4FMDF

Espg-rab1 complex structure at 3.05 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
164
structure length
149
Chain Sequence
KLLLIGDSGVGKSCLLLRFADDTYTISTIGVDFKIRIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords EspG protein
total genus 36
structure length 149
sequence length 164
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdF00
1E9SA 1G5TA 2GJ8A 1P9RA 1HTWA 2FF7A 2J3EA 4HAWA 3KKMA 1OXUA 4IXNA 1UEJA 4Q19A 3C4JA 5EE0A 4OHVA 2ZROA 2V3CC 2ODEA 2DFNA 3EPHA 1TEXA 2ZRHA 3HU3A 4JZKA 2GXAA 3EARA 1UKEA 2YOGA 3X1WA 1GL9B 1V43A 4QGHA 1Q1EA 2W2XA 4QNMA 1EFTA 1IN4A 1Q3HA 4ESVA 3G5UA 4IOJA 1CR1A 4DIEA 5CJPA 4DLWA 1TF2A 4KVAA 3ZVRA 1Z47A 1W36C 1GILA 4Y0AA 1P3JA 1QHHA 4R9UC 3PUXA 2GJAA 1U8ZA 3MSXA 3L43A 1KK2A 1VTKA 3ZQJA 4BLSA 1RJ9B 2AK3A 5F2EA 2WIAA 1TQDA 1S2MA 4TLAA 3L8ZA 2ZJBA 3K1JA 5B58C 1E9EA 2QMEA 3ND8A 2D2FA 5AJVB 2J0VA 3IHWA 3BH7A 1HY3A 3C16C 3E1SA 3BGWA 5JRZA 4DLVA 2PCJA 5H68A 3THYA 3DDCA 1NKTA 1EG7A 3SOPA 2ERXA 1D2MA 1OFUX 2GCNA 5K8UA 3VR2A 1FL9A 5FBLB 2WWHA 4FWIB 2JJ1D 1OH7A 1II8A 4ILEA 5A0FA 4TMXA 5KNDA 3GEEA 4B2IA 1IN6A 4JYBA 3U44A 4N1AA 2DWOA 3B7GA 5IDVA 1FZQA 1ESMA 1E1QA 2F1IA 2KB0A 5J4VA 1E2NA 2ZR0A 3GLHE 4A8JC 4B43A 4DLRA 3AVWA 4C0HA 2REBA 4X8MA 3EW9A 3K0AA 5AJYA 2ZRIA 3OIWA 3BFVA 4PAMA 5JCPA 2QAGA 4IHQA 4EQ6B 2VRWA 2QMHA 2MMGA 1G291 4YDSA 3MJHA 4BUJA 4US1R 1W46A 3VR1A 3V4FA 1IN5A 4DXAA 3P4XA 4IFBA 5CB6A 1MABB 4GP6A 4FIDA 1CXZA 2ZJAA 3GFPA 2OBNA 2RKOA 1OF1A 1VCIA 2V1UA 4GL2A 1NSFA 1G6OA 4CEJB 121PA 1G3QA 3I4LA 4TN1A 4DCSA 5C1BA 4B3CA 2CEAA 2IUSA 3NBXX 3RS2A 4A15A 2XNDA 4TQAA 3GLGA 3L0SA 1ZUIA 3KJGA 4F91B 1SZPA 2ZRBA 3V00A 2FSIA 2RMKA 4O2LA 4W7SA 1KI3A 3ZS9A 1E9CA 2G88A 3BIFA 5G3YA 4BFTA 2P2LA 1N6OA 1TAGA 4GZLA 4CEHB 1S9DA 3RS4A 3THWB 1R8SA 4LJ9A 4TMKA 2H57A 4KLZA 2IWRA 1BYUA 4RD2A 4A8JB 3BH6A 5BN3A 4Q9HA 521PA 4EPXA 4D25A 1KI1A 4H9GA 3IGFA 4DZZA 3B5JA 1DAHA 1FQKA 2NOAA 5JSZB 2J0UB 2J41A 2CCKA 3LXXA 4LZZA 2YOFA 3A36A 1KMHA 5BWMA 1LNZA 4OQLA 3VR6A 5JMTA 2CK3A 4BFSA 3K9NA 4V03A 2FG5A 5LBIA 2QP9X 3WBJA 4Z1MA 3RWOA 3BWDD 4QXAA 1ZM2A 4FMCF 4B6FA 1Q21A 3PIRA 4QNRA 1DVRA 4PHGA 4RD0A 3SE0A 1GG2A 1DEKA 4EPWA 5JRJA 2VHQA 1Q1BA 5K8IA 3CNNA 4A0HA 2JLWA 1LB1B 2PLRA 3DKVA 1KDPA 3EZFA 3W8NA 4BZPA 1DOAA 1ZCAA 1F48A 2VSOA 1DAFA 1P75A 1R0WA 3DHWC 3L0IB 4M8NE 5JECA 2Y8EA 2ZSBA 4HI0E 2YJTD 3EC1A 2Z6VA 5JBQA 4OHZA 5B57C 2CHGA 4TQUS 2Q0HA 3K9GA 1XJQA 4EJSC 1KNQA 4TTQA 2P67A 1BMFD 2FX3A 4KAXA 4WOPA 2AXNA 4HLUC 2VEDA 3PR1A 4TT3D 1IJEA 2EW1A 1BKDR 2ZJOA 4NZYA 1KO7A 4MUBA 3T5GA 2Z0MA 1J99A 1NVVQ 4MQBA 5GJVC 5L3QB 2ORVA 5KNCA 2X19A 3IBGA 4G01B 1XD8A 1CR2A 3BK7A 4QKQA 3U4QA 1KSHA 4Q1FA 1CP2A 1FQJA 1KMHB 2IS6A 1Q1QA 4L4UA 5GJBA 2QQ0A 2RGXA 1SXJE 3KQLA 3OIVA 3AKYA 1SKYE 4Q9JA 2IYVA 1VCMA 4O2RA 4B6EA 1KSGA 1R0YA 4EPYA 4JSTA 2OLJA 4L15A 4Q5IA 1R5BA 2QGNA 2Z4RA 1TUIA 5FUYA 3AV0B 3UG7A 2WWFA 4XVRA 2BMFA 3R7WA 1VYUA 3B1WA 4NYJQ 2AK2A 1R6BX 4US2R 2ZYUX 4FW9A 2DFLA 3WMEA 3QQ5A 5JJLA 2FFQA 5DLQC 1US8B 1FMJA 4TZ6A 3T06B 2IYXA 2VPPA 2Q3HA 2CLSA 1KO4A 4WZBE 3MWYW 1QG2A 1CS4C 1H8EA 1NVXQ 1ZIPA 2OBLA 1G6HA 4PZYA 3T61A 1KNXA 5HR5A 4D4LA 2C03A 4LOAA 2MSDB 2J0QA 1OB2A 4HUQA 4RZ3A 2PZEA 3PEWA 4EJSB 1UF9A 2FV8A 1FP6A 1UM8A 2G1JA 2YHSA 3WY9A 3HDTA 3H1TA 4DUGA 3CPHA 2VH5R 3VKGA 1XD2B 4BRWA 1TU4A 1ZU5A 2UKDA 1E79A 4JKYA 4IDQA 5ANRB 4MRRA 4XOIA 4A0GA 2BCGY 4Q4HA 2FGKA 1HA3A 1N6RA 4CYMA 1JXOA 4FXPA 2OUKA 2DFTA 2CE7A 3FKQA 4HB2A 2EFEB 1J7KA 4QBHA 4US0R 2G3YA 1Q3TA 2WPDD 2UZIR 1KSFX 2C98A 4JJKA 3QPVA 3R9IA 2F1JA 3CRVA 2FPKA 3WXMA 2EVWX 2MMCA 1AS3A 2DB3A 1G21E 5JCZA 4KLNA 1C4OA 3BE4A 2J7PA 2ATXA 1P73A 2QM8A 2V9PA 2BMDA 3MD0A 2H16A 2W58A 3AF3A 3P20A 4ZDWA 2YC2C 3EA5A 2J1LA 3A1VA 3FOZA 3DMDA 1XTKA 1DTSA 3UMSA 1Z2AA 2B6HA 4C0AC 3KB2A 3CX8A 4GMXA 4CVNA 1Z63A 2OXCA 1XP8A 2P65A 1ESNA 2FE4A 2XZPA 2FU5C 3B1VA 3BB3A 3TMKA 1FMLA 2IXFA 5AUPB 4Q4JA 3AVUA 1M6NA 1F2UA 3CWQA 4PQRA 3O8DA 3DZ8A 3WYAA 2WWYA 1OYWA 3CNOA 4MRVA 4PPNA 1ZNXA 4B33A 1OE0A 1NP6A 4QOSA 2EFHB 4CW7A 1W4BA 1COWA 1KDTA 2AD1A 1E9RA 4CEIA 2D2EA 3UWKA 4LUCA 1W1WA 1NBMD 1HUQA 1J70A 5EZ6B 2C9CA 5IHPA 3AGQA 4FMDF 3VR4A 3CONA 3BFKA 4JSYA 3KQKA 1AM4D 1S4QA 5C4MA 4LHYA 3P26A 4F4IA 4RZXA 1MV5A 1CF4A 3BC1A 3UK6A 4TYWA 2ZI4A 3RSLA 1WE2A 3SFVA 1GDDA 1CTQA 1P2VA 3ZLJA 1AS0A 4GBMA 1E2GA 2O8EB 4M4SA 4PAQA 2VSXA 1IXSB 2BVNA 3QI2A 1QHIA 2FGJA 3EIQA 1OXTA 1AKYA 5JZVA 1XTIA 3KFXA 4JLDA 4QGAA 2J7PD 3B78A 4PHTA 4BFZA 3NBZC 4A0FA 2MSCB 4AURA 1V5WA 2VHUA 2OT3B 4TLBA 1BMFA 2W6IA 3L8YA 3NIBA 4BFYA 4M0LA 3CBQA 1EWRA 3IQWA 2GNOA 2F3TA 2WIBA 1KK3A 4KJZA 5L3QA 4CGZA 4DLXA 5E3HA 4W9MC 4XWAA 1U8AA 4WZ6A 3TSWA 4A8JA 2A5FA 1LF0A 2W2VA 3VNUA 1QZXA 1CEEA 1W0KD 3HWSA 3LLMA 4LJ8A 3VR5A 1Z6YA 1HEIA 5CDFA 1ZJ6A 1WMSA 3MWKA 2H8KA 3TE6A 2NO7A 4XVUA 4MGIR 4XIGS 1DO2A 4BLRA 3EX7C 5FPTA 1T8TA 1E0JA 2EFDB 2VP6A 2IA5A 4KHZA 1H8HA 2CCJA 4MITA 2IS1A 3AF0A 3QKSA 4G0NA 1E69A 4OL0A 3LH5A 4DSTA 4KBFA 5CJ2A 4M1YA 2ZU6A 1W4CA 4BASA 4UNPA 2Q9CA 5C4GB 3CM0A 3REGA 5EP2A 4WZAE 1N3BA 4D82A 4GI7A 2Z4SA 1UBEA 2JATA 4P4SA 1P9NA 3IO3A 3QKRA 5AJZA 