4FMDF

Espg-rab1 complex structure at 3.05 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
164
structure length
149
Chain Sequence
b'KLLLIGDSGVGKSCLLLRFADDTYTISTIGVDFKIRIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG protein
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 36
structure length 149
sequence length 164
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdF00
4EPYA 3V4RA 5IT5A 3P4YA 3ZLJA 1EFRA 2CK3D 4JL6A 3MCAA 3RWMB 1UDWA 5DISB 3CUEF 2JIZD 1VPLA 5AUNB 3JZMA 4AY2A 1G16A 3LVRE 2KSQA 3SNHA 3V4FA 2NOAA 3MGCA 1PUIA 2OT3B 2QQ0A 2ZUCA 2ZJZA 5JS7A 2AXPA 3K1JA 3TH5A 4AURA 5ANRB 1P6XA 1TF5A 2QAGB 3KQHA 4NYIQ 4BEJA 4TL9A 4JVNA 4FWIB 1IJEA 1W0JD 2IW3A 5FBQB 3IILA 1GAJA 1GFIA 4O0MA 2CLDX 1W46A 2GJKA 2H17A 3K9LA 3DEFA 2ZEJA 4DVGA 4IDHA 5EUQB 4LBWA 1E2IA 4ESHA 5BYJA 1M6NA 5GVSA 1ONBA 4JLJA 2DWPA 2C2HA 4MKFA 3WYFA 3ASYA 4OK6A 1GNQA 4MRVA 4Q9JA 4ZDJA 4NCNA 2HLDD 2VYFA 1KO8A 4RZUA 2C95A 2F43A 5KU1A 1L4YA 4WOPA 3NG1A 3AGQA 1XTJA 2ZM5A 1RFLA 2QZ4A 1IBRA 2ZI3A 1SXJD 1FTNA 3GJXC 1XF9A 2BMEA 3FMIA 1K6MA 1A7JA 3R9XA 2RHMA 3CRVA 3ZQ6A 1KI7A 1UKYA 4P31A 1OLOA 2CJWB 3A6PC 4V0KA 4TL8A 1ZM7A 1W4CA 2WJYA 2CCJA 2C03A 1LF0A 2O5VA 1YE8A 1G3RA 3QBVA 4I1UA 1AS2A 1GNRA 2VP2A 4F92B 2JLXA 2ZREA 3PR1A 2FDCA 4MDFA 1X3SA 4JYBA 3ZQJA 4JL5A 4UNRA 1WMSA 3SBEA 5FI0B 4L16A 4GDFA 5KPJA 1IY2A 1II8B 4GSYA 4BFVA 5TMPA 5LD2B 1OF1A 5KNBA 1ZCAA 4UXJA 2ZSAA 1XNJA 3L43A 4B35A 4BZXA 2IWHA 4M1TA 2BCGY 1K5GA 2GBLA 2Q0HA 5EE3A 4O3MA 3IDQA 4LSGA 4LHVA 3GEHA 1KY3A 1KMQA 3NEJA 3O8RA 4C0QC 2H92A 5C46F 4BRUA 1NVVR 3K0FA 4NP6A 4LI0A 4XVQA 3QF4B 2W0MA 1H65A 1E79D 2Q21A 4JBWA 1Q1EA 1K5DA 3QQ5A 4R2IA 4YDHB 3Q7PA 1G7CA 2PX0A 2WIAA 2EQBA 4OHXA 1HY3A 3I8XA 2XNDD 4KU4A 121PA 2NO9A 4C0JA 1P5ZB 5KOYA 1XMIA 4DXAA 4ZDIA 4KV9A 3U4QB 3DHWC 3VKWA 4D0GA 2OZEA 1LV7A 5F3WB 3LQRA 3SU8A 4HDCA 1Z6TA 2AXNA 3IGFA 4ABYA 4TMTA 5JMTA 4HUQA 4IW3B 1P9NA 1Z0JA 3PXGA 1GOTA 4BQSA 2ZRJA 3A4LA 3EWSA 2ZXUA 1G5TA 3EA0A 2RKOA 4PSVA 1T91A 1ZNXA 3WMEA 4W5WA 4B6FA 4DKXA 5KSYA 4TLBA 4XTRA 3U44A 4MYTA 2NZJA 3VR3A 4DDWA 3WHLA 2C04A 4HLQB 4DRZA 2JJ2A 2GEDA 2JGNA 4I81A 1G19A 3IQXA 5B57C 2ZJAA 4GP7A 1P61B 1IN7A 2XB2A 4ZKDA 4JYCA 2O52A 2ZRNA 3RRZA 2BJWA 1M7HA 4CYMA 1CKEA 1E2KA 2ZI5A 2DWOA 1GZSA 3UMFA 3NIBA 2IUUA 1VHTA 4AKIA 2QTFA 2QA5A 3TVDA 3S1AA 4DB4A 2PCJA 1SVSA 2PJZA 1MO6A 3GCGA 3NH6A 4KFSA 4QBHA 2ECKA 1Q1BA 1R4AA 3QXJA 4PC1A 2V6IA 2LCFA 5D3MB 1YRAA 3CRMA 2O0HA 2JASA 4QRHA 5EXSA 3LFUA 3FE2A 3I62A 2QP4A 2BKEA 3NBYC 1U9IA 2V7QA 3D7MA 2KE5A 2O8FB 3RHFA 1JEEA 1W36D 3KL4A 4C3ZA 4ZIRB 3BOSA 2EVWX 3Q72A 2RGEA 4NBSA 1CBUA 4TWZA 1EG7A 4FMBB 1R5NA 3RRYA 4PO8A 1CJKC 3GD7A 5CITA 3AEZA 4II7A 1D2EA 1FP6A 3FYHA 2ZYVX 3OIYA 1U98A 2IYWA 3T15A 4R9UC 1E2FA 3I73A 3OEHA 3AKCA 3PFIA 4TYNA 4CGZA 5A4JA 2O8CB 4PAMA 3WNCA 2NG1A 1EFHA 4F7WA 4J0QA 4URVR 3VR4A 3ZDQA 4D25A 1G8FA 2BMFA 1S3GA 2VL7A 1P2UA 4ZPXA 1X6VA 3LY5A 2C78A 4LJ4A 2J46A 3P20A 3SC3A 1IHUA 1HT2E 1MOZA 5CK4A 3LX8A 2J7KA 3TQCA 4K8OA 4GOKA 4LX0A 3GLGB 1R0WA 2GILA 3EG5A 4GBMA 1XJQA 2PLRA 2J0QA 2CCGA 4MGKR 2XAUA 2YZ2A 3I92A 3TQFA 2WICA 2AKAB 4Q00A 3SYNA 3AVVA 4JJZA 1LS6A 1R0XA 2HF8A 2MSDB 3QEOA 4UNPA 4TMVA 5IHPA 2A5GA 4BE7B 3W34A 1W2GA 1J2JA 1OT3A 2W6IA 5LB4A 4DCSA 1NKSA 1W2HA 4KITB 1CR0A 4X8MA 5KDDA 2J7PD 2FPLA 3BGWA 4WZAE 4ITRC 1KK2A 1IOZA 4Q21A 3TW4A 1D6JA 4EPTA 2QEQA 4NHOA 3RSOA 1EXMA 2BOVA 3IO5A 2QY9A 1VIAA 1W0KD 3GLHA 3B6EA 4HB4A 3VTKA 2IS2A 1FZQA 2RGDA 4Q7KA 4BFXA 1IJFA 2YYZA 1SULA 1XCGB 4LK2A 4XSHA 1TEVA 3D31A 2ATXA 2QUZA 3WNDA 1KHTA 4LC0A 4HB0A 4OI0A 3AVUA 4NCJA 4LGMA 2RGBA 4Y0AA 2G1KA 2GJSA 1E3MA 2J59A 2ZUDA 4QGAA 1TX4B 2EYUA 5F9HA 1P62B 2GXQA 3FOZA 4X8LA 2ZRKA 2PEYA 1KO4A 4C0SA 1ZNZA 4DUGA 4Q7LA 1G5RA 2DFKB 2UZ3A 4KJZA 3LWNA 4TYQA 1FX0A 2JLYA 1V5WA 4LBVA 3A1SA 4TQ9A 3W9YA 5HKKA 1E0SA 3CBQA 1R8SA 1XCPA 5L3RA 5JBQA 1JR3A 3DOEA 4QBFA 2RGNA 4NYMR 4UJ3A 3VNUA 3CKLA 3EPLA 2N42A 2YWEA 2G3YA 1VMAA 1Q44A 1WBDA 3ND9A 2QPAA 2OFXA 4FI3C 1CF4A 1TUEA 2FGJA 3ADDA 3SFVA 2D3WA 2DYKA 1KGDA 3RS0A 1S8FA 1I4LD 2XSZD 4DCTA 1XXHA 3A8TA 1ZNYA 2NMVA 1G9XA 4PZZA 4FCVA 2XEXA 2WWFA 3AF1A 3OZXA 1ZM4A 2HV8A 3IHLA 4PPFA 2OCYC 3R9IA 4XVRA 2ODBA 2QMUA 1FMLA 4M22A 3PQCA 5L3QB 3GLGE 2ZI9A 1N0WA 4Q03A 2YJTD 5FTMA 2RB4A 4EQ6A 2PMDA 3T1QA 3T34A 1J8YF 4RFSA 4LYAA 3BH0A 1G3QA 2FJUA 2ONKA 5IDVA 3EZ9A 1U0JA 3HR7A 4M1OA 4A36A 2FFBA 3QIAA 4P33A 3IIJA 2P2LA 2B7CA 4KODA 2VQSA 2OSBA 3ONWA 3UXMA 2J9RA 1Z6YA 2CE2X 2QT1A 4Q4HA 4RFVA 5IK2A 4ZI3A 3GPLA 4LDJA 3QI2A 1NVWQ 2BEKA 4R7ZA 2OFWA 2RGCA 1ZVQA 2H18A 4L5BA 2F1JA 4HZUB 1K8RA 3EW9A 4TYYA 4LBZA 5JCPA 4B3BA 5DIFA 4G5SA 1IXSB 5J4VA 3AVQA 1NMXA 1XDBA 2OE2A 1FOEB 4YMUA 3AV0B 1P3JA 3TW8B 1YZTA 2D74A 1F2UA 5H68A 2WKPA 3SS8A 3HU3A 5FL3A 3H84A 2W2TA 2IK8A 5FTLA 5FOUA 1JJVA 2ZE7A 4QNMA 2OBNA 3WRYC 2IBMA 5EP2A 3AKDA 2FH5B 4DHEA 5BXQC 2J1LA 1JPNA 1ZP6A 4DLTA 2HXYA 2Q9AA 4QG7A 1FNNA 4F93B 2ZSFA 3JVUA 2R2AA 3C8UA 4JT4A 4FMCB 5CLQA 3A1UA 2IYRA 5J4HA 2ZSEA 4YMWA 2VHCA 2ZE8A 4K46A 5AUQA 5C4MA 2IYZA 3ICQB 3EARA 2W6JA 3ADCA 1AKYA 2VP5A 2ZRMA 4JBXA 5FL7D 