S05A 1DRJA 4MV5A 3NGLA 4CTKA 4DMKA 1MORA 1T4CA 2O3RA 3IAXA 2ZTHA 3BHJA 3MCTA 5MFPA 4PO1A 4ZKEA 2CNBA 4I1SA 1KAEA 5AI5A 2P4SA 1KPIA 5CXUA 2XUJA 3LHKA 4Q21A 4DMGA 1E5VA 1HQDA 3ICVA 4F97A 1GL6A 2EV9A 1JQ3A 2VBIA 5TF0A 2J85A 3WS7A 1J39A 1RTKA 3A1CA 3IV9A 3BF7A 4XUDA 3QITA 1ZESA 5ALHA 1RRMA 2DC1A 1QWSA 1N3IA 2JFGA 2ZUBA 2G88A 4XYMA 3MWEA 1QCZA 3WYGA 3ZWAA 4MI1A 1FTQA 4IZIA 4Y2HA 4F9TA 3ROMA 5AVYA 4RD6A 3HC7A 3FHLA 1SKAA 2XJ9A 1SVIA 2GETA 4URUR 1CZUA 1A8IA 3QKWA 1PNVA 2Z04A 5LQSA 1CW2B 2KBEA 4G07A 4JYZA 4PC7A 4KDRA 3MTAA 5K8UA 1IL0A 5C5CA 3IQWA 1QH1B 3SDSA 1GZ7A 4ZVVA 5CNMA 3IS3A 3H9GA 3Q7SA 3GFSA 4KE9A 4RL4A 1CUJA 4YS6A 1XE3A 3WRWA 1CERA 3LIPA 5UKDA 2PKXA 1KH3A 4FSHA 4U2BA 1Z5UA 3D6NB 4I1RA 1YR1A 2JEOA 3CURA 3W7BA 1Y9EA 1RC8A 3CZRA 3D3EA 2QTFA 2D5LA 4EKYA 1NVVQ 2HB6A 3CO5A 3U17A 4FMBB 3V1LA 4PG6A 3EZFA 3K09A 3SIRA 5K0JA 1KRXA 5KNLA 1XDZA 2DSTA 2J9ZB 3DEZA 4KX3A 4MAAA 1YUNA 1CUFA 2H57A 2ZVDA 4CMIB 3ZIAA 2DHEA 5FOSA 2RJNA 4PG4A 4BXOA 2GBGA 1UPTA 3WIVA 1XMXA 2ON6A 3D81A 3LUAA 3OQ6A 4BKPA 5AW2A 3Q3HA 5FRDA 1M0EA 4W5HA 2O7VA 3R1IA 3WYNA 2J0UA 5F3WB 1M10A 1O6BA 1WMSA 1AU9A 1US8A 3TZCA 1L5VA 4EPXA 4P98A 5HA5A 4ZDWA 1YIAA 1CYEA 1DCFA 1D5WA 2JIOA 3IODA 1I7NA 3USES 2Q2VA 1U2TA 4BVLA 1BX1A 1YSCA 2GNPA 2K2WA 2QMHA 2OBYA 1GNQA 2NXNA 1L9XA 3A6KA 3IOMA 3KEGA 3N05A 4WCFB 5EXDA 3RJ5A 2XMDA 3DYVA 3UT6A 4DQLA 4C3ZA 1QWOA 4J4TA 2F1KA 2Z3VA 4FMCB 2W2KA 2JVIA 5A3VA 4F04A 2W48A 2VTVA 5LD2C 1AKMA 2QLBA 5T57A 4LJRA 2QTAA 3VR5H 1VE1A 1NDUA 4MWOA 1NOKA 2MYPA 3JTMA 4HDMB 1SRQA 3P1JA 1BN6A 4ZQFA 4HNVA 3JVVA 4TUYB 4CFZA 4CQJA 3X1JA 1JALA 1PZEA 2J7PA 1GGFA 1PP4A 1HZZA 1QVVA 4E7OA 2ZWOA 4UEQA 5LMNB 2XUPA 2E1PA 3NKVA 