4PC6A 5EXTA 2G9NA 3KQUA 2O8FA 4JL8A 5DISB 1HQCA 5FI0B 3HR8A 4OI1A 3A37A 3V4RA 1LTQA 2ZUBA 2HJGA 1GKUB 3RABA 4ESHA 4BLQA 1OH6A 5JEDA 1KOFA 4JBXA 4NCKA 4R2IA 5SZHB 3TAUA 1EX7A 3PFIA 3LX8A 4F92B 1TF7A 4OK3A 1KI8A 2ZVQX 2PT7A 1P7CA 4NYMQ 2FH5B 1IY2A 1K6MA 2O0HA 5UKDA 3L2OB 1AZTA 4FINA 2FSGA 4JBYA 2GK7A 1VCNA 3NTUA 1VG8A 3B8HA 3Q5EA 3PUWA 5CLLA 3HYRA 1OB5A 1EFUA 4LJYA 3CZPA 1OIWA 1OPXA 1ZC3A 1JAIA 4MA4A 2H1LA 2K5UA 1NVWQ 4QL3A 3SJCA 1XEFA 4H1VA 3NEYA 2IYQA 1RYHA 2P6NA 3ZVMA 2HT6A 3D6TB 4AYTA 1NJGA 2RGGA 3NEJA 2CBZA 2O8EA 2P3SA 4A92A 2C5LA 2RGNC 3ZZUA 1G7RA 4Z54A 3H2YA 4PSAA 5CDFE 2D7DA 3I5XA 4PO8A 3TKLA 3GMTA 4BFWA 1GSIA 2QAGB 3RANA 1IY0A 2L0XA 2AKAB 3UMFA 1T5LA 1G41A 2AWOA 1G64A 4K81B 2HYIC 1P9WA 2WJHA 2VQSA 2YWFA 4A6PA 2WJYA 2OFXA 4XSGA 1KKMA 4YC7A 3EIEA 1JR3D 1WQ1R 4I1SA 3GEHA 1N6IA 3K09A 1NSTA 1X1RA 2ZXUA 2D74A 1YJ5A 3K70D 3CH5A 2PL3A 4HDCA 2IX3A 3THXA 3VU9B 4DSNA 5H70A 3RWMB 3AP2A 5FPHA 3WMFA 3OFND 3ZZTA 1OLOA 3LFUA 2BJVA 3FMFA 5J5CA 2XJ4A 3DL0A 5JEEA 5TARA 1WCV1 3W90A 2W2TA 2GAOA 4C3ZA 3GJ8A 4F93B 4PX9A 1FOEB 2VTKA 1BO6A 3IEUA 5CIQA 1YR9A 1P2TA 2ZSFA 1KJWA 3T12A 5EUMA 1GKYA 3UKDA 1J8MF 4OHXA 2RB4A 2WMNB 2BBSA 5D3QA 2ZRAA 2KJQA 2HYDA 2DPXA 4IRUB 4CDGA 4QBGB 3BORA 4ABYA 2RGCA 1AZSC 1NBMA 3FGNA 1DAGA 1TPZA 2BWJA 2QROA 4DDWA 4II7A 5DHFA 1XCGB 3S1AB 5FOXA 2AKYA 4YQFA 2J59A 2O8BA 1JR6A 3BBPA 1E2EA 3AVPA 1JECA 2VP9A 3F8TA 3DM9B 2D7CA 3WBKA 3VKWA 3OHMA 3X1XA 4GOJA 2RCNA 1NN0A 3LWNA 2ZIAA 2VHJA 2AD5A 4NL4H 2F43A 2JLRA 3Q9LA 4ZKDA 4B3GA 1HYQA 1T8UA 4Q1EA 4Q7JB 3GJ4A 4ZI2A 1Z6GA 2XEXA 3JZMA 1VYTA 2WJVA 4C7OB 5EQTA 4TMZA 4Z8XA 1XPUA 1P4SA 4DVGA 4G5OA 2AL7A 1CJVC 2ZE5A 5JJKA 2V1XA 1D9ZA 4KYIB 4W5WA 1Z2CA 3D31A 4M53A 4Q4AA 3QG1A 4HB3A 4CRWB 4B44A 1D6JA 3ONWA 4QHYA 2WV9A 3KQNA 2ATVA 5KDOA 1XPRA 3QE0A 1E79D 5IRCD 3MWJA 4DDUA 2WM9B 2ZRCA 3FTQA 4BZXA 3A58B 4BPBA 1G16A 1US8A 4F4CA 4Q03A 1N25A 1LS1A 1YZKA 2QT0A 4A1FA 8OHMA 2W6JA 1GRNA 4RVCA 3N70A 1DG1G 4JLOA 2H17A 1XF9A 3ZZ0A 5DO9A 2ZSDA 2IT1A 3KUDA 3K70C 3LDAA 3BFXA 1H8ED 3R9XA 1G7CA 2W83A 1FTNA 3B13B 5FUWA 5CK5A 4UXJA 2FPLA 5FTLA 5CIWA 3B85A 1XMSA 1OFTA 2D3WA 4FMDB 3ZYCA 2JCSA 1QF9A 2FSFA 5EE1A 1A2KC 1TNDA 2BBTA 1SVMA 2R6DA 3QOFA 5EJEA 2IHYA 2QPOA 4BQSA 4RSGA 1HT1E 4PO1A 2JLZA 3DPUA 4ON9A 2B7BA 2ZR7A 1M7HA 3EZ2A 3CB4A 2CL0X 2WWIA 4GT1A 1CJKC 1QHYA 3I3SR 2QTHA 2D06A 3LA6A 1S1CA 1P5ZB 2HLDD 4M1TA 1NG1A 4JLPA 1CJMA 4TMVA 5DYIA 1B0UA 3QXHA 2WPDA 1W44A 3X1ZA 1GKIA 4LHWA 1KYIA 3IKJA 2GAAA 4WIAA 3ASYA 1DAMA 2XTZA 1GRRA 4XD7A 1OYYA 3I92A 1G19A 1U0HC 3LD9A 3TUIC 2F1RA 3U3KA 1TADA 3AF1A 4NPHA 4RFSB 1MRNA 2AWNA 4BRUA 4N0EA 5H1YA 5JHGB 4DUGD 2DY1A 4MYCA 2Q6TA 1R8QA 5F98A 1WXQA 4OK6A 1IAQA 4TMWA 3K0FA 1ZMXA 3P4YA 4TYQA 3VFDA 2QRZA 3K0AB 3QVUA 2GF0A 1KIMA 3RDPA 4A6XA 4LHXA 1E2FA 1VIYA 4EPRA 5FR1A 4C7OA 3WRYC 4CEIB 5P21A 2GTPA 5EXXA 4NP6A 4I99A 4C30A 3UANA 1XXHE 4MH0R 4IOKA 2CMKA 3KKNA 4OI4A 5E4FA 2CDNA 3CNLA 3KDSE 4DEXA 2F43B 1N5IA 2FN4A 1Z22A 4LJ6A 2ZETA 3U7HB 2OV2A 1S3SA 4A2QA 4HEJA 1DBSA 2BM0A 5FBVB 4UNNA 2OCAA 3W8RA 1IN7A 3THYB 1Z06A 2Q21A 2REXB 5LDDC 4B48A 1Z0JA 4ASUD 2CJWB 2YVUA 3L82B 4JT2A 5KSOA 1CJUC 5EZ5A 5KO2A 2XB2A 4HZUA 1XJ0A 2WWGA 4OI2A 4HZIA 5DI9A 1XTSA 4P33A 2H92A 3NH6A 3ZIAA 2QUZA 3DZDA 1G5RA 4Q1CA 5SZIA 4DCNA 1ZM4A 3LBNA 3OE7A 1SQ5A 3C41J 4EKDA 4YMVA 4NCHA 2Z5FA 4D4JA 1M1YE 3OF5A 1N5JA 1KI6A 2QTVB 3MUFA 1Q0UA 1JAHA 2QBYB 1SKYB 2VO1A 2ASEA 2ORIA 3LBIA 3RRYA 4KCGA 2GZAA 5DH9A 2GZDA 2J9RA 1AKEA 2HCBA 1YE8A 4XSHA 3RRZA 3D3QA 3VAAA 4D26A 1WF3A 5G53C 2RGDA 4M1SA 2FZ4A 1RIFA 2YWGA 2NZ8A 3NG1A 4TT3A 3VX4A 2PZGA 3K0CA 1WDTA 4LBZA 3ZS8A 3QKRB 4U7DA 1JXMA 3I32A 2XXAB 3QY0A 3WHKA 4XD7D 2CE2X 3I8SA 2GCOB 4CZ2A 3THOA 3SU8A 4V0OA 2OCPA 2AX4A 3EPJA 2QTFA 4KFRA 1NG9A 1ZM7A 3AKEA 1QHXA 1XXHB 1D8TA 4I1VA 3K9LA 1QHGA 2FWRA 4Q4JB 4URVR 1T9HA 4XVQA 2ONKA 3I72A 4LI0A 3WP0A 3WNBA 1BOFA 1XD9A 5G41A 2GZHA 4XTRA 5FOSA 1N2CE 1KZ7B 1SXJB 3K70B 1K8RA 2IC5A 4EIWA 3C5CA 4AG5A 1EWQA 2X2EA 1OT3A 2AXPA 4JJZA 4Z8YA 1TU3A 3QXJA 1PLKA 2ZSAA 3IIMA 5FL3A 5JSZA 3KB1A 2UZ3A 3GFTA 4BFVA 2ZRLA 4UNQA 3ADDA 2CK3D 1T5IA 3AVYA 5FI1B 1CRQA 4IKEA 4P3YA 1KI6B 1O87A 3T1QA 4MYUA 2XZOA 1RRGA 2QT1A 3SC3A 3U61B 1XX6A 1ZNZA 2W6JD 2JLVA 2A30A 4NBSA 1GL7A 1QVAA 3R8FA 3PQCA 3EAQA 3QPUA 4JVMA 1FNMA 3L0OA 4CIDA 3SEAA 1YR8A 1FX0B 2FFAA 4OBEA 4Q4HB 4QFMA 4UJ3A 3TNFA 3BOSA 3UXMA 1SVLA 2QN6A 2A5JA 1IXRC 1MT0A 1QVRA 4G5SA 4TL8A 2VA8A 3ZJYA 1ZM3A 2ONJA 5DNYB 5DYGA 2P5TB 3EZ9A 1XMVA 4QRHA 2RHDA 1II9A 1SULA 1T91A 4LJ4A 2NMVA 4PO9A 2JASA 4C0JA 1UBCA 1E2PA 2BV3A 3ZH9B 2NIPA 2KBFA 4IDOA 1DAEA 3W6NA 1XCMA 4RD3A 3FHOA 1NBME 4I4LA 2TMKA 4JYCA 1KY3A 5FPYA 3SDZA 3SNHA 1DELA 2WSMA 3T1VA 1ANKA 4AG6A 3AVTA 2Q9BA 3LW7A 2HV8A 4K8OA 2QGZA 4L9WA 1E9DA 4O25A 4PQFA 1UPTA 3OAAA 4JVNA 5JWHA 1E32A 2FFHA 4EFNA 4ZPXA 4D0NA 4EPVA 3DO6A 4EAQA 2ZI7A 4DCTA 2QPAA 3CO5A 3N2EA 2PX0A 1GZSA 1XFAA 3PITA 1ZAKA 2ZRKA 3RRNA 2BJWA 2ZI9A 1XMJA 2B7CA 3Q7QA 1HV8A 1GNQA 1Z0AA 1U98A 4DLUA 1ZBDA 3WP1B 1N6LA 3ASZA 5CM8B 3CF0A 4V0MA 3F3YA 4JLAA 2CLCX 2IS4A 4D2IA 3PXGA 4GOXA 5FOTA 