1VYUA 1R0ZA 3TR0A 3CZQA 5SZHB 1E9RA 3P27A 4IVQA 1QVRA 5E7MA 5JECA 4OI1A 1EFRD 3B9PA 1R10A 1Q3TA 3U7FB 3GFOA 5FI1B 4KFUA 1SXJC 2OHFA 3R8CA 3UATA 1KNQA 2RHDA 2XXAA 1E2GA 2RMKA 1B0UA 5EP1A 1X1SA 1NBME 4ZCLA 2ZS9A 1FTSA 3VKGA 2QE7D 1IY1A 1KKMA 1LW7A 2JJ1D 2ZROA 3SOPA 2WKQA 1Q22A 1Z6GA 2OLJA 5GJBA 4GMXA 2OG2A 5JJKA 4GL2A 3KKOA 3IEVA 3Q3JB 1ESNA 1T5IA 4MGIR 4RKEA 3AKEA 2RGAA 3REFA 1NLYA 3QG1A 1ZD1A 3QJYA 4DSOA 2OV2A 4ZDKA 4G5GA 4C30A 5KNCA 1VYVA 3GEIA 4X8OA 5GJCA 4UNNA 1KI1A 4TN1A 1NJFA 4IVPA 5EJEA 3ADBA 3ZZUA 2F43B 3L0IB 1NP6A 4M9QA 3TIFA 3C4JA 4LC1A 4DIEA 4OI2A 3Q5DA 1ZMXA 2BJVA 3EZ6A 1RYFA 2J7PA 2QSZA 4FXPA 5HE9A 1V43A 4OYHA 5HCNA 3L0PA 1RYHA 4V0ME 1JXOA 1ZC4A 1RJ9A 1KJZA 1AS0A 2IHYA 3EC2A 4JLNA 1VECA 4L9WA 3UIEA 5CB6A 1WXQA 3LLMA 4B3XA 3QVUA 1CULC 1XU4A 4Q9KA 1P2SA 2OBLA 5KDLA 1XD2A 3Q7QA 4KVGA 6Q21A 3TSOA 4V02A 5K8LA 1XMSA 2IYQA 4IFBA 4V03A 4BLSA 2I4IA 2EW1A 4OJKA 5E4FA 2C96A 3B9QA 4D4LA 3PUZA 2REXB 1D5CA 4A8JA 3W3ZB 2PBRA 2QI9C 5DI9A 4TTQA 3X1YA 4XVUA 1M2OB 4NDZA 2OFOA 3NHBA 4FD2A 2L0XA 4F91B 4EAQA 4D26A 3SE0A 2DB3A 4NCIA 2BBOA 3C5CA 2WJJA 4E09A 3H0KA 1QRAA 1NN1A 1KZGB 4FWTA 4NKRA 1GIAA 1G5PA 1XX6A 2YC4C 3GJ3A 4W7SA 2D06A 4V0LA 4IOLA 1KTVA 5DSZA 3RS5A 1EWRA 1NG9A 5AR1A 1P60A 4XWAA 1VTKA 5CYPA 4XWKA 1CRPA 3RS2A 1VIYA 2KI5A 3K0FB 3KB2A 3MWYW 1D8TA 4LYHA 3O8BA 3Q9LA 3DPUA 5KPDA 3QKUA 4BUJA 1XD8A 3MWKA 2ODWA 2GDJA 3TSWA 2IYLD 1SVMA 4B3FX 1QBKC 3IQWA 3L0OA 1LY1A 3K9HA 1MT0A 1QHYA 3KJHA 1Z28A 4PO9A 4KCGA 1AK2A 3FMOB 3EPKA 2JEOA 4AI6A 1N3BA 3NC0C 4AG5A 4AD8A 1IN5A 2R62A 1XEWY 1P7CA 4GZLA 2GESA 2H7VA 4KBGA 5AJVB 1XFAA 4A4DA 4OL0A 2V55B 1C9KA 1MO4A 3JVVA 1QZXA 1Y63A 2EFHB 2X2FA 4GZMA 5B30A 3GJ4A 2ZUBA 5K8IA 4NYJQ 3B1XA 1SKYB 3RS4A 1H8EA 2GXAA 3HR8A 4LJ8A 4DLSA 5GJVC 2XOKD 4TMWA 1OH5A 2J3EA 5JSZB 4B75A 3WBJA 1DAGA 4CW7A 2ZI6A 3QKRA 1S4QA 3VR1A 3X1XA 2ZRGA 4P4SA 5M04A 2CMKA 3MD0A 4S35A 2UZIR 4A2QA 2O8BB 3G5UA 1W1WA 1D2MA 1KI8A 4D4JA 1P9RA 2KWIA 1W36C 3KKQA 2WSMA 1OSNA 1E1RD 2F1HA 3EA5A 5EXXA 3WMFA 4LPSA 2YHSA 3AH8A 3VHXA 3PUVA 3HPQA 3W6OA 2JJ2D 3NEYA 2OXCA 3AP2A 1T3LA 2PZEA 3UWKA 1Z0AA 2IWRA 3GLFE 2D62A 4UQOA 3RVBA 3RS7A 1IXZA 4Q66C 5P21A 3RNLA 1NF3A 3K0AA 3SDZA 1WBBA 3O8CA 2YOGA 1I4DD 1PLJA 1FUKA 3CF0A 3M6AA 2FN4A 2GWHA 1VCIA 3EASA 3I1FA 1Q3HA 2N1BA 1VHLA 3ADKA 2ZYUX 1AZSC 1OXVA 3CNLA 1RRPA 1Q1QA 2CVFA 4A2WA 3KB1A 3TNFA 1DEKA 1ZYUA 4D0NA 4BWYA 2WMNB 2ZS7A 2J5XA 3CWZA 4C9BA 2C99A 2AK3A 1M74A 1EESA 4GOJA 1O3YA 2ZRPA 4LHXA 4XIGS 5FL7A 3NBZC 2P5SA 2V7QD 1Z83A 5TY0A 5IRCD 4NCHA 4L4UA 5BWMA 3CR7A 1VYTA 3ND8A 4H9GA 3VR5A 4BEBA 1TADA 3CH5A 5C2JB 1TQ6A 4E5UA 2W2VA 1ESMA 3GFPA 5FOWA 1DAKA 4JBYA 5UKDA 2Z5FA 4BLRA 5CIWA 1CJVC 1MABA 2F3RA 2G1JA 4OKSA 3PVSA 1P4SA 2IYSA 1UF9A 3ZH9B 2FOLA 1E32A 2QE7A 3MAAC 1VCMA 3OEHD 4BFUA 2YOHA 2JJ1A 4OI4A 4PC7A 2IXGA 2ZIAA 5FPKA 1BMFA 3KJEA 4QM7A 3EWAA 4B47A 3U6KA 2QAJA 4A8JC 2C77A 3RS3A 4LV5B 3QF7A 4QBIA 5FUWA 4E07A 1E0AA 2WJHA 4ZKEA 2ZQ5A 5CM8B 4MITA 1SKYE 3B7GA 3HU1A 3BH6A 1JAIA 2GVDC 4N1AA 3GLIE 2IC5A 2P5TB 4OHYA 1SXJB 1Z5ZA 3MLEA 3ZGXA 4A92A 2VRWA 3G82C 3VHLB 4DSTA 3PUYA 2VPPA 4BZPA 4UKDA 1Q20A 1ZBDA 2W6ID 4QXAA 2QL6A 5CYOA 2ASEA 2VHJA 2A5YB 3LQQA 1MRSA 1ZUHA 221PA 1OFIA 3AM1A 4ZO4A 521PA 1OKKA 3CRQA 2UKDA 1WQ1R 1GVNB 4JLDA 4LV6A 3T1TA 3EXAA 3R7WA 3SBDA 2J87A 3W3AA 1ZUIA 4PPGA 2ZRIA 4DDVA 3AKYA 1E2EA 2B8WA 2IYYA 3CPJB 2A9KA 1XTKA 2EYQA 4WZBE 2DWQA 1TAGA 3N2EA 3R9WA 4A9AA 4K81B 4B76A 4CDGA 1SGWA 2Q6TA 2HF9A 3RRMA 1CP2A 3A1VA 3VQTA 3DM9B 4BZQA 4URYR 3I5XA 4NE2A 4EFMA 2IEYA 2V6JA 4BLOA 5F9FA 1S9HA 3E1SA 1P9WA 4PC3A 2ZR9A 5J4LA 3OE7A 1FX0B 4Q02A 2QGNA 1IXRC 4IDNA 1NN0A 4HAUA 3A4MA 4Q01A 5DN6A 4YMVA 2F3TA 4DIDA 2P6NA 4DUGD 2VTKA 1JALA 2CL7X 3KUDA 3UG7A 2NO0A 5JHGB 1AGRA 4JVMA 1DAFA 3EX7C 3VNVA 2C8VA 5BQ5A 4KSCA 4EDHA 2F9MA 3H4MA 3MRSA 4BFSA 1BO6A 2WZQA 2GJAA 5FPSA 5HKKD 2REOA 2F6RA 1UJ2A 1JR3D 5FUVA 3QNUA 1F2TA 1FFHA 3CW2A 5TV2A 3AVWA 1S9DA 4PO1A 5DHFA 5CDFA 2OILA 5CJPA 1XXHB 1E6CA 1G4UR 2C9OA 2G6BA 2H1LA 1G64A 1UDXA 3B13B 3EPJA 1EK0A 3NBFA 1UBFA 2PX3A 3TLXA 1EFTA 1ZIOA 1S2MA 3J81k 1NVVQ 1XPRA 2X2EA 4PPNA 2GJ8A 4QFMA 2YNMA 1PZNA 2PJRA 4CRWB 3T61A 1XZQA 3KJGA 1QG4A 1Y3AA 3IKJA 1QDEA 2J0UA 2CL0X 1KMHA 1QHNA 1HQCA 2IYXA 3CM0A 4FMDB 4QNRA 4PHFA 4EQ6B 3H2YA 3CF6R 4RFSB 1P73A 1U81A 2XOKA 2ZPTX 1UM8A 5H8WA 1X86B 4I1VA 1FL9A 2CHVA 3I5YA 2XNSA 2AR7A 4TQUS 3K0SA 3BD9A 4JLAA 1NIJA 4Q4HB 1BYIA 1NRJB 1NY6A 3U7GA 1JR6A 2J41A 1RIFA 2RAPA 4V0OA 3U61B 1SXJE 1ZD9A 1E1QA 4MRPA 1UKVY 1E1RA 1N2CE 4E22A 1AKEA 2Z43A 4OBEA 5IK2D 3AGPA 1II9A 5G41A 3K09A 3ZD6A 2Z0MA 2ORIA 2N46A 1HH4A 1R7RA 3AP1A 1F2UB 2LKDA 1GL7A 4UNSA 1UAAA 1TQ2A 1NLZA 2B6HA 2E9SA 3OF5A 2P6RA 4MQBA 2FSFA 1H8HA 1R6BX 1US8A 3FGNA 3TVTA 4JT2A 3U5ZB 4CEJA 1GKYA 3DMNA 3KFVA 1KDPA 3DMDA 1WB9A 4EKDA 1ZIPA 1PLKA 4A0FA 3W6PA 1JECA 2XB4A 1N6OA 1OIWA 1Z6AA 4GPTA 1W47A 1CJUC 1QHHB 3FVQA 2YWFA 3P4XA 1ZM9A 4M4SA 3KDSE 2WV9A 1E2MA 2CNWA 3BERA 5KSZA 1W36B 2DCUA 1U8YA 1EWQA 1TF2A 4G1UC 3WMGA 1RKBA 3GJ5A 1Z06A 4JKYA 1TMKA 4IJMA 4TYWA 2P0EA 1KK3A 4JIMA 4LYFA 4M9XA 1JR3E 1XEXA 2PZGA 