2IYZA 3R0IA 1BQ3A 5IJAA 1YB1A 1ELOA 2I66A 3LDGA 1Y6QA 2XTNA 1H9AA 4XKJA 3PZBA 3RVNA 1QVZA 2PNFA 3EEQA 1LGYA 3ESQA 5E6RB 4D02A 4A0RA 2ODEA 4EMUA 1IG0A 2G9VA 4WY8A 1AHPA 2PQMA 2B8TA 4JP2A 4KQ6A 5TQ0B 5BT8A 2AUNA 4HVLA 5EKDA 2VLIA 1A8UA 3ILYA 2OHXA 3RGWS 3INRA 3SYMA 1CDEA 3EOZA 4G1BA 4E1VA 3GVIA 4N1AA 1SBZA 5C8YA 3E2MA 4TV9F 1U4OA 4KXYA 1HWYA 3O1IC 3CLRC 4RD4A 2IXAA 1CR4A 2Y68A 3GXBA 4H7JA 4MA0A 5CTAA 3OT5A 5CVCA 3DOOA 3V4LA 1E66A 5TV2A 4ZAZA 4ZQCB 1B43A 1QORA 2VF7A 5DVZA 5C51B 4DZTA 4W5NA 4M3NA 2IHKA 4KGVA 5FR2A 1DDIA 2ZTSA 2X2OA 1JE0A 5AJZA 5C8XA 5IZCC 1IN4A 3BOSA 1GGKA 2P9TA 3FFTA 3OE5A 1D7AA 2I1WA 5CG1A 1S3GA 4HZUA 1XALA 1ZMXA 3JQFA 4GPIB 5DTQA 1TAUA 1TCVA 1YS2X 3RV4A 3FNQA 3GLHE 3NB0A 1ZK0A 3DKVA 4J7XA 4Z9XA 3K0FA 5LA6B 4M54A 5I7UA 3F6YA 1WDMA 2V98A 4XXHA 4CLDA 4P0QB 1OLSA 2PKQO 1F4VA 2H18A 2CDAA 1NLUA 3COWA 2Y0DA 2NO9A 1QRRA 4GLOA 3OG9A 1YK1A 2EYUA 3UFXA 2JJ1D 2B2CA 2P9JA 5E7IA 3TXAA 3HYNA 1CY1A 5F98A 3C97A 3VOBA 1QCCA 1XWFA 2FF7A 2LTAA 4HQ6A 1FZTA 1FYDA 1LPNA 1UC8A 3M4YA 4H3HB 3H05A 5ES3A 3V9AA 1AUXA 4E88A 1Z33A 4H1HA 3RRYA 1JPVA 5KDDA 3SPXA 4KBYA 1NPTO 3ZLUA 1UKZA 1YB4A 1NIJA 3HB9A 3UWPA 1VMKA 1CIJA 2CSUA 2OECA 1PG2A 1XZLA 2P68A 3ETJA 3PWSA 3FNGA 4R83A 3WGVA 2HJVA 3O82A 2Q5QA 4Q05A 4YJ2A 2BFMA 1SKYB 1YZGA 3DFUA 5JSUA 2F1OA 2QTRA 1FTYA 3G8YA 2PPVA 1SVMA 4MV7A 4XD7A 3RYTC 5FO0A 4BZPA 2R6R1 4EF6A 4Q3NA 1R4AA 2P75A 3U1VA 1SD5A 2Z9DA 2JLBA 1HDCA 5IDWA 2G9UA 1QG2A 1XV5A 3N5KA 4A4DA 5HRAA 2GH1A 1UK8A 3I1YA 4HHEA 1S0UA 5HMMA 1M1XB 2OP0A 3VU8A 1Z56C 4MQ5A 2ZRBA 1KZYC 1KVUA 3HJGA 2DPXA 3AOEC 4R31A 1ULUA 3RVKA 1KAQA 3QE2A 2PLRA 3HN2A 3KWMA 2ZIFA 2W2VA 1V8OA 4TQ9A 1VG0B 2ZKIA 2ZRFA 