3BRWD 1TMKA 3NVAA 1LFDB 4HLDA 3KKQA 2ZYWX 5DI3B 3PJRA 3V9PA 2B8TA 2ZITA 3HR7A 3U4QB 1N6PA 4ARZB 3PV0A 2VF8A 2HCJB 621PA 2EU8A 1KAOA 1XEWX 3ZVNA 1G8HA 3LV8A 4G5RA 1ZW6A 3UWOA 1WBDA 3U60B 2BOVA 1SVOA 1IQPA 1MO5A 5BQ5A 2PH1A 3K53A 1EK0A 1KO5A 2DBYA 3IO5A 2CL6X 5E7IA 4DLSA 4D4KA 1MRSA 4ARZA 1VHLA 3ZD6A 1U9IA 1RKBA 1XBTA 1TTTA 4PSKA 3WRXC 2EYUA 5JI3E 4LPSA 5JLJA 1G4UR 1JQLB 5EP1A 3TIFA 1J2JA 221PA 4OQFA 2ZI5A 1X1SA 3Q3JB 4ZCMA 4AI6A 4PZLA 5KSZA 3R8CA 2O8DB 1Q20A 1P6XA 4TL6A 3U3RA 2PEZA 3AF4A 4JVSB 4YXWD 1E98A 2KBEA 3LW8A 3GLIE 1P2SA 2CNWD 2ZPTX 4KI0A 4YDHB 2PJRA 3JZAA 1NVUQ 2QSYA 3X2SA 2NGRA 3NC0C 4BFXA 2GKSA 3KKPA 4OHYA 1Z29A 2WOOA 3A4LA 3AKCA 4HAUA 3OE7D 4M1KA 4QM6A 5AJXA 2A7QA 1NVVR 1KZGB 5FTJA 3SBDA 3SS8A 3ZIAD 2WZQA 5EP4A 4C0SA 3OIUA 1N0WA 3RC3A 1RVDA 1SVSA 5B30A 4IFEA 3M4YA 2A5YB 2GJSA 2JIZA 1WP9A 4JLKA 1E2HA 1AK2A 3Q72A 4EPTA 1I2DA 1E1RA 1N5KA 1X8JA 2R62A 1ZRHA 3GCGA 4IOLA 1KJZA 4BLOA 3MFYA 3MG9A 1YHNA 4N0DA 2ODNA 4R2HA 4FMCB 2YC4C 4PFSA 4Q21A 1E2JA 1XZPA 3NWJA 3B1XA 1P72A 3PENA 1DS6A 4FI3C 1CR4A 4XJXA 2ZRJA 5JS7A 3H86A 2ANCA 1FUUA 3BJIC 1YRAA 4R71A 2B92A 3UATA 1E4VA 1Z08A 5KU1A 4TLEA 3CRMA 4Q48A 3CX7A 4DEYA 2OM2A 2KWIA 2BDTA 4D0GA 1G20E 2GA8A 2CHQA 1XCPA 2QM7A 3QPWA 5DHAA 3IUYA 1EFCA 1JQJC 2WAYA 3KL4A 1IOZA 5KUTA 1P62B 4JBWA 1KO8A 2OEPA 1JJVA 3DOEA 4LPKA 2VP0A 2OXRA 4HLUA 4TSFA 3W5IA 5L3VA 3GPLA 2OO7A 1ZINA 1NIPA 2VIIA 1S0UA 5M04A 4YMWA 5SZJA 3TQCA 4LRWA 1YZUA 2HT1A 1L8QA 4RD6A 3OZXA 4BLPA 1T0HB 2FJUA 3LLUA 4BWYA 2XOKA 1DARA 1N0UA 4RD4A 1MABA 1KAGA 3B2EA 4W5JA 2NO9A 4UQOA 5KDLA 2WSSA 4N3NA 3O8RA 2QSZA 3GLIA 2GWHA 3NH9A 1QHNA 1RC8A 4AK9A 3I5YA 2OAQ1 2PBRA 3T15A 4OKSA 4GNKA 2C96A 5JHHB 3K0CC 4Q1BA 3TJZA 5F3WB 3AH8A 1OJLA 1K5DA 4IVPA 5IF9A 3E5HA 1XEWY 2F3RA 2C2HA 1EFHA 1I4LD 1OHHA 4G5GA 4H1UA 4AWXA 1YQTA 5J4LA 1BS1A 1KI9A 2XITA 4LC0A 2YWHA 3IPYA 4E07A 3R20A 721PA 2YYZA 3RS3A 1RRCA 2IYZA 3EASA 1Z6XA 4Q01A 1VKJA 2AFIE 2XAUA 1GUAA 5AK0A 1W4RA 1F3OA 2RGAA 1HE1C 1R10A 4LK2A 2V7QA 3EPKA 4JMPA 1VG0B 1U2RA 1AJEA 2C99A 3Q85A 1D5CA 4TTPA 2GETA 2SHKA 4Q4LA 1WRBA 2JAQA 3FDIA 1HE8B 1E2IA 1LVGA 4RKEA 3CLVA 1X8LA 1W0JA 1FPMA 2XSZD 4R7ZA 4G5QA 4LGMA 4JT4A 1YZTA 4IEIA 1XEXA 2ODBA 4ASUA 1MKYA 4NH0A 1SKQA 5FPKA 3UMRA 3PVSA 2XXAA 2R65A 1XJCA 2YZ2A 5TVKA 1TQ4A 2ZUDA 1NLFA 1S96A 3MWLA 1VHTA 3I8XA 3GJ5A 1OH8A 5DGXA 3A4NA 5DE3A 1RPZA 3IIKA 4HUTA 3ICQB 2ERYA 1FFHA 3BS4A 1OHHD 1Z0KA 1K5GA 3PUYA 4XWOA 2O8CB 2OCBA 1PZNA 3T35A 2ZREA 4XWKA 1X8KA 4M1MA 2ZSEA 4Q66C 2J87A 1I2MA 1VG9B 2WAXA 3U3OA 5K8TA 2O5VA 5L8VA 3WMGA 4B71A 2BHRA 4OQXA 3MAAC 2RGBA 4HZUB 4F7WA 3U2QA 2ZUCA 3C8UA 5BN5A 2IYSA 1LF5A 2EWWA 2G0TA 1KMQA 4GRAA 3P1JA 2GVDC 4PR0A 1RYFA 5D3MA 1CLUA 3VMFA 5DN6D 1TQ2A 2JGNA 1W48A 1VPLA 1QRAA 1E3MA 4X8HA 1AQYA 4ACBA 1UBFA 1NLZA 2J0SA 1NN1A 2QU8A 4MKHA 3ADCA 1AN0A 2H5EA 1QHHB 1E6CA 2ZS9A 1NRJB 3TBKA 2ZR9A 1MH1A 4LY6A 1T0JB 1NLYA 4NYIR 5KYKA 4YMUA 4MDFA 4QGGA 1UEIA 3OFNA 4AD8A 1CIPA 4NTZA 2B8WA 2ZE8A 1DE0A 5LD2C 2Z83A 3C15C 4HDQB 1E2KA 1S3GA 3TUZC 5LB4A 4R98A 1U0JA 4RD1A 4AKGA 1UAAA 1VG1A 3ADKA 5B64A 4Y0VA 4M1WA 2E1RA 4P32A 1SHKA 2A2ZA 2G6BA 4POAA 2J45A 4Q7LA 5CYOA 2V54A 3RS0A 1G18A 2Q3MA 5HCIA 1XDBA 4PPQA 3RLFA 4FCWA 3CRQA 1G7SA 1MO3A 2ZRPA 4LWZA 2GXUA 1UKVY 4HAXA 1AS2A 4JLJA 4NHOA 3FYHA 1CBUA 2PJZA 4EUNA 1VYVA 4I81A 4KO8A 3N2IA 1KK0A 3OEEA 1C1YA 1M2OB 1QG4A 3T5DA 1A7JA 3AF2A 2XOKD 4ZDKA 4AYWA 1NKSA 3BERA 1SVKA 6Q21A 1XRJA 3ZVLA 2BBOA 2G77B 5J47A 4Q47A 1QBKC 1GITA 1U9IC 3JVUA 3U6BA 4URZR 5HKKD 2HXSA 1UJ2A 1ZCBA 2WKPA 1SXJC 3UIEA 4L9SA 2FOLA 3U5ZB 1NMXA 2XTNA 4AKIA 4Q1DA 2ZEJA 2FEOA 3QKTA 4URUR 2Z43A 1ZU4A 4E22A 4QJ3A 2HUPA 1AGPA 3CWZA 5FL7D 4TL7A 2RHMA 3DMNA 4LYJA 4AYXA 1ZC4A 1RJ9A 3U7GA 1NF3A 5AUQA 4D6PA 3VHXA 3RVBA 2IEYA 2QEQA 1ZUHA 3SFZA 1JEEA 3MMPA 3DVLA 4Q7KA 3TR5A 4EFMA 3RS5A 3LX5A 2A5GA 4GZMA 1O3YA 4V02A 2CVHA 3AVQA 5L3SA 1E1RD 1GFIA 2IEZA 5KPDA 1Y3AA 1XZQA 2VBCA 3QXCA 1OV4A 2VYFA 2R6FA 4ITRC 2VHTA 1XD2A 2YNMA 3UG6A 1G8GA 1ZNYA 1F2TA 4GPTA 4MYHA 4URXR 2PZFA 1JB1A 3T34A 3CW2A 3TH5A 4IOMA 1PLLA 4QG7A 3FFAA 4ZDJA 1I4DD 2QPTA 1JR3A 2A3RA 2ZANA 4HAVA 4ZI3A 2ZE6A 4OK5A 2MSEB 4GP7A 4NMMA 2VHCA 4TMTA 3K0SA 3O8CA 4NYMR 5J4HA 4M2LA 2BKUA 3GJ7A 2YV5A 4EQ6A 2QNRA 2V6JA 4NU0A 4QC2A 5C46F 1F6BA 3VX3A 2ORWA 1TUEA 3GLFE 2YOHA 3BXZA 2CLDX 2GF9A 3CUEF 2CVFA 1TX4B 1UKYA 3M6AA 2YINC 4KYUA 4DKXA 1G8PA 1NY5A 4JLVA 4DLTA 1ZP6A 2XZLA 2CL7X 3M1IA 3HP1A 4DSUA 2QBYA 1KDOA 2IUTA 2LCFA 1U8YA 4B2PA 3LNCA 4LHZA 1GOTA 4U02A 1FNNA 4FCTA 3U3JA 1HQYE 3RRMA 3U7FB 3CX6A 2FA9A 1DAIA 3A1WA 2O52A 1N6HA 1RE0A 4MDEA 2WVJA 1S1MA 5D3MB 1IONA 2Q3FA 5HZKA 4C0LA 5L3RA 1JBKA 3A4MA 1XMIA 2FNAA 3O8BA 3QIAA 3QNUA 4TLDA 2DWQA 3KZ1E 4QJ5A 2NG1A 4UXIA 1UADA 4B3XA 4D0LB 3SR0A 4JKIA 4DT1A 4OI0A 5F9FA 2ZRGA 2X1VA 1JPNA 2QORA 3AGPA 4TZ0A 1G8FA 4OQMA 3FMIA 1XXHA 3KQHA 4NCIA 5EUQB 4P31A 5AUNB 2ZU0C 1E9BA 1CULC 4IDNA 2V8OA 4Q02A 5JFGA 2P0EA 5CB8A 2RH5A 5HE9A 4Q9LA 1KO1A 4P0TA 2F55A 2VLIA 4BE7B 1Y63A 2J7KA 4C0QC 4DSOA 3IILA 3SYNA 3TUJC 2RGEA 3IDQA 3CR7A 1ETUA 4JLNA 4X8LA 2GEDA 4WBSA 4HDOB 4DDVA 