3LDAA 4EIWA 1DOAA 2Y8EA 2QM8A 2W6JD 2G88A 2GCNA 2YOFA 1SVLA 3B1ZA 2XXAB 2RH5A 2P67A 4TTRA 4RD1A 2IL1A 3MFYA 2BBSA 2OAQ1 3TKLA 2ATVA 2NIPA 3U7EB 2O8EA 3T06B 1PVOA 2WKRA 1WF3A 1XXHE 3K53A 2JLWA 1GRNA 2QENA 4EJSA 5JWOA 2FZ4A 4M1YA 5FOSA 2R6CA 2WTUA 4PAOA 2FFQA 1T8TA 3B8HA 3X1WA 4FMCF 4HSEA 4POAA 3VFDA 1CXZA 1NG1A 4PAQA 4Q4JA 4EFNA 2QGZA 5EP3A 3W5IA 1CTQA 1G17A 1N0UA 3FKSA 3WXMA 2XTMA 1ODFA 5LBIA 1FMJA 4MYCA 3EPHA 3BFXA 5A0FA 1UBCA 4UXIA 3BFVA 3LW7A 2Z4RA 1NSTA 4PSAA 2DHRA 3UKDA 2P65A 3ZVRA 1CR2A 1RJ9B 4P4UA 4F38A 2GA8A 3OAAA 4QHSA 3LXXA 3GJ6A 4MGZR 3CF2A 4C0HA 2QORA 2ONJA 2W58A 1XD2B 2ZSBA 5G3ZA 2GBLC 3WRXC 2CLSA 4B34A 1BIFA 2IT1A 1DPFA 4YQFA 2OEPA 4PSKA 4HZIA 3U3MA 4A8JB 4CF7A 4PFSA 5IF9A 1U0HC 2GNOA 4GMDA 4O2LA 2QMEA 5L3VA 4EPRA 3GJ0A 4TLEA 1XEWX 2C5LA 3W8NA 3X1ZA 1YRBA 4DT1B 1OXXK 3M0EA 4P3YA 1E0KA 3DKPA 1G8HA 2GZDA 2GXSA 4FN5A 1C4OA 5EE0A 1KAGA 3BB1A 3WBKA 1QHGA 1XJ0A 3L0SA 1T6NA 1G1MA 3EZ7A 5L8VA 4O2RA 4IDPA 2R8RA 2FSHA 4BPBA 1JPJA 2RGXA 1J7KA 2NPIA 2BM0A 5FFMA 4I1OA 1VG8A 3BE4A 821PA 3NH9A 3GJ8A 3KKMA 3ZD7A 2CJWA 4RCYA 2WSSA 1LS1A 5F2EA 5FTNA 4AKGA 5G40A 1YZNA 4RY2A 2XZOA 4C4PA 5JRZA 4B73A 4B74A 3CPHA 3TGPA 2P6UA 3QXSA 3VAAA 4ON9A 4XTCS 5C1BA 2Q3FA 4HLDA 1IN6A 4I1SA 4GP6A 2NGRA 3I3SR 3VU9B 2PT7A 4M0LA 2LWIA 1KJYA 3NXSA 3QVVA 4WW0A 3ZYCA 4C7OB 3KQUA 621PA 1G4AE 2EFDB 2XX3A 1NMZA 3LNCA 1Q12A 2QT0A 3ZVMA 1II8A 2YC2C 1TQ4A 4BASA 3QENA 1KAOA 1LTQA 1Z0KA 1JXMA 2H16A 3NBXX 3OESA 4Q9HA 3TUZC 2VHQA 2VF7A 5HE8A 2FSGA 4JLKA 5FOVA 1A5TA 2VHUA 3FMPB 5JHHB 2PH1A 3EZ2A 1DTSA 3W8RA 3E2IA 4B3CA 3QKRB 1TTTA 1H8ED 4P4SB 1T0HB 5FTKA 1F6BA 1PV4A 3O47A 4QHTA 3NTUA 1KDTA 5FTJA 1NL3A 2FZLA 4NL4H 1G3IA 4KHZA 4AYTA 2ZRHA 4FCTA 4A0GA 2AKYA 4IOKA 2GZHA 5KDOA 1U9IC 1J99A 4TL6A 4UXHA 2J0SA 3THYA 2F9LA 4RJLA 4US1R 1NI3A 3MWLA 2HJVA 5EP4A 5FBWB 3K0AB 1KIMA 4CEIA 4PC6A 4MRSA 4PQFA 3CX7A 4KLZA 2G77B 1SKQA 3BJIC 3NC1C 2ZRAA 2WWYA 2B7BA 5EUMA 4EPXA 2XITA 3U3KA 1I2MA 4TQAA 1T0JB 1FW6A 1YVDA 1M7BA 1OH7A 1XTRA 1JEDA 4Z1MA 3NVAA 3FB4A 4EJSC 1ZU5A 3TSZA 1W48A 4DC9A 1E2DA 5LB2A 4OJQA 4BRWA 5HZKA 5FPHA 2JLQA 4L8GA 4QM6A 4YLGA 4QGGA 4BFTA 5EQTA 3BH7A 4URWR 5E3HA 5KYKA 3E5HA 1T3HA 4V0NA 4ERNA 4OK3A 1G6HA 1COWA 2ZR7A 1R5BA 4NPHA 1AS3A 1Q21A 1N5JA 1XZPA 2I1QA 3HDTA 3B85A 2GCOA 2WAXA 1TL7C 2ZJ2A 2FWRA 1ETUA 2ZAMA 5FBVB 2GKSA 2FEOA 3L2OB 1MRNA 4OQMA 3GMTA 3KFXA 1NMYA 3B1WA 2A78A 3ICEA 1R0YA 5FUYA 4UNQA 2J0VA 5B2ZA 3SFZA 1AZTA 1S0UA 4RD4A 3CPEA 1T8UA 4B48A 1Z63A 4Q1EA 5D3MA 3ZZTA 3CO5A 1E2HA 2QNRA 1R8QA 2CHGA 5KUTA 5J40A 4DLZA 3H86A 1BMFD 1N0VC 2WWWA 5HZHA 5CJ2A 4Q47A 1A82A 1W5TA 2IXFA 4AIIA 1G291 3CNOA 1WA5A 4ZIRA 2V8OA 1OXUA 3VR2A 4IRUB 1Q0UA 4OQFA 4N0EA 1RC8A 2ZTSA 3RRNA 2GK6A 2R44A 2SHKA 2K5UA 1PJRA 2GHIA 3NHAA 3LH5A 3K8YA 4M1KA 5EZ5A 1F48A 4LZZA 3VX4A 3MJHA 1E4VA 3GQBA 5FBLB 1ZM3A 2B8TA 2FA9A 1XJCA 4OHVA 2HYDA 1E9AA 3THOA 1X8JA 3U6BA 3BRWD 1S1CA 2KBEA 3EIEA 4JLBA 5FOTA 1N5LA 5EE9A 1PUJA 2F1RA 2RGNC 1OKKD 4LCBA 3PUXA 1IQPA 3LBHA 3K70D 1Z22A 3ZVNA 2YKGA 4Z8YA 1DAIA 4RD2A 3W90A 5JZVA 2PEZA 1AGPA 1DBSA 1JQLB 3LBNA 5KSOA 1AM4D 2QRZA 2QBYB 2WBLC 4GI7A 3EAQA 1MO3A 3R8FA 5JJLA 1IN4A 4Q1FA 1FUUA 1HYQA 5H1YA 2IS4A 5TVKA 2Z83A 1CLUA 1I4TD 4G3XA 2ORWA 1E2NA 2BBTA 2C9YA 3PEUA 2V3CC 3DZDA 3BS4A 4Z51A 2O8DA 2ZRFA 1T3SA 4D80A 3IBGA 2CXXA 3AF3A 3OE7D 1OE0A 2R6AA 1GM5A 1NVUQ 4FW9A 5C4GB 1S96A 3QXXA 4G5RA 3ECCA 2YVUA 5DN6D 1WCV1 1N6IA 2DFLA 4D4KA 3EC1A 4RZ2A 1F2TB 2QPOA 2V1XA 4ARZA 5L3SA 3TR5A 2CVHA 2H57A 4C2TA 4IVRA 4LRWA 1XMVA 2VA8A 1YR8A 4G5QA 2FSIA 2ZYWX 4PPQA 4PZLA 5AUOB 1JI0A 4PR0A 3TK1A 4R71A 3CZPA 3QKTA 1W4RA 2QTHA 2FMXA 1GILA 3U60B 2J0UB 1KMHB 4JLOA 4DCVA 1YZKA 3I72A 2GK7A 3SJZA 4TLCA 2ZSDA 4HUQB 1MR3F 3QSYA 2P3SA 5CK5A 2VSOA 2AN9A 2JLZA 2IS1A 1SVOA 4M9SA 2EFEB 3SYLA 3ETLA 5EZ6B 3FTQA 4ILEA 4MA4A 3VMFA 3X2SA 1Z3IX 4PQRA 4RZXA 1ZW6A 3AVYA 2F7SA 4ASUA 3GEEA 4C0AC 4JMPA 1P75A 1E9DA 3U44B 2G83A 3KKPA 4W5JA 4TTPA 1S3SA 4LOAA 1GG2A 2ORVA 1E2PA 2KB0A 3D8BA 4OK5A 2HXSA 4NYJR 4DLXA 5BYKA 1XPOA 1E99A 1NBMA 1E4YA 3A1WA 5HR5A 1CEEA 2ZJ5A 2ZE5A 3P1JA 3DZ8A 2EFCB 1A2BA 3N70A 3HU2A 4GT1A 1E1QD 1M1YE 3DVLA 1VDZA 1CR4A 4JLVA 4WBSA 4C0KA 3LD9A 1GSIA 2VSXA 4ACAA 5HPYB 2D4HA 1N6HA 1W44A 5SZJA 2IYTA 1Z0FA 4FMDF 1U99A 1WRBA 3CWQA 1KI6A 3C15C 3S1AB 1JJ7A 2QTVB 4XSGA 5EXTA 1H8HD 1L4UA 4LYJA 2B21A 4Q4LA 4NU0A 3THXA 1OH8A 3PV0A 4QJ3A 5TDHA 3ZIAA 2MSEB 4IDQA 2JLUA 2V54A 1Z2AA 3IUYA 5DNYB 4V0MA 4M1MA 5E7JA 4HDOB 4P0TA 4QHYA 1G41A 3I32A 2B92A 4HLCA 2V1UA 4QL3A 4CEHA 1E96A 1G21E 2CNWD 3L82B 3KQLA 2A3RA 2ODNA 1OYYA 3BWDD 1DADA 4Q48A 1GL9B 2D2FA 3DOFA 5GJWC 4MKHA 5KSPA 2CCKA 3TAUA 4B3DA 2AK2A 2VP9A 4W5HA 3AQ4A 3MG9A 4XD7A 4PC2A 3I61A 4M21A 4M8NE 2O8EB 1BH2A 1OXSC 2REBA 3RYTC 4JVLA 1KDOA 4JSYA 2E87A 2HT1A 2MSCB 4TYPA 4EJSB 3B5JA 3KJIA 1SQ5A 4Q1AA 2XJ9A 3PCRB 1OFUX 1LF5A 1SZPA 2OM2A 3DKVA 1UKEA 1DAHA 2ZU0C 3TUIC 3F8TA 2QRNA 3C16C 1YZLA 4Q4JB 1UEJA 4YC7A 4TZ0A 3H1TA 4I99A 1R2QA 5SZKB 5B64A 4B3GA 2GTPA 2A5FA 2GF9A 4KBFA 1SHKA 2AWOA 3FPAA 1EX7A 3PITA 2I3BA 3QE0A 1KSJA 1NN3A 3AVOA 4HAZA 3C5HA 2ZRLA 