4FMTA

Crystal structure of a chpt protein (cc_3470) from caulobacter crescentus cb15 at 2.30 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
209
Chain Sequence
DVQGPDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChpT protein
publication title Branched signal wiring of an essential bacterial cell-cycle phosphotransfer protein.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 71
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fmtA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fmtA02
1TBWA 1AH6A 5CTUA 4URMA 4HZ0A 2BREA 4MOTA 4NH9A 2ZKJA 2Q8GA 3R4NA 1JOYA 2YEDA 3INXA 3O2FA 3G7EA 3NXSA 3OMUA 4AWOA 1H7UA 2BU7A 5D7DA 2XDLA 4XC0A 2BZ5A 3TK1A 4O09A 5FNDA 1MX0A 3ZRXA 2XDXA 4AS9A 4BIZA 4PU9A 3GIFA 4FCPA 3HZ1A 2QM8A 2IWUA 2YI0A 3U2KA 3ZXQA 2XX5A 4MPNA 1YC3A 2CG9A 4CWPA 1THNA 2YI6A 3WHAA 4AWQA 2YE4A 2YEGA 3D0BA 4MTXA 4GT8A 3TZ2A 2YEBA 4L91A 4JYBA 3EHHA 1AH8A 2YGAA 4LC1A 4EFTA 2XJJA 4O04A 1Y8NA 3MNRP 1BKNA 2FXSA 5FNFA 4URNA 4JAUA 4U7NA 2WI7A 2VWCA 1NHIA 1Z59A 5IDMA 1UY9A 4MP2A 4FPPA 1Y8OA 4R3MA 3ZKDA 2VW5A 4LPBA 1Z5BA 2IWXA 3K99A 1R62A 2YEIA 1GKZA 2CCUA 3B27A 2Q8FA 5L3JA 3BM9A 2BU5A 4KSHA 4H7QA 1QYEA 4L93A 5M4NA 2YE9A 4EGHA 5FWKA 3C0EA 4PL9A 3OWBA 3RKZA 1Z5AA 4WUDA 4XDMA 2JKIA 4BAEA 4YKTA 2XJXA 2BTZA 4JASA 1TH8A 3R4OA 2YEFA 5CF0A 2HKJA 3Q5KA 1EA6A 4EEHA 4KFGA 3CRLA 2CH4A 1UY8A 1YT1A 1KIJA 4CE1A 5J71A 1BXDA 4AWPA 2YE8A 1NHHA 3K98A 4ASFA 1UYKA 2ZDXA 4KP4A 4CE3A 1EI1A 2YKBA 2WI6A 3QDDA 4CE2A 2QG0A 3OW6A 4YKUA 4Q20A 2YGFA 3T1KA 5B1OA 1B62A 2BU2A 2XK2A 2YE2A 3K97A 3FT8A 5C93A 3R91A 3B25A 2WEQA 5D7RA 4XIPA 4LWFA 2WI1A 3ZRVA 3WQ9A 5IN9A 2WI3A 2YEAA 3CGZA 4I5SA 3B28A 4L90A 2H8MA 4L8ZA 2YEJA 4UROA 4KSGA 2YE6A 3EKOA 4LWIA 3O0IA 4FMTA 1S14A 4U93A 1ID0A 1YERA 2JJCA 3HZ5A 3O6OA 4X9LA 5D6QA 5M4KA 1KZNA 2QF6A 3EHFA 2FWZA 3EHGA 4GT1A 3GIEA 5M4MA 2YJXA 2YGEA 3Q5LA 3LPSA 1UY6A 1Y4SA 1UYIA 2YKIA 3R4MA 2O1VA 4MB9A 2O1UA 1YSRA 3ZXOA 1B3QA 1B63A 2CCSA 3VHAA 1BYQA 5F3KA 4JQLA 3TZ5A 4L94A 2P67A 2GFDA 3A0ZA 4NH8A 1YT0A 3R92A 3FV5A 5M4EA 3D2RA 4FCQA 4URLA 1YSZA 2VCJA 4ZKIA 2XJGA 2XDUA 2BU6A 5CTWA 4ASAA 5D7CA 3RLRA 3T2SA 2FTKA 4YKQA 4XIQA 4GQTA 3ZCCA 3R4PA 2XDSA 1I5AA 2XHRA 4K4OA 2WI2A 1U2OA 2YE5A 2YK2A 2QM7A 3TTZA 2XHXA 3SL2A 4CWSA 4JYCA 3TUHA 5M4HA 3GIGA 1Y8PA 3U2DA 2XX2A 3PEJA 4GEEA 4XD8A 1UY7A 3VADA 2LFSA 2LFRA 2XABA 2BYIA 4CWQA 4V25A 3NMQA 4ASGA 1QY8A 1UYLA 3HHUA 4B7PA 2Q2EB 4LWGA 2QFOA 2YEHA 2ZBKB 4YKYA 2HG1A 4BQGA 2ESAA 1GKXA 4XCJA 3TZ0A 4XTJA 1ZXMA 4XE2A 5CPHA 1F51A 3CWVA 3IEDA 5J6AA 2O1WA 2YKEA 3INWA 4LWEA 4QPKA 4EM7A 3A0YA 4ZVIA 4BQJA 2XDKA 3LNUA 4PRVA 3T10A 2WEPA 4XKOA 1AMWA 4YKXA 2AKPA 3T0HA 4CWRA 4WUBA 3B24A 4PRXA 4O07A 4R1FA 2YKJA 4KTNA 4XITA 1L0OA 2YE7A 4HXZA 4YKWA 4XCLA 4HZ5A 1TIDA 1ZW9A 1TILA 4W7TA 1MU5A 3A0XA 4XKKA 4MPEA 2XD6A 3K60A 4GCZA 3GIGB 1YESA 4E00A 1NHJA 1I5DA 2CCTA 2K5BA 4JAVA 4DZYA 4GFNA 5BODA 4FCRA 1IXMA 3Q5JA 1S16A 3ZRWA 4P8OA 2BT0A 4H85A 3P32A 4KQVA 4LP0A 3VHDA 4QPJA 3DGEA 3CRKA 4CWNA 2YEEA 1UYCA 3KE6A 5M4PA 1Y4UA 2YI5A 2IORA 3PEHA 2C2AA 4EMVA 2BYHA 1H7SA 3FT5A 1TC6A 2XHTA 4BIUA 2E0AA 4O05A 4HXWA 2HCHA 3T0ZA 1PVGA 3H80A 4R3AA 1GJVA 4LWHA 5B1NA 3HEKA 4E01A 1ZXNA 1UYEA 5F5RA 2YECA 4U7OA 1U0ZA 4GGLA 3C11A 3HYYA 4E02A 2IOPA 4I3HA 3A0TA 2UWDA 4O0BA 3A0RA 1TC0A 4HYPA 3H4LA 3BMYA 2YK9A 2Q8HA 2WWWA 5CTYA 4B6CA 3MD0A 4MP7A 4CWFA 5CTXA 3ZRWB 4H81A 4P7AA 1I58A 1JM6A 4EGIA 2IOQA 4BXIA 3HYZA 2FWYA 1BGQA 5IDJA 1A4HA 3OWDA 3A0WA 3EKRA 2BU8A 2XX4A 4DUHA 2YE3A 2IWSA 2WI4A 3JZ3A 5D6PA 1ZWHA 1AM1A 4MT8A 2BSMA 1UYMA 2Q8IA 2YKCA 4HYMA 3D36A 3RLPA 2FYPA 1YC4A 2BRCA 3G7BA 5GGZA 1YETA 4EGKA 3CGYA 2WI5A 2GQPA 3EHJA 5BOCA 2CGFA 1UYFA 2WERA 1OSFA 1YT2A 5FNCA 4MPCA 1Z5CA 3G75A 1YC1A 3VHCA 4CWTA 4MBCA 4HY6A 4NH7A 1UYGA 4YKZA 1AJ6A 1I5BA 2ZDYA 4YKRA 1UYHA 3ZM7A 4CWOA 1I59A 4XIRA 2QG2A 3QTFA 1I5CA 2H55A 3OPDA 2XCMA 4WUCA 1QZRA 1US7A 3B26A 4XKAA 4EFUA 4ASBA 2PNRA 1UYDA 1YS3A 3RLQA 4V26A 2YJWA 2VCIA 2EXLA 3U67A 3TZ4A 4HY1A 3ZKBA 2YI7A
chains in the Genus database with same CATH superfamily
1NVPD 3OW2U 1S5JA 4URMA 4HYOA 2Q5ZA 5H2FZ 1QLEB 2BREA 3QG5A 4J11A 5FL7G 1UPGA 3SPCA 4HBNA 1FJGB 2ZKJA 4MVOA 4X1IB 1I5XA 3A8TA 1MSWD 2N74A 3GB7C 4ZOLA 3RYFA 2XDLA 5C8YA 4NKGB 5HFLA 2LGWA 3AG3B 4O09A 4BIOA 1MX0A 2PYJA 3OUSA 3ABLB 3T2MA 1XILA 2ODMA 4LR3A 1YDXA 2ETNA 3ASOC 1FFXB 1YC3A 1SQBH 4AWQA 3D0BA 4YHHB 2NR5A 4RQFA 5IE9A 2VQEB 4L91A 1NTZH 2FKXA 1AI4A 3SPGA 1R73A 5LL6Y 3BA9A 2XAQA 2VQFO 4UB8Z 2XJJA 3Q4HA 3MNRP 1BKNA 3J80N 3C3SA 2FXSA 2WI7A 2VWCA 4NYKA 4RQEA 4EKWA 5J2TB 2V7QG 3CCMV 5IDMA 5KAIZ 3FFQA 2D3OW 1WB7A 1VMGA 1Y8OA 5KHGA 5J9PC 2YXLA 3ZKDA 1R3IC 2VW5A 5H9CA 4O4HA 2IWXA 1R62A 2CTRA 1LUVA 4UVCA 2LP7A 1TVKB 4UCUA 1M93A 3B8NA 1I94B 3MHHC 2Z5UA 4B3SO 4PL9A 3OWBA 4WUDA 2OCHA 2BCCH 4BAEA 1N34B 3JALB 4LF9B 4JASA 4DV0O 1TH8A 3R4OA 5CF0A 4NXMO 2HKJA 1H8EG 1SS3A 4JI3O 1EA6A 4X66B 4EEHA 2CH4A 5CB4B 3CSXA 5J71A 2Y4UA 1BXDA 1SQPH 2V4DA 1JJ2U 1FS0G 4ASFA 5FPOA 1VQ4V 1SERA 2DMXA 2WLHA 1IBKO 2YKBA 1NQTA 1TUBB 3QDDA 1B6QA 3DC6A 2QG0A 5IY5B 2AXTZ 1RM1C 4RUFA 1I7FA 2VRZA 2M6YA 3WFVA 4H0LB 4O4IA 1IURA 5B1OA 3FYEB 1P49A 2BU2A 1RPOA 4Q6GA 2XK2A 3CCJV 2YE2A 3K97A 1GMGA 3BRCA 2CH7A 1N36B 3J7AU 5GONA 1NU1H 3R91A 3WB0A 2RCVA 5BR8O 3R65A 4IYHA 1VQ5V 2MW2B 4LWFA 2A06H 5JJNB 5L3EA 2Y69B 1QLEC 1CXZB 4WBNB 3CJHB 3WQ9A 1DLBA 2WI3A 4YJ2B 5BXZA 3SYQA 3B28A 4PDMA 3JYCA 5LXTA 3F5TA 4UROA 2Q0AA 2B5UA 4P2ZA 3ZX6A 5LHGA 3O0IA 3ABUA 3K0DA 4JYAB 3HZ5A 4I55A 5D6QA 4FVMA 2XAGA 3JCUZ 1GO3F 4GUNA 4NXNO 5B66Z 4DR3O 3EHFA 1JCHA 2QKSA 1W2BU 5CA1A 2FWZA 2QKCA 2YGEA 4ZBMA 1Y4SA 4D7SA 2PGGA 4DUYB 1VQ6V 2O1VA 4MB9A 2QWQB 1IDSA 4X1KB 1YSRA 3DXRA 3S3WA 3BPZA 3BCCH 5IT9N 1BL8A 4X65O 2W6IG 4JQLA 3TZ5A 5A9GA 3BABA 2P67A 1PPJH 4UCOA 3STLC 4J7JA 1YCIA 2ZDIC 3CCUV 3D2RA 5E1AC 4FCQA 4NVPA 1YSZA 1ZL8A 2IH1C 1AILA 2PI5A 2XJGA 4MVUA 1VF6C 5CTWA 4ASAA 4QIWF 4MVSA 4YKQA 1N4CA 1XNQO 1VF7A 1H2GA 4P9PA 2XHRA 2WI2A 4GYCB 2ZXWC 3K5NA 1K92A 2QM7A 4I50B 1ZTEA 3H1JH 5B3SC 5M4HA 4DV6O 3GIGA 1Y8PA 3U2DA 1SF9A 2F4VO 3N2GA 4DO2A 1QVFU 4GEEA 4V25A 5LA6B 1YTFD 3CRMA 2IJJA 2JEXA 2QFOA 2YEHA 2Y0PA 3WG7B 5IJ0B 3W7WA 3CEIA 3JSNA 4HNAA 4XE2A 1BT8A 3QO5A 4JI8O 1V54B 3CWVA 2VQFB 1PKXA 1JFFB 3WU2Z 4BQJA 3AG1B 3ZBHA 3B8MA 3THOA 4B7EA 4UVAA 4K35A 1OCRC 4XKOA 3W7XA 4CWRA 5B1BB 5AG2A 4TQFA 4OPHA 4O07A 4KTNA 1ZX3A 4XITA 2ATKC 2CGOA 5IYBO 3HKCA 5ITZA 4B3MO 4XCLA 1WA8B 3ZS8C 5IJ9A 2EJ7A 3JARB 3L74H 1K5QA 5D5QA 1KYOF 2RN9A 3MDSA 3OD4A 4KXRA 1TILA 4XKKA 4B3SB 4YJ3A 1YESA 3CWBH 4E00A 2CCTA 3N27A 4JAVA 4GFNA 1IXMA 2DOSA 3LDEA 5KMGB 4P8OA 1ENVA 1NT2B 4DV0B 3P32A 3D3QA 3LUTB 5CBFA 4NXMB 3VHDA 4LWSA 4JI3B 1XMOO 3DGEA 1Z5WA 2W0XA 4E4EA 3JD4A 1L0LH 2OTLV 3JAMN 2CDYA 1XEQA 3APOA 2YEEA 3VQYA 5L3CA 2HVKC 1NTMH 5M4PA 3CYOA 1ORQC 1M57B 4O4IB 1IBKB 4DW0A 2YI5A 3BFRA 1H2MA 4DR1O 2KSDA 1QVGU 3ETQA 5KUMA 3FT5A 1TC6A 1A32A 1LR1A 4FK5C 4BIUA 2C1IA 2FL4A 4O05A 3H80A 1GJVA 1QLNA 2Q4PA 2PUSA 1SESA 1RP3B 5JJJB 2YXHA 3PN1A 4GGLA 4D6TH 5BR8B 3ZN1A 3H01A 3M8AA 3D8CA 3HYYA 2OIGA 2BOBC 2IOPA 4X64O 5JCOA 4WFFA 4FFKA 1NJIW 4I3HA 3E22A 2OCCC 4PA4A 4JI1O 5IYZA 4QE7A 3OUFA 2DE0X 3G67A 2JRIA 4B6CA 1TAEA 2NNUA 1Q8IA 4X20A 4TUYB 4CWFA 3RN4A 1OJHA 3DTUB 1KP3A 2XTAA 4CH3A 4GLXA 4DV7O 2IH3C 2IOQA 4BR6A 2FWYA 1BGQA 4UXNA 1A4HA 4NXNB 2EZPA 5K1PA 4PD4F 4PV1B 4LF7O 5LHIA 1JPXA 2RNBA 4JTCB 3ZMZA 4FLTA 3E83A 4X1YB 4FIPC 2FB5A 4MTFA 2Q8IA 2MK3A 2ZE8A 2FYPA 5CMUA 3H1IH 3G7BA 5GGZA 3CP1A 1YETA 3CGYA 3O65A 4O2BB 4X65B 2ZE7A 4DRXA 2CGFA 1OSFA 1Z5CA 1YC1A 2ZIOA 3VHCA 2D2CB 1R3LC 2K9PA 4YKZA 1AJ6A 1FFXA 4ICGA 4GKJO 2JJ2G 1UYHA 4JI0O 1WPBA 4WFEA 5FPRA 5CBGA 2XCMA 3AG2B 4DXWA 2A3QA 1XNQB 2PNRA 2AW9A 1YS3A 1AJPA 1JJOA 4JAAA 1AH6A 3K06A 3ZMSA 3JAKB 1KMIZ 2UXXA 1B04A 4HAMA 4X89A 4HZ0A 3N2GB 5GTIZ 3D36C 1X4TA 2ZIMA 2Q8GA 1JOYA 3X2QC 4DV6B 4MTOA 3CC4V 3NXSA 4AWOA 2F4VB 1H7UA 2CTPA 4JYYA 2ZNJA 3IC9A 1WJZA 2ZCEA 1TVKA 2XDXA 1Y74A 1YF2A 1HNXO 3ABTA 1WNSA 2WLJA 2YIBA 3ETEA 3M7MX 4PU9A 2Q7GA 3L9DA 1QU7A 2QM8A 2DYRB 4AILC 4FLYA 2JS3A 4QNHB 5BZBA 3WB2A 5CA3A 3FB5C 1G6UA 4NTWA 4MPNA 4JI8B 1MA1A 2HHHO 3G71V 4CWPA 5EK0A 1BQZA 1THNA 2YI6A 1XL4A 4LFBO 4MTXA 1N8RW 2IU0A 1OCZC 5CB4A 5LHHA 4GT8A 3FD9A 2YEBA 4JYBA 1J5EO 3ETDA 1AH8A 4X62O 2YGAA 1XDCA 3OE7G 4O04A 1Y8NA 5BY1A 2IW5A 