4AIIA 4MRPA 3R7WB 5TDHA 3PG5A 4BGDA 2D4HA 3AEZA 2W0SA 3TQFA 1UDWA 2OSBA 4Q18A 4V0KA 5FL7A 4U5XA 4NYJR 1XTJA 1JALA 4LV8B 2WJGA 3EWSA 3FVQA 4GSYA 4Q9KA 4M21A 4AC9A 3DOFA 2LKCA 2WHXA 3M0EA 4YMTA 1OH5A 1R5NA 3JVVA 3I61A 4GOKA 2GEVA 2QMOA 4LV5B 4NCNA 4ZV4A 1G3MA 5JWOA 2NO0A 1N6KA 2ZVPX 3GD7A 4MKGA 3GP8A 5CLQA 2QENA 4V0ME 4AKHA 2R8RA 1VMAA 4UXHA 1W4AA 2GEUA 2JLYA 2ZQ5A 4B35A 4RFVA 1OFIA 3FKSA 3OEHA 4J0QA 4GFDA 1UDXA 2XTMA 4D4MA 5FOVA 5DN6A 3EPLA 3LO5A 3AVOA 5KTYA 1KHTA 3NBFA 3MJRA 4PC1A 4DHEA 1FUKA 3HPQA 1YU9A 2KI5A 1U90A 3ND9A 1G3RA 3I1FA 2OESA 3ETLA 2QE7A 5EE9A 2JLQA 3H4MA 3FHCB 2WKQA 4TWZA 3SQWA 2CCGA 3GJ3A 4DCUA 2IUUA 1C9KA 4IDPA 2GBLC 1NIJA 3H84A 3HPRA 4LYAA 3W6OA 5GVSA 1SXJA 1IM2A 4FMBB 3X1DA 1GWNA 2O8FB 3Q5DA 5E95A 4B32A 4MUAA 4PPFA 3EC2A 2IYLD 4M1OA 3LBHA 2P6UA 1YZGA 4V0NA 2GJKA 4C9BA 3THXB 1OXVA 1ODFA 4B2LA 3AUYA 1BIFA 1E94E 1Z6TA 3KXLA 2IK8A 4M9SA 2GCOA 5FTKA 5CYPA 3WNCA 1EFRD 2XX3A 5B2ZA 1EXMA 1KKLA 4E5UA 1F2TB 2R6AA 4F38A 2FMXA 1E96A 1GVNB 1NMZA 3RHFA 4UJ5A 4TYNA 421PA 4MGYR 3AB3A 3VTKA 5L3SB 1DAKA 2FDCA 2QP4A 3MGCA 3AQ4A 3VKHA 3TSOA 5H8WA 1ONBA 4FD2A 3K9HA 2F9MA 2ODWA 1TEVA 5CK4A 1F2UB 3SJZA 2IYWA 3W6PA 2V7QD 1MR3F 2GXSA 4QBIA 1E9FA 4FWTA 1JEDA 3GLHA 1COWD 4PC2A 1GM5A 4DC9A 2X2FA 1Z0FA 2DFKB 1L4YA 2EQBA 3FFBA 2IYYA 4KFTA 5IK2A 4LJ5A 3E2IA 2QP3A 3ECCA 2OG2A 3H0KA 3IBYA 3CIOA 2GBLA 3O47A 3NKVA 1U99A 4S35A 2JLSA 4EDHA 3FWYA 4JLMA 5KPJA 5FUXA 1R2QA 2I4IA 2ZI6A 2G1KA 1AIPA 4WVFA 1G7TA 1A1VA 3TR0A 4LX0A 4MGZR 4B74A 2PLFA 5E7JA 1RFLA 2F1HA 2AFHE 3SQXA 4PQYA 4GDFA 1CRPA 3W3ZB 1J90A 1N0VC 1ZYUA 3BH0A 3OIYA 5FPSA 5J4KA 2BIFA 4B3BA 4ZIRA 2JA1A 2DR3A 3ICEA 2JJ2A 5FH9A 5J4YA 3NBYC 1L4UA 4QM7A 1D2EA 2WSSD 2PCLA 3GLGE 4RJLA 4DRZA 2ZYVX 3BAFA 1LV7A 2XSZA 4WA7A 4YONB 1GP2A 1E2MA 2IW3A 4EJSA 2JDID 2VP5A 4KV9A 2WJIA 2FSHA 1G17A 2W00A 5KNBA 5AUOB 1ZUNB 2GDJA 2AR7A 2OILA 4WAUA 5FOUA 5GVRA 5K8LA 1NNEA 1Q44A 2QE7D 3VHLB 1W7AA 4GMDA 3AM1A 3C7KA 3SI7A 4QJ4A 3SZRA 4I1UA 4LHVA 3LVQE 2QY9A 4DB2A 2IHBA 5FTMA 2VSFA 2V55B 5A4JA 2OFWA 4OJQA 1D9XA 2JLUA 3LQQA 3HU2A 5FUVA 1TQ6A 2XB4A 2R44A 2N46A 2ZI3A 5AWFC 3SJBA 3FMOB 2JLXA 3G0HA 2F9LA 3UPUA 4PAOA 1KSJA 4ACAA 1XEXB 2P5SA 5HCNA 4TYYA 2QZ4A 1E2LA 1GRQA 4PHHA 2JJ2D 4KSBA 3VR3A 1OW3B 3QUSA 1ZVQA 3EZ6A 4MGKR 2ZRDA 4C0KA 3RYTC 3MCAA 2PMKA 5KHOC 2IL1A 5C2JB 3CF6R 3AP1A 1E9AA 4DLZA 2EYQA 1G5PA 2PEYA 1A82A 1SGWA 3AVVA 2OBMA 4JVLA 5DI3A 5JI2E 3WYGA 4LBVA 1SVIA 4L5BA 4WW0A 1FP7A 2D62A 4B76A 4TQ9A 4TYPA 4UKDA 2OCYC 4URWR 1XB2A 1XTQA 1M7GA 4IEEA 3SN6A 4E03A 3GEIA 3CPEA 4TLCA 3GLIB 1S9HA 1YZNA 3CRRA 4AKEA 3KUCA 1KI4A 4KVGA 2BC9A 4PC3A 4LYFA 2ZJ2A 3KFVA 4Q7MB 4QHTA 5AJWA 3R9WA 3IPXA 3ZQ6A 4FCVA 2O8CA 2XNSA 3QG5A 2C95A 2F7SA 3MRSA 5DSZA 3PCRB 4BEBA 3U7EB 1R0ZA 2QA5A 1M7BA 1UBGA 2HF8A 2G83A 3CH4B 5G3ZA 3TVTA 2NZJA 2HXYA 1YR7A 4YXWA 4O0MA 2GXQA 4C4PA 3U6KA 3K09C 4Q00A 1XPOA 4TTRA 1GNRA 1Z3IX 2KSQA 4QBFA 3TLXA 1TL7C 3QSYA 2CXXA 1JPJA 2QQEA 2X8AA 1W5TA 4A82A 4U00A 1ZM9A 1G4AE 4M9QA 1WA5A 4KODA 2DHRA 1VDZA 1X3SA 3GJ0A 4PZZA 3SBEA 2C9YA 4JLBA 3EWAA 2VP2A 5EE5B 2FZLA 3P27A 4P4TA 4B75A 2CJWA 2V4ZA 4JIMA 3MLEA 1YR6A 4C2TA 1N6NA 5BN4A 2J0UA 4ERNA 4MRNA 3EXAA 3SYLA 1Q22A 3CRW1 3KKOA 4RCZA 1GAJA 2ZTSA 1FW6A 3CZQA 1NN5A 4DIDA 3BB4A 4X8OA 3OESA 1UKZA 3TVDA 1HH4A 4RCYA 3KJHA 3CPJB 2VF7A 4M9XA 2IS2A 1D2NA 3PEYA 2OE2A 4HB0A 1W0KA 4MKIA 1I4TD 2NO6A 2JJ8A 3CKLA 3B9PA 3TW4A 2AHOA 2WMOB 3J81k 2WKRA 2VL7A 3NHBA 1TF5A 3C14C 4ZDIA 2PMDA 3GLFB 3AUXA 3GLHB 1RZ3A 3B60A 5HZHA 3QBTA 3ZD7A 2GESA 2W6ID 1UFQA 2WICA 4RZUA 2PT5A 3OAAD 1T3HA 3FKSD 3OEHD 4HUQB 5BW8A 3AP3A 3IIJA 3A6PC 4KXFB 1LW7A 1PUJA 1U81A 4IVQA 4IW3B 4BLTA 4TSFD 4B73A 2H18A 3B6EA 1FTSA 3REFA 4RZ2A 2BKEA 4PHFA 2N42A 3PEUA 3X1YA 3GLFA 1G3UA 4IDHA 4BFUA 3LQRA 2YKGA 2ZS8A 2OAP1 2C9OA 4DBLC 1M34E 5FBRB 1PLJA 1Z0DA 1DO0A 3EA0A 1DPFA 2LKDA 1KI2A 3P32A 5C18A 1EGAA 4PANA 2CHVA 2I3BA 1AQUA 3LY5A 4NYIQ 3BD9A 2AN9A 2BMEA 1Z07A 3HU1A 4LC1A 3TRFA 4RFSA 3GQBA 4KSCA 5F9HA 3LVRE 2IYUA 3NDPA 2X77A 2NPFA 4DCVA 4CT5A 2O8DA 3W3AA 2C78A 2ECKA 2OLKA 1MO4A 1E1QD 2ZS7A 4HYYA 4L16A 4A0RA 5EXSA 1ZD9A 1NJFA 5HKKA 4NCJA 4UNRA 1VCOA 2DCUA 3QJYA 2JJ1A 1T4GA 1Q57A 3EZ7A 1WBBA 4HSEA 2O0KA 4CEJA 1H65A 2NO1A 2C77A 2I1QA 1E4YA 1NI3A 5EXPA 2IXEA 1W47A 4NONA 1XTRA 4MKFA 3OEED 1R0XA 5SZKB 1GNPA 3TGPA 3Q8XB 4DLYA 1MOZA 1XU4A 1Z5ZA 3QXXA 3TW8B 4B34A 4LV6A 1W36D 2WWWA 4KU4A 5FTNA 1Q12A 2J5XA 1GTVA 3QVVA 2F6RA 2CNWA 1ZIOA 3AKDA 4C2UA 4JL5A 3ADBA 2ZJ5A 3F5FA 4NE2A 1QHSA 2XGJA 1OXXK 4MRSA 4RKFA 1KTVA 1KJYA 5EE3A 3HJNA 4BZQA 1JNYA 2GJ9A 1YZLA 2C8VA 2P6RA 5BXQC 3LRPA 3GJXC 3L0PA 4ZO4A 2OFOA 1YVDA 4WXPA 5TY0A 3KJIA 5CITA 1KI7A 4HLQB 1R7RA 4LCBA 5LB2A 2ZJ8A 2NQ2C 2W0MA 1J8YF 3A1UA 3LXRA 4NDZA 1JI0A 1IN8A 4PC7A 1T6NA 4Q4AB 2BEJA 2QL6A 3WNDA 4KBGA 2QI9C 4JS0A 5HPYB 2DWPA 1B23P 3KJEA 1OIXA 2BBWA 3D7MA 2ZJZA 3QEOA 3SYKA 5BYKA 5TXGA 4KFUA 5JWRA 2ZAMA 2HF9A 1FX0A 1T3LA 4PTLA 2HDNB 1H8HD 1T3SA 3I73A 3KXKA 3I62A 2ZRNA 1NMYA 3U44B 3RS7A 3GFOA 2WWXA 3CF2A 2IWHA 3B1YA 3NXSA 4QGFA 3W9YA 2WTUA 3B1ZA 2QMUA 2ZE7A 2BMJA 3W34A 4EFLA 