4NYIR 4LBYA 4TSFA 5FUXA 3W6NA 4ZI2A 2FFHA 5JWRA 3T35A 3FKSD 4FCWA 1DARA 3RSLA 4HATA 5BN4A 1KSFX 1P2VA 3C41J 4LHZA 4RD0A 1OHHA 5FR2A 4L15A 4B2PA 1XTIA 3NDPA 2OCPA 1YZQA 3SR0A 2BVNA 2KBFA 3O8DA 2VP4A 3BC1A 2H5EA 2ZU6A 3TBKA 3RWOA 3QPWA 2ANCA 4KVAA 4AKEA 1TPZA 3OAAD 1G3MA 3GLHB 4B43A 1JB1A 2AD5A 4DLWA 1YU9A 5FR1A 3SJAA 3VR6A 3A58B 4HLUA 2FE4A 2R9VA 3CX8A 1I2DA 3PENA 4H1UA 2D7CA 1ZM2A 4LV8B 1XCMA 1HURA 4B2IA 1E9BA 3FKQA 4ZCMA 1UFQA 2GEUA 1A2KC 4PHGA 1E9EA 2DFNA 4HB3A 2WOJA 3T1VA 5A5GA 1E9SA 1N6KA 2W83A 3K9NA 3RC8A 2WWGA 4URUR 1DAMA 1E9CA 1NKTA 2RCNA 1VG0B 2EWVA 3EZFA 1DG1G 3A36A 1XTQA 1RRFA 4UJ5A 3QPVA 4WIAA 5HCIA 4DDUA 1G3UA 2EWWA 1F60A 3HP1A 3LO5A 4IHQA 1P72A 3GLFA 4L9SA 1U8ZA 3PUWA 3FFAA 3SJBA 1RVDA 3TMKA 3ASZA 4H1VA 3IBYA 2IUTA 4DCNA 1UKZA 2WSSD 4TLAA 3SJCA 4BFYA 4TLDA 1EFCA 4MYHA 3PEVA 1XMJA 3QKSA 2WWIA 3IPYA 1DVRA 4PQYA 5AJXA 3SHWA 2BCJQ 1IAQA 5DYGA 2G9NA 3LA6A 1DAEA 4TMKA 1AIPA 4IKEA 4Q5IA 1XRJA 4Q7JB 1E69A 3I8SA 2CE7A 4CT4B 4LWZA 2JLVA 5FBRB 4EPWA 4HAYA 4Q4AA 3SEAA 1NNEA 1OH6A 2ZJBA 1IONA 4D82A 1KSGA 3LW8A 3M4YA 2IEZA 2QN6A 3QXCA 3IPXA 1Z0IA 2QP3A 1SHZA 2G0TA 4YXWD 2F55A 2WJGA 2H8KA 1FNMA 3IEUA 5DI3A 1P2TA 1OB5A 5FH9A 1ZNWA 3CRRA 2X1VA 2OCAA 5B58C 2ZVQX 3AF4A 4B32A 3THYB 4HEJA 4LJ6A 1ZUNB 3KTAA 1J70A 1X8KA 1RPZA 2DY1A 3QY0A 5AJZA 4U00A 1RE0A 1XB2A 4A2PA 4US0R 4QKQA 4CEIB 3AF2A 4S2EA 3KXLA 4G5OA 4HUTA 1MH1A 1UPTA 3THWA 4P32A 1KZ7B 1N6LA 2HCJB 4KI0A 5D3QA 3GLHE 3RANA 4D6PA 4DSUA 1QF9A 3RC3A 3T12A 4R98A 1XP8A 4A6PA 5BN5A 4QBGB 1XBTA 5TXGA 2OXRA 2AWNA 2WJVA 1G6OA 3KXIA 2R6FA 4QJ4A 3GLIA 1ZINA 2QSYA 4M9ZA 5G53C 4D2IA 4P4TA 2GAOA 5JSZA 2IXEA 4MKGA 4US2R 1IY0A 3KZ1E 2E1RA 1LVGA 4Q1CA 1SVWA 1DG3A 1X1RA 2AFIE 4MYUA 2VF8A 4Z1MD 1TU4A 3SQXA 4OQXA 2O8BA 3AP3A 3Q8XB 1G7RA 3BAFA 1E0JA 2A7QA 5LDDC 1Q57A 2HEIA 1YZUA 2QG6A 1KSHA 2GCOB 4HAXA 2VBCA 4DLYA 3DO6A 2QP9X 4TT3D 2BM1A 4KAXA 3HJNA 3R20A 3PJRA 1COWD 2ANBA 2VP6A 4LPKA 5CIQA 2IHBA 3PEWA 2QBYA 2QQEA 3OIWA 2WOOA 4O25A 1FPMA 4KFRA 2C9CA 1O87A 2PL3A 2JDIA 5JLJA 4WA7A 2WPDA 1IM2A 3DL0A 3AUYA 3N2IA 4URXR 3LV8A 2BBWA 2X19A 3OEEA 1N6RA 4F4CA 3DDCA 4QOSA 2R6DA 3GFTA 1N5IA 2I1VB 4C0LA 1QHSA 1T5LA 4WVFA 2IS6A 1N6NA 2Q9CA 3ZS8A 4B2LA 2A5DA 3MUFA 2XZPA 4HLUC 3ZVLA 3K70C 1KY2A 4M2LA 1G7SA 3FHOA 4XOIA 2BWJA 2CK3A 4HB2A 2IYUA 4WXPA 1LNZA 3QG5A 5CB8A 4JS0A 3U3OA 2PZFA 4HYYA 2JIZA 4MKIA 4NZYA 2HDNB 5J4KA 2NO1A 2UVQA 4JL8A 4QGHA 1D2NA 4WZ6A 4Q7MB 4FIDA 1G7TA 1CRQA 2XTZA 3WYGA 3CONA 3FHCB 4AG6A 1KJWA 3GJ7A 4TMZA 2QMOA 1TEXA 4LUCA 4JLMA 1KI4A 1L2TA 1ZU4A 3AB3A 1KOFA 1U90A 4RKFA 2NO7A 1YR6A 2WJIA 4PZYA 4TL7A 1RRGA 3W5JA 2BHRA 4JKIA 1W0JA 4U02A 4XH9B 3FDIA 4KXFB 4RD6A 1FQJA 2ZAOA 2ZVPX 3LBIA 3RABA 4M53A 2QAGA 2GRJA 1EGAA 3PIRA 3NDBB 3IHWA 3LRPA 2O0JA 2ZRDA 5DH9A 421PA 2ZI4A 3X1DA 1W49A 3GP8A 4DEXA 1RZ3A 2OESA 4YONB 2HLDA 1D9XA 1GUAA 4IDOA 1UADA 4JZKA 1G8PA 3E70C 4Q19A 3T5DA 1OJLA 3UANA 4M1WA 5F98A 2F1IA 3TRFA 1GP2A 1M8PA 5J5CA 1SXJA 1UBGA 1WP9A 2Q9BA 4QC2A 2O8DB 4EUNA 5LPNA 2HYIC 5AUPB 1OFHA 2VSFA 2Z4SA 3IIKA 5FOXA 5SZIA 3KQNA 3AVXA 2HT6A 5G3YA 3SI7A 1BOFA 2YWHA 5JS8A 1T9HA 1CS4C 4ARZB 5E7IA 2NQ2C 4EPVA 5L3SB 3PEYA 1J90A 2AFHE 5BN3A 1G20E 1C1YA 3C14C 1T4GA 2PT5A 2W0SA 3CIOA 3OIVA 4LJ9A 5AJYA 5AK0A 5H70A 1OIXA 4TZ6A 5AWFC 4PHTA 4MUAA 2ZRCA 4A6XA 2VO1A 3NKVA 3Q5EA 4IXMA 2AHOA 4CVNA 2ZJOA 4HDQB 1HE1C 4IFEA 1U94A 1XTSA 2ODEA 4YMTA 1KO7A 2ZITA 3OIUA 1OFTA 1Z47A 1E2LA 1JQJC 1YKSA 3ZS9A 1KI2A 3QPUA 2A5JA 4Q1BA 4NYMQ 3K09C 1QVAA 4HAVA 3AUXA 4XJXA 5DE3A 2LKCA 3UG6A 4BLPA 2WWHA 3BB3A 5DGXA 2Z6VA 5TB5A 2TMKA 4TMXA 1KO1A 4BLTA 4CT5A 1Z2CA 1YZGA 1OB2A 4X8HA 4OHZA 4R2HA 5JRJA 2JATA 1TU3A 3QUSA 2OO7A 1TUIA 4KYUA 1N5KA 5KNDA 1E79A 1M7GA 4HI0E 2WM9B 3BXZA 4YXWA 4Q9IA 1AJEA 3N5CA 2XNDA 2GAAA 4QGFA 2D7DA 3B60A 1MKYA 3I4LA 4RCZA 2A2ZA 5JI2E 1TQDA 3WHKA 1QHIA 4B71A 4A1FA 4ASUD 1HUQA 4KSBA 1A1VA 2VH5R 2OCBA 3QF4A 2W00A 3WNBA 4CIDA 4A0RA 4GOXA 5FPTA 4D0LB 4NTZA 2QM7A 3IIMA 4DCUA 1CJTC 1NBMD 1Z07A 1AQUA 4Z54A 4W9MC 4WAUA 1VCOA 1VG1A 1Z08A 2X77A 4YMSA 3U4QA 1ZAKA 3SN6A 2V9PA 1GKUB 1F5NA 3B1VA 2HJGA 3K0EA 3BK7A 2ZE6A 4LJAA 1KI6B 4M1SA 2ZR0A 1DE0A 2WVJA 3K9GA 2FF7A 3D6TB 4IEIA 3A1TA 4N0DA 4BLQA 1GRQA 2EU8A 1QG2A 3THXB 4PANA 3FMFA 2OBMA 4MUBA 1ZC3A 1GWNA 2FX3A 2GEVA 3NWJA 3KQKA 2YWGA 4C0BA 1RRCA 3QOFA 3CNNA 3D3QA 1KNXA 1Q1ZA 3T5GA 1X8LA 1ZJ6A 4CEHB 4PXAA 3ZIAD 721PA 3BFKA 4C2UA 4Q9LA 3BBPA 1EFUA 4TT3A 4DLVA 2JLRA 3LVQE 1G8GA 3LX5A 3PG5A 1YR7A 2R65A 1ANKA 4AK9A 1KK1A 4OQNA 1W4BA 5HTKA 5KTYA 4BGDA 5JCZA 1Z8FA 2IUSA 4DLRA 2PCLA 1GL6A 1GITA 1KKLA 1Z29A 4KYIB 2O0KA 1NY5A 3SYKA 4BFZA 4XD7D 5CLLA 1MABB 2YV5A 3WYAA 4LY6A 5EXPA 4AYXA 4CZ2A 4EFLA 2ZETA 2VEDA 2VHTA 1YHNA 5CM9C 2QAGC 2CHQA 4WXRA 2R6GA 1OIVA 1QHHA 3B78A 1NIPA 3KUCA 3L8YA 2CEAA 5JJIA 3A4NA 4NH0A 2V4ZA 3SHFA 3OFND 4RD3A 4RSGA 2ZI7A 3JZAA 5JEEA 2W2XA 3ZJYA 5K8UA 5JEDA 1NJGA 1BYUA 3WY9A 1KDRA 1VG9B 2BKUA 2GETA 2O8FA 4B33A 2FFAA 4PTLA 4MH0R 5FPYA 2XZLA 1A4RA 5J47A 2XJ4A 5K8TA 3UMRA 2ERXA 1L7VC 4TSFD 1GNPA 3LAWA 3F3YA 3CX6A 1BKDR 4HAWA 4BECA 3UMSA 4AYWA 4JLPA 5KHOC 3HWSA 