1KIFA 4L3VA 5L9AA 4FGUA 2JGDB 4W82A 1O4VA 1O6GA 3RSLA 3T9BA 3VU0A 1VPTA 1XGKA 3HUUA 4TQGA 2FR1A 4A5SA 1AO3A 4BFWA 5CDFA 2N3ZA 3UJHA 4BQEA 1X14A 4D9MA 4D7AA 1MC5A 1LEHA 1AGNA 2WDPA 5LQUA 3ZQUA 1QV7A 2P9EA 3RT7A 1ST2A 5J5AA 3NH9A 4P1ZA 1YQEA 4CIBA 1ZJ4A 1EFAA 1D8AA 1DAPA 4MVCA 1XN4A 3L1JA 2C7PA 5GM1A 5BSHA 4FZJA 3AKDA 1ML4A 1V35A 4BDSA 3HY6A 2GN8A 1LA2A 3RFUA 1NQAO 3KOWA 4O3FA 3VBCA 3WICA 4LDRA 4N7JA 4I55B 3EEYA 1H0SA 1PWXA 4QWWA 4PR3A 4MQEA 3FNRA 2G8NA 2BKAA 2N1MA 5D00A 3OM0A 3RC1A 3LT1A 4F5YA 1FLDA 4ZC1A 1LI4A 3GRAA 5EJAA 4QBGB 3SYLA 3KR2A 4WESB 3WK4A 2OFXA 5BSMA 2ZR9A 4MRNA 3U9LA 1QQAA 1GUDA 4GC9A 2H2AA 5KPDA 1DTWA 1PCXA 5KTYA 2HT6A 3FPGA 3D6FA 2BUAA 4BBAA 5JO0A 3ZCUA 3N0WA 4IYRA 4WD3A 1L5HA 4EHNA 1SCIA 2AFIE 2FMIA 3WGUA 4RPIA 2RJOA 3B7PA 3CZ5A 3KYCA 5AKYA 1G38A 3NKFA 4KV9A 5FIUA 3VR5D 4C0QC 1NP6A 5F2NA 4OYRA 2O5CA 1NHWA 4A2QA 3EBOA 1U7HA 4EKEA 2PSEA 3WGIA 1NPDA 2VS1A 5F21A 2ZSJA 1VE3A 3TF5A 1KEEB 2RH5A 5CFPA 1FYVA 2Q3EA 3L0IB 4IZ6A 5J4HA 4PAOA 4Q1FA 3GT4A 1EQAA 3PVSA 4M1MA 2A9VA 2OO7A 2X19A 1T0JB 4PCLA 2X0DA 1CKEA 1FA9A 4YRSA 4DZRA 3QWHA 2QAIA 2WUWE 1Z22A 3OETA 1NRXA 1O95D 2IYVA 4KQ1A 2PX8A 4PQGA 4YCSA 4YRIA 1ILEA 1NP7A 1J42A 2ZB3A 3LUJA 3E9EA 2PV0A 1GCOA 5CVEA 4EPRA 4ZCMA 4HK4A 1F7VA 5K3CA 1KI6B 4PLHA 3A1TA 4XLZA 3Q7QA 3ZNQA 1OVMA 2FUNB 2V0NA 5A4KA 2A1TR 2AX4A 2R4QA 2VTBA 2RGDA 2OSVA 3A2LA 1SHTX 3PF8A 3KZVA 2GZ2A 3NPAA 3UC5A 2ASEA 1IXSB 2E9SA 2FW0A 1IXRC 3PQCA 4QQKA 5CFZA 1YE8A 1OILA 5ISMA 3E4DA 2IOHA 1M1UA 3GAZA 3AV0B 3EQ6A 4PLGA 4HN4B 5F7JA 2BKVA 1X80A 4UOEA 4ND3A 1F12A 3HCAA 2WHPB 3DEYX 3ZW9A 2I6FA 4ZQBA 4WOPA 3V3KA 1WP9A 2H1SA 1P6XA 2D0OB 2C5AA 2GYWA 3L4JA 2H85A 3MJSA 4KR6A 