4URNA 1Q5OA 4U7NA 3RVYA 1G8MA 4CH6A 4EFBA 4B3MB 3OFNG 1DF5A 2AHYA 1TGOA 3TJTA 3ZRSA 4R3MA 3ZHTA 5JVDB 1KBHA 1GN6A 2F23A 4PA6A 1SZTA 2HJDA 1I08A 1IZ3A 5LGNA 1GKZA 3B27A 3RW0A 4ZHQB 4YIOA 1B06A 3BM9A 4WBNA 3CJHA 3VQWA 1YZBA 1F7YA 1XMOB 4YJ2A 1RSOB 5FWKA 1MMMA 1F4MA 1HP8A 1Z5AA 4XDMA 5LP6A 3FYIB 2JKIA 3B77A 4YKTA 1Q43A 2B1IA 5DEDA 2JVDA 1VF5B 2NLJC 1Q86W 1JX9A 2YEFA 4DR1B 1YITV 3Q5KA 3F5WC 4RAIA 4KFGA 1XREA 1UY8A 1KIJA 4CE1A 3ABKB 2YE8A 3E8FA 3L72H 2KG7B 3ZHRA 2OWOA 4FLUA 1H2NA 1OCOC 4GX0A 1KKCA 4YKUA 1ZSPA 2XUMA 1XMQO 5IYZB 4I7ZB 4X64B 3RYCB 1SETA 1Y4MA 1K97A 2EULA 3CPWU 4X20B 1K7DA 4JI1B 3FT8A 1YVWA 5F2VO 4JI5O 1VQOV 2UXCO 3B25A 5FNVB 5KUKA 4J41A 4IT5A 1EN5A 1CPYA 4DV7B 1Y76B 2AHZA 2H8PC 3AG4C 3QF7A 3CGZA 4I5SA 5LGUA 2B1GA 4HY1A 2H8MA 3U11A 2N04A 3H1KH 2EIKB 4LF7B 1G1XB 4KSGA 3OMAB 1EZVH 1NI8A 4LWIA 4FMTA 4U93A 1ID0A 2JJCA 1IX9A 2RDCA 4I50A 4DRXB 3A0BZ 2LGQA 4MTGA 3RYHB 1V55B 2PF4E 1WLEA 3CC2V 5L3DA 2YJXA 1P7BA 2OYQA 2EIJB 3T4DA 1UY6A 3C3TA 4UCTA 2JS5A 3R4MA 5LA6A 3ZIAG 2O1UA 2YIBD 4GKJB 1PNMA 4JI0B 2CCSA 1IVSA 1BYQA 5IJ0A 2X7RB 3OTOO 2GFDA 3FV5A 3C90A 1NVPB 2VCJA 1GKFA 2XDUA 1JFFA 4IHJB 2P6JA 1AI6A 1R3JC 4WCEV 2WLIB 3ABMC 4KL1A 2LW7A 1QQCA 4LH7A 4IL6Z 3CD6V 1QCEA 1N32O 2OT5A 1YXBA 2LQTA 3B09A 1NR7A 4O2AB 3R4PA 2WA3A 1XOUA 4UVBA 2EX3A 2C1GA 1W0JG 2DQ0A 2Q67A 1Y74B 2YIDA 4PA3A 4ABMA 1U2OA 3IC7A 3CB2A 1LNQA 1WA8A 3SL2A 3JARA 2CK3G 5L3GA 1SZXA 2IU3A 1HNXB 3HKBB 1PV0A 5TISZ 2UUCO 3PEJA 2Q73A 5CN0A 2LFSA 1SQVH 2LFRA 2P7TC 4XBFA 4UCVA 1AR4A 5KMGA 2HHHB 2IJHA 2ZNIA 1HNZO 3HHUA 4B7PA 3I5DA 4DW1A 4LFBB 1JR9A 2UU9O 1GH6A 3ZN0A 1UFIA 3OM3B 2ZBKB 1SKVA 4EEQA 3AEIA 3IGAC 2XAJA 3HPLC 3SYPA 3F7YC 1J5EB 4XCJA 3SJCC 1VQ8V 4DV5B 5JCOC 4XDJA 3DC5A 4X62B 1QR8A 1CEZA 3INWA 2VWKA 4LWEA 4QPKA 4D7TA 4GX2A 4EM7A 3RVZA 3FB8C 3SDLA 2IM9A 1M56B 1PP9H 4PRVA 3E8GA 3T10A 4JI7O 2IJKA 1KQSU 2IJIA 3SYCA 2GTAA 2UUAO 4PI0A 4WUBA 2VWJA 4X9QA 4PRXA 1S76D 4R1FA 1PL0A 2ILMA 1SQQH 2QWRB 4CZZA 3T1CA 2Q69A 2B9ZA 5LP6B 3JATB 5H5NA 4W7TA 2FYUH 1MU5A 4UUJC 4OGQB 2P5OA 3AG3C 2XD6A 3CS5A 4GCZA 3K58A 3OGCC 3I55V 4FCRA 4TUYA 4I0XA 2CUGA 3Q5JA 4AI8A 3UKMA 2PTMA 2ITCC 3ABLC 3SYOA 3BY6A 4G2KA 4KQVA 4LP0A 3CYGA 3E86A 2HHIA 1GN4A 5B1AB 3LDCA 1FXKB 3CRKA 1JMKC 3TXQA 3NR7A 1N0JA 1Y4UA 1R6NA 2IORA 3ASNB 4X1YA 4DR7O 1P84F 2C2AA 3I56V 2PZSA 4JV5O 2BYHA 4EMVA 1I5YA 2XHTA 1XMQB 2E0AA 1PNLA 2HCHA 1PVGA 1ZLZA 4PA7A 4O2BA 5EBWC 4LF6O 5DM6V 5F5RA 2WA4A 1HDJA 2YECA 4JI5B 4B3TO 4QE9A 3T1HO 2UXCB 2DYSB 4JTDB 2DN9A 3OEHG 2P22C 2UWDA 2EIMB 1KC8W 3L71H 2YK9A 1E79G 3N2KB 2GV9A 1IBMO 4TQDA 3BHPA 3LSSA 2WWWA 5CTYA 1E1RG 2QKAA 3JD0A 3G80A 4LF5O 5BMVB 3JAKA 1JM6A 5JQGB 1ZWIC 3VQXA 5IDJA 1RPRA 3LSQA 3OWDA 1AR1B 1WP7A 2XX4A 5LYJB 4B7KA 2WI4A 3IAYA 5D6PA 3GWOA 4RUEA 2P4KA 5LMNO 2QWNB 2YKCA 4F6EA 2ITDC 2WAMA 2BRCA 5IY5C 2WI5A 2GQPA 5BOCA 2UXBO 3OTOB 1OHHG 1YT2A 2X6AA 2JGDB 4UB6Z 3G75A 2QR4A 2ZD9A 1S5HC 4G28B 4HY6A 4CWTA 1GM7A 4NH7A 1UYGA 2WLMA 1I5BA 2ZDYA 1SQFA 3SR2C 3ICXA 4XIRA 2QG2A 4JZ2A 1I5CA 5EBMC 4TV8B 1MOFA 4WUCA 1N32B 4W4LA 2Y69C 3K5MA 4EFUA 4ASBA 1UYDA 4NTXA 2A79B 1AJQA 4Z2WA 1TBWA 5CTUA 3ZHVA 3B40A 4O4JA 1AI7A 1NTKH 4MOTA 4NH9A 3K3WA 3R4NA 4IGGA 2F93B 5JVDA 1D5NA 2YEDA 3INXA 3OTFA 2QTOA 2UUCB 3TGUH 3G7EA 3OMUA 3HR0A 4XC0A 2BZ5A 2HG5C 1BHBA 2WLKA 1GM8A 2L6LA 4ZHQA 2E74B 4I9QA 3MAQA 1HNZB 3ZRXA 1O9GA 4FJCC 4J42A 2UU9B 1RSOA 4DK0A 3GIFA 3HZ1A 2IWUA 2YI0A 3U2KA 1WPXA 3UO2A 3ZXQA 1HWYA 1VQLV 4TV9B 3K5OA 2H3OA 1YSCA 4UCRA 3WHAA 2YE4A 4GX5A 1JQ0A 4JI7B 2KG7A 4DR4O 1Y66A 1PL4A 2R9RB 2UUAB 4EFTA 1J95A 4JAUA 4P9OA 1CP9A 3RYCA 1Z59A 1K5SA 1X59A 1UY9A 1KD1W 4MP2A 2YEVB 4K0KB 4I0XB 3IFXA 4FLWA 1Y6XA 3RT3C 2W0FC 5JWPA 5EIBD 1Z5BA 3K99A 1K4CC 1L0NH 5H6RA 1Q6IA 5FNVA 1BMFG 5J2UB 2Q8FA 2BU5A 4KSHA 2JGUA 1COWG 3UO3A 3H9VA 3JD2A 1Y76A 4H7QA 1QYEA 5M4NA 2YE9A 3C0EA 1AP5A 4JF3A 4B08A 4P30A 2HFEC 2Q7HA 1AJNA 3OMNB 3WG7C 1NBMG 4DR5O 1YI2V 4IIJB 2BTZA 2LJ2A 3ZHQA 3JCZA 3K04A 1YHQV 1GAXA 4DR7B 1FFTB 4JV5B 3CRLA 1YT1A 1BCCH 1V54C 1NHHA 1SA0B 3RYHA 1UYKA 1BSMA 3AG1C 2X6BA 2XASA 4LF6B 5LBQA 3QO8A 2WI6A 3QTCA 4F4LA 2RJZA 4CE2A 4B3TB 3OW6A 1AI5A 1KU9A 3T1HB 5B1BC 2E3CA 3OAAG 5IWAO 4ZIBA 3D3IA 1WP8A 1VQ9V 5C93A 3K5LA 1IBMB 4B3RO 3STZC 2QEXV 4I9WA 2P4VA 5E79Z 1S3JA 4XIPA 3OR7C 4IHJA 3U0ZA 1NR1A 2WI1A 5KX5B 1DF4A 4LF5B 2YUAA 2WLIA 2F43G 4DR2O 4I4TB 1P4RA 2YEAA 4L90A 3K57A 1OCCB 4O2AA 4JZGA 2YEJA 4O4LB 3CE2A 2KQXA 3EKOA 4CC5A 4CS2A 3ZMTA 3WB1A 3SYAA 1P7GA 5K1XA 1VF6A 1SRYA 2XOKG 3O6OA 2QE7G 1GN2A 1M57C 5LMNB 3CXCU 3HKBA 5LGTA 3EHGA 2Y48A 3KZIZ 3LSUA 3Q5LA 2E75B 2UXBB 2BOCC 1KUQA 1K9MW 3CRRA 1THZA 1HNWO 2Q68A 3ZXOA 1B3QA 4W4KA 4EB6B 4DV5O 1XUQA 4J10A 3VHAA 3ASOB 1O9HA 1URFA 4DV2O 4J80A 4MVRA 3A0ZA 1YT0A 3R92A 3LNNA 5M4EA 4DV3O 4KHPO 2XHBA 3AK2A 4O4JB 4ZKIA 3G6EV 2YSUB 1NH2B 2BU6A 1F23A 3W7SA 4LP8A 1QHTA 4G27B 2FTKA 1VQKV 3OGIB 4XIQA 3ZCCA 1AR5A 3ZEDA 2XT9A 1WAZA 1MSDA 5GW7A 1IBLO 4GZRB 2YDEA 3E2EA 4IYIA 3TTZA 4BWAA 2XHXA 3FAVA 3JATA 3RGBA 4CWSA 3CX5F 2YXYA 4JYCA 4U3JA 1XHZA 1U96A 2XX2A 4JPRA 4FM1A 1XHXA 3GVMA 3JASA 4XD8A 1UY7A 3LNMB 2XABA 1UJWB 4WFHA 2BYIA 2BTQB 4CWQA 1VARA 4C7UA 1R6KA 5JJEB 3EFFK 3J81N 1UYLA 4ASGA 1W0KG 3EVKA 3APQA 1H2KA 3B2EE 4X8AA 4LWGA 1GM9A 1WN7A 4LF4O 1FXKA 3CCLV 2HG1A 4YKYA 1GKXA 1XNRO 3CCEV 1ZXMA 4DR4B 1FXHA 2ADPA 1LUWA 5EIBC 1DK1A 1SQGA 1BE3H 3IEDA 5J6AA 2O1WA 3AG2C 1Q7YW 2Z0AA 3A0YA 4U3FH 4ZVIA 4GX1A 3MHSC 1M9NA 2XDKA 3LNUA 3SJAC 2WEPA 1AMWA 4YKXA 4PDVA 1L1FA 1GN3A 4YY3O 5CBHA 1EBOA 2YE7A 4A5UB 5HFMA 4HZ5A 4MS2A 2HP8A 1TIDA 1NS1A 1ZW9A 1R6TA 1Q6HA 3A0XA 3DSQA 5FLXN 3N2KA 3K60A 2Y0IA 4YIPA 1KB9F 1US6A 4L8JA 1NHJA 1MABG 1I5DA 2VS0A 4PDRA 4DR5B 1YIJV 2GBOA 2DYRC 5BMVA 1EM1A 5JQGA 2HKOA 4J7KA 2AZ2A 4QPJA 2NN4A 4CWNA 4JGSA 3BA8A 1VIBA 4H37A 5LYJA 3TETA 3KE6A 3U10A 2DJVA 5L3FA 4MW8A 3W7TA 3CRQA 5KHKA 4K8XA 3JSLA 5EC1C 2QTSA 2EILB 3K0GA 1H7SA 1FD9A 1BQ0A 4HXWA 1K34A 1ZAUA 5JH7B 4LWHA 5B1NA 5IWAB 4ASUG 3HEKA 1ZXNA 2EINB 3O9OA 2JGDA 3ZMUA 4DYLA 3JD3A 5KA6A 3C11A 1VP7A 4LFAO 1XI1A 4B3RB 1N0NA 2QGNA 2F1MA 3H1LH 1M5IA 3E8BA 4BW5A 2K1EA 3A0TA 1V9PA 3CXHF 1FAFA 3BMYA 4DR2B 4TV8A 2Q8HA 4WFAV 1T5EA 1EN4A 1XL6A 4CBCA 3MD0A 4LFCO 5CTXA 4PHZA 3ZRWB 2JIZG 4H81A 2DQ3A 2Q8VA 3ML0A 2BSKB 4P7AA 4EGIA 5JENA 3HYZA 2ZXWB 2CE4A 4TT3G 4DUHA 4AQYO 2IWSA 4MVZA 3UT5B 3ABKC 5B3SB 1VQPV 4WFGA 3ZJZA 3BAAA 4L87A 1HNWB 3HKEB 3OEEG 1UYMA 3G6BA 5EYPB 3D36A 2V1DA 1YC4A 4FZ0A 4DV2B 3EHJA 2XAHA 2WERA 3VOUA 5LOVA 4OPAA 2UXDO 1MG1A 3F7VC 4TV9A 3CCSV 4FLVA 4DV3B 4KHPB 3CCQV 4LBEC 5EC2C 2R70A 3ZM7A 1S72V 2QJ1A 4CWOA 1YJWV 1VQ7V 1R1BA 1I59A 2XAFA 1OV9A 2H55A 1US7A 4J9ZB 3IJ4A 1TUEB 3KG2A 4XKAA 3RFRA 4HZ3A 3RLQA 3UM7A 1OCRB 3BVOA 1OZ0A 3FAVB 1Q90D 2ZINA 1K73W 1IBLB 4K0KO 3TZ4A 2YI7A 3ZKBA 2ZM6O 2EIKC 2GUZA 4U3JB 1HW7A 1W59A 4PDLA 3JASB 2YEVA 3T1YO 2GDSA 3HKDB 1ZUQA 3JAWB 2PY5A 2JJ1G 3P3NA 3ZHSA 1QR9A 2HLDG 5KHJA 1FYJA 3O2FA 3EXAA 2BU7A 5D7DA 3TK1A 1Q82W 1V55C 5J2UA 1FXVA 1RFYA 2EIJC 5FNDA 4AS9A 4NR1A 4JI6O 2YI9A 4BIZA 2CTQA 1U97A 4LF4B 4N23A 4F6RA 4FCPA 4DV1O 3K79A 4UV9A 2WPDG 2R9IA 1XNRB 2A9HA 2XX5A 2EILC 4ZI7B 4IIJA 2CG9A 3GWKC 1JA8A 2YEGA 2ZE6A 4KFMA 1Z2GA 2Q9LA 3W7UA 1H38A 3A2FA 5LMUO 2R9AA 1QNMA 3TZ2A 4J9YB 1SA0A 2EINC 3EHHA 4NTYA 4YY3B 4MVMA 4LC1A 3CC7V 4FFBB 5CA0B 5FNFA 3SPJA 1NZ6A 1NHIA 3E35A 4FPPA 4DUZO 4LPBA 4ZOLB 1N33O 2O57A 3RYFB 4R7CA 2OCCB 2YEIA 5C8YB 2E5LO 2CCUA 3A0HZ 5KX5A 3FKSG 5L3JA 2Y4TA 2ZR2A 5D5PA 4I4TA 4L93A 1KKDA 3K08A 1VQMV 4EGHA 4NB5A 2OTJV 2KKWA 4JI2O 4OXSA 3RKZA 4PJ0Z 2A0LA 4O4LA 3QNEA 2XJXA 4UFZA 2Q0OC 3P3PA 1Z5VA 3TCUA 5DN6G 2A7WA 3S5TA 4DV4O 1D5AA 3CCVV 4N21A 4AWPA 2XNDG 3K98A 1K3EA 2ZDXA 4JI4O 4KP4A 4CE3A 2EZOA 1M56C 1EI1A 2ZR3A 2GSMB 3Q4HB 5EZYA 1PNKA 3JD1A 4LFAB 2ZE5A 2QA4V 3TXSA 2CAZC 3FX7A 4TWKA 4Q20A 4EB6A 2YGFA 3RBZA 3T1KA 1MNGA 4LNUA 4CS4A 3KCXA 1B62A 3G4SV 4RWUA 3FB7C 2PYLA 5LP6C 4O4HB 2WEQA 4LFCB 1VQNV 3UQ8A 5D7RA 5IYDO 1I0HA 4DR6O 3ZRVA 4R50A 5IN9A 1BS3A 1K33A 1YTFB 4L8ZA 3LMMA 1GTOA 3CMAV 4OX9O 3SPHA 3ETGA 2YE6A 4AQYB 5B1AC 3CRCA 3K9SA 1FXKC 3KCYA 1S14A 2Q6AA 1YERA 5DECA 1K4DC 4FZ1A 4X9LA 3X2QB 5M4KA 2ARHA 1KZNA 5LOVB 2YI8A 2GTSA 2HR3A 1FKAO 3ASNC 3M99B 1KECA 2EJRA 1MZEA 2QF6A 4GKKO 2UUBO 3RYIA 4GT1A 5H6QA 3GIEA 4UCSA 4LF8O 5M4MA 2UXDB 3LPSA 2YS8A 3VQVA 1UYIA 2YKIA 2CGNA 2OIEA 