2ZM5A 4O3MA 2R6CA 2BCJQ 1LS6A 2OZEA 1ZD8A 4KFSA 3FB4A 5JJIA 4OYHA 1SVWA 4AY2A 2EWVA 4OJKA 5FR2A 3WHLA 1G3IA 4DT1B 3C5HA 1R4AA 4TL9A 5FFMA 1WB9A 2O8BB 4IVRA 1PJRA 2E9SA 1GL6A 3F0TA 1A4RA 4G3XA 4HB4A 3Q7PA 4UNSA 2QAGC 3PUVA 5HE8A 1XWIA 4Q1AA 1ZNWA 5TB5A 1W36B 2IXGA 1N5LA 3N5CA 1L7VC 1W0JD 4M9ZA 1OKKA 4D80A 3PEVA 5E7MA 1E99A 4URYR 3HYTA 4B47A 5IK2D 1W2HA 3IEVA 4OHWA 1IHUA 4DDTA 3T1TA 3KTAA 1PV4A 2JEOA 1YZQA 3FPAA 1IY1A 3QENA 1IJFA 1Z28A 1P2UA 5KSPA 3SHWA 4Z51A 3EIHA 5ELXA 5DIFA 1GIAA 4NKRA 1BH2A 1DG3A 2A5DA 2ZRFA 3G82C 2QAJA 4E09A 4F4JA 4Q9IA 2N1BA 1OFHA 3AVXA 3A1SA 4A2WA 4B3DA 1DADA 2PX3A 2ZYTX 2REOA 2BEKA 4HLCA 4KITB 3CR8A 4RY2A 4ZIRB 4DB4A 4PSVA 4YMSA 1F5NA 2ZRMA 2E87A 2IF2A 4IJMA 1IXZA 4HAZA 1NN3A 1II8B 5A5GA 4LBWA 5TMPA 1RRFA 1S8FA 2A9KA 2GVZC 2GILA 2H7VA 1JJ7A 2HLDA 4FN5A 4YLGA 5GADl 2KE5A 1OIVA 5HTKA 1U94A 3A8TA 3TSZA 4PXAA 4G1UC 4WXRA 3IQXA 2Q9AA 3QXSA 2GHIA 2DYKA 3KX2A 5GJWC 5J40A 2IYTA 1X6VA 2WOJA 2ZJYA 3S1AA 4A36A 1A5TA 4LJAA 2ANBA 5BYJA 4M22A 2IYRA 4Z1MD 3TK1A 1KDRA 1M74A 2GCPA 2LWIA 3QF4B 1CR0A 5KDDA 3QBVA 3FE2A 1SXJD 1JR3E 1PUIA 3IHLA 3QKUA 1R5OA 4S2EA 2I1VB 1W2GA 1ZD1A 1P61B 4BECA 2QRNA 1OSNA 1ELOA 1E2DA 1QDEA 1M8PA 3DKPA 2EFGA 4D81A 2OHFA 1AA9A 3NDBB 1CJTC 4L8GA 2FEMA 4A2PA 1HURA 1P60A 4V0LA 1SHZA 1HT2E 4PPGA 3B82A 3K0FB 1Z6AA 4BEJA 2XJ9A 1G1MA 2JDIA 4C0BA 2IF0A 4A4DA 2A78A 1OXSC 2HEIA 5FBWB 5TV2A 1NY6A 3W5JA 4B3FX 2XNDD 1G9XA 5IT5A 1PVOA 4A9AA 3VU9A 3GJ6A 2GK6A 1L2TA 5GJCA 3RC8A 1U0LA 3NC1C 3VQTA 1Z83A 2QG6A 2IBMA 1YRBA 3DEFA 3QKSB 1E0SA 1YKSA 3FMPB 4W5HA 2EFCB 3SJAA 1F60A 4XTCS 1A2BA 5EP3A 4ZCIA 4CF7A 1VIAA 4LBYA 3DM5A 5AR1A 2UVQA 4ZKEA 2RGNA 3T1OA 2O0JA 4P4SB 1Q1ZA 3VNVA 2B21A 3B9QA 1EESA 1XNJA 3EG5A 1CKEA 4CT4B 2VP4A 3RAPR 3RSOA 1II0A 1X86B 2WBLC 3BB1A 2RAPA 4IXMA 4ZCLA 2WJJA 5KOYA 1E0KA 3THWA 2FPMA 3WYFA 4LSGA 4CEHA 2BM1A 3FHTA 1BYIA 1KY2A 1EX6A 4K46A 1IBRA 4JL6A 1Z0IA 3K8YA 4DWJA 3GLGB 2C04A 1MO6A 1E0AA 1LY1A 2JIZD 2J46A 3U3MA 2R9VA 4LJ7A 4I1OA 5LPNA 1W5SA 2GRJA 3E70C 5G40A 3TAHA 1CU1A 4HAYA 1NL3A 3RNLA 2R6GA 3D8BA 4QHSA 3KXIA 1KGDA 3PUZA 4HATA 2NPIA 3ZGXA 2NTYC 2G0NA 2V6IA 2FFBA 2R2AA 3QF4A 5FOWA 4MYTA 3NHAA 5JS8A 5FBQB 1RW4A 5KSYA 1KK1A 3SHFA 1EFRA 5CM9C 3LAWA 3QEJA 1E2QA 4LDJA 1RRPA 821PA 4P4UA 1G8YA 1OKKD 1W49A 4LYHA 3ZDQA 2YWEA 4DJTA 5LD2B 3A1TA 1AGRA 3K0EA 4OQNA 2HJVA 1VECA 3QF7A 2ZAOA 1Z8FA 4XH9B 3KTAB
chains in the Genus database with same CATH superfamily
1DDOA 4YAIA 3PF9A 2EAUA 2B7LA 5CXQA 1G5TA 3OT4A 1O94C 1P9RA 1HTWA 4R8RA 3K8QA 1EMDA 4GLFA 2COEA 5EIBD 5AW9A 3U49A 3CN7A 1OXUA 5DGIA 3CNQS 2WSIA 1UEJA 1LPBB 3AYXB 4OHVA 3VUEA 2V3CC 4PHCA 4S1TA 1TEXA 1TZBA 2ZRHA 4JZKA 5JSZB 2QN7A 2NXWA 3H2GA 3K15A 4DR7B 4MR7A 4O1MA 5GY7A 3UOGA 5HWSA 2E6UX 1XRPA 2H3HA 2Y05A 3KDAA 1BCSA 1SVNA 3HB0A 4GEKA 4IOJA 3NHLA 3CYFA 3IMCA 1CR1A 4N65A 4DIEA 4EY6A 1ZVJA 4Q39A 4BMVA 4J2TA 1LXCA 4RH3A 4DLWA 1TF2A 4TXNA 1JU4A 2V0CA 1QQ6A 1P3JA 2XMGA 1QHHA 3GPBA 3O2NA 4M0UA 4R9UC 3PUXA 3HCBA 1QPBA 3ZXIA 3FOFC 4DV5B 4H7KA 1XYYA 4IAOA 1ZGCA 2GAJA 2PRKA 1OWLA 3JATA 4BLSA 5HILA 4BWVA 4HN9A 3ZI7A 1T4CB 2O06A 1PQUA 2PXXA 4PFJA 4QQRA 3E2MA 5DIZA 3M4ZA 3OFSA 1MZVA 4WY8A 3ILSA 1JHPA 3M6WA 2VHWA 4FHDA 5EFZA 3TQOA 3QWIA 2HSJA 1CX9B 2Q5OA 1MW9X 2QMEA 4EG1A 1KETA 3DULA 4MVJP 2HSEA 3BEOA 2FZGA 3BH7A 3E1SA 4EKIA 5H68A 1A77A 4QQNA 3THYA 3PJFA 5FA6A 3RVMA 2EF1A 3ZDAA 1EG7A 4N5LA 4HDNA 5I51A 3RYCB 2I2XB 3HCWA 2BMAA 4Y1EA 2G8NA 3MWEB 3N0XA 3VR2A 2CYBA 1NNI1 2YXNA 1RSZA 3ITNA 5FEUA 3BRWA 4TMXA 5KNDA 3RD5A 4INAA 1VJDA 2NSLA 2XQJA 1P80A 2C57A 1IN6A 1AKRA 1SAYA 2DWOA 1YFLA 1E7MA 2V7PA 2WD9A 2YASA 1FZQA 4BV8A 3PFNA 1TZCA 1E1QA 2F1IA 1N36B 3CV3A 4HBZA 4A8JC 1UMKA 1RPNA 1X7ZA 4B43A 3C1TA 3AVWA 3T7TA 1C0EA 1P9OA 4H59A 2ZJ1A 3BFVA 3VO9A 1JQKA 4YEDA 2BONA 3VJLA 1Y4SA 3LBFA 5IJAA 2PQ0A 5B2FA 4GWLA 1PWYE 1G291 4QUAA 4YDSA 5C5EA 5E6SA 5MGBA 1GAEO 5AK6A 3VR1A 2AOUB 1QKJA 1O94D 1Y9ZA 5F3RA 4DXAA 4HAOA 3G5MA 3MMZA 5CB6A 4V1CI 4ND8A 3OJEA 1J9GA 1CXZA 2Y1CA 1BD3A 3NDRA 4MMXB 4QUIA 3PVZA 4TMFA 1T2CA 5TVGA 1JH8A 2A9OA 4ILKA 4ZICA 3NHJA 4WY5A 4FYIA 1OY1A 2YZKA 1MV8A 4TN1A 3ZBUA 1QDLB 3ZVMA 4B3CA 1XRQA 2IUSA 1L4GA 1TCBA 2Y92A 3B8EA 3NOQA 3V46A 3VOBA 4EUSA 4A15A 3NOVA 4RDCA 5BWBA 1A9YA 1BGVA 4ZZ1A 1SUEA 1Q7GA 2FSIA 4E4RA 4Z1OA 4O2LA 4W7SA 2G88A 5KBYA 4CEHB 2G5GX 3CF4G 3RS4A 2HTFA 2D6FA 3QMVA 4K6GA 3Q3GE 3PDWA 5A4IS 3FPGA 1RAIA 4BBPA 3IIIA 5LA6F 3P9PA 4CNBA 4EPXA 5KYNA 4D25A 1KI1A 4CBVA 1FNSA 4AG3A 1VBFA 4RQTA 1GZ4A 5AJHA 1FYXA 1DAHA 3OZTA 3B5IA 3WGMA 1LPAB 1XLTA 2J0UB 2J41A 3KZOA 4J0CA 4MIKA 1Z6QA 4JYMA 3FROA 1DC5A 1TT7A 4HFRA 4LMBA 3GUHA 3B48A 3A36A 4C87A 1LNZA 4UVDA 3OZSA 4C4XA 3KR1A 4P3XA 2J5KA 5LBIA 3DB2A 1MF7A 1UQRA 2VDRB 4RJKA 1EKXA 4Z1MA 3RWOA 4FE3A 1U65A 4EGQA 1Q21A 5CFLA 3HACA 4DMRA 2GA9A 4RD0A 3SE0A 5FPPA 2OVFA 3HUTA 1SXPA 4EPWA 2J09A 4L22A 1S2OA 2VHQA 4RKQA 5HFNA 3UCEA 5KYXB 3CNNA 4A0HA 1LB1B 5AI5A 1G1AA 5TGTA 4GOLD 1DWPA 1S02A 1W35A 4IR7A 4HFNA 4BZPA 5JDIA 1K7FB 2VDWA 1ZCAA 1F48A 2VSOA 1P75A 1MA0A 3IA2A 3ESZA 3IERA 3OZ7A 4IMRA 4X1YA 3TO5A 2V4MA 