1J1ZA 4YFVA 1T9ZA 5EHZA 4IFIA 4US0R 1JWBB 3O4RA 1PZFA 1IWPB 1V3QE 4ND6A 4MX8A 1MF7A 5JC1A 1MFZA 3ZW8A 2JCYA 4XDYA 2WG2A 5HXAA 4O0LA 3EVTA 2W8BB 4IUBS 4L5JA 2HA5A 3A0RB 4HSGA 2OCGA 3JZFA 1ZC4A 3VYTB 4ZOQI 2WKRA 5G1PA 4LI0A 2EP7A 2AR7A 5IHXA 3EPPA 5IYZA 3PTLA 3JALA 3RTCA 2EC5A 3OZGA 3DOJA 2X5OA 2AK3A 1BE6A 1QC5B 3OFJA 1SCKA 4N3BA 1V1RB 5IG2A 3FOFC 3GPBA 2IZ0A 3FSEA 1ZMOA 2H92A 4S1OA 5CIWA 4DQUA 2WW8A 1P80A 4H7EA 5AHOA 1GU0A 2ZUVA 1YFLA 3K9FC 3B3JA 1X74A 5IAOA 5T4BA 4Y8VA 1HORA 5F76A 3N2YA 3K8YA 5CFOA 3M5DA 2PM8A 3DTTA 2GERA 4NG5A 4R98A 4A23A 5C1IA 2RGBA 3ZQ4A 1C0EA 2OOKA 2O2SA 2YRFA 3CLTD 1MA0A 1GL9B 5GADl 3G2QA 2EFCB 1VYHA 3G2IA 3RRZA 1BTOA 3JV7A 5LB2A 1TKRA 1NBIA 4TTIA 5LDGA 2OFWA 1SC6A 4CEIB 2VF8A 1FFWA 3AI2A 3FYHA 2I78A 1WVGA 3ACBA 2F17A 2RIPA 2OENG 4UTVA 2BRUA 3SMQA 3X1KA 2W5UA 3CA8A 1EVZA 4RY9A 3KXKA 3N2GB 1OLXA 3SSOA 3B53X 3DDHA 3U4GA 2HSZA 4QT0A 2O8CB 1Y9AA 5KMGA 1OBOA 2JJMA 1ND5A 3LY8A 4QYIA 1S6YA 3K8QA 4P33A 3TFOA 2PS0A 4PV7A 3MD0A 2ZZKA 5C7IO 3DGEC 4D79A 4HDAA 1T3HA 2FX3A 1CJTC 2CXHA 4KMRA 4LK3A 2X3UA 1L8AA 4WN9A 5EIXA 3TO5A 2ECOA 5JFOA 5IJ0A 2M9MA 2KLHA 3GFBA 1QPZA 2CMGA 2QUBA 3ZHOA 3GLIE 4KYVA 4RHEA 3UW1A 3V33A 2GI4A 3G2LA 2MINB 3CNHA 3MNFA 4IQ4A 4MW6A 4Q3OA 1XP5A 1JDTA 3RSQA 1ORWA 1VGVA 2WD7B 3DE2X 2FG6C 4HAXA 3SFTA 1F2TB 3W7AA 5JASA 3JQAD 4F72A 1U4SA 1PT6A 4N03A 4ZREA 2W6NA 1TOAA 1I6WA 1N1DA 2B1GA 3B52X 4A9AA 4XJSA 1NXOA 3IHLA 2XZDA 3A2NA 2FLVA 1XN1A 3JVDA 4M0FA 4YONB 5IM5A 1C3JA 1CVIA 2I76A 3QKSA 4OP1A 2A0UA 2DQ4A 4AJPA 3AJ8A 5COAA 5JG7A 3Q5GA 1VE7A 5GVRA 4CODB 4C7VA 5KYUA 2HT1A 1VLMA 1EZ4A 1QZTA 4LOLA 1MXFA 5TT0A 2I8AA 4S1PA 4P83A 3ZS9A 1GP2A 1WCYA 4AZ3A 1N5DA 