2BTQA 1SC5B 4H13B 4KUMA 3QVNA 1B63A 1AP6A 1S5LZ 1KP2A 2PI4A 2DYSC 5F3KA 2LW1A 4X88A 4PA9A 4L94A 3CCRV 1HR0O 4NH8A 2X6CA 3SPIA 2CH7B 2YIAA 1OCZB 5GONB 3P30A 2EIMC 2GUZB 1BZKA 1PD3A 2F66C 4URLA 1FPOA 2HJFC 1WB8A 1R3KC 5KHIA 5D7CA 3RLRA 2ZM6B 3T2SA 2R72A 2WLLA 5L3BA 1XBLA 1QBZA 1YEWA 3T1YB 4GQTA 5LXTB 2XDSA 3K03A 1ROPA 1I5AA 2ADQB 2BTOA 2YICA 1PM9A 3PJSK 4K4OA 2YE5A 2LO1A 2ZT9B 3CHXA 4I55B 2YK2A 4H44B 4F6RB 2P06A 3UCSC 2QWPB 2QWOB 2H94A 3SJBC 1FJGO 2QM4A 1SQXH 1H2LA 4JI6B 3TUHA 5CA1B 4UV8A 3AG7A 4DV1B 1XQ8A 4QJFB 2P90A 3VADA 3R66A 1H2SB 5GTHZ 4X1IA 4WFBV 4DR3B 3NMQA 3CRAA 3DXRB 1QY8A 2Q2EB 4TSFG 3K9AA 3OMIB 5B5EZ 1BHAA 4BQGA 5LMUB 1M1KW 5IYCO 3KKYA 1Q3EA 2ESAA 3AK3A 3TZ0A 4XTJA 2X0LA 4MVQA 4FM0A 4BW9A 3L70H 5CPHA 1YJNV 1L8DA 1F51A 2DWEC 2YKEA 1ZL8B 3E8HA 4YHHO 2HVJC 2VQEO 4E72A 1GK9A 2L35A 5JH7A 3VBBA 1OCOB 2AGAA 3E89A 2AKPA 4XDLA 3T0HA 3L73H 3B24A 4DUZB 2G38A 2YKJA 1N33B 1L0OA 1VEWA 4HXZA 2EBOA 2E5LB 1EN6A 4YKWA 1TA8A 2ZDIA 5KLVH 4CC6A 1YJ9V 3B4SA 4FM2A 2RMKB 3SJQC 4XDKA 2AZ0A 4MPEA 1GRJA 5KAFZ 1EZJA 5J2TA 3ZMVA 4JI2B 1NH2D 3GIGB 1F4NA 1Q6UA 4BAYA 2K5BA 4DZYA 5BODA 4YXWG 3RWRD 3AG4B 4CS3A 4R6ZA 1S16A 3ZRWA 2WLNA 2BT0A 4H85A 2BSKA 2GHYA 4R8CA 1D2DA 1I94O 4CH5A 2IBZH 3FB6C 4DV4B 4FLXA 1AVMA 1Q81W 3BEHA 3QO7A 4J7ZA 4QGPA 5EZYB 2Z3YA 4JTAB 1UYCA 2HEPA 1N34O 4HNAB 1E1QG 3UT5A 4LF9O 4JI4B 2CTWA 3PEHA 3K59A 4LNUB 4DK1A 4X66O 2UXNA 3HKEA 3SGIA 3JALA 2ZKOA 5EYPA 3T0ZA 3CMEV 4R3AA 2BE3A 4E01A 4E2LA 1H8HG 1S77D 2DW4A 1UYEA 4U7OA 1U0ZA 4LH6A 2YC0A 2Q7EA 4DR6B 4E02A 2JEUA 3HKCB 5ITZB 1TUBA 2FMLA 3AK1A 5IJ9B 5A2QN 1NKDA 1Y67A 4O0BA 3A0RA 4Z1VA 1TC0A 4K3AA 2ZQMA 4HYPA 3H4LA 1N36O 1G4YB 3OR6C 4MW3A 4YJ3B 1EFRG 5EBLC 1M4UA 3H1HH 3ABMB 4FLZA 4MP7A 4OX9B 1S0VA 1DTOA 1BGYH 1I58A 1K8AW 3RYIB 4LWSB 4CH4A 4LCUC 4BXIA 2M7WA 2QDOA 3S3XA 2JDIG 3A0WA 3HKDA 3JAWA 3EKRA 2BU8A 4GKKB 2UUBB 2F95B 4H33A 2YE3A 4LF8B 3JZ3A 2KB1A 2RQ6A 4JYAO 3OT7A 1ZWHA 1DGSA 4TOIA 1AB3A 1AM1A 3EHBB 2E76B 4MT8A 4WF9V 2BSMA 4K8ZA 4HYMA 1IXBA 3RLPA 3L75H 4EGKA 2W6JG 4MSWC 2QSAA 1UYFA 3ZHUA 3LDDA 2DWDC 2WSSG 1HR0B 5FNCA 4MPCA 4EFEA 5KHHA 4DUYO 3T4ZA 4Z1MG 4MBCA 4RO2A 4ZI7A 4AHCA 4YKRA 2WLLB 1AROP 1RM1B 3E22B 4X1KA 3QTFA 3OPDA 1JVMA 5KA5A 2JK5C 1QZRA 3HB3B 3B26A 1M90W 4PELA 4PI2A 4V26A 2N05A 4FFBA 2VCIA 5CA0A 2EXLA 2YJWA 3U67A 1OCCC 1MZFA
chains in the Genus database with same CATH topology
1NVPD 3OW2U 4URMA 4HYOA 1QLEB 2BREA 5FL7G 3SPCA 2ZKJA 4MVOA 1I5XA 1MSWD 3GB7C 2XDLA 5HFLA 3AG3B 4O09A 1MX0A 3OUSA 3ABLB 3T2MA 3ASOC 1YC3A 4AWQA 3D0BA 4RQFA 4L91A 1AI4A 3SPGA 1R73A 2XAQA 2XJJA 3MNRP 1BKNA 2FXSA 2WI7A 2VWCA 4RQEA 4EKWA 2V7QG 3CCMV 5IDMA 2D3OW 1Y8OA 5J9PC 3ZKDA 1R3IC 2VW5A 5H9CA 2IWXA 1R62A 4UVCA 2LP7A 3B8NA 3MHHC 2Z5UA 4PL9A 3OWBA 4WUDA 4BAEA 4JASA 1TH8A 3R4OA 5CF0A 2HKJA 1H8EG 1EA6A 4EEHA 2CH4A 5J71A 1BXDA 1JJ2U 1FS0G 4ASFA 1VQ4V 1SERA 2WLHA 2YKBA 1NQTA 3QDDA 1B6QA 2QG0A 5IY5B 1RM1C 4RUFA 3WFVA 5B1OA 3FYEB 2BU2A 1RPOA 2XK2A 3CCJV 2YE2A 3K97A 1GMGA 3R91A 3R65A 1VQ5V 4LWFA 5L3EA 2Y69B 1QLEC 3WQ9A 1DLBA 2WI3A 3SYQA 3B28A 4PDMA 3JYCA 4UROA 2B5UA 4P2ZA 5LHGA 3O0IA 3ABUA 3K0DA 3HZ5A 5D6QA 2XAGA 1GO3F 3EHFA 1JCHA 2QKSA 1W2BU 2FWZA 2YGEA 4ZBMA 1Y4SA 1VQ6V 2O1VA 4MB9A 1YSRA 1BL8A 2W6IG 4JQLA 3TZ5A 2P67A 3STLC 3CCUV 2ZDIC 3D2RA 5E1AC 4FCQA 1YSZA 2IH1C 2PI5A 2XJGA 4MVUA 5CTWA 4ASAA 4QIWF 4MVSA 4YKQA 1H2GA 4P9PA 2XHRA 2WI2A 2ZXWC 1K92A 2QM7A 5B3SC 5M4HA 3GIGA 1Y8PA 3U2DA 4DO2A 1QVFU 4GEEA 4V25A 1YTFD 2IJJA 2JEXA 2QFOA 2YEHA 3WG7B 3W7WA 4XE2A 3QO5A 1V54B 3CWVA 1PKXA 4BQJA 3AG1B 3B8MA 4UVAA 1OCRC 4XKOA 3W7XA 4CWRA 5B1BB 4O07A 4KTNA 4XITA 2ATKC 5IYBO 4XCLA 1K5QA 1TILA 4XKKA 1YESA 4E00A 2CCTA 4JAVA 4GFNA 1IXMA 3LDEA 4P8OA 1ENVA 3P32A 5CBFA 3LUTB 3VHDA 3DGEA 1OCCC 3JD4A 2OTLV 2YEEA 5L3CA 2HVKC 5M4PA 3CYOA 1ORQC 1M57B 2YI5A 1QVGU 5KUMA 3FT5A 1TC6A 4FK5C 4BIUA 4O05A 3H80A 1GJVA 1QLNA 1SESA 4GGLA 3ZN1A 3H01A 3HYYA 2BOBC 2IOPA 1NJIW 4WFFA 4I3HA 2OCCC 4PA4A 4QE7A 3OUFA 4B6CA 2NNUA 4CWFA 3DTUB 1KP3A 2IH3C 2IOQA 2FWYA 1BGQA 4UXNA 1A4HA 2EZPA 5LHIA 1JPXA 4JTCB 3ZMZA 3E83A 4FIPC 4MTFA 2Q8IA 2MK3A 2FYPA 5CMUA 3G7BA 5GGZA 3CP1A 1YETA 3CGYA 2CGFA 1OSFA 1Z5CA 1YC1A 3VHCA 1R3LC 4YKZA 1AJ6A 2JJ2G 1UYHA 4WFEA 5CBGA 2XCMA 3AG2B 4DXWA 2PNRA 1YS3A 1AJPA 1AH6A 3K06A 3ZMSA 2UXXA 4HAMA 4X89A 4HZ0A 2Q8GA 1JOYA 3X2QC 4MTOA 3CC4V 3NXSA 4AWOA 1H7UA 2XDXA 3ABTA 2WLJA 3ETEA 4PU9A 2QM8A 2DYRB 4QNHB 5BZBA 5CA3A 3FB5C 4MPNA 3G71V 4CWPA 5EK0A 1THNA 2YI6A 1XL4A 4MTXA 1N8RW 2IU0A 1OCZC 5LHHA 4GT8A 2YEBA 4JYBA 3ETDA 1AH8A 2YGAA 3OE7G 4O04A 1Y8NA 2IW5A 4URNA 4U7NA 3RVYA 1G8MA 3OFNG 1DF5A 2AHYA 3ZRSA 4R3MA 4PA6A 1SZTA 5LGNA 1GKZA 3B27A 3RW0A 3BM9A 5FWKA 1F4MA 1Z5AA 4XDMA 3FYIB 2JKIA 3B77A 4YKTA 2B1IA 2NLJC 1Q86W 1JX9A 2YEFA 1YITV 3Q5KA 3F5WC 4RAIA 4KFGA 1UY8A 1KIJA 4CE1A 3ABKB 2YE8A 3E8FA 1OCOC 4GX0A 4YKUA 1SETA 1Y4MA 1K97A 3CPWU 1K7DA 3FT8A 1VQOV 3B25A 5KUKA 1CPYA 2AHZA 3AG4C 2H8PC 3CGZA 4I5SA 5LGUA 2B1GA 2H8MA 2EIKB 4KSGA 3OMAB 4LWIA 4FMTA 4U93A 1ID0A 2JJCA 4MTGA 1V55B 1WLEA 3CC2V 5L3DA 2YJXA 1P7BA 2EIJB 3T4DA 1UY6A 3R4MA 3ZIAG 2O1UA 1PNMA 2CCSA 1BYQA 2X7RB 2GFDA 3FV5A 1NVPB 2VCJA 1GKFA 2XDUA 2P6JA 1AI6A 1R3JC 4WCEV 2WLIB 3ABMC 3CD6V 1QCEA 2OT5A 1NR7A 3R4PA 4UVBA 1W0JG 2DQ0A 2Q67A 1U2OA 4PA3A 3IC7A 1LNQA 3SL2A 2CK3G 5L3GA 2IU3A 3PEJA 5CN0A 2LFSA 2LFRA 2P7TC 4XBFA 2IJHA 3HHUA 4B7PA 3ZN0A 3OM3B 2ZBKB 3AEIA 3IGAC 2XAJA 3HPLC 3SYPA 3F7YC 4XCJA 1VQ8V 4XDJA 1QR8A 1CEZA 3INWA 4LWEA 4QPKA 4EM7A 4GX2A 3RVZA 3FB8C 1M56B 4PRVA 3E8GA 3T10A 2IJKA 1KQSU 2IJIA 3SYCA 4WUBA 4PRXA 1S76D 4R1FA 1PL0A 4CZZA 3T1CA 2Q69A 4W7TA 1MU5A 4UUJC 3AG3C 2XD6A 4GCZA 3OGCC 3I55V 4FCRA 3Q5JA 3UKMA 2ITCC 3ABLC 3SYOA 3BY6A 4G2KA 4KQVA 4LP0A 3E86A 5B1AB 3LDCA 1FXKB 3CRKA 1Y4UA 1R6NA 2IORA 3ASNB 2C2AA 4EMVA 3I56V 2BYHA 1I5YA 2XHTA 2E0AA 1PNLA 2HCHA 1PVGA 4PA7A 5EBWC 5DM6V 5F5RA 2YECA 4QE9A 2DYSB 4JTDB 3OEHG 2UWDA 2EIMB 1KC8W 2YK9A 1E79G 3LSSA 2WWWA 5CTYA 1E1RG 3JD0A 1JM6A 1ZWIC 5IDJA 1RPRA 3LSQA 3OWDA 1AR1B 2XX4A 2WI4A 5D6PA 3GWOA 4RUEA 2YKCA 2ITDC 2WAMA 2BRCA 5IY5C 2WI5A 2GQPA 5BOCA 1OHHG 1YT2A 2X6AA 3G75A 4CWTA 2ZD9A 1S5HC 4G28B 4HY6A 1GM7A 4NH7A 1UYGA 2WLMA 1I5BA 2ZDYA 4XIRA 2QG2A 1I5CA 5EBMC 4WUCA 1MOFA 2Y69C 4EFUA 4ASBA 1UYDA 2A79B 1AJQA 1TBWA 5CTUA 1AI7A 4MOTA 4NH9A 3K3WA 3R4NA 2YEDA 3INXA 2QTOA 3G7EA 3OMUA 4XC0A 2BZ5A 2HG5C 1BHBA 2WLKA 1GM8A 3ZRXA 4FJCC 3GIFA 3HZ1A 2IWUA 2YI0A 3U2KA 1WPXA 3ZXQA 1HWYA 1VQLV 1YSCA 3WHAA 2YE4A 4GX5A 1JQ0A 1Y66A 2R9RB 4EFTA 1J95A 4JAUA 4P9OA 1CP9A 1Z59A 1K5SA 1UY9A 1KD1W 4MP2A 2YEVB 3IFXA 2W0FC 1Z5BA 3K99A 1K4CC 5H6RA 1BMFG 2Q8FA 2BU5A 4KSHA 1COWG 3JD2A 4H7QA 1QYEA 5M4NA 2YE9A 3C0EA 4JF3A 4P30A 2HFEC 1AJNA 3OMNB 3WG7C 1NBMG 1YI2V 2BTZA 3JCZA 3K04A 1YHQV 1FFTB 3CRLA 1YT1A 1V54C 1NHHA 1UYKA 3AG1C 2X6BA 2XASA 5LBQA 3QO8A 2WI6A 4F4LA 4CE2A 3OW6A 1AI5A 5B1BC 3OAAG 3D3IA 1VQ9V 5C93A 3STZC 2QEXV 4I9WA 1S3JA 4XIPA 3OR7C 1NR1A 2WI1A 1DF4A 2WLIA 2F43G 1P4RA 2YEAA 4L90A 1OCCB 2YEJA 3EKOA 3ZMTA 3SYAA 1SRYA 2XOKG 3O6OA 2QE7G 1M57C 3CXCU 5LGTA 3EHGA 2Y48A 3Q5LA 2BOCC 1K9MW 1THZA 2Q68A 3ZXOA 1B3QA 3VHAA 3ASOB 4MVRA 3A0ZA 1YT0A 3R92A 5M4EA 4ZKIA 3G6EV 2YSUB 1NH2B 2BU6A 1F23A 3W7SA 4LP8A 4G27B 2FTKA 1VQKV 4XIQA 3ZCCA 5GW7A 3E2EA 3TTZA 2XHXA 4CWSA 4JYCA 2XX2A 4JPRA 4XD8A 1UY7A 3LNMB 2XABA 1UJWB 4WFHA 2BYIA 4CWQA 1R6KA 4ASGA 3EFFK 1UYLA 1W0KG 4X8AA 4LWGA 1GM9A 4YKYA 1FXKA 3CCLV 2HG1A 1GKXA 3CCEV 1ZXMA 1FXHA 3IEDA 5J6AA 2O1WA 3AG2C 1Q7YW 3A0YA 4ZVIA 4GX1A 3MHSC 1M9NA 2XDKA 3LNUA 2WEPA 1AMWA 4YKXA 4PDVA 1L1FA 5CBHA 1EBOA 2YE7A 5HFMA 4HZ5A 4MS2A 1TIDA 1ZW9A 3A0XA 3K60A 1NHJA 1MABG 1I5DA 4PDRA 1YIJV 2DYRC 2HKOA 4QPJA 4CWNA 4JGSA 4H37A 3TETA 3KE6A 5L3FA 4MW8A 3W7TA 5EC1C 2EILB 3K0GA 1H7SA 4HXWA 1K34A 4LWHA 5B1NA 4ASUG 3HEKA 1ZXNA 2EINB 3ZMUA 3JD3A 5KA6A 3C11A 3E8BA 4BW5A 2K1EA 3A0TA 3BMYA 2Q8HA 4WFAV 1XL6A 4CBCA 3MD0A 5CTXA 3ZRWB 2JIZG 4H81A 2DQ3A 3ML0A 4P7AA 4EGIA 3HYZA 2ZXWB 4TT3G 4DUHA 2IWSA 4MVZA 3ABKC 5B3SB 1VQPV 4WFGA 3ZJZA 4L87A 3OEEG 1UYMA 3D36A 2V1DA 1YC4A 3EHJA 2XAHA 2WERA 3VOUA 1MG1A 3F7VC 3CCSV 3CCQV 4LBEC 5EC2C 3ZM7A 1S72V 4CWOA 1YJWV 1VQ7V 1I59A 2XAFA 2H55A 1US7A 4J9ZB 1TUEB 3KG2A 4XKAA 4HZ3A 3RLQA 3UM7A 1OCRB 1OZ0A 1K73W 3TZ4A 3ZKBA 2YI7A 2EIKC 4PDLA 2YEVA 2JJ1G 3O2FA 1QR9A 2HLDG 2BU7A 5D7DA 3TK1A 1Q82W 