3OA2A 1NVGA 3G5AA 4F9TA 4KFCA 2QMYA 2XUGA 3EC1A 2QTNA 2Z6VA 2G17A 2WJZB 2I6TA 4PG7A 4RVNA 1PNRA 2CMHA 2G7ZA 4NIMA 1Q0HA 2C8JA 2D5CA 2FQQA 1T1EA 2UV8A 2JHCA 3WADA 1PT9A 1Q15A 4X1IB 5KYXA 2P67A 3D3NA 5HKBA 1QQ7A 2GBIA 4REOA 3OPYB 1YS1X 3I04A 2E5WA 4HLUC 3EIWA 4NZZA 2EW1A 2H7CA 4KR6A 1BKDR 2ZJOA 1EFVA 1KO7A 3ROKA 4ENRA 2QS9A 2XYHA 1RWXA 1NBAA 3DEJA 3ESYA 4BCBA 1NVVQ 1Y8QB 2RB5A 3UMMA 1HWYA 5GJVC 5L3QB 2IJGX 1VSUA 1D1SA 3IBGA 4FTWA 4NG5A 4CKYA 1HZJA 1XD8A 3IEKA 4N8SA 4D9CA 1Y5NA 3BK7A 1YB4A 2UAGA 4OHBA 2X13A 3HP7A 1OT5A 2I2AA 5T4BA 1Q1QA 1GUFA 1TO6A 3KYJB 3PYLA 1HEYA 1ODSA 4J43A 3HVJA 4JYPA 4ZI5A 2BGTA 1AK9A 4RM2A 1SXJE 1JKIA 1EAYA 3DV9A 1OLUB 2EHDA 1PEKE 3MJEA 1FK8A 1LKZA 4WK0B 3CA8A 4IQ8A 4Z4IA 2Y1EA 3OIVA 3AKYA 4JQSA 4Q9JA 2PLAA 1W85B 4K6KA 1TYCA 3H3FA 3L8MA 5CX1A 1YOVA 1KPHA 2BUCA 1DTWB 3M34A 1YZHA 2KX7A 1QFZA 2EARA 2OKGA 2OLJA 1RIIA 2QXTA 2ZYSA 4L15A 4WK6A 5E1BA 5A6VA 1Q83A 1ULBA 5IM4F 1GAQA 2PBLA 1B6RA 1GJRA 1YB7A 4DBZA 4XVRA 2BMFA 5CBPB 3N5KA 1VYUA 3UTDA 1CIVA 3FVRA 4FFRA 4Z9AA 2PFGA 3SSNA 5TIIA 1R6BX 5IJWA 2WU1A 3P9YA 5EJ4A 2ZYUX 4PCLA 2DFLA 1W25A 4WKGA 5LQNA 4TXMA 4TQGA 5JJLA 4C78A 2X0KA 3ORHA 3RRFA 3IAUA 2FW1A 2PUHA 3T06B 3F9IA 2V74B 4F6LA 4GXQA 4E08A 3PQEA 5I9TA 3HO1A 2FN8A 2CLSA 3B53X 1SHLA 2CLIB 3KSDO 3ELYA 3WGQA 2BTQB 4BMCA 1CS4C 1H8EA 5HR5A 3V1KA 4KPYA 1OB2A 2Q6VA 4RZ3A 1K7EB 5CFQA 4GUDA 1RZRD 2Q29A 3JPWA 4EJSB 2FV8A 1FP6A 2QTCA 4L2IB 3WY9A 4JX8A 1CV2A 2GHRA 4DUGA 2VDLB 1M0EA 1OX5A 1VIVA 3VKGA 1XD2B 2X0EA 3PXUA 4LDQA 5C53B 4IDQA 4H16A 4I55B 4K9PA 1DPGA 2C5SA 4EHAA 3KT3A 4MRRA 4X7BA 3HJFA 2R7MA 1NWCA 2BCGY 4Y0NA 3ROFA 3U3DA 1NNUA 1OX4A 2OUKA 3FKQA 4K9DA 2EFEB 2V03A 4X3PA 3DHYA 4EYSA 3E22B 2ACEA 3E9YA 1Q3TA 1PJLA 1TAQA 2WPDD 2UZIR 2C98A 3QPCA 4AO8A 5KTOA 2R0QC 1W88B 3LCMA 2XNHA 3R9IA 2F1JA 2EVWX 3PD7A 3H65A 1TFUA 4UULA 2ZUUA 3MHPA 1WXDA 3BE4A 4QVKA 4X54A 2G25A 4FFMA 2QM8A 3MD0A 5JH7B 3H9GA 4G1BA 3OQMA 1X87A 4I7EA 1DRJA 1EP2B 5K3EA 3EGXA 3V1YA 2I76A 2WRZA 1XTKA 6ABPA 4J9UE 4WKBA 4JGIA 4KWEA 1NOJA 3UMSA 2HF7A 2NQTA 3RYHA 1CZKA 3SYMA 3WFZA 4DPLA 4I9GA 3CX8A 4UMDA 3AIOA 4GBGA 1YZYA 2P65A 3Q41A 3PLAE 4OLAA 1Y6ZA 3D4OA 3B1VA 4W1RA 5B6PA 2I7DA 1FMLA 5TMEA 3LUHA 4KR0A 3GAFA 4Q4JA 2YICA 4WCVA 5AUPB 1QE3A 3RUEA 4FYWA 3PFHA 1F2UA 3BK1A 1SEPA 1DSSG 3D8HA 3H17A 2G4LA 4Q05A 3LO8A 2DE0X 4OQZA 3TLGA 1OE0A 4QOSA 2NU6A 1N4DA 1RAGA 3INRA 4R2MA 2AD1A 4MI9A 5FUMA 1E9RA 2VFAA 1T10A 2FK7A 1WNTA 3B6KA 5EZ6B 3H87A 2YFYA 4MQEA 4I8IA 1X1BA 3DOJA 4FMDF 4BU1A 3SLRA 4V1CB 4PU0A 4IXWA 4IDAA 1KARA 4L4YA 4LDPA 4G24A 4BXOB 1UMBB 3KQKA 3S29A 1S4QA 3EOBI 3LKBA 4LHYA 4F4IA 1MV5A 3QITA 3BC1A 3AHDA 3LFTA 2O1EA 2ZI4A 3RSLA 1NXVA 1GR1A 3L93A 1H0HA 2I4TA 3TZHA 1GDDA 2Q6KA 1PG5A 1CTQA 4JGBA 1P2VA 3NATA 4BO1A 3RAEC 2V0NA 3KAKA 4DJFC 3GEGA 3WJ7A 1E2GA 2YHBA 2VSXA 2B0JA 2PO7A 5KSWB 4UHDA 2CFTA 3BMQB 3FVWA 4YIKA 4X41A 3IT3A 4I19A 2OWDA 4GZ6A 3OZCA 3DL2A 2HRQA 3ERCA 4R2KA 4MDYA 3B78A 3G2OA 4PHTA 3OZFA 4BFZA 1KZ1A 2XI4A 2OT3B 3IBTA 2QD4A 3L8YA 3GBSA 3SSOA 4MCIA 1PR1A 4KMRA 2AF3C 3FPSA 2C7VA 3KM0A 3IQWA 2QMQA 2G4CA 2GNOA 2VBFA 3PDHA 5L3QA 1KK3A 1VCHA 1CNFA 4ENQA 4DLXA 1O6GA 1ISRA 1QHFA 1U8AA 3LXUX 1AV7A 2VF4X 1IQUA 4IDDA 4ND6A 1B3BA 4RJJA 3FOCA 4WZ6A 2ARKA 1AKMA 3RRBA 3GOQA 3V4PB 5IPFA 4DJDC 1AOXA 1W0KD 4LJ8A 2W98A 3L1JA 3DB1A 3USES 3VR5A 4EATA 2WNIA 2ZCVA 4PSCA 2YNMC 4RMIA 3C7DB 2FWAA 2QL7A 4GC9A 1OGYA 1TGVA 4MQ6A 1YRQA 3B1FA 4DMHA 4MGIR 1GARA 5A3JA 2IW1A 3WGYA 1PWZA 1ECLA 5A0VA 5F7ZA 3F5SA 3VV2A 4XZ3A 4E7OA 4R1MA 2RGRA 2WG0A 1RMTA 4I55A 3TQTA 5FPTA 3HA5A 1E0JA 1JZSA 3EK2A 1XVLA 1RLUA 3BDVA 1QZUA 3PSHA 1ISGA 3QVSA 4EUFA 1XQWA 3OA0A 4KHZA 2QLMA 4JC5A 3FGOA 4IHKA 3TZ6A 1LK0A 3JALA 5GTDA 2XMSA 3QKSA 3KQWA 3B6JA 4G0NA 4M49A 1FMTA 1E69A 3NTRA 4INPA 4U6SA 5GWXA 4ZI7F 4PRZA 4KBYA 4YLYA 1QQTA 3UMYA 1QR6A 3SD7A 2BZ0A 3V7WA 5B7QA 1W4ZA 4CDRA 2Q9CA 1LUAA 3CM0A 3K0BA 3OE5A 4L3VA 5K3CA 3RI3A 2GM3A 4X6YA 2UVDA 3ENNA 1NF2A 1ZK0A 2HHJA 2P9CA 3PQFA 1XCJA 1R6XA 2JATA 2YRFA 4GI7A 4P4SA 5EXTA 4XUCA 1IFXA 4PC6A 2G9NA 2AW5A 3PA8A 1M2EA 1CY1A 1ICEA 1HQCA 1ECGA 3JZIA 4JL8A 5DISB 4ARVA 3ZW8A 1N8KA 3L05A 2W2NA 3ETNA 3CC8A 4EGCB 5LXTB 1Y1SA 2V7VA 1O08A 3TSCA 4EX6A 3RB8A 1KH2A 4DA7A 2HNAA 2PIDA 4LKRA 4RA6A 4Y2UA 3TAUA 3VBEA 4TUYA 3UENA 1B73A 3KPWA 2X4LA 3PFIA 3ZE7A 5FDFA 1R4MA 1Q92A 5K6RA 1QGUA 3LUCA 2WSLA 2CJPA 4A8PA 4JWKA 3COYA 1P7CA 4NYMQ 3G1UA 4JI5B 4M98A 5KVSA 4CG0A 1OAKA 1E5DA 5UKDA 1SIOA 3EPPA 1AZTA 4FINA 4AWBA 1N8NA 1VCNA 2PHZA 5E9AA 3ZR4B 3VSDA 3ZDXB 2RJ3A 4D4HA 4UZSA 5K3FA 1OB5A 4XVCA 5FV7A 3NGLA 1OIWA 3G8CA 4LYGA 2M2IA 2R7AA 3UJ8A 4BNZA 4EY3A 1UP7A 3HCEA 3CZ4A 1WUIS 3ZE0B 1YVRA 1NVWQ 2K5UA 2RHGB 3H9BA 4XUDA 3WWDA 5K0FA 1QCCA 3EXIA 3JQRA 4YR9A 4P7BA 4EVRA 2IYQA 1DJPA 4HNSA 2DJIA 2H2FA 3HXOA 3D6TB 1QUFA 2H1IA 3H42B 1ZI9A 3ZWXA 3L1VA 5FBKA 2QQGA 3CUSA 5GGXA 5EMHA 3WC4A 4BX2A 3R0IA 4B9EA 3H2YA 4TXLA 2D7DA 4N47A 4RXMA 2XCQA 1TGYA 2X6QA 4GE3A 3EEIA 3KR2A 4BFWA 3RANA 2FMIA 3LHDA 3MZ0A 1MPXA 1XNQB 1G8SA 3PR2B 2UZ0A 4K81B 3UK1A 1P9WA 1PHPA 1DGQA 5F35A 3F47A 1GVHA 2YWFA 4J0HA 