4DB2A 1OHHD 3BIFA 1GTVA 1W4AA 2ZJYA 4F4IA 4B44A 2O8CA 2AL7A 1EX6A 2G0NA 1HT1E 4PX9A 3U3JA 4AWXA 1AQYA 1JNYA 3K0CA 4MRNA 3LXRA 3V00A 4I4LA 1U0LA 1HTWA 5GVRA 1UEIA 3R7WB 3K70B 3ZZ0A 2GXUA 1LB1B 3RLFA 1N6PA 1XEFA 2BMJA 2HCBA 2WAYA 1OXTA 2QPTA 2X8AA 2JCSA 2NTYC 1U8AA 3CR8A 3REGA 2XTNA 2DPXA 4D81A 2JAQA 3GLGA 1YQTA 2JJ8A 4JVSB 1GRRA 3QBTA 1CJMA 2BMDA 1KI9A 2OLKA 2Q3MA 3TAHA 1IN8A 3L8ZA 2IX3A 1GKIA 1WE2A 4ZV4A 4U7DA 2DR3A 2NO6A 1Z6XA 4RVCA 2QROA 2ZRBA 1CIPA 5LD2C 1CR1A 1VKJA 3SZRA 4PHHA 3FWYA 3AVPA 3P26A 3HYRA 1NVXQ 2BC9A 1W0KA 3RAPR 4MDEA 5C18A 3GLFB 2IF2A 2NZ8A 3UWOA 4DJTA 2IF0A 3VKHA 4ESVA 4JSTA 3U7HB 3CLVA 2CDNA 3HYTA 3KXKA 2MMGA 1W7AA 2VIIA 3FFBA 1DELA 2QMHA 2FPMA 4JJKA 3QKSB 2XGJA 2WWXA 4NONA 1ZD8A 2GCPA 1G18A 4ZCIA 2WHXA 1DS6A 2BV3A 2FPKA 3B2EA 1HE8B 3BORA 3C7KA 2GF0A 1FP7A 4MRRA 4DT1A 1YR9A 1E2QA 1ELOA 1HA3A 2QU8A 3HPRA 3SQWA 1DO0A 1NSFA 2FU5C 2FGKA 3MJRA 1AN0A 1YJ5A 3CRW1 2YINC 4YDSA 4NCKA 1L8QA 4GRAA 4G0NA 4Q4AB 3F5FA 3EIHA 5DLQC 1MO5A 1BS1A 3WP0A 3OHMA 1ZCBA 2D2EA 2JLSA 1OYWA 4ACBA 1RW4A 3BB4A 3QEJA 1G8YA 2Q3HA 1E9FA 1UBEA 4A0HA 5DI3B 1NLFA 4FINA 5AJWA 1MV5A 2BIFA 1FQKA 1XD9A 1GDDA 2AX4A 3KKNA 4IOJA 1M34E 1U2RA 3A37A 3LLUA 2VLIA 3MSXA 4OQLA 4AKHA 4E03A 2KJQA 4LJYA 4N3NA 3UK6A 2XSZA 3Q85A 3KTAB 2A30A 4G01B 1OPXA 4KLNA 2EFGA 4LJ7A 2GVZC 2WIBA 3P32A 4OHWA 1OV4A 4DLUA 4B6EA 1F3OA 3AF0A 4KFTA 3WP1B 5JWHA 2ZYTX 3VU9A 4Q1DA 3AVTA 3THWB 3MMPA 4C7OA 4GNKA 1XWIA 5EE5B 3CH4B 1KYIA 3VX3A 2VP0A 4A15A 2CL6X 5E95A 5TARA 5DO9A 3CB4A 2ZS8A 4LHWA 4RZ3A 1SVIA 1WDTA 1N25A 2HUPA 1US8B 4AC9A 2ZANA 4NMMA 3GLIB 1E2JA 1XPUA 2FNAA 4CEJB 5EE1A 1TNDA 2BEJA 3M1IA 4IXNA 3T1OA 5L3QA 3KX2A 3UPUA 1DO2A 1R5OA 3U2QA 3B82A 5DYIA 4DDTA 5JI3E 1VCNA 2FV8A 4Y0VA 1PLLA 2NPFA 4BFWA 4DSNA 2OAP1 3IO3A 2DFTA 3TUJC 2ERYA 2BDTA 1Z0DA 5KO2A 2C98A 2J45A 3TE6A 3MWJA 1KK0A 1E94E 4XWOA 2FG5A 2WMOB 1II0A 2ZJ8A 4KO8A 4QJ5A 4U5XA 5JFGA 5ELXA 2IYVA 2MMCA 3F0TA 1JAHA 4D4MA 1XEXB 1JBKA 2CLCX 3B1YA 4HZUA 1HV8A 2OUKA 1SVKA 1ZRHA 1NN5A 1B23P 3U3RA 1D9ZA 1KI3A 1KO5A 1LFDB 2DBYA 1S1MA 2JA1A 4ZDWA 5BW8A 4DZZA 3FHTA 4IOMA 4F4JA 2JDID 1AA9A 2WPDD 4Q18A 1HEIA 3EIQA 2PLFA 4IEEA 1W5SA 5CDFE 1HQYE 2IA5A 1TF7A 2PMKA 3QXHA 3K0CC 4LJ5A 2RGGA 1E98A 4MGYR 3RDPA 1OW3B 4DEYA 2AD1A 3OEED 5J4YA 1CU1A 4A82A 3G0HA 3DM5A 3OFNA 4LHYA 2FEMA 3TJZA 4Z8XA 2GZAA 8OHMA 5DHAA 2CBZA 4DBLC 4GFDA 4URZR 5GADl 1QHXA 4DWJA 3V9PA 1J8MF 2GJ9A
chains in the Genus database with same CATH superfamily
2REQA 4XDHA 1ZJZA 3KELA 4YRGA 5CLFA 4BQRA 2QVXX 3MCAA 4U2BA 1UDWA 1QO7A 4YGYA 4ZU3A 4CMAA 4IIUA 5AUNB 2ODQA 4H6PA 4IJVA 2ORED 2PL9A 2A9QA 3LVRE 3BHNA 4QVKA 2HDHA 1BCRA 1EX9A 4PZCA 4KOEC 4LXUA 3UMGA 4PRYA 3TH5A 3CVUA 2FRDA 3OM8A 2WWRA 1Z0UA 1VE7A 2Q46A 1P6XA 1KKUA 2GZSA 3QTLA 3SE7A 5BNZA 5J43A 1TF5A 1N33B 1RAIA 3IVAA 4NYIQ 4F6LA 1AV7A 4TL9A 1KETA 4GXRA 2PT9A 3L84A 3KYIB 3W77A 4EUSA 1CB7A 3H5NA 4XEHA 1Q0SA 5CEJA 1IJEA 2IW3A 4XWWA 4N82A 2XXAA 1NTOA 4KR7A 3L1JA 3ZE7A 3ZZNA 1ZG3A 3L0CA 1FE8A 5LMCA 1I6KA 4HQ0A 4RORA 1SBTA 3ZD9A 2M6KA 1DWOA 4ZMSA 5PGMA 4QA9A 3RJZA 4UFNA 3S2IA 3ZE1B 4TKUB 4Z1OA 1ZD5A 4IDHA 4R8SA 5ADUS 3FOBA 3LI2A 1UBLS 2CNDA 3SEZA 1JU3A 2XADA 1JTVA 2AI2A 4MV4A 4ESHA 1AMNA 2XEDA 4X20A 2DWPA 2C2HA 1CDOA 4MKFA 3WYFA 4R1QA 3RF7A 1QKIA 5EJIA 2H0QA 1XZMA 2QL5A 3P0HA 4X1KA 2OQVA 4ARUA 1TLTA 5BSFA 3IJRA 2CD7A 2OHGA 3R5XA 1M2NA 4DBZA 3Q7SA 1ADJA 1RFLA 1JHXA 2QZ4A 2ZI3A 1SUFA 4AJJA 2I6GA 1XWFA 3KK0A 5A4IS 5JNVA 1SURA 4QOIA 4DABA 1NZJA 2BMEA 1WEKA 2IGTA 2CN1A 4BXOB 3R9XA 2JGRA 2RHMA 4KXXA 1EK6A 2O7VA 3TZHA 3ZGZA 1WSAA 4DC0A 4LXQA 4CMBA 5DBIA 3OOEA 5KYXA 4P31A 1OLOA 4XUCA 3AJRA 5IDXA 4TL8A 1ZM7A 1E3IA 5EWMB 2JI4A 1IIRA 2J4CA 2Q2NA 3L0YA 5DM1A 2AN3A 1QQ7A 2NZYA 2P2YA 3OTOB 4BNDA 1AKMA 1IXKA 4B8YA 4PG7A 5JSKA 3AR2A 1RM0A 1YE8A 3QWBA 4YJ2B 1G3RA 5JYBA 3SJUA 4EGQA 1JQAA 2J30A 3OTGA 4OJNA 2PNJA 5A0TA 2OV4A 1GPUA 3H8SA 3EBOA 3PR1A 1L5KA 2FDCA 1QYCA 1IQUA 1M2OA 4UCFA 4ZGWA 1JHAA 1X94A 3SBEA 1S2DA 3COJA 1K89A 1FYFA 1EU1A 2NSLA 3UWSA 4R3UC 3TG8A 5KPJA 5CVEA 1LDGA 4GSYA 1G1AA 5LD2B 5EPUA 1ML4A 3BK1A 1SCDA 3RASA 1MGOA 2P5UA 4TYMA 3VKFA 1WLSA 3AXTA 3MQ2A 5IJ0A 4M1TA 1GPKA 3MERA 2BCGY 1K5GA 4NSNA 3SZOA 1KXJA 1G0NA 2GBLA 1L5YA 2ZBQA 3K31A 5H3LA 4JP8A 3U31A 4O3MA 3PXBA 3H1EA 4P58A 4LSGA 5JZSA 1I4EB 4AVYA 2CFSA 2JFWA 2ZBRA 3M6VA 3NEJA 3O8RA 5F9MA 2H92A 5C46F 4Z3DA 4BRUA 4ARBA 3ELUA 3HRHA 1T9BA 4YP9A 1XHEA 2R1VB 1H65A 4WCVA 1DBPA 2R8XA 4HQLA 1Q1EA 1K5DA 2WJ6A 2X0FA 4YDHB 5BV0A 3BE5A 2ERCA 2WIAA 1I0LA 2EQBA 2XF2A 2MINB 1XU7A 4OHXA 5AXAA 3I23A 3VVCA 3R4VA 1Q7EA 4DA6A 4JBLA 1AKWA 2XUPA 3CZ5A 1NE7A 3I6IA 3IAXA 2DOKA 4KV9A 3U4QB 1I51A 2QX9A 3ED5A 1NC3A 2HNAA 3GVHA 1EIZA 1L5VA 2OZEA 1LV7A 2P4UA 2BR4A 3LKZA 4JOBA 2JKZA 2Q4TA 4P81A 3V7WA 3I42A 3V8EA 4CBVA 5AM4A 5L4LA 1KZ4A 4XGQA 2XUHA 3U80A 4I08A 3IGFA 2J33A 2PQMA 3KJQA 4HUQA 1H9CA 3D6UA 4HMPA 3LO8A 1PV2A 4XXHA 4RJIA 1RWNA 2YV3A 2EAUA 3S70A 3MT9A 3H6GA 3JQBC 5IDYA 2O5CA 2ZXUA 1ZISA 1RYDA 2WG0A 4KGDA 4CF4A 1YA4A 2P7HA 2BTQA 3KTFA 5EIEA 3F4BA 1RWOA 1EHCA 4M9UA 2X5XA 3ISVA 2WA1A 4MHOA 3GLKA 