1V55C 1FXVA 2EIJC 5FNDA 4AS9A 4BIZA 4N23A 4FCPA 3K79A 4UV9A 2WPDG 2R9IA 2A9HA 2XX5A 2EILC 2CG9A 2YEGA 4KFMA 3W7UA 1H38A 3TZ2A 4J9YB 2EINC 3EHHA 4MVMA 4LC1A 3CC7V 5FNFA 3SPJA 1NHIA 3E35A 4FPPA 4LPBA 4R7CA 2OCCB 2YEIA 2CCUA 3FKSG 5L3JA 2ZR2A 4L93A 1KKDA 3K08A 1VQMV 4EGHA 2OTJV 3RKZA 4OXSA 2A0LA 3QNEA 2XJXA 3TCUA 5DN6G 3CCVV 4N21A 4AWPA 2XNDG 3K98A 1K3EA 2ZDXA 4KP4A 4CE3A 2EZOA 1M56C 1EI1A 2ZR3A 2GSMB 1PNKA 3JD1A 2QA4V 4TWKA 4Q20A 2YGFA 3RBZA 3T1KA 1B62A 3G4SV 3FB7C 2WEQA 1VQNV 5D7RA 5IYDO 3ZRVA 4R50A 5IN9A 1K33A 1YTFB 4L8ZA 1GTOA 3CMAV 2YE6A 3SPHA 3ETGA 5B1AC 1FXKC 1S14A 2Q6AA 1YERA 1K4DC 4X9LA 3X2QB 5M4KA 1KZNA 2HR3A 3ASNC 3M99B 1KECA 2EJRA 2QF6A 4GT1A 5H6QA 3GIEA 5M4MA 3LPSA 1UYIA 2YKIA 4KUMA 1B63A 1KP2A 2PI4A 2DYSC 5F3KA 4X88A 4PA9A 4L94A 3CCRV 4NH8A 2X6CA 3SPIA 1OCZB 3P30A 2EIMC 1PD3A 4URLA 2HJFC 1R3KC 5D7CA 3RLRA 3T2SA 2WLLA 5L3BA 1QBZA 4GQTA 2XDSA 3K03A 1ROPA 1I5AA 3PJSK 4K4OA 2YE5A 2YK2A 2H94A 3TUHA 4UV8A 4QJFB 2P90A 3VADA 4WFBV 3NMQA 1QY8A 2Q2EB 4TSFG 3K9AA 3OMIB 1BHAA 4BQGA 1M1KW 5IYCO 2ESAA 3TZ0A 4XTJA 2X0LA 4MVQA 5CPHA 1YJNV 1F51A 2DWEC 2YKEA 3E8HA 2HVJC 1GK9A 3VBBA 1OCOB 3E89A 2AKPA 4XDLA 3T0HA 3B24A 2YKJA 1L0OA 4HXZA 2EBOA 4YKWA 2ZDIA 1YJ9V 3SJQC 4XDKA 4MPEA 1EZJA 3GIGB 3ZMVA 1NH2D 1F4NA 4BAYA 2K5BA 4DZYA 5BODA 4YXWG 3AG4B 4R6ZA 1S16A 3ZRWA 2WLNA 2BT0A 4H85A 2GHYA 4R8CA 3FB6C 1Q81W 3BEHA 3QO7A 2Z3YA 4JTAB 1UYCA 1E1QG 3PEHA 2UXNA 3T0ZA 3CMEV 4R3AA 4E01A 4E2LA 1H8HG 1S77D 2DW4A 1UYEA 4U7OA 1U0ZA 4E02A 2JEUA 1NKDA 4O0BA 3A0RA 1TC0A 2ZQMA 4HYPA 3H4LA 1G4YB 3OR6C 4MW3A 1EFRG 5EBLC 3ABMB 4MP7A 1S0VA 1DTOA 1I58A 1K8AW 4LCUC 4BXIA 2M7WA 2JDIG 3A0WA 3EKRA 2BU8A 2YE3A 4H33A 3JZ3A 2KB1A 1ZWHA 1AM1A 3EHBB 4MT8A 4WF9V 2BSMA 4HYMA 3RLPA 4EGKA 2W6JG 4MSWC 1UYFA 3LDDA 2DWDC 5FNCA 2WSSG 4MPCA 3T4ZA 4Z1MG 4MBCA 4RO2A 4YKRA 2WLLB 1AROP 1RM1B 3QTFA 3OPDA 1JVMA 5KA5A 2JK5C 1QZRA 3HB3B 3B26A 1M90W 4PELA 4V26A 2YJWA 2VCIA 2EXLA 3U67A 4HY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBW A;  1AH6 A;  5CTU A;  4URM A;  4HZ0 A;  2BRE A;  4MOT A;  4NH9 A;  2ZKJ A;  2Q8G A;  3R4N A;  1JOY A;  2YED A;  3INX A;  3O2F A;  3G7E A;  3NXS A;  3OMU A;  4AWO A;  1H7U A;  2BU7 A;  5D7D A;  2XDL A;  4XC0 A;  2BZ5 A;  3TK1 A;  4O09 A;  5FND A;  1MX0 A;  3ZRX A;  2XDX A;  4AS9 A;  4BIZ A;  4PU9 A;  3GIF A;  4FCP A;  3HZ1 A;  2QM8 A;  2IWU A;  2YI0 A;  3U2K A;  3ZXQ A;  2XX5 A;  4MPN A;  1YC3 A;  2CG9 A;  4CWP A;  1THN A;  2YI6 A;  3WHA A;  4AWQ A;  2YE4 A;  2YEG A;  3D0B A;  4MTX A;  4GT8 A;  3TZ2 A;  2YEB A;  4L91 A;  4JYB A;  3EHH A;  1AH8 A;  2YGA A;  4LC1 A;  4EFT A;  2XJJ A;  4O04 A;  1Y8N A;  3MNR P;  1BKN A;  2FXS A;  5FNF A;  4URN A;  4JAU A;  4U7N A;  2WI7 A;  2VWC A;  1NHI A;  1Z59 A;  5IDM A;  1UY9 A;  4MP2 A;  4FPP A;  1Y8O A;  4R3M A;  3ZKD A;  2VW5 A;  4LPB A;  1Z5B A;  2IWX A;  3K99 A;  1R62 A;  2YEI A;  1GKZ A;  2CCU A;  3B27 A;  2Q8F A;  5L3J A;  3BM9 A;  2BU5 A;  4KSH A;  4H7Q A;  1QYE A;  4L93 A;  5M4N A;  2YE9 A;  4EGH A;  5FWK A;  3C0E A;  4PL9 A;  3OWB A;  3RKZ A;  1Z5A A;  4WUD A;  4XDM A;  2JKI A;  4BAE A;  4YKT A;  2XJX A;  2BTZ A;  4JAS A;  1TH8 A;  3R4O A;  2YEF A;  5CF0 A;  2HKJ A;  3Q5K A;  1EA6 A;  4EEH A;  4KFG A;  3CRL A;  2CH4 A;  1UY8 A;  1YT1 A;  1KIJ A;  4CE1 A;  5J71 A;  1BXD A;  4AWP A;  2YE8 A;  1NHH A;  3K98 A;  4ASF A;  1UYK A;  2ZDX A;  4KP4 A;  4CE3 A;  1EI1 A;  2YKB A;  2WI6 A;  3QDD A;  4CE2 A;  2QG0 A;  3OW6 A;  4YKU A;  4Q20 A;  2YGF A;  3T1K A;  5B1O A;  1B62 A;  2BU2 A;  2XK2 A;  2YE2 A;  3K97 A;  3FT8 A;  5C93 A;  3R91 A;  3B25 A;  2WEQ A;  5D7R A;  4XIP A;  4LWF A;  2WI1 A;  3ZRV A;  3WQ9 A;  5IN9 A;  2WI3 A;  2YEA A;  3CGZ A;  4I5S A;  3B28 A;  4L90 A;  2H8M A;  4L8Z A;  2YEJ A;  4URO A;  4KSG A;  2YE6 A;  3EKO A;  4LWI A;  3O0I A;  4FMT A;  1S14 A;  4U93 A;  1ID0 A;  1YER A;  2JJC A;  3HZ5 A;  3O6O A;  4X9L A;  5D6Q A;  5M4K A;  1KZN A;  2QF6 A;  3EHF A;  2FWZ A;  3EHG A;  4GT1 A;  3GIE A;  5M4M A;  2YJX A;  2YGE A;  3Q5L A;  3LPS A;  1UY6 A;  1Y4S A;  1UYI A;  2YKI A;  3R4M A;  2O1V A;  4MB9 A;  2O1U A;  1YSR A;  3ZXO A;  1B3Q A;  1B63 A;  2CCS A;  3VHA A;  1BYQ A;  5F3K A;  4JQL A;  3TZ5 A;  4L94 A;  2P67 A;  2GFD A;  3A0Z A;  4NH8 A;  1YT0 A;  3R92 A;  3FV5 A;  5M4E A;  3D2R A;  4FCQ A;  4URL A;  1YSZ A;  2VCJ A;  4ZKI A;  2XJG A;  2XDU A;  2BU6 A;  5CTW A;  4ASA A;  5D7C A;  3RLR A;  3T2S A;  2FTK A;  4YKQ A;  4XIQ A;  4GQT A;  3ZCC A;  3R4P A;  2XDS A;  1I5A A;  2XHR A;  4K4O A;  2WI2 A;  1U2O A;  2YE5 A;  2YK2 A;  2QM7 A;  3TTZ A;  2XHX A;  3SL2 A;  4CWS A;  4JYC A;  3TUH A;  5M4H A;  3GIG A;  1Y8P A;  3U2D A;  2XX2 A;  3PEJ A;  4GEE A;  4XD8 A;  1UY7 A;  3VAD A;  2LFS A;  2LFR A;  2XAB A;  2BYI A;  4CWQ A;  4V25 A;  3NMQ A;  4ASG A;  1QY8 A;  1UYL A;  3HHU A;  4B7P A;  2Q2E B;  4LWG A;  2QFO A;  2YEH A;  2ZBK B;  4YKY A;  2HG1 A;  4BQG A;  2ESA A;  1GKX A;  4XCJ A;  3TZ0 A;  4XTJ A;  1ZXM A;  4XE2 A;  5CPH A;  1F51 A;  3CWV A;  3IED A;  5J6A A;  2O1W A;  2YKE A;  3INW A;  4LWE A;  4QPK A;  4EM7 A;  3A0Y A;  4ZVI A;  4BQJ A;  2XDK A;  3LNU A;  4PRV A;  3T10 A;  2WEP A;  4XKO A;  1AMW A;  4YKX A;  2AKP A;  3T0H A;  4CWR A;  4WUB A;  3B24 A;  4PRX A;  4O07 A;  4R1F A;  2YKJ A;  4KTN A;  4XIT A;  1L0O A;  2YE7 A;  4HXZ A;  4YKW A;  4XCL A;  4HZ5 A;  1TID A;  1ZW9 A;  1TIL A;  4W7T A;  1MU5 A;  3A0X A;  4XKK A;  4MPE A;  2XD6 A;  3K60 A;  4GCZ A;  3GIG B;  1YES A;  4E00 A;  1NHJ A;  1I5D A;  2CCT A;  2K5B A;  4JAV A;  4DZY A;  4GFN A;  5BOD A;  4FCR A;  1IXM A;  3Q5J A;  1S16 A;  3ZRW A;  4P8O A;  2BT0 A;  4H85 A;  3P32 A;  4KQV A;  4LP0 A;  3VHD A;  4QPJ A;  3DGE A;  3CRK A;  4CWN A;  2YEE A;  1UYC A;  3KE6 A;  5M4P A;  1Y4U A;  2YI5 A;  2IOR A;  3PEH A;  2C2A A;  4EMV A;  2BYH A;  1H7S A;  3FT5 A;  1TC6 A;  2XHT A;  4BIU A;  2E0A A;  4O05 A;  4HXW A;  2HCH A;  3T0Z A;  1PVG A;  3H80 A;  4R3A A;  1GJV A;  4LWH A;  5B1N A;  3HEK A;  4E01 A;  1ZXN A;  1UYE A;  5F5R A;  2YEC A;  4U7O A;  1U0Z A;  4GGL A;  3C11 A;  3HYY A;  4E02 A;  2IOP A;  4I3H A;  3A0T A;  2UWD A;  4O0B A;  3A0R A;  1TC0 A;  4HYP A;  3H4L A;  3BMY A;  2YK9 A;  2Q8H A;  2WWW A;  5CTY A;  4B6C A;  3MD0 A;  4MP7 A;  4CWF A;  5CTX A;  3ZRW B;  4H81 A;  4P7A A;  1I58 A;  1JM6 A;  4EGI A;  2IOQ A;  4BXI A;  3HYZ A;  2FWY A;  1BGQ A;  5IDJ A;  1A4H A;  3OWD A;  3A0W A;  3EKR A;  2BU8 A;  2XX4 A;  4DUH A;  2YE3 A;  2IWS A;  2WI4 A;  3JZ3 A;  5D6P A;  1ZWH A;  1AM1 A;  4MT8 A;  2BSM A;  1UYM A;  2Q8I A;  2YKC A;  4HYM A;  3D36 A;  3RLP A;  2FYP A;  1YC4 A;  2BRC A;  3G7B A;  5GGZ A;  1YET A;  4EGK A;  3CGY A;  2WI5 A;  2GQP A;  3EHJ A;  5BOC A;  2CGF A;  1UYF A;  2WER A;  1OSF A;  1YT2 A;  5FNC A;  4MPC A;  1Z5C A;  3G75 A;  1YC1 A;  3VHC A;  4CWT A;  4MBC A;  4HY6 A;  4NH7 A;  1UYG A;  4YKZ A;  1AJ6 A;  1I5B A;  2ZDY A;  4YKR A;  1UYH A;  3ZM7 A;  4CWO A;  1I59 A;  4XIR A;  2QG2 A;  3QTF A;  1I5C A;  2H55 A;  3OPD A;  2XCM A;  4WUC A;  1QZR A;  1US7 A;  3B26 A;  4XKA A;  4EFU A;  4ASB A;  2PNR A;  1UYD A;  1YS3 A;  3RLQ A;  4V26 A;  2YJW A;  2VCI A;  2EXL A;  3U67 A;  3TZ4 A;  4HY1 A;  3ZKB A;  2YI7 A; 
#chains in the Genus database with same CATH topology