3W6OA 3M1LA 3T4EA 1HO3A 1VPWA 1OH8A 1GU7A 3A1UA 2VF2A 1IZ0A 1J9EA 3F0TA 2C5BA 2GBLC 1AXEA 2Q0QA 2V65A 2XE6A 3BAZA 1Y5LA 3KTFA 3AF3A 4LX0A 4HLQB 3ANSA 4IVQA 5LLSA 1BD3A 3W8DA 4GR9A 4CF6A 1EJ2A 2GAAA 2FEXA 2ONKA 2GPTA 3CPHA 5IABA 3GRYA 5ITVA 1F7UA 1GCUA 2ZYWX 1Z4KA 2GZHA 3HDTA 5AVXA 3K70C 3CUYA 4UTPA 1PFGA 4BMDA 2F3PA 3K1AB 1YS7A 1XTBA 2XQVA 1OOEA 3NV7A 5IXJA 1JU3A 5ESXA 3M1IA 1E2MA 2IYNA 1Y5MA 3W3ZB 2WZDA 3CNLA 4JLUA 3RREA 4L1KA 1VKZA 3COYA 3AX6A 3VC1A 2RD2A 3UCXA 2NVWA 1V4NA 3GCZA 1XTTA 3K09C 4B4VA 2YBEA 5JJKA 3E84A 4JUAA 1C2TA 1WB6A 2QQ5A 4CCAA 4XW2A 4OK6A 4X93A 3ZHCA 1E4OA 5JECA 3FYCA 3DKPA 3LFTA 1SBNE 3PKJA 4FE3A 4LGYA 2IIBA 4G1EB 3CN9A 4L3OA 2HU2A 1IUKA 4MWEA 5EYPA 5G0UA 4BGIA 1UDRA 2ZRDA 3P20A 4R9UC 2XNKA 3NCHA 4WGGA 4ETIA 5JZSA 4JXXA 4ESOA 3EG9B 3V1NA 2EZ4A 2XDWA 1QX4A 4ZI7F 4Y0AA 2HBQA 2R47A 2XNHA 3OZCA 4M8IA 1XO1A 2AEMA 1POXA 3R3ZA 4H6XA 4LGVA 3UHFA 1BCRB 4O4HB 5BRJA 4F60A 2FUG1 1IWBB 3K5PA 4B45A 5DH9A 1JHOA 2QIPA 1IU9A 2F7SA 2VAMA 2Y93A 2JJYA 4JFAA 5B2EA 4XE5A 2YVKA 1WZCA 4AUNA 5EIAA 3TLCA 1CJKC 3W6PA 1OXVA 2AR9A 1C9DB 5T3UA 4G89A 4IVPA 1RAGA 1EDEA 1B16A 2UZIR 1NASA 2EG9A 2R11A 3FCOA 4LTNA 3QVOA 5L95A 1DC7A 1NKVA 3CXRA 1V47A 5D2CA 4IEEA 1GG5A 3RIMA 2HPVA 3M3DA 1U9JA 4Q15A 1GSIA 1Z29A 3DL0A 3PQ4A 1IHUA 2IY9A 3BH6A 5FYDA 3JQQA 1AXRA 3LYHA 3SYRA 3Q4GA 2V59A 1BE8A 2QHXA 4H0CA 2PGIA 1OIWA 5LLTA 2JLSA 3PEUA 5HJEA 3AUXA 5BP7A 1VECA 3KSZO 1T1EA 1SA0A 2V7VA 4IMRA 4HDSB 4EP1A 1WNTA 1USWA 3TM5A 1NLYA 3UWSA 4G8CA 1MRNA 2JHAA 3L9XA 4Y2TA 4ABYA 1L4FA 4P9NA 3W4KA 2OAEA 2BEVB 5KNDA 1LF5A 5BRAA 1JJBA 4IDHA 4V2UA 2WUDA 5LBTA 2HO4A 3W5UA 1GZHB 4P3YA 2WAOA 3O1LA 4F1JA 3F67A 1ZN9A 2B8JA 