3LX6A 2WJYA 4RM3A 1NYQA 2C0QA 5AIAA 2AYYA 3KPUA 2B25A 1WQ1R 3F6BX 2R97A 4N41A 4I1SA 5HM6A 1XYGA 5FYDA 1X1RA 5EIBC 5KWVA 2ZXUA 4MWDA 5JD4A 1JB9A 2ODPA 4KOEC 1FUIA 2PL3A 1U3TA 3IV9A 3I2IA 1RKQA 4HDCA 3VU9B 3PUKA 3C6YA 3FWHA 3LZDA 1IEQA 1OLOA 4HNRA 3LFUA 1U1EA 3DEKA 1RCTE 3LS2A 3C3AA 4X20B 5J5CA 5CB4B 5KQSA 1KQFA 4RKYA 4Y2TA 3V2IA 4E5NA 5B4VA 4G0OA 2W2MA 2I5PO 4ROTA 4HNVA 1JU3A 4F93B 1P0CA 5REQA 1FOEB 2P41A 2VTKA 3DXYA 3DOUA 1KEEA 1H3EA 3Q3VA 3T12A 3UGKA 2HIAA 3QTLA 1QYXA 3KP1A 2ZTVA 1TKBA 1V3QE 2WMNB 4FEEA 4Y6GB 5DNDA 4AECA 6PFKA 4FILA 1JTFA 2Q07A 1XL0A 2QZPA 2AFRA 3TMAA 2E3JA 4E5DA 2R8BA 3HM2A 3RROA 3DMHA 1SU8A 1AZSC 1NBMA 3FGNA 4ZJUA 4IJQA 5AKGA 3CXRA 1XR3A 5LP6A 1PZMA 5DK6A 1JA9A 4XM0A 1TPZA 1UBHS 3ACBA 4II7A 1Q7RA 1HFJA 3MHTA 1FLVA 1TYDE 4JEUA 5FOXA 4ZOAA 3SDSA 4BMDA 4OMCA 5L6MB 3GUZA 1UFRA 3N87A 5CA1B 1F8UA 1JECA 3FUTA 4JCOA 2H4FA 1THGA 1UZUA 1D04A 3IB6A 1PJAA 1Z5OA 3OHMA 4RJTA 5BNTA 2EGHA 4I66A 3A4VA 4OSOA 3FWKA 1I3OA 3IIEA 3LWNA 1LLFA 3RBZA 2ZIAA 3RIHA 2VHJA 1K7YA 4EMUA 4ZKDA 1V8ZA 2F43A 2GVNA 2IZOA 2O3QA 3GMDA 4LRSB 5C8XA 2JH8A 3ZCUA 4RTRA 1I01A 2HFJA 2HBZA 2Q2QA 4E5MA 1EX1A 5C1DA 3VOAA 2LVBA 1VYTA 4QDUA 5K05A 4C7OB 3EB9A 3NJ4A 4RIIA 1XPUA 2P7HA 2Z3WA 2J4CA 5REQB 1MH9A 4H6PA 3PGA1 5KNDD 5JJKA 3IJRA 4WK4B 3VAYA 3PL1A 3D31A 2LP4Y 3DKKA 3WQRA 3HC7A 4Q4AA 1AO3A 5KNDH 4HB3A 3PA6A 1O1YA 1N5DA 1WUJS 3TZCA 2ZYIA 4IUCS 3VDNB 2MYPA 1PZHA 3HA7A 5TMDA 5HS4A 4WRRA 4QHYA 3PQ8A 3U31A 4DR6B 1QDUA 2A57A 2ATVA 3IODA 3OPVA 4Y2YA 1G38A 2QIPA 4MYSA 3C8HA 1RWWA 3I6ZA 1ODLA 4JP3A 3FTQA 4K1XA 3VU3A 4ZOQI 4BPBA 1G16A 1ZX1A 4JELA 3P0JA 1TLTA 1P7VA 2O2HA 4Y8VA 4A1FA 4IGKA 4A6DA 5TGDA 4BNWA 5CLJA 4RVCA 1M83A 3N70A 3QVWA 3R7LA 3UOWA 4EPYA 2ZSDA 2IT1A 1TM5E 4J8PA 4PFQA 4LF7B 4ZOLA 1H8ED 1G7CA 4JXKA 5DHQA 4ZK2A 1FTNA 5FUWA 4A23A 5LNK6 3FFWA 5CK5A 1QZTA 2JZNA 4UXJA 4OOEA 3VR4H 5IKPA 1XMSA 3PKIA 3AI3A 4KMSA 1P91A 3FUWA 4WEQA 1GZ7A 1S2LA 2X8JA 5KVVA 3QFRA 3PE3A 2IHYA 2ACVA 2WSYB 4K6MA 1JH9A 4RSGA 1KC3A 5K0ZA 3EZ2A 1M73E 4HDKB 1PWXA 3G8BA 3LJKA 4E7PA 2WE7A 1X7XA 3NV7A 2QTHA 1A97A 2ZOSA 1XC7A 1H5UA 1PR6A 4RABA 5EYPA 1P5ZB 1U1GA 2O2SA 2ZT6A 1CJMA 4TMVA 2VUHB 1B0UA 1MJNA 1W44A 1MG5A 3IA7A 1I6MA 5FPQA 2MINA 1Z4MA 2PYIA 2ZBGA 1OFVA 2YMLA 2JC3A 3GQVA 4LHWA 3X44A 5ALSA 1DAMA 2XTZA 5I7UA 1OYYA 4R4JA 5BVGA 3TUIC 2BFCB 2YXBA 4KDRA 5C4IA 3EBLA 3BMNB 1C29B 3OC0A 3QEKA 1TADA 2BSXA 4X6LA 4OFWA 4NPHA 1L5WA 3T5MA 2NV0A 2B34A 2XE6A 4KTVE 3DEHA 1RU3A 2EQ5A 1KAQA 2Z5GA 3GUUA 5JHGB 4F8YA 1VGRA 4XCXA 4AS1A 3W77A 2O57A 4MYCA 5I9MA 1ZL2A 2YVKA 1I7PA 3MCZA 1R8QA 1WXQA 2NSJA 3P9XA 3R7NA 1LDNA 10MHA 4BMXA 5TF4A 2ZSUA 3K0FA 5HUQA 4YJHB 1N2CA 3OLZA 2QR5A 3K1AA 4QO7A 3ZXXA 5M7EA 2HWKA 5CH3A 5I9LA 4QU8A 5TSDA 1VIYA 2ZBFA 3Q3CA 3WX0A 3TZEA 3V8MA 1DWUA 3VJRA 2AN5A 3W5VA 2DY0A 4I99A 4C30A 4P3OA 2CD9A 3PX2A 4MH0R 5K2MA 3UANA 3ROTA 4EL5A 3KKNA 5E4FA 4BX0A 3JR7A 5IKMA 3ME5A 3IAAA 2BR5A 1EE9A 2Z95A 3OD5A 4ERXA 3HCRA 1H2YA 3OQJA 2JFNA 3I39X 4LJ6A 3NOXA 2OV2A 3TN7A 2PLWA 3MOSA 4A2QA 2Z9BA 4HEJA 5A9SB 4NESA 3T3OA 1Z2DA 2B8EA 5DXAA 2H2AA 1DMSA 4L1KA 2HA5A 4I3GA 1DEXA 1YUBA 5BSUA 5IFLA 2WAMA 2RAUA 4MS4B 3K8OE 5LZ7A 1UMDB 1WZIA 2OKCA 2Z5LA 4AMBA 4B48A 3NANA 4YP1A 5C7LO 2CJWB 3R4CA 4F2PA 2YVUA 2ERCA 4TS4A 1A9XA 5KO2A 4UZFA 1NDHA 4R3WA 5EZYB 3ZEAA 3TZBA 3RAGA 1XTSA 4M0EA 2ZIGA 3GWGA 3RYFB 1GCOA 4MI6A 1G5RA 3W7AA 1SQ5A 3ZWMA 4EKDA 4NCHA 3WDSA 1M1YE 3OF5A 3PC6A 1N5JA 4LFAB 2QBYB 4MAAA 4LQDA 1PX2A 2ZVDA 4DBLE 4DLBA 3ODPA 5HX7A 5KX5A 3ZTTA 3P2EA 2APJA 5DH9A 4CQLB 1U2QA 1AKEA 2IOFK 2J9RA 2BD0A 4ZOBA 3D3QA 4ZQBA 1NRXA 1UBLS 3PE4A 4PG8A 1CEXA 1YB2A 4P6VF 3A6KA 4M1SA 4QFDA 2YWGA 2BTEA 1GV0A 3DYBA 1LSOA 1QONA 1SK8A 3K0CA 3S8EA 4LBZA 1O0CA 4MUEA 5E6RB 1K6IA 3C3YA 4D42A 5HQJA 1WPXA 4YBZA 1JXMA 2VI5A 3HCFA 1DNPA 3QY0A 3UMBA 2CE2X 3EQZA 4GMFA 1J0AA 1LC3A 2B1QA 1R16A 3RU2A 2C20A 1NC1A 4J0EA 3LWZA 4HTFA 1JG4A 2DB3A 3WAGA 1ZM7A 1H1LB 2ZCUA 3K9LA 4I1VA 4QO8A 1RXIA 1U2EA 2IGTA 2D13A 2G1UA 1T9HA 3AIIA 3L7LA 5IM5A 4K6OA 4ZARA 5F33A 3I72A 5DBHX 1JLLB 4Z99A 4YP7A 5LP6C 1F12A 3WP0A 1XD9A 1XHFA 4R8LA 5G41A 3RS9A 3WLFA 5B55A 2DPHA 4XTRA 4EELA 2P91A 1K8RA 3C5CA 4AG5A 3ZV5A 1EWQA 2WDZA 3JASA 1IDOA 5IUJC 3SZLA 5JSZA 3BE8A 4GQBA 3HYNA 2RKWA 2UZ3A 2VUIB 1KEVA 3DZCA 3FCEA 3H5TA 5FX2A 4H7EA 3TG8A 2VNIA 1JA0A 4CR6A 3O31A 1ZD5A 5J63A 3BIOA 1CRQA 1KI6B 3ORFA 3C24A 1RRGA 1CS0B 4YO7A 4QUJA 1AKTA 4OHUA 1PJZA 1XX6A 2X8JB 1FY2A 2VNKA 5DHSA 1SA0B 3EAQA 3VH1A 4URFA 3BN3A 3L0OA 2D4AA 5KTRA 2FFAA 4UJ3A 1P0IA 1VJ0A 3WK8A 5DBOA 1ULZA 3UXMA 1O9BA 1IXRC 2OTCA 1GGNA 5DP1A 4BNKA 1CF2O 3H3XA 4J4BA 3RYIA 2FOIA 4TL8A 3K9FC 2IHJA 3ZJYA 5C1OA 5CB4A 1RM0A 5DNYB 1RHUA 1NMSA 3EZ9A 1T24A 1SULA 1T91A 5ALVA 2DQKA 1EXDA 2RJNA 3PIDA 5BORA 1RXYA 5EJAA 5JBNA 5DHTA 2PR7A 3HGQA 2QTZA 2V7UA 1ODIA 2Q0XA 5LN1A 4J6FA 3GJSA 4Q3OA 2A1UB 2H2IA 3FHOA 5KJEA 1CJCA 3EF0A 1KY3A 5FPYA 2LDXA 1SC4A 1FFEA 1OWMA 3EY9A 2O50A 3IHTA 4N8DA 5FP0A 3T1VA 3V4ZA 3AVTA 4MGEA 3ZHVA 2HV8A 3GLVA 4ESOA 3JQ7A 5AHKA 1RLIA 2XH8A 1AE1A 3C97A 1Y1LA 1E32A 4RPCA 1JN0A 2XVYA 5E4JA 