 1NVP D;  3OW2 U;  1S5J A;  4URM A;  4HYO A;  2Q5Z A;  5H2F Z;  1QLE B;  2BRE A;  3QG5 A;  4J11 A;  5FL7 G;  1UPG A;  3SPC A;  4HBN A;  1FJG B;  2ZKJ A;  4MVO A;  4X1I B;  1I5X A;  3A8T A;  1MSW D;  2N74 A;  3GB7 C;  4ZOL A;  3RYF A;  2XDL A;  5C8Y A;  4NKG B;  5HFL A;  2LGW A;  3AG3 B;  4O09 A;  4BIO A;  1MX0 A;  2PYJ A;  3OUS A;  3ABL B;  3T2M A;  1XIL A;  2ODM A;  4LR3 A;  1YDX A;  2ETN A;  3ASO C;  1FFX B;  1YC3 A;  1SQB H;  4AWQ A;  3D0B A;  4YHH B;  2NR5 A;  4RQF A;  5IE9 A;  2VQE B;  4L91 A;  1NTZ H;  2FKX A;  1AI4 A;  3SPG A;  1R73 A;  5LL6 Y;  3BA9 A;  2XAQ A;  2VQF O;  4UB8 Z;  2XJJ A;  3Q4H A;  3MNR P;  1BKN A;  3J80 N;  3C3S A;  2FXS A;  2WI7 A;  2VWC A;  4NYK A;  4RQE A;  4EKW A;  5J2T B;  2V7Q G;  3CCM V;  5IDM A;  5KAI Z;  3FFQ A;  2D3O W;  1WB7 A;  1VMG A;  1Y8O A;  5KHG A;  5J9P C;  2YXL A;  3ZKD A;  1R3I C;  2VW5 A;  5H9C A;  4O4H A;  2IWX A;  1R62 A;  2CTR A;  1LUV A;  4UVC A;  2LP7 A;  1TVK B;  4UCU A;  1M93 A;  3B8N A;  1I94 B;  3MHH C;  2Z5U A;  4B3S O;  4PL9 A;  3OWB A;  4WUD A;  2OCH A;  2BCC H;  4BAE A;  1N34 B;  3JAL B;  4LF9 B;  4JAS A;  4DV0 O;  1TH8 A;  3R4O A;  5CF0 A;  4NXM O;  2HKJ A;  1H8E G;  1SS3 A;  4JI3 O;  1EA6 A;  4X66 B;  4EEH A;  2CH4 A;  5CB4 B;  3CSX A;  5J71 A;  2Y4U A;  1BXD A;  1SQP H;  2V4D A;  1JJ2 U;  1FS0 G;  4ASF A;  5FPO A;  1VQ4 V;  1SER A;  2DMX A;  2WLH A;  1IBK O;  2YKB A;  1NQT A;  1TUB B;  3QDD A;  1B6Q A;  3DC6 A;  2QG0 A;  5IY5 B;  2AXT Z;  1RM1 C;  4RUF A;  1I7F A;  2VRZ A;  2M6Y A;  3WFV A;  4H0L B;  4O4I A;  1IUR A;  5B1O A;  3FYE B;  1P49 A;  2BU2 A;  1RPO A;  4Q6G A;  2XK2 A;  3CCJ V;  2YE2 A;  3K97 A;  1GMG A;  3BRC A;  2CH7 A;  1N36 B;  3J7A U;  5GON A;  1NU1 H;  3R91 A;  3WB0 A;  2RCV A;  5BR8 O;  3R65 A;  4IYH A;  1VQ5 V;  2MW2 B;  4LWF A;  2A06 H;  5JJN B;  5L3E A;  2Y69 B;  1QLE C;  1CXZ B;  4WBN B;  3CJH B;  3WQ9 A;  1DLB A;  2WI3 A;  4YJ2 B;  5BXZ A;  3SYQ A;  3B28 A;  4PDM A;  3JYC A;  5LXT A;  3F5T A;  4URO A;  2Q0A A;  2B5U A;  4P2Z A;  3ZX6 A;  5LHG A;  3O0I A;  3ABU A;  3K0D A;  4JYA B;  3HZ5 A;  4I55 A;  5D6Q A;  4FVM A;  2XAG A;  3JCU Z;  1GO3 F;  4GUN A;  4NXN O;  5B66 Z;  4DR3 O;  3EHF A;  1JCH A;  2QKS A;  1W2B U;  5CA1 A;  2FWZ A;  2QKC A;  2YGE A;  4ZBM A;  1Y4S A;  4D7S A;  2PGG A;  4DUY B;  1VQ6 V;  2O1V A;  4MB9 A;  2QWQ B;  1IDS A;  4X1K B;  1YSR A;  3DXR A;  3S3W A;  3BPZ A;  3BCC H;  5IT9 N;  1BL8 A;  4X65 O;  2W6I G;  4JQL A;  3TZ5 A;  5A9G A;  3BAB A;  2P67 A;  1PPJ H;  4UCO A;  3STL C;  4J7J A;  1YCI A;  2ZDI C;  3CCU V;  3D2R A;  5E1A C;  4FCQ A;  4NVP A;  1YSZ A;  1ZL8 A;  2IH1 C;  1AIL A;  2PI5 A;  2XJG A;  4MVU A;  1VF6 C;  5CTW A;  4ASA A;  4QIW F;  4MVS A;  4YKQ A;  1N4C A;  1XNQ O;  1VF7 A;  1H2G A;  4P9P A;  2XHR A;  2WI2 A;  4GYC B;  2ZXW C;  3K5N A;  1K92 A;  2QM7 A;  4I50 B;  1ZTE A;  3H1J H;  5B3S C;  5M4H A;  4DV6 O;  3GIG A;  1Y8P A;  3U2D A;  1SF9 A;  2F4V O;  3N2G A;  4DO2 A;  1QVF U;  4GEE A;  4V25 A;  5LA6 B;  1YTF D;  3CRM A;  2IJJ A;  2JEX A;  2QFO A;  2YEH A;  2Y0P A;  3WG7 B;  5IJ0 B;  3W7W A;  3CEI A;  3JSN A;  4HNA A;  4XE2 A;  1BT8 A;  3QO5 A;  4JI8 O;  1V54 B;  3CWV A;  2VQF B;  1PKX A;  1JFF B;  3WU2 Z;  4BQJ A;  3AG1 B;  3ZBH A;  3B8M A;  3THO A;  4B7E A;  4UVA A;  4K35 A;  1OCR C;  4XKO A;  3W7X A;  4CWR A;  5B1B B;  5AG2 A;  4TQF A;  4OPH A;  4O07 A;  4KTN A;  1ZX3 A;  4XIT A;  2ATK C;  2CGO A;  5IYB O;  3HKC A;  5ITZ A;  4B3M O;  4XCL A;  1WA8 B;  3ZS8 C;  5IJ9 A;  2EJ7 A;  3JAR B;  3L74 H;  1K5Q A;  5D5Q A;  1KYO F;  2RN9 A;  3MDS A;  3OD4 A;  4KXR A;  1TIL A;  4XKK A;  4B3S B;  4YJ3 A;  1YES A;  3CWB H;  4E00 A;  2CCT A;  3N27 A;  4JAV A;  4GFN A;  1IXM A;  2DOS A;  3LDE A;  5KMG B;  4P8O A;  1ENV A;  1NT2 B;  4DV0 B;  3P32 A;  3D3Q A;  3LUT B;  5CBF A;  4NXM B;  3VHD A;  4LWS A;  4JI3 B;  1XMO O;  3DGE A;  1Z5W A;  2W0X A;  4E4E A;  3JD4 A;  1L0L H;  2OTL V;  3JAM N;  2CDY A;  1XEQ A;  3APO A;  2YEE A;  3VQY A;  5L3C A;  2HVK C;  1NTM H;  5M4P A;  3CYO A;  1ORQ C;  1M57 B;  4O4I B;  1IBK B;  4DW0 A;  2YI5 A;  3BFR A;  1H2M A;  4DR1 O;  2KSD A;  1QVG U;  3ETQ A;  5KUM A;  3FT5 A;  1TC6 A;  1A32 A;  1LR1 A;  4FK5 C;  4BIU A;  2C1I A;  2FL4 A;  4O05 A;  3H80 A;  1GJV A;  1QLN A;  2Q4P A;  2PUS A;  1SES A;  1RP3 B;  5JJJ B;  2YXH A;  3PN1 A;  4GGL A;  4D6T H;  5BR8 B;  3ZN1 A;  3H01 A;  3M8A A;  3D8C A;  3HYY A;  2OIG A;  2BOB C;  2IOP A;  4X64 O;  5JCO A;  4WFF A;  4FFK A;  1NJI W;  4I3H A;  3E22 A;  2OCC C;  4PA4 A;  4JI1 O;  5IYZ A;  4QE7 A;  3OUF A;  2DE0 X;  3G67 A;  2JRI A;  4B6C A;  1TAE A;  2NNU A;  1Q8I A;  4X20 A;  4TUY B;  4CWF A;  3RN4 A;  1OJH A;  3DTU B;  1KP3 A;  2XTA A;  4CH3 A;  4GLX A;  4DV7 O;  2IH3 C;  2IOQ A;  4BR6 A;  2FWY A;  1BGQ A;  4UXN A;  1A4H A;  4NXN B;  2EZP A;  5K1P A;  4PD4 F;  4PV1 B;  4LF7 O;  5LHI A;  1JPX A;  2RNB A;  4JTC B;  3ZMZ A;  4FLT A;  3E83 A;  4X1Y B;  4FIP C;  2FB5 A;  4MTF A;  2Q8I A;  2MK3 A;  2ZE8 A;  2FYP A;  5CMU A;  3H1I H;  3G7B A;  5GGZ A;  3CP1 A;  1YET A;  3CGY A;  3O65 A;  4O2B B;  4X65 B;  2ZE7 A;  4DRX A;  2CGF A;  1OSF A;  1Z5C A;  1YC1 A;  2ZIO A;  3VHC A;  2D2C B;  1R3L C;  2K9P A;  4YKZ A;  1AJ6 A;  1FFX A;  4ICG A;  4GKJ O;  2JJ2 G;  1UYH A;  4JI0 O;  1WPB A;  4WFE A;  5FPR A;  5CBG A;  2XCM A;  3AG2 B;  4DXW A;  2A3Q A;  1XNQ B;  2PNR A;  2AW9 A;  1YS3 A;  1AJP A;  1JJO A;  4JAA A;  1AH6 A;  3K06 A;  3ZMS A;  3JAK B;  1KMI Z;  2UXX A;  1B04 A;  4HAM A;  4X89 A;  4HZ0 A;  3N2G B;  5GTI Z;  3D36 C;  1X4T A;  2ZIM A;  2Q8G A;  1JOY A;  3X2Q C;  4DV6 B;  4MTO A;  3CC4 V;  3NXS A;  4AWO A;  2F4V B;  1H7U A;  2CTP A;  4JYY A;  2ZNJ A;  3IC9 A;  1WJZ A;  2ZCE A;  1TVK A;  2XDX A;  1Y74 A;  1YF2 A;  1HNX O;  3ABT A;  1WNS A;  2WLJ A;  2YIB A;  3ETE A;  3M7M X;  4PU9 A;  2Q7G A;  3L9D A;  1QU7 A;  2QM8 A;  2DYR B;  4AIL C;  4FLY A;  2JS3 A;  4QNH B;  5BZB A;  3WB2 A;  5CA3 A;  3FB5 C;  1G6U A;  4NTW A;  4MPN A;  4JI8 B;  1MA1 A;  2HHH O;  3G71 V;  4CWP A;  5EK0 A;  1BQZ A;  1THN A;  2YI6 A;  1XL4 A;  4LFB O;  4MTX A;  1N8R W;  2IU0 A;  1OCZ C;  5CB4 A;  5LHH A;  4GT8 A;  3FD9 A;  2YEB A;  4JYB A;  1J5E O;  3ETD A;  1AH8 A;  4X62 O;  2YGA A;  1XDC A;  3OE7 G;  4O04 A;  1Y8N A;  5BY1 A;  2IW5 A;  4URN A;  1Q5O A;  4U7N A;  3RVY A;  1G8M A;  4CH6 A;  4EFB A;  4B3M B;  3OFN G;  1DF5 A;  2AHY A;  1TGO A;  3TJT A;  3ZRS A;  4R3M A;  3ZHT A;  5JVD B;  1KBH A;  1GN6 A;  2F23 A;  4PA6 A;  1SZT A;  2HJD A;  1I08 A;  1IZ3 A;  5LGN A;  1GKZ A;  3B27 A;  3RW0 A;  4ZHQ B;  4YIO A;  1B06 A;  3BM9 A;  4WBN A;  3CJH A;  3VQW A;  1YZB A;  1F7Y A;  1XMO B;  4YJ2 A;  1RSO B;  5FWK A;  1MMM A;  1F4M A;  1HP8 A;  1Z5A A;  4XDM A;  5LP6 A;  3FYI B;  2JKI A;  3B77 A;  4YKT A;  1Q43 A;  2B1I A;  5DED A;  2JVD A;  1VF5 B;  2NLJ C;  1Q86 W;  1JX9 A;  2YEF A;  4DR1 B;  1YIT V;  3Q5K A;  3F5W C;  4RAI A;  4KFG A;  1XRE A;  1UY8 A;  1KIJ A;  4CE1 A;  3ABK B;  2YE8 A;  3E8F A;  3L72 H;  2KG7 B;  3ZHR A;  2OWO A;  4FLU A;  1H2N A;  1OCO C;  4GX0 A;  1KKC A;  4YKU A;  1ZSP A;  2XUM A;  1XMQ O;  5IYZ B;  4I7Z B;  4X64 B;  3RYC B;  1SET A;  1Y4M A;  1K97 A;  2EUL A;  3CPW U;  4X20 B;  1K7D A;  4JI1 B;  3FT8 A;  1YVW A;  5F2V O;  4JI5 O;  1VQO V;  2UXC O;  3B25 A;  5FNV B;  5KUK A;  4J41 A;  4IT5 A;  1EN5 A;  1CPY A;  4DV7 B;  1Y76 B;  2AHZ A;  2H8P C;  3AG4 C;  3QF7 A;  3CGZ A;  4I5S A;  5LGU A;  2B1G A;  4HY1 A;  2H8M A;  3U11 A;  2N04 A;  3H1K H;  2EIK B;  4LF7 B;  1G1X B;  4KSG A;  3OMA B;  1EZV H;  1NI8 A;  4LWI A;  4FMT A;  4U93 A;  1ID0 A;  2JJC A;  1IX9 A;  2RDC A;  4I50 A;  4DRX B;  3A0B Z;  2LGQ A;  4MTG A;  3RYH B;  1V55 B;  2PF4 E;  1WLE A;  3CC2 V;  5L3D A;  2YJX A;  1P7B A;  2OYQ A;  2EIJ B;  3T4D A;  1UY6 A;  3C3T A;  4UCT A;  2JS5 A;  3R4M A;  5LA6 A;  3ZIA G;  2O1U A;  2YIB D;  4GKJ B;  1PNM A;  4JI0 B;  2CCS A;  1IVS A;  1BYQ A;  5IJ0 A;  2X7R B;  3OTO O;  2GFD A;  3FV5 A;  3C90 A;  1NVP B;  2VCJ A;  1GKF A;  2XDU A;  1JFF A;  4IHJ B;  2P6J A;  1AI6 A;  1R3J C;  4WCE V;  2WLI B;  3ABM C;  4KL1 A;  2LW7 A;  1QQC A;  4LH7 A;  4IL6 Z;  3CD6 V;  1QCE A;  1N32 O;  2OT5 A;  1YXB A;  2LQT A;  3B09 A;  1NR7 A;  4O2A B;  3R4P A;  2WA3 A;  1XOU A;  4UVB A;  2EX3 A;  2C1G A;  1W0J G;  2DQ0 A;  2Q67 A;  1Y74 B;  2YID A;  4PA3 A;  4ABM A;  1U2O A;  3IC7 A;  3CB2 A;  1LNQ A;  1WA8 A;  3SL2 A;  3JAR A;  2CK3 G;  5L3G A;  1SZX A;  2IU3 A;  1HNX B;  3HKB B;  1PV0 A;  5TIS Z;  2UUC O;  3PEJ A;  2Q73 A;  5CN0 A;  2LFS A;  1SQV H;  2LFR A;  2P7T C;  4XBF A;  4UCV A;  1AR4 A;  5KMG A;  2HHH B;  2IJH A;  2ZNI A;  1HNZ O;  3HHU A;  4B7P A;  3I5D A;  4DW1 A;  4LFB B;  1JR9 A;  2UU9 O;  1GH6 A;  3ZN0 A;  1UFI A;  3OM3 B;  2ZBK B;  1SKV A;  4EEQ A;  3AEI A;  3IGA C;  2XAJ A;  3HPL C;  3SYP A;  3F7Y C;  1J5E B;  4XCJ A;  3SJC C;  1VQ8 V;  4DV5 B;  5JCO C;  4XDJ A;  3DC5 A;  4X62 B;  1QR8 A;  1CEZ A;  3INW A;  2VWK A;  4LWE A;  4QPK A;  4D7T A;  4GX2 A;  4EM7 A;  3RVZ A;  3FB8 C;  3SDL A;  2IM9 A;  1M56 B;  1PP9 H;  4PRV A;  3E8G A;  3T10 A;  4JI7 O;  2IJK A;  1KQS U;  2IJI A;  3SYC A;  2GTA A;  2UUA O;  4PI0 A;  4WUB A;  2VWJ A;  4X9Q A;  4PRX A;  1S76 D;  4R1F A;  1PL0 A;  2ILM A;  1SQQ H;  2QWR B;  