1O96B 4CKCB 4ZCQA 1D4AA 2YWFA 4IKPA 4MI3A 2GKOA 4JOSA 3TLMA 4DV2B 2FPIB 3SFZA 1MJGA 2H7YA 1RWVA 2HQ1A 2ZRMA 1USKA 4BUJA 4B3TB 1QO0A 3O2JA 5AOAA 3JQFC 5DNYB 1ENZA 4MTLA 2YJGA 3H4IA 5KVCA 4R2HA 8LDHA 4HRXA 3IULA 4G5GA 5H9VA 2WFAA 3AIOA 2WDZA 4TN5A 4CGYA 5DU2A 3RFVA 4E5VA 2AJBA 1EJ0A 5AW3A 4K8OA 3QFSA 5DKFA 5JCPA 1ZUD1 3WZMA 3BCSA 4KMSA 5IT4A 1MO2A 1JIJA 3HE3A 3IRUA 5A4MS 4EY3A 3VHXB 1WMEA 5MN6A 2WM2A 2PZMA 4ND5A 3TUIC 7YASA 2CFOA 1CFZA 5ELLA 2QL7A 3R4VA 2CLOB 3ECCA 3LY5A 2FLWA 3H1GA 5CBPB 4OGFA 2XD9A 2ZBQA 1T2CA 4D9FA 3UJBA 1E77A 2LPMA 2RAPA 1WABA 2H59A 3USCS 4U5QA 3I9V1 2PCJA 1JSRA 4WZAA 3MB8A 4LXHA 4OD0A 4Z2AA 4J03A 5D5PA 4G4IA 4ER7A 3ESRA 3ZDBA 1OC2A 3ELUA 1FVHA 1WJGA 3OPNA 3ZCSA 2R8BA 5IF3A 1VDMA 1H2HA 4D9GA 2GEUA 3EC1A 3KLPX 5T4EA 4G0WA 3HR4A 4DMUB 2AOUB 1IBCA 4IM7A 4IDDA 4CKWB 5K4AA 2VHVA 2FWAA 1I3NA 3DMHA 2VH1A 3FUCA 2CJPA 1ZH2A 1QP8A 3RFXA 4EPYA 2CDRA 3AJEA 4ZO4A 1UBUS 3TBKA 4AG5A 1LBHA 1GPYA 3WIEA 1C3OB 2XGGA 3L2OB 2W6MA 4KBFA 3U13A 5B36A 2IC5A 1VIMA 3EB9A 4FC6A 4A91A 2G7MC 1U3VA 1N5RA 3K0HA 5AICA 5TPWA 3UTCA 4RGQA 3H8SA 1J0DA 4PE5B 3C3KA 2APJA 1RYNA 2Z2KA 3FNIA 3HDQA 1T3LA 3AH8A 3Q3GE 5G2OA 4DJFC 5JV5A 3L7DA 2QN6A 3OICA 4S1NA 1KXZA 1Q1AA 4CIDA 3EX7C 1N3LA 1WMAA 3R4CA 4RPJA 3GQVA 5DRTA 3OEHA 5A9TA 3O4GA 3S2UA 3T5GA 4D26A 1REQB 3PHGA 1O54A 1G8JA 3G0GA 2HA3A 4F4UA 3E15A 1IRXA 1Y3HA 4LF5B 4TRRA 2Q5FA 3VJLA 3VYVA 4BX9A 2YL2A 3E7WA 2MR6A 4WKBA 4JI6B 3EWNA 1JKJA 3UW3A 3OTQA 4K9KA 5KKCA 4H0NA 1UQRA 5C4MA 3LC1O 4LUCA 3COVA 3ENKA 3DUFB 4W8GA 3TCNA 3TOXA 3VZDA 1NBME 4H4EA 3E18A 3SBOA 5K0FA 2VJMA 4ILEA 1D2CA 3D31A 5A7FA 4L4YA 1H1LB 1K88A 2GN9A 1G7SA 2EBHX 4P5DA 2YOFA 2PIAA 4UVEA 4C43A 