1QVVA 2GZRA 1KFKB 2PGXA 3DMRA 5TNXA 1KFCB 2BGLA 3M9LA 3H1FA 4MYTA 1FNBA 3RNOA 2X22A 4KRYA 2C04A 4C7XA 3NW9A 4BZZA 4E6EA 2Y1CA 3BTUA 4DRZA 4N48A 4KUHA 3CQ9A 3LXMA 1BU5A 2O8VA 4B09A 3EVAA 4D5EA 4H7KA 1G19A 4I81A 4DA0A 3K8QA 3TW0A 3LWDA 2ZJAA 3ZY4A 1TMYA 3QFSA 4I50B 2WIDA 4GP7A 3VTZA 1N1DA 5A02A 4RULA 4ZKDA 5BURA 3SDBA 1LI5A 2ZRNA 4U5QA 1T10A 1M7HA 3UVEA 1E77A 3E5MA 2RGRA 4G0WA 5EMLA 1MT3A 2ZI5A 1TJNA 2DWOA 1H69A 1UJNA 5LQRA 4AKIA 1FMCA 3E18A 2PSDA 4EG6A 2QTFA 2ZW9A 2HRBA 4DB4A 2HWWA 4KSYA 4PIPA 3GCGA 4MI9A 3MCWA 4NESA 3WYDA 1OD6A 1K5HA 2IIQA 2COKA 3DEKA 5D3MB 3ZE0B 2PUAA 4MUJA 2WE7A 1AB5A 2NV0A 2Y0PA 3D2LA 3SQDA 1EGVB 1N2ZA 3LHDA 4C20A 3DHNA 3NVDA 4D56A 3HJTA 1QOQB 4M88A 4NOKA 3FE2A 3AETB 4TV9B 1PR9A 2GVNA 5BSHA 5M5BA 4NMHA 2BKEA 2CFOA 1NUTA 1Z8DA 2V7QA 2AG1A 3D7MA 4FS8A 1M0EA 4MJXA 4G63A 1XZNA 3L1KA 3O6VA 4ZIRB 2EVWX 2VI5A 4H7EA 3N0VA 2CUNA 2J3MA 1CDZA 1SBCA 2D0IA 1JHQA 1R0BA 4II7A 3ODGA 4YAJA 5G1PA 3WB1A 4B6RA 3T15A 2XUAA 1XPJA 4R9UC 2M6SA 1R18A 3RIHA 2BKVA 5BRJA 3I73A 3OEHA 3QM1A 5HKOA 5A4JA 4LSMA 2ZVJA 4PAMA 1U0RA 3ANLA 4Z4FA 4EMUA 2E2WA 3E5NA 1F8UA 5ALIA 1KQNA 4J0QA 1RAAA 4JI3B 4D25A 2IH4A 1OOEA 1HKUA 2IOYA 4HFNA 3WRYA 4ZPXA 2CLLB 2Q5LA 3DVAA 3UGJA 4LJ4A 3VM6A 5CFQA 1T2DA 4QSHA 5CK4A 1YA8A 1KXZA 2C7GA 4I8XA 3CLRC 4PGGA 1DT3A 4MI3A 4GOKA 4LX0A 3V1YA 2GILA 4EX6A 1L3CA 2PLRA 4HNQA 1U28C 2WHQA 2QX6A 1EVEA 1N7IA 1SUDA 2BDEA 1I0IA 2FPUA 1O4WA 4RTMA 1Y8RA 2YZ2A 4HWSA 4C6TB 4JFAA 2GWRA 4Q00A 4TUYF 2W6ZA 1DHRA 1YZ3A 2QLMA 4J9VA 1RNLA 1SC4A 4PXSA 3VRHA 5IHPA 1C80A 3ADDA 5JCJD 2A5GA 3W34A 1WPXA 1J2JA 3I64A 3ICCA 5LB4A 2MHCA 5AJHA 4CKWA 3V7NA 1SJ9A 1DU4A 1RKXA 3CUTA 2J7PD 4D02A 4NE9A 5M3BA 3U3XA 1F5SA 4WZAE 4ITRC 4ETMA 5DEIA 3IP6A 2JFNA 2QEQA 2HTFA 4HEQA 4LI3X 3B12A 4Z9FA 3RSOA 1EXMA 4BYGA 5BPFA 1PW7A 1UXJA 1YB4A 2QY9A 3CN7A 3WZ2A 1VMKA 3GLHA 4MOWA 1UKAA 1EKXA 4M7WA 2PMCA 5FNVB 4E4YA 3PX3A 3H0CA 3C3WA 4BFXA 1JYFA 5I7UA 1IJFA 2YYZA 4NBWA 3RFCA 3CT6A 3FY4A 3KIPA 2W6NA 3B9RA 1TEVA 3HKCB 4HNTA 3A06A 1A4UA 1JHUA 2Y92A 3P9SA 5BV7A 3K6KA 3LQ1A 4AX4A 3G9UA 1L1FA 3VYVA 3AVUA 5C1IA 4F3CA 2QD2A 2EKQA 1L7NA 3R41A 3INGA 3UJHA 1MZPA 2OHXA 2H6EA 1ORRA 2J59A 3DOCA 3EQ8A 2VDUE 1WMDA 4QGAA 1I14A 1PK9A 2OD7A 1YS2X 1H1LB 5F9HA 3FOZA 2VAVA 1MJFA 4C0SA 2XI4A 1BS2A 4DUGA 4J0HA 5DTJA 3JQRA 3UA4A 1G5RA 3VMMA 2QUJA 1WOYA 5DM60 2G36A 2M9MA 2UZ3A 4KJZA 2GD1O 4IZOA 4L8VA 1M1NB 4WKBA 4XD2A 3GZNA 1K7YA 2VT2A 3I6ZA 3IR5A 1OWOA 3O93A 3AM4A 4N49A 4CLOA 3P7MA 4TQ9A 2G1PA 1BXGB 4EHBA 3D8RA 3L8EA 4KJXA 5DGIA 3DXYA 5F7ZA 2G08A 3O4VA 3C98A 3EPLA 4XQEA 4CDMA 1D2RA 2JFZA 2N42A 2FPXA 4QVGA 1CEQA 1F17A 1Y6ZA 3ND9A 2QPAA 2ZK7A 3TNJA 4BJHB 2QDKA 2NU9B 4Y2YA 1ZMRA 1F7UA 1XNRB 4FI3C 5F3RA 1CF4A 3G8DA 2BGJA 1BE0A 1U3DA 3P45A 2DYKA 2FW8A 2ZAYA 4KIUA 1A98A 1RAHA 1ZJJA 1QG0A 4KXYA 5HIMA 3P9CA 1CDEA 2XSZD 4HG2A 4DCTA 1O96A 1XXHA 3NV9A 1ZNYA 3SY8A 5E2IA 3PKJA 2GPAA 2EJVA 4B3TB 1C14A 2Q4RA 3AF1A 4HNRA 1Y98A 5C52B 4WESA 3IUJA 2EW8A 4ICIA 4DG5A 3RARA 1UIMA 3TTTA 2WKSA 5HVNA 2MSNA 1IM8A 4CMIA 7ABPA 4I4TA 2KPOA 1FMLA 4JWKA 4M22A 3R3HA 4R01A 4PRZA 2O2YA 1W96A 3SOZA 4EECA 4H3VA 5G0VA 4PCLA 3H9CA 2NLOA 1N0WA 1SXIA 2AGVA 4UOZA 2RB4A 3BGVA 2GMWA 4X97A 3RYFB 5E1MA 3T34A 3QX3A 2VSQA 2PUJA 3ITDA 4LYAA 4RFSA 5IBCA 9MHTA 2ET6A 5H80A 4M1OA 2FFBA 4P33A 3SQNA 5I8PA 3IMFA 1O0CA 1IJBA 2OSBA 5JROA 2BW0A 2IY9A 4HGNA 5IK2A 3ROQA 4EVSA 5HW0A 5J1SB 3LCCA 1I3KA 3QI2A 3GRAA 4OGGA 4R7ZA 3SIRA 4RH1A 2R4UA 1A9QA 4B46A 2I0FA 1ZVQA 2H18A 2RGCA 2F1JA 2VRCD 5F5NA 1BQ3A 3A2MA 3BE6A 1Z2DA 3D4NA 3JQCA 3H2ZA 4B7ZA 4EGCB 1DDIA 3CLTC 4TYYA 1DJMA 2WD7A 4G5SA 5DIFA 5JY1A 1XDZA 3OT1B 1JIKA 5FI5A 4ERXA 1JEYA 3GP5A 2C4UA 3BWEA 3IAM6 4KQEA 4R8MA 4CMGA 3I76A 1LDBA 5DGDA 2AEEA 3HNOA 2YIDA 3EGXB 3NP7A 3P8ZA 5DTQA 3H1GA 5H68A 3SIWA 4RL6A 4A3SA 1VB5A 2RGUA 5FL3A 4LHSA 3U48A 5LWQA 4MR7A 4G0PA 4DARA 2OBNA 3C3MA 2WIFA 2JNWA 3PLRA 1YRQA 3RIEA 3VC3A 4DHEA 4GSLA 3ZCUA 1JPNA 1ZP6A 2HXYA 5FOQA 2CXRA 1MJNA 1DLJA 1EDOA 1U0GA 4WUTA 1U5AA 4H27A 3CNEA 4OBWA 2PSEA 4C87A 5LDGA 3TOCA 2FR8A 4IGKA 5LJLA 5CLQA 5GIPE 1I2CA 1N2GA 2HZBA 4Y18A 2ZSEA 3LLVA 4C22A 3AZOA 2ZE8A 2VPWA 4J0IA 2GPBA 5B53A 1LBHA 1S2OA 1BDBA 3CG4A 2I55A 3ADCA 1A27A 1TKAA 4I55A 4CE6A 2ZRMA 3INYA 1VYUA 5ILOA 1E9RA 1P0CA 1J23A 1FFDA 2H7CA 3GH3A 1EFRD 3B9PA 4WNIA 2O3TA 1RBZA 1YE3A 3NHZA 3U7FB 1UMDB 2FZWA 2O50A 2OG1A 3GFOA 4NCXA 3PUKA 4FC7A 1L1QA 3UATA 2AZDA 2EBHX 1RWBA 1O8CA 1E5LA 1U1EA 1X1BA 1E2GA 2G06A 2RHDA 2VWQA 2RMKA 3S0JA 2HHJA 1FSSA 1NHWA 3H5AA 4ZU1X 4G5HA 1NBME 3G5TA 2C94A 1IY1A 1KKMA 2A9PA 4RHYA 4Z4QA 4DR6B 3D8HA 4DOMA 1ZESA 3FFTA 1Z6GA 2IXBA 1NVDA 3H04A 3IB6A 3INRA 4TM7A 1LI4A 4CDNA 1QQAA 3ZJVA 5JJKA 3KKOA 5JS2A 3IEVA 3FCXA 1ESNA 1ODTC 1T5IA 3LY7A 1CUIA 4RKEA 1EBBA 3QG1A 4RMNA 1OAOC 4AUNA 1RM3A 2IDJA 3CVOA 1JG4A 1N9ZA 1VYVA 5GJCA 1B8PA 4BQIA 1SXQA 2VJCA 3H2BA 1EXVA 1KI1A 1X74A 1A4IA 1XRRA 3AR6A 3ICOA 3SS7X 1NJFA 5EJEA 4WJZA 2ZWIA 4LQLA 3CXRA 3ZZUA 1UBUS 2F43B 4DV6B 1K98A 1JDJA 1Q7BA 2B20A 3C4JA 2PFSA 1RQ7A 4LC1A 3BL5A 2JIQA 4RXTA 2BJVA 3NUGA 1RYFA 2B4TO 4QJBA 4BNMA 