5KYKA 2VTBA 2ZI7A 4IV8A 1O5TA 3CO5A 5K45A 5TEWA 1FTYA 4I5DA 3GGOA 4K2AA 1QK4A 3LC1O 2VS1A 4NV3A 4TRMA 4RVSA 1JHAA 3Q7QA 1QB7A 1AG9A 4AP6A 1GNQA 3EULA 4JB0A 1GNVA 3ZDFA 6AT1A 1ADCA 4DLUA 1K97A 2A1IA 2VXYA 3AEQB 3ASZA 1XK6A 3NHYA 1DXOA 3CF0A 4AJLA 4BQIA 3P19A 1X9IA 2ZZNA 4F12A 4D6YA 2ZB7A 4LVUA 3T7SA 4AZSA 1DV2A 4D2IA 4EI8A 5JAOA 4HNAA 3NVAA 4HLDA 1LFDB 3IAXA 3KKQA 3IQIX 4EMTA 2W6PA 3F6PA 1KAEA 4IIDA 2OLEA 4LW8A 2XV1A 3BKXA 3HR7A 4JJFA 1GCUA 1N6PA 2A5LA 2E4XA 2XEDA 2VF8A 3PV0A 4M6WA 2C9ZA 1ORIA 1BZYA 1V16B 3H2SA 3WRVA 2VPQA 4D8TA 621PA 2M1ZA 2EIXA 3CZ9A 2NUTA 2C5GA 1ZH4A 4JASB 2IQ5A 1OA1A 5I9SA 3VZQA 3U60B 3NALA 4Z0TA 1SVOA 4OKNA 4M0PA 2X5XA 4YJ3B 5HF8A 1WVIA 1UBTS 2K2WA 4GDMA 4W8GA 1MX5A 1AGXA 4TUYB 2Q99A 5DWVA 1E1DA 2FVXA 2R86A 1NONA 4ARZA 1JDBB 2PUWA 4CN8A 1ZHOA 6CHYA 1JIUA 1PEDA 1I3KA 3F7NA 4PSKA 3IBSA 3WRXC 3TYXA 4O33A 5JI3E 1ODCA 1AMNA 3LPMA 3TIFA 2NM0A 3A1EA 3KAJA 3KUUA 1BD4A 1UJNA 3H1FA 3L6UA 2VZ0A 1UFVA 4PZLA 4RPHA 3OQHA 5ESRA 1DQYA 3R8CA 2AZDA 2Q8QA 3RW9A 5KSZA 4Q3BA 1O77A 2ZIEA 4X9XA 5E4TA 4Z7QB 2E4WA 3HFRA 4TL6A 3ST7A 3U3RA 2ETVA 2PEZA 4JVSB 3S2IA 1E98A 4K3VA 4E4YA 3BPSA 1O57A 1P1BA 2BFMA 2NZXA 3CTPA 4CR7A 3GLIE 2QTBA 3S5UA 1F8XA 1U6IA 3BVPA 3JWGA 3MRXA 1XMPA 3QOXA 3B52X 3LK6A 5EMKA 4O2AA 4MV9A 3FOEC 1I4WA 3OE7D 4AN1A 4MV7A 2VNAA 4QYMA 2A7QA 5AJXA 5FTJA 3M2TA 3UV7A 4U9UA 3VUFA 2VYCA 3W79A 4JSRA 2ZRQA 3GDHA 3GJQA 4UHJA 1NMEA 1JSCA 1P9LA 1UKBA 1RVDA 3OIUA 4F56A 5B30A 5JPDA 4DV6B 3PKJA 2R8ZA 1MORA 2J3JA 4QJBA 2A5YB 2HQBA 3R7DA 3LT2A 4CG2A 4LMPA 4O2BF 3A1NA 2VHYA 4UMVA 3Q72A 5F23A 3PZBA 1M1NB 2Q49A 2RIPA 1X8JA 3KE8A 4YJ2B 4BO5A 2Q3CA 5PNTA 2VYVD 2F3PA 3BCSA 4YCAA 4UQLA 2O54A 3DV0B 3MG9A 1YHNA 2O2XA 1T5BA 4M3NA 3F6RA 3BGDA 3HCOA 4UU0A 4BJHB 4K87A 2YC4C 1EFPA 1FNDA 1CK4A 3SEQA 1WP4A 3ZWPA 3FHJA 5CPBA 3HJBA 1QRUA 3ELWA 3BCHA 2C4NA 4GX2A 3P52A 1FUUA 3BJIC 4TOIA 2XVZA 4R71A 5CAEA 5GZ1A 1A7UA 1E4VA 3SQDA 2PUBA 3H11A 4Q48A 5GZ6A 3CX7A 1DKLA 2AG0A 1WSAA 1K63A 2BDTA 1QX4A 1G5FA 2DQSA 4KXQA 4TSRA 1OGIA 5C32A 2GA8A 3WIEA 2IY8A 5EZQA 2QM7A 3QPWA 2XWJI 4F60A 2OMEA 5FBHA 1T8SA 1I14A 1JQJC 1G8KA 2B8NA 4RV9A 3JQEA 2VDKB 5MDHA 1P62B 4AJIA 5EHGA 5DCUA 3OKPA 3W2HA 1KO8A 2OEPA 5L3VA 3KO8A 1FNCA 3OZEA 3AR8A 3KJXA 5CU7A 1LZKA 4ZXPA 1ZINA 4D99A 5LXTA 4DJ5X 3W5HA 5B7PA 4HVCA 5G0VA 3RARA 3RVLA 4DN6A 1IH8A 4WNAA 2DHEA 1L8QA 4M38A 2AE1A 1IY9A 3OZXA 3RSZA 5L40A 1W34A 2G1AA 2VEOA 3AEQA 1TD9A 3MOIA 4CQJA 3ER9A 1LFAA 1N0UA 4RD4A 4W5JA 1R9JA 2PQMA 4QECA 5DRTA 1FRQA 3WI7A 4ARSA 2PUTA 2WSSA 3BRQA 1HT3A 4MVJG 3O8RA 4KDCA 4B4OA 3K4PA 3PNLA 4CV1A 1NVFA 3HBMA 4O4JA 2GPBA 3NH9A 3S2SA 2NTEA 5INTA 1Z5PA 1X15A 4KPUA 4QYTA 4G85A 3I5YA 2DHCA 1ZGJA 1HDGO 2XCRB 3N6RA 1LWOA 4CGYA 1CUUA 5E2BA 4RTPA 3RYHB 1Z45A 4Q1BA 5F3WB 4AL4A 3TM4A 4DYHA 2BT4A 3D5TA 2H1HA 3TQHA 4YIHA 4OU5A 5IF9A 1KVRA 1M1YB 2I6FA 1E1MA 2C2HA 1EFHA 3Q88A 3Q3HA 5T4HA 1I4LD 2XWQA 3AT1A 3CKYA 4AWXA 4LZNA 1YQTA 5JH7A 4FM9A 1BS1A 4FQ5A 4L4ZA 4JHXA 3HV0A 2J4FA 4E07A 4FGUA 4ETWA 721PA 4OLJA 1UOOA 2ZSHA 2P7IA 2XD9A 3GDOA 1RRCA 3AG6A 5KCZA 1AF7A 5HNKA 4LOKA 1A1SA 4O5AA 5DWQA 4R9VA 1U5BA 1DOHA 2R5FA 3W7BA 4LK2A 2ID7A 1SOAA 4LA4A 3N59A 2C94A 4RHFA 1VG0B 3ZS9A 3EPKA 1V3UA 2B99A 3BZBA 1Y42X 1D5CA 2JFGA 4TTPA 3DNFA 1XLWA 5JLAA 2ZB2A 1YQWA 1KKUA 3JQCA 3WJAA 3ZWWA 3QVLA 4U0KA 2XA1A 4RKEA 3FRJA 4WBXC 3NIWA 4JJ6A 5D3ZA 5FO1A 5CA0F 4OUDA 2LDBA 2XSZD 5M34A 4R7ZA 4FR5A 3L7CA 4FGKA 6NULA 3LBAA 4IEIA 1VKNA 5BYBA 3JQBA 3GLTA 1XEXA 2ODBA 2PD3A 3HBNA 4ZRNA 4F4UA 2A0UA 2W93A 3HV2A 3LYAA 4ASUA 4NH0A 2HJSA 4FC7A 4ZCQA 2ON6A 1N9KA 1Y89A 3N0WA 1TM1E 1XJCA 2VYVA 1H2RS 1IVYA 4PXYA 1TQ4A 5TVKA 3SG0A 5JOQA 1V6SA 4EF5A 3AWIA 3I8XA 1OILA 3ILHA 3KOXA 1FQOA 1PZFA 3BM5A 1NNLA 2OXEA 3ABSB 3M4NA 3OOSA 1THTA 4GUAA 1AKQA 4II2A 5DGXA 3KSUA 3WOHA 3WLKX 3IIKA 1UKAA 3MSCA 4OYLA 4DCOA 4LQ4A 1FFHA 3BS4A 4O4HF 3D7LA 1VPVA 1R50A 2PK3A 1K5GA 1M1XB 1IRXA 2J5BA 2CWDA 2DQ4A 2IXDA 2HQSA 3GRPA 2KS6A 1QJ4A 3IAHA 3PC4A 4BJ6A 5I4KA 5K0GA 3O1IC 4LE2A 1FC0A 2X0JA 1M6WA 3T35A 1CYDA 1XPJA 1X8KA 2VZLA 4XQ0A 4DRXB 2P0AA 2O05A 1VG9B 1EBFA 1FP2A 3LOPA 1E92A 4EGSA 3HR4A 5IHXA 4H3SA 3D4IA 4OQXA 4WWHA 2AG5A 1REQA 1JEAA 2PS0A 2H85A 3JQFA 5FJIA 4BTEA 3JRXA 3C8UA 1LRJA 1R6VA 5BN5A 1KAMA 3D6FA 1CLEA 5IMBA 4WXYB 1LF5A 5DF1A 2VSNA 3EDRA 4C7VA 2PPVA 3P1JA 3KOYA 3FPBA 4M55A 3NIFB 5LYYA 2G07A 5HGXA 1VPLA 4S1NA 1LBSA 2AJDA 1QG6A 2PRSA 2XUDA 2WA2A 2YIDA 4B80A 1KQPA 2ZTLA 4P9NA 2CDAA 4MKHA 1AN0A 4WN9B 4MVWA 2ZS9A 3LT5A 1CE8B 3A9RA 4AJJA 5KYTA 5JNWA 3O4GA 4YRDA 4PLCA 4ZO9A 2W2LD 4AD8A 1HDOA 1OA0A 5TQVA 2R4QA 4CQNA 1NR5A 2B8WA 1NHGA 4JXJA 3E9QA 1H4VB 1DE0A 3EEOA 3PF8A 1W93A 2COUA 5BNWA 2R6HA 3C15C 1E2KA 4R98A 5B53A 1PRYA 1JKFA 3EF1A 1NI5A 5KREA 3BTUA 3A06A 2DP4E 2XVMA 4WGFA 2OYRA 2NU8A 3FB1A 3BREA 1WKVA 2E1RA 4D9KA 2UYHA 3ZN2A 5K0SA 1GADO 4J03A 4POAA 3EA4A 4Q7LA 3WLLA 5CYOA 3RUFA 3RS0A 3RV4A 1EB8A 2Q3MA 3KC2A 1WV0A 2VXCA 3P2YA 4ZJYA 1QZ3A 5TJ9A 2V5VA 4ITVA 1W9MA 1MO3A 4QUGA 1AS2A 1C7EA 3HL4A 4JLJA 4K05A 4YFYA 5DTMA 4EUNA 4YMHA 4YCMA 2KLHA 3GW8A 4KHPB 1P4RA 4YWHA 2ZIXA