3EPJA 4QWMA 3AKEA 4C4ZA 1Y81A 3HJUA 1UWLA 4HAZA 4EATA 1JHDA 2WFLA 4RVOA 3SQOA 3FGNA 1F4LA 1PZNA 3BYZA 1D4OA 2I7VA 4EG4A 5F23A 4HYEA 4YASA 2JGIA 2GN6A 5K99A 3KHSA 2X0FA 3LWDA 1J23A 2HMWA 3AUJB 3MJTA 4ITVA 4RM3A 4D9JA 3R7LA 4ESEA 4ZFNA 2V7XA 1R18A 3EFEA 1AD2A 3KJGA 4PLYA 3BGIA 3RUPA 4X95A 3PU6A 4IKEA 4RIFA 4Z8XA 1CT9A 2PRSA 4QO7A 5CAEB 4OLFA 4AJKA 2Q1YA 5EINA 3OQHA 2WWTA 2CJYA 2EFJA 3AM5A 3RAJA 4Q4DA 1V6CA 1BSVA 5ITSA 2CC2A 2BAGA 2GEDA 3JYOA 3BXXA 4M9QA 1SCAA 4I36A 3BJZA 2O5VA 1KFJB 2ECQA 1CV2A 1FRFS 2DCMA 4CM5A 2QP3A 3I2FA 5HGJA 3TKLA 3HA7A 1D6NA 3FXAA 1Y33E 3LXMA 1I33A 3OFSA 3RAFC 2IP2A 5BW5A 2JK1A 3HH8A 4NEGA 3CO0S 4OXNA 1C7FA 2BGJA 1DMRA 1OT5A 5CX1A 2HRZA 5AK6A 2CF6A 1RXSA 2Y99A 5E1BA 5JRJA 3EFBA 3V80A 1U65A 2HPZA 1CUHA 3E23A 4HWGA 5FUVA 4BGEA 3BSYA 8AT1A 2G1KA 4DLLA 3H2YA 3EYAA 1UL1X 2XUAA 1AXGA 2AD1A 3WX0A 4TZ0A 1W36C 3ICQB 3I58A 4IGEA 1RM3A 2PKRA 4WQMA 2E21A 4KYUA 1K9VF 3C8MA 1GRRA 5C7YA 4Z0PA 2XF2A 4P7BA 3NHLA 3ZOKA 1U5BA 4Q9KA 1P2UA 3PDUA 6REQB 1DDOA 5I9BA 1HNWB 2X6QA 2RC5A 3UKDA 5SZHB 5JXHA 1I6LA 3O73A 2H7XA 1SBYA 4N82A 3VH4A 4F6LA 3HP4A 2QE7D 4D25A 2CK3D 3EIEA 3X1MA 3EXHC 1KZ6A 2PD6A 1ISGA 5B4TA 1JJ7A 5JNUA 3Q8WA 3D7NA 1RXYA 2FZVA 3E7PA 3OZFA 2AG6A 3Q6IA 4LBZA 4HAOA 5IMBA 4PXYA 3ONFA 2XTAA 3KOXA 5DBOA 5HE8A 1GFWA 4UQOA 5FYQA 3A1NA 1SK8A 1G0NA 5ECYA 3IUPA 2XE8A 5FUYA 3SF8B 1MC1A 5EZ6B 1WB5A 3SEZA 3OD5A 3VMMA 5H7XA 3TW8A 1NW7A 1F2DA 3DL7A 2E18A 1LDYA 4ND1A 4BYGA 1ICEA 3JR7A 3PI7A 4M86A 3E1KA 4XZ3A 3T9FA 2G82A 1UT6A 5TVKA 4AMUA 5KOJA 3V2HA 3H5RA 1XZEA 1EX6A 1P9WA 3GBSA 1Z0UA 2EZTA 1HDIA 2QZSA 4PGAA 4TLCA 4FI3C 2VNAA 1I9GA 1YMQA 4FEAA 4WLVA 1FP2A 2XOKD 2GKSA 1U1DA 2OB1A 3C