1VBMA 3FGOA 5EG5A 1NA5A 1YB2A 2QY6A 3LCVB 1EEXB 3GCDA 4WX2B 5HCNA 3OPMA 2QM0A 1DIGA 1RYHA 4V0ME 1JUDA 1KC1A 5H16A 1W1UA 3EC2A 2A14A 3SSMA 4L9WA 5COAA 3UV6A 4XYEA 1WXQA 2QTNA 3RVMA 3STXA 3H5TA 1T9AA 2O59A 5EI5A 3NTXA 2E18A 2FPOA 2VTBB 3BGIA 4NBRA 1UP4A 1ZAYA 1JZTA 1EJBA 3LK7A 2PSJA 3JZFA 1DV2A 4KVGA 5D87A 4IFBA 2AFRA 3QMMA 4OJKA 3F3SA 3CNQS 1SZJG 1E6EA 1NUHA 2HIHA 1XQ9A 4O4LB 4YJFA 1Z7EA 2REXB 4D4LA 1U2SA 3OU6A 4LG1A 4OOEA 1OGYA 2V58A 4TTQA 5FD8A 3FCUB 3GGOA 5CH8A 2VCEA 2VJKA 2XMCA 1VE6A 3L7IA 4N6OA 3DEZA 1JRLA 2GSWA 2NAFA 4GXNA 3PEEA 4YT2A 4F91B 2G8NA 5ISMA 4MYRA 4KQFA 3WKCA 4YDQA 2DB3A 4LRQA 4H2DA 1P80A 1JSCA 3GUZA 4WN9B 3G9XA 4E09A 3H0KA 1QRAA 3JWHA 1NN1A 1Q0RA 5IARA 3PRJA 3O9MA 3UM9A 3OWOA 1XX6A 2E49A 3KQWA 4PYQA 3PD0A 1E7SA 4IUDS 4JGBA 4V0LA 5DSZA 3ZNQA 3FLAA 2QGFA 4HN9A 3MMZA 1GT6A 2C82A 1TLFA 2KLBA 1VTKA 3I6YA 3AEYA 4K9RA 5CYPA 1JKIA 3ISJA 4FVTA 4I19A 3WFJA 1JR4A 5KTRA 5KTNA 1CRPA 1C4XA 2E85A 3U7QA 2HMUA 4L07A 1W4LA 3MWYW 1YSCA 1PW5A 2FG6C 4UHJA 1QIKA 2X41A 1V7CA 2GBFA 3GEBA 2WQ7A 3FWKA 5KKAA 4EYGA 1ZVMA 2VJLA 4M0EA 4EB0A 4EKIA 4BUJA 4TKVA 2AMVA 2HH9A 3MWKA 1UBHS 4GLOA 1EMDA 1SVMA 3UUWA 5L3ZA 3E81A 3CUUA 4AZ3B 1XZFA 3K9HA 1MT0A 4RVGA 1AKUA 2WU4A 4N3GA 5TQ2A 3EPKA 2JEOA 4I46A 5EEGA 3SZ3A 3AG5A 3NC0C 1IN5A 5IH3A 4FIZA 3C97A 1P7CA 2H7VA 4KP7A 1HFEL 1BGWA 1QE3A 3QVTA 1XDSA 1S2NA 2DUNA 3A7EA 4IHKA 3DLCA 1J8QA 2V55B 1VPDA 2PUBA 1QZXA 4ZP1A 2JFXA 5F3DA 3HBFA 3WB9A 3WWYA 4QU9A 2GZMA 4WERA 1C7JA 1UT6A 2OCIA 4RAOA 1DZ3A 4EGAA 4RTKA 1Y5RA 1F8GA 1LRLA 4NYJQ 2GXAA 3HR8A 3ZXIA 5IABA 4I5EA 3V4SA 3UWDA 1OH5A 3PQ4A 4NFYA 1WUYA 2J3EA 2VSYA 4B75A 1PS0A 3DD5A 3NDIA 1A9YA 2QUKA 5F1KA 4TRMA 2Q6IA 4UBIA 3VR1A 4GX5A 3VPAA 2CMKA 1LTKA 2HU2A 2VHWA 1X7ZB 3O4JA 4BMVA 4A2QA 1O8BA 2B36A 3G5UA 3MWEB 1CB0A 1Z56C 1LSSA 2W6PA 2I7CA 2KWIA 3ABOB 3H9JA 4JK3A 5CXXA 2WB4A 1OSNA 2F1HA 2WSMA 3NHJA 2Q6OA 2XDAA 1JR2A 3CFYA 3D8SA 3BA6A 3AH8A 5EXXA 2Z2XA 4FW8A 4ZT3A 3JQQA 3HJCA 3UT6A 1QP0A 2CKMA 2HQSA 2P69A 1KAQA 1UFOA 5GQSA 3TLCA 2LCIA 3GVXA 4ZVPA 1GEGA 5F21A 5F2NA 1XTZA 3DONA 4WZBB 5NLLA 1X7YB 2P5YA 1EGHA 2ZPAA 4KAJA 2D62A 1TC1A 2YR0A 2XB6A 3RS7A 2XCSB 4RKWA 3DTYA 3HMKA 1K0UA 1ST3A 4HLNA 3RNLA 2YOGA 3ZWKA 3T5AA 3O8CA 3LYAA 1G5QA 1NDHA 4W5TA 2DFVA 3M6AA 4G2TA 4JEUA 3ROPA 1QK4A 2GWHA 1U6IA 3W5VA 5I7WA 3T3NA 2HNKA 4G5FA 2P9FA 4RADA 1OXVA 4XW2A 3RKUA 2PKYX 3CNLA 5JC8A 4CM5A 4G0ZA 2QU7A 1TAUA 1ULBA 4KG7A 4CETA 2EARA 4FOLA 3KQPA 1PEKE 1ZYUA 1Z5UA 2PO5A 4LYGA 1D0IA 1S6YA 1CZOA 2GN1A 3PFGA 5FNZA 1TVKB 2J5XA 3W9UA 2FYTA 4PNHA 2VR1A 4DGSA 2EKZA 2B4QA 5EWLA 5JC1A 3OJLA 2FN8A 2H2DA 1BA2A 2AJTA 3E6AA 3M5DA 4LHXA 3DR5A 3S5UA 3TFWA 4I50F 4XIGS 2DUMA 3LZCA 3CY6A 3UB2A 1HMPA 3LC7O 1OI2A 5BWMA 1CUSA 3VR5A 1M5UA 2Q2QA 2Z09A 1NVTA 3BDIA 4YRNA 5J4HA 3EQZA 3L01A 4JBYA 1UCFA 4I9FA 2Z5FA 4F8YA 5AVZA 1NE2A 4D41A 4B6JA 1CJVC 2VNIA 3DS8A 4OKSA 1I5EA 2UYHA 1IHOA 1OR8A 2EG5A 2WP8J 5LZ5A 1LZKA 3ILVA 3OEYA 3ZH9B 4B3HA 4M54A 3MAAC 1VCMA 4BFUA 2HHHB 1H3EA 1XVUA 1TYBE 1GA4A 4LGVA 4CI9A 2JFFA 1SCJA 4FFNA 5FPKA 1BMFA 1HLFA 3VR4D 4QM7A 1LWNA 1OWNA 1FFXA 1TDJA 2FEXA 3EWAA 5B36A 1SAYA 2YWBA 4W5RA 1KYWA 1P39A 3MIZA 4DMRA 1PTJA 1VL1A 2ABWA 4AZTA 4DWWA 4TS1A 3OQNA 2F3UA 4DRXB 1OGIA 1E3TA 1QOPB 3OM0A 2C77A 2FWAA 1NQXA 1PJTA 4LV5B 3QF7A 3HC7A 2QAIA 2Q28A 3GD5A 4G41A 4NG4A 4L2IB 4G4IA 3A4IA 4ZT6A 2ZQ5A 3EODA 3RK0A 3MWFA 4MITA 3TTXA 3GA5A 1SKYE 1M34A 3B7GA 4WD3A 1TYAE 4HWOA 2V3VA 3K0BA 3OZWA 1ZL2A 2Y2UA 1A2QA 3AEKB 3ZOZA 2QVCA 4L5CA 4OHYA 3MLEA 2CYAA 4CCSA 1JSZA 1KBZA 4YMIA 3FAZA 4Y67A 3QV1A 3DBOB 1D7OA 5SV2A 3WLNA 4BZPA 1Q20A 4DSTA 3BCHA 1YMVA 2W6ID 3OQOA 1P1KA 5CYOA 2ASEA 2QM3A 1PD1A 2POQX 2Q4DA 4FE7A 3VSAA 1RXWA 4F6CA 3VV2A 221PA 1JP7A 1N2XA 5TSDA 3KM0A 4OXXA 5ALTA 2DPMA 1BOOA 5ICFA 4ZO4A 4F3RA 4BGIA 1OKKA 4CQLB 2W8ZA 1WQ1R 4BVBA 1AHPA 2YXLA 4DZRA 4MR8B 4IHJB 3EXAA 1YTUA 1GD1O 2XDQB 3SBDA 1H5UA 1KDVA 5HXAA 2PPVA 2W4IA 3DW3X 3ZKWB 4CLDA 4DDVA 2JZOA 2V9CA 5H81A 1PKEA 3CPJB 2A9KA 1XTKA 3BFJA 5TQJA 1Y3HA 3Q98A 2Z5VA 5ECGC 3RSFA 4K81B 1FDOA 2Q6TA 4XGNA 2OXTA 3I9LA 3KHUA 1U11A 4ZQGA 1W25A 1ECFA 1ND5A 1VRVA 3A1VA 5EIFA 3QE2A 1SBQA 1P81A 2OQIA 1EXNA 2BF7A 1QAMA 4AICA 5BUZA 5F9FA 5ICMA 1NVAA 3BMQA 3E1SA 2ZR9A 1RYZA 2E6UX 1V4NA 1E3SA 1FX0B 4Y6GB 1LWOA 4BMOB 2VKQA 3ZBPA 4JR0A 2EERA 2R4TA 4K1LA 3GBPA 4U6QA 3VDRA 4DY6A 2M1XA 2RHCA 4RJ2A 3ZEAA 1EVJA 1FYEA 3BRCA 3VSCA 1X1TA 2WG1A 4COKA 4MVJM 3KUDA 5JHGB 1FTGA 4AM8A 4JVMA 3VNVA 1DAFA 3A6ZA 1RP1A 2JI9A 4LKRA 3MRSA 3H4MA 4FBLA 1LK0A 5HKKD 4NBUA 4DMMA 4NJMB 2VOJA 3SLGA 4J3FA 4YCLA 1JR3D 5AM5A 5EJ4A 1I6WA 3ZHQA 1EVKA 1F2TA 1FFHA 5D1HA 3AVWA 2QDXA 4J1NA 5DHFA 2P91A 1E1NA 1MX3A 1G4UR 4OUKX 5I9LA 2C9OA 2HXGA 4GI3A 4LC9A 1CYDA 3B13B 3ZY2A 1ONPA 4OMDA 4Q9NA 3W6UA 3BHIA 4QELA 1S2MA 4CKEB 4HDRA 2VK8A 2X2EA 2FWJA 5HF6A 4JP3A 4X6UA 5CFPA 5AHKA 2ZT5A 2YNMA 4MYSA 2G17A 4Y9TA 4ZCRA 3NR2A 4JC0A 4ZPJA 3MGGA 4ZJPA 1PJQA 2J0UA 1T4CB 4DLKA 1HQCA 4KO1S 2NSDA 5CM2Z 4D9FA 4OY3A 1DBQA 3CF6R 3H2YA 3WAKA 2WJ3A 1Z6ZA 4WI1A 3CYFA 3WGZA 4GXTA 4I36A 1W9HA 1P5FA 4IQFA 1LSOA 4M98A 4OHMA 4RIFA 