4CZZ A;  3T1C A;  2Q69 A;  2B9Z A;  5LP6 B;  3JAT B;  5H5N A;  4W7T A;  2FYU H;  1MU5 A;  4UUJ C;  4OGQ B;  2P5O A;  3AG3 C;  2XD6 A;  3CS5 A;  4GCZ A;  3K58 A;  3OGC C;  3I55 V;  4FCR A;  4TUY A;  4I0X A;  2CUG A;  3Q5J A;  4AI8 A;  3UKM A;  2PTM A;  2ITC C;  3ABL C;  3SYO A;  3BY6 A;  4G2K A;  4KQV A;  4LP0 A;  3CYG A;  3E86 A;  2HHI A;  1GN4 A;  5B1A B;  3LDC A;  1FXK B;  3CRK A;  1JMK C;  3TXQ A;  3NR7 A;  1N0J A;  1Y4U A;  1R6N A;  2IOR A;  3ASN B;  4X1Y A;  4DR7 O;  1P84 F;  2C2A A;  3I56 V;  2PZS A;  4JV5 O;  2BYH A;  4EMV A;  1I5Y A;  2XHT A;  1XMQ B;  2E0A A;  1PNL A;  2HCH A;  1PVG A;  1ZLZ A;  4PA7 A;  4O2B A;  5EBW C;  4LF6 O;  5DM6 V;  5F5R A;  2WA4 A;  1HDJ A;  2YEC A;  4JI5 B;  4B3T O;  4QE9 A;  3T1H O;  2UXC B;  2DYS B;  4JTD B;  2DN9 A;  3OEH G;  2P22 C;  2UWD A;  2EIM B;  1KC8 W;  3L71 H;  2YK9 A;  1E79 G;  3N2K B;  2GV9 A;  1IBM O;  4TQD A;  3BHP A;  3LSS A;  2WWW A;  5CTY A;  1E1R G;  2QKA A;  3JD0 A;  3G80 A;  4LF5 O;  5BMV B;  3JAK A;  1JM6 A;  5JQG B;  1ZWI C;  3VQX A;  5IDJ A;  1RPR A;  3LSQ A;  3OWD A;  1AR1 B;  1WP7 A;  2XX4 A;  5LYJ B;  4B7K A;  2WI4 A;  3IAY A;  5D6P A;  3GWO A;  4RUE A;  2P4K A;  5LMN O;  2QWN B;  2YKC A;  4F6E A;  2ITD C;  2WAM A;  2BRC A;  5IY5 C;  2WI5 A;  2GQP A;  5BOC A;  2UXB O;  3OTO B;  1OHH G;  1YT2 A;  2X6A A;  2JGD B;  4UB6 Z;  3G75 A;  2QR4 A;  2ZD9 A;  1S5H C;  4G28 B;  4HY6 A;  4CWT A;  1GM7 A;  4NH7 A;  1UYG A;  2WLM A;  1I5B A;  2ZDY A;  1SQF A;  3SR2 C;  3ICX A;  4XIR A;  2QG2 A;  4JZ2 A;  1I5C A;  5EBM C;  4TV8 B;  1MOF A;  4WUC A;  1N32 B;  4W4L A;  2Y69 C;  3K5M A;  4EFU A;  4ASB A;  1UYD A;  4NTX A;  2A79 B;  1AJQ A;  4Z2W A;  1TBW A;  5CTU A;  3ZHV A;  3B40 A;  4O4J A;  1AI7 A;  1NTK H;  4MOT A;  4NH9 A;  3K3W A;  3R4N A;  4IGG A;  2F93 B;  5JVD A;  1D5N A;  2YED A;  3INX A;  3OTF A;  2QTO A;  2UUC B;  3TGU H;  3G7E A;  3OMU A;  3HR0 A;  4XC0 A;  2BZ5 A;  2HG5 C;  1BHB A;  2WLK A;  1GM8 A;  2L6L A;  4ZHQ A;  2E74 B;  4I9Q A;  3MAQ A;  1HNZ B;  3ZRX A;  1O9G A;  4FJC C;  4J42 A;  2UU9 B;  1RSO A;  4DK0 A;  3GIF A;  3HZ1 A;  2IWU A;  2YI0 A;  3U2K A;  1WPX A;  3UO2 A;  3ZXQ A;  1HWY A;  1VQL V;  4TV9 B;  3K5O A;  2H3O A;  1YSC A;  4UCR A;  3WHA A;  2YE4 A;  4GX5 A;  1JQ0 A;  4JI7 B;  2KG7 A;  4DR4 O;  1Y66 A;  1PL4 A;  2R9R B;  2UUA B;  4EFT A;  1J95 A;  4JAU A;  4P9O A;  1CP9 A;  3RYC A;  1Z59 A;  1K5S A;  1X59 A;  1UY9 A;  1KD1 W;  4MP2 A;  2YEV B;  4K0K B;  4I0X B;  3IFX A;  4FLW A;  1Y6X A;  3RT3 C;  2W0F C;  5JWP A;  5EIB D;  1Z5B A;  3K99 A;  1K4C C;  1L0N H;  5H6R A;  1Q6I A;  5FNV A;  1BMF G;  5J2U B;  2Q8F A;  2BU5 A;  4KSH A;  2JGU A;  1COW G;  3UO3 A;  3H9V A;  3JD2 A;  1Y76 A;  4H7Q A;  1QYE A;  5M4N A;  2YE9 A;  3C0E A;  1AP5 A;  4JF3 A;  4B08 A;  4P30 A;  2HFE C;  2Q7H A;  1AJN A;  3OMN B;  3WG7 C;  1NBM G;  4DR5 O;  1YI2 V;  4IIJ B;  2BTZ A;  2LJ2 A;  3ZHQ A;  3JCZ A;  3K04 A;  1YHQ V;  1GAX A;  4DR7 B;  1FFT B;  4JV5 B;  3CRL A;  1YT1 A;  1BCC H;  1V54 C;  1NHH A;  1SA0 B;  3RYH A;  1UYK A;  1BSM A;  3AG1 C;  2X6B A;  2XAS A;  4LF6 B;  5LBQ A;  3QO8 A;  2WI6 A;  3QTC A;  4F4L A;  2RJZ A;  4CE2 A;  4B3T B;  3OW6 A;  1AI5 A;  1KU9 A;  3T1H B;  5B1B C;  2E3C A;  3OAA G;  5IWA O;  4ZIB A;  3D3I A;  1WP8 A;  1VQ9 V;  5C93 A;  3K5L A;  1IBM B;  4B3R O;  3STZ C;  2QEX V;  4I9W A;  2P4V A;  5E79 Z;  1S3J A;  4XIP A;  3OR7 C;  4IHJ A;  3U0Z A;  1NR1 A;  2WI1 A;  5KX5 B;  1DF4 A;  4LF5 B;  2YUA A;  2WLI A;  2F43 G;  4DR2 O;  4I4T B;  1P4R A;  2YEA A;  4L90 A;  3K57 A;  1OCC B;  4O2A A;  4JZG A;  2YEJ A;  4O4L B;  3CE2 A;  2KQX A;  3EKO A;  4CC5 A;  4CS2 A;  3ZMT A;  3WB1 A;  3SYA A;  1P7G A;  5K1X A;  1VF6 A;  1SRY A;  2XOK G;  3O6O A;  2QE7 G;  1GN2 A;  1M57 C;  5LMN B;  3CXC U;  3HKB A;  5LGT A;  3EHG A;  2Y48 A;  3KZI Z;  3LSU A;  3Q5L A;  2E75 B;  2UXB B;  2BOC C;  1KUQ A;  1K9M W;  3CRR A;  1THZ A;  1HNW O;  2Q68 A;  3ZXO A;  1B3Q A;  4W4K A;  4EB6 B;  4DV5 O;  1XUQ A;  4J10 A;  3VHA A;  3ASO B;  1O9H A;  1URF A;  4DV2 O;  4J80 A;  4MVR A;  3A0Z A;  1YT0 A;  3R92 A;  3LNN A;  5M4E A;  4DV3 O;  4KHP O;  2XHB A;  3AK2 A;  4O4J B;  4ZKI A;  3G6E V;  2YSU B;  1NH2 B;  2BU6 A;  1F23 A;  3W7S A;  4LP8 A;  1QHT A;  4G27 B;  2FTK A;  1VQK V;  3OGI B;  4XIQ A;  3ZCC A;  1AR5 A;  3ZED A;  2XT9 A;  1WAZ A;  1MSD A;  5GW7 A;  1IBL O;  4GZR B;  2YDE A;  3E2E A;  4IYI A;  3TTZ A;  4BWA A;  2XHX A;  3FAV A;  3JAT A;  3RGB A;  4CWS A;  3CX5 F;  2YXY A;  4JYC A;  4U3J A;  1XHZ A;  1U96 A;  2XX2 A;  4JPR A;  4FM1 A;  1XHX A;  3GVM A;  3JAS A;  4XD8 A;  1UY7 A;  3LNM B;  2XAB A;  1UJW B;  4WFH A;  2BYI A;  2BTQ B;  4CWQ A;  1VAR A;  4C7U A;  1R6K A;  5JJE B;  3EFF K;  3J81 N;  1UYL A;  4ASG A;  1W0K G;  3EVK A;  3APQ A;  1H2K A;  3B2E E;  4X8A A;  4LWG A;  1GM9 A;  1WN7 A;  4LF4 O;  1FXK A;  3CCL V;  2HG1 A;  4YKY A;  1GKX A;  1XNR O;  3CCE V;  1ZXM A;  4DR4 B;  1FXH A;  2ADP A;  1LUW A;  5EIB C;  1DK1 A;  1SQG A;  1BE3 H;  3IED A;  5J6A A;  2O1W A;  3AG2 C;  1Q7Y W;  2Z0A A;  3A0Y A;  4U3F H;  4ZVI A;  4GX1 A;  3MHS C;  1M9N A;  2XDK A;  3LNU A;  3SJA C;  2WEP A;  1AMW A;  4YKX A;  4PDV A;  1L1F A;  1GN3 A;  4YY3 O;  5CBH A;  1EBO A;  2YE7 A;  4A5U B;  5HFM A;  4HZ5 A;  4MS2 A;  2HP8 A;  1TID A;  1NS1 A;  1ZW9 A;  1R6T A;  1Q6H A;  3A0X A;  3DSQ A;  5FLX N;  3N2K A;  3K60 A;  2Y0I A;  4YIP A;  1KB9 F;  1US6 A;  4L8J A;  1NHJ A;  1MAB G;  1I5D A;  2VS0 A;  4PDR A;  4DR5 B;  1YIJ V;  2GBO A;  2DYR C;  5BMV A;  1EM1 A;  5JQG A;  2HKO A;  4J7K A;  2AZ2 A;  4QPJ A;  2NN4 A;  4CWN A;  4JGS A;  3BA8 A;  1VIB A;  4H37 A;  5LYJ A;  3TET A;  3KE6 A;  3U10 A;  2DJV A;  5L3F A;  4MW8 A;  3W7T A;  3CRQ A;  5KHK A;  4K8X A;  3JSL A;  5EC1 C;  2QTS A;  2EIL B;  3K0G A;  1H7S A;  1FD9 A;  1BQ0 A;  4HXW A;  1K34 A;  1ZAU A;  5JH7 B;  4LWH A;  5B1N A;  5IWA B;  4ASU G;  3HEK A;  1ZXN A;  2EIN B;  3O9O A;  2JGD A;  3ZMU A;  4DYL A;  3JD3 A;  5KA6 A;  3C11 A;  1VP7 A;  4LFA O;  1XI1 A;  4B3R B;  1N0N A;  2QGN A;  2F1M A;  3H1L H;  1M5I A;  3E8B A;  4BW5 A;  2K1E A;  3A0T A;  1V9P A;  3CXH F;  1FAF A;  3BMY A;  4DR2 B;  4TV8 A;  2Q8H A;  4WFA V;  1T5E A;  1EN4 A;  1XL6 A;  4CBC A;  3MD0 A;  4LFC O;  5CTX A;  4PHZ A;  3ZRW B;  2JIZ G;  4H81 A;  2DQ3 A;  2Q8V A;  3ML0 A;  2BSK B;  4P7A A;  4EGI A;  5JEN A;  3HYZ A;  2ZXW B;  2CE4 A;  4TT3 G;  4DUH A;  4AQY O;  2IWS A;  4MVZ A;  3UT5 B;  3ABK C;  5B3S B;  1VQP V;  4WFG A;  3ZJZ A;  3BAA A;  4L87 A;  1HNW B;  3HKE B;  3OEE G;  1UYM A;  3G6B A;  5EYP B;  3D36 A;  2V1D A;  1YC4 A;  4FZ0 A;  4DV2 B;  3EHJ A;  2XAH A;  2WER A;  3VOU A;  5LOV A;  4OPA A;  2UXD O;  1MG1 A;  3F7V C;  4TV9 A;  3CCS V;  4FLV A;  4DV3 B;  4KHP B;  3CCQ V;  4LBE C;  5EC2 C;  2R70 A;  3ZM7 A;  1S72 V;  2QJ1 A;  4CWO A;  1YJW V;  1VQ7 V;  1R1B A;  1I59 A;  2XAF A;  1OV9 A;  2H55 A;  1US7 A;  4J9Z B;  3IJ4 A;  1TUE B;  3KG2 A;  4XKA A;  3RFR A;  4HZ3 A;  3RLQ A;  3UM7 A;  1OCR B;  3BVO A;  1OZ0 A;  3FAV B;  1Q90 D;  2ZIN A;  1K73 W;  1IBL B;  4K0K O;  3TZ4 A;  2YI7 A;  3ZKB A;  2ZM6 O;  2EIK C;  2GUZ A;  4U3J B;  1HW7 A;  1W59 A;  4PDL A;  3JAS B;  2YEV A;  3T1Y O;  2GDS A;  3HKD B;  1ZUQ A;  3JAW B;  2PY5 A;  2JJ1 G;  3P3N A;  3ZHS A;  1QR9 A;  2HLD G;  5KHJ A;  1FYJ A;  3O2F A;  3EXA A;  2BU7 A;  5D7D A;  3TK1 A;  1Q82 W;  1V55 C;  5J2U A;  1FXV A;  1RFY A;  2EIJ C;  5FND A;  4AS9 A;  4NR1 A;  4JI6 O;  2YI9 A;  4BIZ A;  2CTQ A;  1U97 A;  4LF4 B;  4N23 A;  4F6R A;  4FCP A;  4DV1 O;  3K79 A;  4UV9 A;  2WPD G;  2R9I A;  1XNR B;  2A9H A;  2XX5 A;  2EIL C;  4ZI7 B;  4IIJ A;  2CG9 A;  3GWK C;  1JA8 A;  2YEG A;  2ZE6 A;  4KFM A;  1Z2G A;  2Q9L A;  3W7U A;  1H38 A;  3A2F A;  5LMU O;  2R9A A;  1QNM A;  3TZ2 A;  4J9Y B;  1SA0 A;  2EIN C;  3EHH A;  4NTY A;  4YY3 B;  4MVM A;  4LC1 A;  3CC7 V;  4FFB B;  5CA0 B;  5FNF A;  3SPJ A;  1NZ6 A;  1NHI A;  3E35 A;  4FPP A;  4DUZ O;  4LPB A;  4ZOL B;  1N33 O;  2O57 A;  3RYF B;  4R7C A;  2OCC B;  2YEI A;  5C8Y B;  2E5L O;  2CCU A;  3A0H Z;  5KX5 A;  3FKS G;  5L3J A;  2Y4T A;  2ZR2 A;  5D5P A;  4I4T A;  4L93 A;  1KKD A;  3K08 A;  1VQM V;  4EGH A;  4NB5 A;  2OTJ V;  2KKW A;  4JI2 O;  4OXS A;  3RKZ A;  4PJ0 Z;  2A0L A;  4O4L A;  3QNE A;  2XJX A;  4UFZ A;  2Q0O C;  3P3P A;  1Z5V A;  3TCU A;  5DN6 G;  2A7W A;  3S5T A;  4DV4 O;  1D5A A;  3CCV V;  4N21 A;  4AWP A;  2XND G;  3K98 A;  1K3E A;  2ZDX A;  4JI4 O;  4KP4 A;  4CE3 A;  2EZO A;  1M56 C;  1EI1 A;  2ZR3 A;  2GSM B;  3Q4H B;  5EZY A;  1PNK A;  3JD1 A;  4LFA B;  2ZE5 A;  2QA4 V;  3TXS A;  2CAZ C;  3FX7 A;  4TWK A;  4Q20 A;  4EB6 A;  2YGF A;  3RBZ A;  3T1K A;  1MNG A;  4LNU A;  4CS4 A;  3KCX A;  1B62 A;  3G4S V;  4RWU A;  3FB7 C;  2PYL A;  5LP6 C;  4O4H B;  2WEQ A;  4LFC B;  1VQN V;  3UQ8 A;  5D7R A;  5IYD O;  1I0H A;  4DR6 O;  3ZRV A;  4R50 A;  5IN9 A;  1BS3 A;  1K33 A;  1YTF B;  4L8Z A;  3LMM A;  1GTO A;  3CMA V;  4OX9 O;  3SPH A;  3ETG A;  2YE6 A;  4AQY B;  5B1A C;  3CRC A;  3K9S A;  1FXK C;  3KCY A;  1S14 A;  2Q6A A;  1YER A;  5DEC A;  1K4D C;  4FZ1 A;  4X9L A;  3X2Q B;  5M4K A;  2ARH A;  1KZN A;  5LOV B;  2YI8 A;  2GTS A;  2HR3 A;  1FKA O;  3ASN C;  3M99 B;  1KEC A;  2EJR A;  1MZE A;  2QF6 A;  4GKK O;  2UUB O;  3RYI A;  4GT1 A;  5H6Q A;  3GIE A;  4UCS A;  4LF8 O;  5M4M A;  2UXD B;  3LPS A;  2YS8 A;  3VQV A;  1UYI A;  2YKI A;  2CGN A;  2OIE A;  2BTQ A;  1SC5 B;  4H13 B;  4KUM A;  3QVN A;  1B63 A;  1AP6 A;  1S5L Z;  1KP2 A;  2PI4 A;  2DYS C;  5F3K A;  2LW1 A;  4X88 A;  4PA9 A;  4L94 A;  3CCR V;  1HR0 O;  4NH8 A;  2X6C A;  3SPI A;  2CH7 B;  2YIA A;  1OCZ B;  5GON B;  3P30 A;  2EIM C;  2GUZ B;  1BZK A;  1PD3 A;  2F66 C;  4URL A;  1FPO A;  2HJF C;  1WB8 A;  1R3K C;  5KHI A;  5D7C A;  3RLR A;  2ZM6 B;  3T2S A;  2R72 A;  2WLL A;  5L3B A;  1XBL A;  1QBZ A;  1YEW A;  3T1Y B;  4GQT A;  5LXT B;  2XDS A;  3K03 A;  1ROP A;  1I5A A;  2ADQ B;  2BTO A;  2YIC A;  1PM9 A;  3PJS K;  4K4O A;  2YE5 A;  2LO1 A;  2ZT9 B;  3CHX A;  4I55 B;  2YK2 A;  4H44 B;  4F6R B;  2P06 A;  3UCS C;  2QWP B;  2QWO B;  2H94 A;  3SJB C;  1FJG O;  2QM4 A;  1SQX H;  1H2L A;  4JI6 B;  3TUH A;  5CA1 B;  4UV8 A;  3AG7 A;  4DV1 B;  1XQ8 A;  4QJF B;  2P90 A;  3VAD A;  3R66 A;  1H2S B;  5GTH Z;  4X1I A;  4WFB V;  4DR3 B;  3NMQ A;  3CRA A;  3DXR B;  1QY8 A;  2Q2E B;  4TSF G;  3K9A A;  3OMI B;  5B5E Z;  1BHA A;  4BQG A;  5LMU B;  1M1K W;  5IYC O;  3KKY A;  1Q3E A;  2ESA A;  3AK3 A;  3TZ0 A;  4XTJ A;  2X0L A;  4MVQ A;  4FM0 A;  4BW9 A;  3L70 H;  5CPH A;  1YJN V;  1L8D A;  1F51 A;  2DWE C;  2YKE A;  1ZL8 B;  3E8H A;  4YHH O;  2HVJ C;  2VQE O;  4E72 A;  1GK9 A;  2L35 A;  5JH7 A;  3VBB A;  1OCO B;  2AGA A;  3E89 A;  2AKP A;  4XDL A;  3T0H A;  3L73 H;  3B24 A;  4DUZ B;  2G38 A;  2YKJ A;  1N33 B;  1L0O A;  1VEW A;  4HXZ A;  2EBO A;  2E5L B;  1EN6 A;  4YKW A;  1TA8 A;  2ZDI A;  5KLV H;  4CC6 A;  1YJ9 V;  3B4S A;  4FM2 A;  2RMK B;  3SJQ C;  4XDK A;  2AZ0 A;  4MPE A;  1GRJ A;  5KAF Z;  1EZJ A;  5J2T A;  3ZMV A;  4JI2 B;  1NH2 D;  3GIG B;  1F4N A;  1Q6U A;  4BAY A;  2K5B A;  4DZY A;  5BOD A;  4YXW G;  3RWR D;  3AG4 B;  4CS3 A;  4R6Z A;  1S16 A;  3ZRW A;  2WLN A;  2BT0 A;  4H85 A;  2BSK A;  2GHY A;  4R8C A;  1D2D A;  1I94 O;  4CH5 A;  2IBZ H;  3FB6 C;  4DV4 B;  4FLX A;  1AVM A;  1Q81 W;  3BEH A;  3QO7 A;  4J7Z A;  4QGP A;  5EZY B;  2Z3Y A;  4JTA B;  1UYC A;  2HEP A;  1N34 O;  4HNA B;  1E1Q G;  3UT5 A;  4LF9 O;  4JI4 B;  2CTW A;  3PEH A;  3K59 A;  4LNU B;  4DK1 A;  4X66 O;  2UXN A;  3HKE A;  3SGI A;  3JAL A;  2ZKO A;  5EYP A;  3T0Z A;  3CME V;  4R3A A;  2BE3 A;  4E01 A;  4E2L A;  1H8H G;  1S77 D;  2DW4 A;  1UYE A;  4U7O A;  1U0Z A;  4LH6 A;  2YC0 A;  2Q7E A;  4DR6 B;  4E02 A;  2JEU A;  3HKC B;  5ITZ B;  1TUB A;  2FML A;  3AK1 A;  5IJ9 B;  5A2Q N;  1NKD A;  1Y67 A;  4O0B A;  3A0R A;  4Z1V A;  1TC0 A;  4K3A A;  2ZQM A;  4HYP A;  3H4L A;  1N36 O;  1G4Y B;  3OR6 C;  4MW3 A;  4YJ3 B;  1EFR G;  5EBL C;  1M4U A;  3H1H H;  3ABM B;  4FLZ A;  4MP7 A;  4OX9 B;  1S0V A;  1DTO A;  1BGY H;  1I58 A;  1K8A W;  3RYI B;  4LWS B;  4CH4 A;  4LCU C;  4BXI A;  2M7W A;  2QDO A;  3S3X A;  2JDI G;  3A0W A;  3HKD A;  3JAW A;  3EKR A;  2BU8 A;  4GKK B;  2UUB B;  2F95 B;  4H33 A;  2YE3 A;  4LF8 B;  3JZ3 A;  2KB1 A;  2RQ6 A;  4JYA O;  3OT7 A;  1ZWH A;  1DGS A;  4TOI A;  1AB3 A;  1AM1 A;  3EHB B;  2E76 B;  4MT8 A;  4WF9 V;  2BSM A;  4K8Z A;  4HYM A;  1IXB A;  3RLP A;  3L75 H;  4EGK A;  2W6J G;  4MSW C;  2QSA A;  1UYF A;  3ZHU A;  3LDD A;  2DWD C;  2WSS G;  1HR0 B;  5FNC A;  4MPC A;  4EFE A;  5KHH A;  4DUY O;  3T4Z A;  4Z1M G;  4MBC A;  4RO2 A;  4ZI7 A;  4AHC A;  4YKR A;  2WLL B;  1ARO P;  1RM1 B;  3E22 B;  4X1K A;  3QTF A;  3OPD A;  1JVM A;  5KA5 A;  2JK5 C;  1QZR A;  3HB3 B;  3B26 A;  1M90 W;  4PEL A;  4PI2 A;  4V26 A;  2N05 A;  4FFB A;  2VCI A;  5CA0 A;  2EXL A;  2YJW A;  3U67 A;  1OCC C;  1MZF A; 
#chains in the Genus database with same CATH homology
 1NVP D;  3OW2 U;  4URM A;  4HYO A;  1QLE B;  2BRE A;  5FL7 G;  3SPC A;  2ZKJ A;  4MVO A;  1I5X A;  1MSW D;  3GB7 C;  2XDL A;  5HFL A;  3AG3 B;  4O09 A;  1MX0 A;  3OUS A;  3ABL B;  3T2M A;  3ASO C;  1YC3 A;  4AWQ A;  3D0B A;  4RQF A;  4L91 A;  1AI4 A;  3SPG A;  1R73 A;  2XAQ A;  2XJJ A;  3MNR P;  1BKN A;  2FXS A;  2WI7 A;  2VWC A;  4RQE A;  4EKW A;  2V7Q G;  3CCM V;  5IDM A;  2D3O W;  1Y8O A;  5J9P C;  3ZKD A;  1R3I C;  2VW5 A;  5H9C A;  2IWX A;  1R62 A;  4UVC A;  2LP7 A;  3B8N A;  3MHH C;  2Z5U A;  4PL9 A;  3OWB A;  4WUD A;  4BAE A;  4JAS A;  1TH8 A;  3R4O A;  5CF0 A;  2HKJ A;  1H8E G;  1EA6 A;  4EEH A;  2CH4 A;  5J71 A;  1BXD A;  1JJ2 U;  1FS0 G;  4ASF A;  1VQ4 V;  1SER A;  2WLH A;  2YKB A;  1NQT A;  3QDD A;  1B6Q A;  2QG0 A;  5IY5 B;  1RM1 C;  4RUF A;  3WFV A;  5B1O A;  3FYE B;  2BU2 A;  1RPO A;  2XK2 A;  3CCJ V;  2YE2 A;  3K97 A;  1GMG A;  3R91 A;  3R65 A;  1VQ5 V;  4LWF A;  5L3E A;  2Y69 B;  1QLE C;  3WQ9 A;  1DLB A;  2WI3 A;  3SYQ A;  3B28 A;  4PDM A;  3JYC A;  4URO A;  2B5U A;  4P2Z A;  5LHG A;  3O0I A;  3ABU A;  3K0D A;  3HZ5 A;  5D6Q A;  2XAG A;  1GO3 F;  3EHF A;  1JCH A;  2QKS A;  1W2B U;  2FWZ A;  2YGE A;  4ZBM A;  1Y4S A;  1VQ6 V;  2O1V A;  4MB9 A;  1YSR A;  1BL8 A;  2W6I G;  4JQL A;  3TZ5 A;  2P67 A;  3STL C;  3CCU V;  2ZDI C;  3D2R A;  5E1A C;  4FCQ A;  1YSZ A;  2IH1 C;  2PI5 A;  2XJG A;  4MVU A;  5CTW A;  4ASA A;  4QIW F;  4MVS A;  4YKQ A;  1H2G A;  4P9P A;  2XHR A;  2WI2 A;  2ZXW C;  1K92 A;  2QM7 A;  5B3S C;  5M4H A;  3GIG A;  1Y8P A;  3U2D A;  4DO2 A;  1QVF U;  4GEE A;  4V25 A;  1YTF D;  2IJJ A;  2JEX A;  2QFO A;  2YEH A;  3WG7 B;  3W7W A;  4XE2 A;  3QO5 A;  1V54 B;  3CWV A;  1PKX A;  4BQJ A;  3AG1 B;  3B8M A;  4UVA A;  1OCR C;  4XKO A;  3W7X A;  4CWR A;  5B1B B;  4O07 A;  4KTN A;  4XIT A;  2ATK C;  5IYB O;  4XCL A;  1K5Q A;  1TIL A;  4XKK A;  1YES A;  4E00 A;  2CCT A;  4JAV A;  4GFN A;  1IXM A;  3LDE A;  4P8O A;  1ENV A;  3P32 A;  5CBF A;  3LUT B;  3VHD A;  3DGE A;  1OCC C;  3JD4 A;  2OTL V;  2YEE A;  5L3C A;  2HVK C;  5M4P A;  3CYO A;  1ORQ C;  1M57 B;  2YI5 A;  1QVG U;  5KUM A;  3FT5 A;  1TC6 A;  4FK5 C;  4BIU A;  4O05 A;  3H80 A;  1GJV A;  1QLN A;  1SES A;  4GGL A;  3ZN1 A;  3H01 A;  3HYY A;  2BOB C;  2IOP A;  1NJI W;  4WFF A;  4I3H A;  2OCC C;  4PA4 A;  4QE7 A;  3OUF A;  4B6C A;  2NNU A;  4CWF A;  3DTU B;  1KP3 A;  2IH3 C;  2IOQ A;  2FWY A;  1BGQ A;  4UXN A;  1A4H A;  2EZP A;  5LHI A;  1JPX A;  4JTC B;  3ZMZ A;  3E83 A;  4FIP C;  4MTF A;  2Q8I A;  2MK3 A;  2FYP A;  5CMU A;  3G7B A;  5GGZ A;  3CP1 A;  1YET A;  3CGY A;  2CGF A;  1OSF A;  1Z5C A;  1YC1 A;  3VHC A;  1R3L C;  4YKZ A;  1AJ6 A;  2JJ2 G;  1UYH A;  4WFE A;  5CBG A;  2XCM A;  3AG2 B;  4DXW A;  2PNR A;  1YS3 A;  1AJP A;  1AH6 A;  3K06 A;  3ZMS A;  2UXX A;  4HAM A;  4X89 A;  4HZ0 A;  2Q8G A;  1JOY A;  3X2Q C;  4MTO A;  3CC4 V;  3NXS A;  4AWO A;  1H7U A;  2XDX A;  3ABT A;  2WLJ A;  3ETE A;  4PU9 A;  2QM8 A;  2DYR B;  4QNH B;  5BZB A;  5CA3 A;  3FB5 C;  4MPN A;  3G71 V;  4CWP A;  5EK0 A;  1THN A;  2YI6 A;  1XL4 A;  4MTX A;  1N8R W;  2IU0 A;  1OCZ C;  5LHH A;  4GT8 A;  2YEB A;  4JYB A;  3ETD A;  1AH8 A;  2YGA A;  3OE7 G;  4O04 A;  1Y8N A;  2IW5 A;  4URN A;  4U7N A;  3RVY A;  1G8M A;  3OFN G;  1DF5 A;  2AHY A;  3ZRS A;  4R3M A;  4PA6 A;  1SZT A;  5LGN A;  1GKZ A;  3B27 A;  3RW0 A;  3BM9 A;  5FWK A;  1F4M A;  1Z5A A;  4XDM A;  3FYI B;  2JKI A;  3B77 A;  4YKT A;  2B1I A;  2NLJ C;  1Q86 W;  1JX9 A;  2YEF A;  1YIT