3I5YA 1GPBA 3BIWA 3G1UA 3EG9A 3H5WA 1V5GA 2R86A 4WCFA 2NYRA 2W2OA 1SCNE 2BTOA 3OCCA 2G76A 3PWKA 1NY6A 4WFJA 4N47A 4EMBA 1TKRA 3SKYA 2P6OA 3U61B 1EJ6A 1ZD9A 3PD1A 1MOPA 3OURA 1VL8A 4J0JA 1UKVY 1GTZA 3K3PA 4MUHA 4EA8A 1M1ZA 1IZZA 1Z4JA 1VJRA 2C5SA 2FUG6 4YRZA 4K9SA 5BQPA 1SN7A 4BBZA 1II9A 3DBRB 4OXKA 5G41A 3WWPA 2N46A 1GY8A 1R7RA 1YQUA 3H17A 3AP1A 4FYIA 4MS4B 3ZWCA 2JD1A 3DP7A 1TQ2A 4Y2HA 1IATA 5JNSA 5F52A 2A1UB 2BHSA 2XE7A 4MQBA 3TVTA 1US8A 3FGNA 2H08A 3HKDA 1ORIA 3EVTA 2ACEA 3NYWA 2ZXFA 1KDPA 3HCOA 2QYSA 3KFVA 1A76A 4EKDA 3MB5A 1PLKA 5EWJA 2D54A 4HN2A 1JECA 1NVGA 1EFPB 1N6OA 2XB4A 3HGQA 1W47A 1QHHB 1XAIA 2H1IA 3FVQA 1G63A 2ESRA 2BR3A 5I9SA 5A5FA 3FZYA 3H5IA 3VOAA 3QY9A 3O03A 3KDSE 2WD8A 5KYUB 3RHZA 3T9EA 1U3VA 3HN2A 2FJ0A 4AKTA 5KSZA 2EZTA 2DCUA 1W36B 1U8YA 4G1UC 3IXLA 4O2BB 2HF7A 1RKBA 2C2GA 4ZMBA 3NM4A 1KK3A 3F6RA 3LDAA 1DOAA 2NQ8A 1FRFS 2G88A 2GCNA 3KXPA 3S29A 2JGIA 3MUEA 4LZNA 4YQYA 3ZHYA 5BOSA 5DYYA 5GP1A 1WKBA 2P67A 2RH5A 4TTRA 3SHVA 2IL1A 3JV7A 4Z2AA 5AW2A 4J1TC 2G04A 3HXLA 2HRRA 2PGLA 3EQ7A 1YUNA 2DJ5A 2ACVA 3FTCA 2ATVA 3KALA 3KZVA 3LPMA 1J2TA 4K6KA 4UAGA 5DNDA 3T7DA 3U7EB 5IEJA 5SY6A 1FVHA 1E6KA 4HJXA 4YS6A 2WKRA 3RBAA 1WF3A 3V4OA 1GRNA 3HXPA 2Q5HA 2DEUA 5FOSA 4UOEA 4RTOA 3L3BA 1T8TA 2O3QA 4HQ6A 1CQPA 2EX0A 4LQDA 4EO9A 4MQ6A 4POAA 3VFDA 2OLEA 1QO9A 2PRKA 5LA6A 1CXZA 4O1IA 3IAHA 5EP3A 4WJLA 3B3JA 5JR3A 3H7IA 3AHHA 1EAMA 5EMHA 7MHTA 3FKSA 3B9BA 1PWEA 2LTAA 2XTMA 4K3UA 3LPCA 3WXMA 3GMDA 5NULA 1ODFA 4XQ0A 5LBIA 1FMJA 1U9CA 1SCUB 5A0FA 1OMOA 4QRDA 4I3HA 5BNIA 1UBCA 3GLVA 4KL8S 4B3JA 5IKPA 2DRIA 2UYGA 3BFVA 3LW7A 1JAZA 5EUCA 3OCZA 1FLNA 4NRDA 3SHTA 4PSAA 2DHRA 3UKDA 1PR4A 3ZVRA 3SYTA 1RJ9B 1YCDA 1NXOA 4GKAA 5JALA 4IIJB 4F38A 2PMWB 5JAQA 3U0VA 4F72A 1HNWB 3LMKA 4MVWA 5IYZB 2F4VB 3I61A 1FCJA 4FGLA 4QHSA 1UXGA 4L73A 2PTGA 4M8SA 2QORA 2GFQA 1EE2A 1XD2B 2VT6A 2W58A 2GBLC 2GO1A 4G1EB 1O54A 4P80A 1G8SA 2ZUUA 1L7MA 1WM1A 2KW5A 3BCSA 3DGFC 3HUDA 5I01A 2I7DA 2A0YA 5JZBA 4PSKA 3IOBA 5KCZA 4H60A 3H2IA 5FA6A 3WV5A 1DTWA 5IF9A 4TKUA 1U0HC 4OYRA 4YUZA 4MVJH 1L5MA 5CB4B 2Z6AA 4C08A 2ADOA 3GJ0A 4JWTA 1XEWX 1ZIYA 3DZFA 4EPRA 4U7PB 4AUEA 5JSHA 5EZYA 2I3ZA 5FTWA 1IPFA 5KC9A 2NP7A 3HVJA 4H1HA 3DKPA 2BZ0A 3NETA 4FN5A 4KNWA 4LDQA 2G6TA 3TXYA 1DWUA 1DJPA 1GEEA 1KAGA 1CHNA 1L8XA 4C6HA 5KOHA 2XCUA 3W06A 5DM70 2Z2KA 3L0SA 1G1MA 3EZ7A 5K0GA 1X7GA 2GDZA 1U1DA 5L8VA 1T4DA 2G7ZA 4YIHA 1ORHA 3E53A 3EVZA 3FYUA 3PC7A 4B0OA 2FSHA 2R00C 2RGXA 1UXKA 4N3AA 5TGZA 2BM0A 3S28A 4G86A 1VG8A 2R47A 4I1OA 1V3UA 2J3LA 3OLXA 3P97A 1F9AA 4G4SP 5THXA 3E7PA 1EWKA 3KR2A 4K9QA 4WOCA 3NH9A 4KLCA 3EVBA 3EISA 3U7IA 4CT0A 1JFVA 2B5OA 2F8LA 3HDVA 4I3GA 5EOVA 1LS1A 2E4UA 3WRWA 3C3EA 4G9EA 1K92A 4FGWA 2XZOA 5JU6A 4BKMA 4ZK2A 4HDSB 1L1EA 1IJKA 3OO1A 2EC5A 2FOXA 3CPHA 5HNKA 5G0UA 3TGPA 4NU6A 2BFBA 3FUCA 3A9VA 4CHTA 2VXYA 3VAAA 1CUYA 1RPTA 4UBLA 4XTCS 2Q3FA 2Y6VA 4HLDA 4Y2RA 3E23A 4GP6A 1IIBA 3R7BA 3BT7A 3DHVA 3VU9B 1KJYA 3ZYCA 3MT8A 2JI7A 4WW0A 4JI8B 1IZ8A 3F98A 3KQUA 4LQCA 2XX3A 3RSGA 4GGPA 1AU9A 2A0WA 2QT0A 1T5DX 2QVZX 1VDMA 4L4XA 4YRBA 5JYCA 3BM5A 2VHQA 1J8DA 2VF7A 4IMIB 1TT5B 5HE8A 3WE7A 1A5TA 3Q12A 5FHRA 2XLCA 3FMPB 2PH1A 3EZ2A 3W8RA 4JZYA 3E2IA 1XKTA 2GI4A 1TTHA 3QKRB 2NXCA 1T8WA 2ZUWA 4A8PA 3ONDA 3KEFA 1QZZA 4CM9A 3EFOA 4RJKA 1KJQA 4KIJA 3AW8A 2PNFA 1Y4DE 3AO0B 4ND1A 5F77A 4D9IA 1UZAA 1CVIA 2WG2A 3G59A 1NFRA 1QGUA 4F06A 4HCJA 2E82A 3JYQA 1XROA 2R84A 5FTJA 3HA5A 3EOBI 1ZI8A 3B2QA 4QOHA 1E7QA 1PX2A 2W6OA 4FCTA 4L8LA 2ZYAA 3SMVA 2CC2A 4UEWA 5AI4A 1XK7A 4DPMA 1DQNA 2J0SA 3THYA 2G9QA 3TO5A 1CY0A 4L4RA 4AG3A 4US1R 4GG1A 5HBRA 3QZUA 1P4RA 3W4IA 2RHGB 3I9FA 1M83A 1SHUX 4YT5A 2DTXA 2INGX 1MAHA 3VKUA 4L5YA 3RYCB 4PQFA 5KQSA 1UOEA 4M0KA 2B0CA 4KLZA 4W99A 3D8TA 4ER0A 1SKQA 4YN3A 3VYSB 2ZRAA 2DBZA 2IV7A 2WWYA 3NM5A 2XITA 3PR3A 3WLSA 1FW6A 5A06A 1YVDA 5EJAA 3DBLB 4QFDA 4COOA 4R9VA 4AMUA 1ZU5A 1W48A 2CJPA 4OJQA 3O8QB 2WVHA 3N86A 4JB8A 4R16A 1D5WA 2IPXA 1I7PA 2FPPB 4M49A 2MSWA 4RABA 3D5EA 1COZA 5SYAA 4QGGA 1ISGA 3EJWA 1R9JA 4BFLA 1Z4PX 1DAOA 3V1KA 1XYGA 3FDXA 1T3HA 2H4XA 3RRJA 1FRZA 1TZMA 1TCVA 1NXTA 4OK3A 1P19A 2W6MA 2ZR7A 4G9BA 3DEJA 1W73A 3SXUB 1NWCA 2RHWA 2GFIA 1NXWA 4L08A 3WZLA 1LI7A 2WAXA 3ZNNA 2FQYA 1CG6A 2FWRA 2Y93A 4UDYX 1WPRA 1C29B 1XCJA 2CXTA 1U1CA 1Z4LA 2H7XA 4AXXA 5L7TA 3GT4A 1ISFA 4DJFC 1JFFB 2ZJ3A 2R8YA 1A7KA 3JQ9A 3TI7A 2AT1A 2HLNA 3PICA 4HNAB 4MZDA 1M2HA 1R1DA 2FEAA 4OQMA 4ZT2A 1QK3A 5L7YA 3KFXA 3U4IA 4FHDA 3WTBA 4F8EA 4Y0NA 1NWHA 3CPEA 4FJ2A 4NH4A 3DMTC 2A35A 4B48A 3DHEA 5HF5A 4IDBA 4WOKA 1KQFA 2OP1A 4KAAA 2P77A 3ETDA 3CC8A 4JASB 1FSGA 5D3MA 5JFTA 2JFOA 3CO5A 2JS7A 4BO3A 1NQOA 3O4IA 5CR9A 1QQBA 1BWSA 2CHGA 2WF6A 5J40A 1UMBB 1Y42X 4FD3A 1VLJA 4IYRA 2AZ4A 3EUEA 3UN1A 2QLJA 4Z5XA 1ULHA 2PJUA 1JIVA 2WWWA 1XMQB 4R69A 4ANFA 2PE5A 4JYPA 3GMSA 3D6AA 1A82A 4AIIA 2HIGA 2QS9A 4ZIRA 5A4AA 1F0YA 4KZKA 2D5BA 1E9VA 1NJ8A 2ZTSA 1RC8A 2P0AA 2XUFA 3DMPA 3O8OB 2GK6A 4NR0A 4QWWA 3BJZA 5JTTA 2D5AA 2VQDA 2XXBA 3KUUA 4C3OB 2JIDA 1T8PA 4X91A 1XDDA 1BU8A 2XA9A 4M1KA 3SZGA 4DYDA 3ZDAA