V;  3Q5K A;  3F5W C;  4RAI A;  4KFG A;  1UY8 A;  1KIJ A;  4CE1 A;  3ABK B;  2YE8 A;  3E8F A;  1OCO C;  4GX0 A;  4YKU A;  1SET A;  1Y4M A;  1K97 A;  3CPW U;  1K7D A;  3FT8 A;  1VQO V;  3B25 A;  5KUK A;  1CPY A;  2AHZ A;  3AG4 C;  2H8P C;  3CGZ A;  4I5S A;  5LGU A;  2B1G A;  2H8M A;  2EIK B;  4KSG A;  3OMA B;  4LWI A;  4FMT A;  4U93 A;  1ID0 A;  2JJC A;  4MTG A;  1V55 B;  1WLE A;  3CC2 V;  5L3D A;  2YJX A;  1P7B A;  2EIJ B;  3T4D A;  1UY6 A;  3R4M A;  3ZIA G;  2O1U A;  1PNM A;  2CCS A;  1BYQ A;  2X7R B;  2GFD A;  3FV5 A;  1NVP B;  2VCJ A;  1GKF A;  2XDU A;  2P6J A;  1AI6 A;  1R3J C;  4WCE V;  2WLI B;  3ABM C;  3CD6 V;  1QCE A;  2OT5 A;  1NR7 A;  3R4P A;  4UVB A;  1W0J G;  2DQ0 A;  2Q67 A;  1U2O A;  4PA3 A;  3IC7 A;  1LNQ A;  3SL2 A;  2CK3 G;  5L3G A;  2IU3 A;  3PEJ A;  5CN0 A;  2LFS A;  2LFR A;  2P7T C;  4XBF A;  2IJH A;  3HHU A;  4B7P A;  3ZN0 A;  3OM3 B;  2ZBK B;  3AEI A;  3IGA C;  2XAJ A;  3HPL C;  3SYP A;  3F7Y C;  4XCJ A;  1VQ8 V;  4XDJ A;  1QR8 A;  1CEZ A;  3INW A;  4LWE A;  4QPK A;  4EM7 A;  4GX2 A;  3RVZ A;  3FB8 C;  1M56 B;  4PRV A;  3E8G A;  3T10 A;  2IJK A;  1KQS U;  2IJI A;  3SYC A;  4WUB A;  4PRX A;  1S76 D;  4R1F A;  1PL0 A;  4CZZ A;  3T1C A;  2Q69 A;  4W7T A;  1MU5 A;  4UUJ C;  3AG3 C;  2XD6 A;  4GCZ A;  3OGC C;  3I55 V;  4FCR A;  3Q5J A;  3UKM A;  2ITC C;  3ABL C;  3SYO A;  3BY6 A;  4G2K A;  4KQV A;  4LP0 A;  3E86 A;  5B1A B;  3LDC A;  1FXK B;  3CRK A;  1Y4U A;  1R6N A;  2IOR A;  3ASN B;  2C2A A;  4EMV A;  3I56 V;  2BYH A;  1I5Y A;  2XHT A;  2E0A A;  1PNL A;  2HCH A;  1PVG A;  4PA7 A;  5EBW C;  5DM6 V;  5F5R A;  2YEC A;  4QE9 A;  2DYS B;  4JTD B;  3OEH G;  2UWD A;  2EIM B;  1KC8 W;  2YK9 A;  1E79 G;  3LSS A;  2WWW A;  5CTY A;  1E1R G;  3JD0 A;  1JM6 A;  1ZWI C;  5IDJ A;  1RPR A;  3LSQ A;  3OWD A;  1AR1 B;  2XX4 A;  2WI4 A;  5D6P A;  3GWO A;  4RUE A;  2YKC A;  2ITD C;  2WAM A;  2BRC A;  5IY5 C;  2WI5 A;  2GQP A;  5BOC A;  1OHH G;  1YT2 A;  2X6A A;  3G75 A;  4CWT A;  2ZD9 A;  1S5H C;  4G28 B;  4HY6 A;  1GM7 A;  4NH7 A;  1UYG A;  2WLM A;  1I5B A;  2ZDY A;  4XIR A;  2QG2 A;  1I5C A;  5EBM C;  4WUC A;  1MOF A;  2Y69 C;  4EFU A;  4ASB A;  1UYD A;  2A79 B;  1AJQ A;  1TBW A;  5CTU A;  1AI7 A;  4MOT A;  4NH9 A;  3K3W A;  3R4N A;  2YED A;  3INX A;  2QTO A;  3G7E A;  3OMU A;  4XC0 A;  2BZ5 A;  2HG5 C;  1BHB A;  2WLK A;  1GM8 A;  3ZRX A;  4FJC C;  3GIF A;  3HZ1 A;  2IWU A;  2YI0 A;  3U2K A;  1WPX A;  3ZXQ A;  1HWY A;  1VQL V;  1YSC A;  3WHA A;  2YE4 A;  4GX5 A;  1JQ0 A;  1Y66 A;  2R9R B;  4EFT A;  1J95 A;  4JAU A;  4P9O A;  1CP9 A;  1Z59 A;  1K5S A;  1UY9 A;  1KD1 W;  4MP2 A;  2YEV B;  3IFX A;  2W0F C;  1Z5B A;  3K99 A;  1K4C C;  5H6R A;  1BMF G;  2Q8F A;  2BU5 A;  4KSH A;  1COW G;  3JD2 A;  4H7Q A;  1QYE A;  5M4N A;  2YE9 A;  3C0E A;  4JF3 A;  4P30 A;  2HFE C;  1AJN A;  3OMN B;  3WG7 C;  1NBM G;  1YI2 V;  2BTZ A;  3JCZ A;  3K04 A;  1YHQ V;  1FFT B;  3CRL A;  1YT1 A;  1V54 C;  1NHH A;  1UYK A;  3AG1 C;  2X6B A;  2XAS A;  5LBQ A;  3QO8 A;  2WI6 A;  4F4L A;  4CE2 A;  3OW6 A;  1AI5 A;  5B1B C;  3OAA G;  3D3I A;  1VQ9 V;  5C93 A;  3STZ C;  2QEX V;  4I9W A;  1S3J A;  4XIP A;  3OR7 C;  1NR1 A;  2WI1 A;  1DF4 A;  2WLI A;  2F43 G;  1P4R A;  2YEA A;  4L90 A;  1OCC B;  2YEJ A;  3EKO A;  3ZMT A;  3SYA A;  1SRY A;  2XOK G;  3O6O A;  2QE7 G;  1M57 C;  3CXC U;  5LGT A;  3EHG A;  2Y48 A;  3Q5L A;  2BOC C;  1K9M W;  1THZ A;  2Q68 A;  3ZXO A;  1B3Q A;  3VHA A;  3ASO B;  4MVR A;  3A0Z A;  1YT0 A;  3R92 A;  5M4E A;  4ZKI A;  3G6E V;  2YSU B;  1NH2 B;  2BU6 A;  1F23 A;  3W7S A;  4LP8 A;  4G27 B;  2FTK A;  1VQK V;  4XIQ A;  3ZCC A;  5GW7 A;  3E2E A;  3TTZ A;  2XHX A;  4CWS A;  4JYC A;  2XX2 A;  4JPR A;  4XD8 A;  1UY7 A;  3LNM B;  2XAB A;  1UJW B;  4WFH A;  2BYI A;  4CWQ A;  1R6K A;  4ASG A;  3EFF K;  1UYL A;  1W0K G;  4X8A A;  4LWG A;  1GM9 A;  4YKY A;  1FXK A;  3CCL V;  2HG1 A;  1GKX A;  3CCE V;  1ZXM A;  1FXH A;  3IED A;  5J6A A;  2O1W A;  3AG2 C;  1Q7Y W;  3A0Y A;  4ZVI A;  4GX1 A;  3MHS C;  1M9N A;  2XDK A;  3LNU A;  2WEP A;  1AMW A;  4YKX A;  4PDV A;  1L1F A;  5CBH A;  1EBO A;  2YE7 A;  5HFM A;  4HZ5 A;  4MS2 A;  1TID A;  1ZW9 A;  3A0X A;  3K60 A;  1NHJ A;  1MAB G;  1I5D A;  4PDR A;  1YIJ V;  2DYR C;  2HKO A;  4QPJ A;  4CWN A;  4JGS A;  4H37 A;  3TET A;  3KE6 A;  5L3F A;  4MW8 A;  3W7T A;  5EC1 C;  2EIL B;  3K0G A;  1H7S A;  4HXW A;  1K34 A;  4LWH A;  5B1N A;  4ASU G;  3HEK A;  1ZXN A;  2EIN B;  3ZMU A;  3JD3 A;  5KA6 A;  3C11 A;  3E8B A;  4BW5 A;  2K1E A;  3A0T A;  3BMY A;  2Q8H A;  4WFA V;  1XL6 A;  4CBC A;  3MD0 A;  5CTX A;  3ZRW B;  2JIZ G;  4H81 A;  2DQ3 A;  3ML0 A;  4P7A A;  4EGI A;  3HYZ A;  2ZXW B;  4TT3 G;  4DUH A;  2IWS A;  4MVZ A;  3ABK C;  5B3S B;  1VQP V;  4WFG A;  3ZJZ A;  4L87 A;  3OEE G;  1UYM A;  3D36 A;  2V1D A;  1YC4 A;  3EHJ A;  2XAH A;  2WER A;  3VOU A;  1MG1 A;  3F7V C;  3CCS V;  3CCQ V;  4LBE C;  5EC2 C;  3ZM7 A;  1S72 V;  4CWO A;  1YJW V;  1VQ7 V;  1I59 A;  2XAF A;  2H55 A;  1US7 A;  4J9Z B;  1TUE B;  3KG2 A;  4XKA A;  4HZ3 A;  3RLQ A;  3UM7 A;  1OCR B;  1OZ0 A;  1K73 W;  3TZ4 A;  3ZKB A;  2YI7 A;  2EIK C;  4PDL A;  2YEV A;  2JJ1 G;  3O2F A;  1QR9 A;  2HLD G;  2BU7 A;  5D7D A;  3TK1 A;  1Q82 W;  1V55 C;  1FXV A;  2EIJ C;  5FND A;  4AS9 A;  4BIZ A;  4N23 A;  4FCP A;  3K79 A;  4UV9 A;  2WPD G;  2R9I A;  2A9H A;  2XX5 A;  2EIL C;  2CG9 A;  2YEG A;  4KFM A;  3W7U A;  1H38 A;  3TZ2 A;  4J9Y B;  2EIN C;  3EHH A;  4MVM A;  4LC1 A;  3CC7 V;  5FNF A;  3SPJ A;  1NHI A;  3E35 A;  4FPP A;  4LPB A;  4R7C A;  2OCC B;  2YEI A;  2CCU A;  3FKS G;  5L3J A;  2ZR2 A;  4L93 A;  1KKD A;  3K08 A;  1VQM V;  4EGH A;  2OTJ V;  3RKZ A;  4OXS A;  2A0L A;  3QNE A;  2XJX A;  3TCU A;  5DN6 G;  3CCV V;  4N21 A;  4AWP A;  2XND G;  3K98 A;  1K3E A;  2ZDX A;  4KP4 A;  4CE3 A;  2EZO A;  1M56 C;  1EI1 A;  2ZR3 A;  2GSM B;  1PNK A;  3JD1 A;  2QA4 V;  4TWK A;  4Q20 A;  2YGF A;  3RBZ A;  3T1K A;  1B62 A;  3G4S V;  3FB7 C;  2WEQ A;  1VQN V;  5D7R A;  5IYD O;  3ZRV A;  4R50 A;  5IN9 A;  1K33 A;  1YTF B;  4L8Z A;  1GTO A;  3CMA V;  2YE6 A;  3SPH A;  3ETG A;  5B1A C;  1FXK C;  1S14 A;  2Q6A A;  1YER A;  1K4D C;  4X9L A;  3X2Q B;  5M4K A;  1KZN A;  2HR3 A;  3ASN C;  3M99 B;  1KEC A;  2EJR A;  2QF6 A;  4GT1 A;  5H6Q A;  3GIE A;  5M4M A;  3LPS A;  1UYI A;  2YKI A;  4KUM A;  1B63 A;  1KP2 A;  2PI4 A;  2DYS C;  5F3K A;  4X88 A;  4PA9 A;  4L94 A;  3CCR V;  4NH8 A;  2X6C A;  3SPI A;  1OCZ B;  3P30 A;  2EIM C;  1PD3 A;  4URL A;  2HJF C;  1R3K C;  5D7C A;  3RLR A;  3T2S A;  2WLL A;  5L3B A;  1QBZ A;  4GQT A;  2XDS A;  3K03 A;  1ROP A;  1I5A A;  3PJS K;  4K4O A;  2YE5 A;  2YK2 A;  2H94 A;  3TUH A;  4UV8 A;  4QJF B;  2P90 A;  3VAD A;  4WFB V;  3NMQ A;  1QY8 A;  2Q2E B;  4TSF G;  3K9A A;  3OMI B;  1BHA A;  4BQG A;  1M1K W;  5IYC O;  2ESA A;  3TZ0 A;  4XTJ A;  2X0L A;  4MVQ A;  5CPH A;  1YJN V;  1F51 A;  2DWE C;  2YKE A;  3E8H A;  2HVJ C;  1GK9 A;  3VBB A;  1OCO B;  3E89 A;  2AKP A;  4XDL A;  3T0H A;  3B24 A;  2YKJ A;  1L0O A;  4HXZ A;  2EBO A;  4YKW A;  2ZDI A;  1YJ9 V;  3SJQ C;  4XDK A;  4MPE A;  1EZJ A;  3GIG B;  3ZMV A;  1NH2 D;  1F4N A;  4BAY A;  2K5B A;  4DZY A;  5BOD A;  4YXW G;  3AG4 B;  4R6Z A;  1S16 A;  3ZRW A;  2WLN A;  2BT0 A;  4H85 A;  2GHY A;  4R8C A;  3FB6 C;  1Q81 W;  3BEH A;  3QO7 A;  2Z3Y A;  4JTA B;  1UYC A;  1E1Q G;  3PEH A;  2UXN A;  3T0Z A;  3CME V;  4R3A A;  4E01 A;  4E2L A;  1H8H G;  1S77 D;  2DW4 A;  1UYE A;  4U7O A;  1U0Z A;  4E02 A;  2JEU A;  1NKD A;  4O0B A;  3A0R A;  1TC0 A;  2ZQM A;  4HYP A;  3H4L A;  1G4Y B;  3OR6 C;  4MW3 A;  1EFR G;  5EBL C;  3ABM B;  4MP7 A;  1S0V A;  1DTO A;  1I58 A;  1K8A W;  4LCU C;  4BXI A;  2M7W A;  2JDI G;  3A0W A;  3EKR A;  2BU8 A;  2YE3 A;  4H33 A;  3JZ3 A;  2KB1 A;  1ZWH A;  1AM1 A;  3EHB B;  4MT8 A;  4WF9 V;  2BSM A;  4HYM A;  3RLP A;  4EGK A;  2W6J G;  4MSW C;  1UYF A;  3LDD A;  2DWD C;  5FNC A;  2WSS G;  4MPC A;  3T4Z A;  4Z1M G;  4MBC A;  4RO2 A;  4YKR A;  2WLL B;  1ARO P;  1RM1 B;  3QTF A;  3OPD A;  1JVM A;  5KA5 A;  2JK5 C;  1QZR A;  3HB3 B;  3B26 A;  1M90 W;  4PEL A;  4V26 A;  2YJW A;  2VCI A;  2EXL A;  3U67 A;  4HY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...