4FMTA

Crystal structure of a chpt protein (cc_3470) from caulobacter crescentus cb15 at 2.30 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
209
Chain Sequence
DVQGPDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChpT protein
publication title Branched signal wiring of an essential bacterial cell-cycle phosphotransfer protein.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 71
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fmtA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fmtA02
5FNDA 4BQJA 4L91A 3O2FA 4CWPA 4HXZA 3OPDA 3C0EA 4XITA 4HYPA 4JASA 3ZRWA 4MPNA 1YC4A 3CRLA 2WI4A 3WHAA 3ZRXA 4ZVIA 5C93A 3TTZA 4DZYA 3K97A 2YI0A 4LWGA 2YEJA 5GGZA 1QYEA 2WEPA 2FYPA 2JKIA 3B25A 4FCQA 2YGEA 5IN9A 1UYDA 4XE2A 4XIQA 2WWWA 5M4KA 4WUCA 3A0WA 1ZXNA 1YESA 1UYKA 3RKZA 3BM9A 2FWZA 2HKJA 5J71A 2IOPA 4QPJA 4YKXA 4MB9A 3R92A 3VHDA 4AS9A 3FV5A 2YKEA 4JAVA 4GEEA 1QZRA 2YKBA 2QG0A 4UROA 5M4NA 4YKYA 1ID0A 4L90A 1S16A 2QFOA 4XKKA 2E0AA 4HZ5A 2YE9A 3P32A 1JM6A 4AWPA 1TILA 3OWBA 3PEHA 4V26A 5B1NA 1YS3A 4HYMA 4H7QA 5F5RA 4GGLA 1ZXMA 1B63A 4LWFA 2XHRA 4XCLA 4X9LA 2IORA 3TK1A 4PRXA 3G7BA 5FNCA 4L94A 3EHJA 4P8OA 4DUHA 4PU9A 1US7A 1UYLA 2BU2A 4KSHA 3B24A 5CPHA 1AH6A 2JJCA 3Q5KA 5M4HA 5FWKA 4ASGA 2CCSA 4I5SA 1UY8A 4YKWA 3TZ5A 4HZ0A 1Z5AA 2QM7A 5BODA 3U67A 1TC6A 3U2DA 4XTJA 4CWNA 4XIPA 5D7DA 4MP7A 2YE3A 3TZ2A 3T10A 5CF0A 2O1UA 4EGHA 2LFRA 1NHHA 2XDUA 1UY9A 1BXDA 2YGAA 2XABA 2XDSA 3A0XA 3ZXQA 2VCJA 3K98A 1I58A 3MNRP 2BU6A 3EHGA 1S14A 4R1FA 3R4OA 1UYFA 2H8MA 3GIFA 2UWDA 1Y4UA 3QDDA 4EEHA 4ZKIA 3HZ5A 4ASBA 2YI6A 1U2OA 4MP2A 2Q8GA 5M4PA 1YERA 1UYGA 4GT1A 3EKOA 2BZ5A 4URNA 4CWFA 2WI2A 3FT8A 3NXSA 4ASFA 2YKIA 4L8ZA 4BIUA 4BAEA 2IOQA 2C2AA 4GFNA 2AKPA 3CWVA 4CWTA 4R3AA 1AH8A 4BIZA 1KIJA 4LWIA 1TBWA 3TZ0A 1OSFA 3R4PA 3ZRWB 2K5BA 3K60A 4YKRA 4XIRA 2GFDA 2YKCA 3SL2A 4U7NA 3OW6A 4U7OA 2BU7A 2WI5A 3QTFA 2P67A 4CWSA 1YSZA 4CE1A 4FCPA 4KFGA 4EGKA 2WI1A 2XDKA 4EFUA 4HY6A 1I5BA 4MTXA 3MD0A 1H7UA 1I59A 5CTWA 4EFTA 3ZXOA 3G7EA 3C11A 3Q5JA 3T1KA 1ZWHA 3B28A 4O0BA 1THNA 2XX4A 3R4NA 2ZDYA 2YEGA 4O09A 4FPPA 3O0IA 3NMQA 4ASAA 1BYQA 5IDJA 4O05A 3IEDA 4I3HA 5CTXA 2XJJA 5D7RA 2BYHA 2WI6A 2FXSA 4H85A 1YT1A 3VHCA 2ESAA 3ZM7A 5CTUA 4HY1A 3H80A 4YKZA 4E01A 3CRKA 4YKTA 4EM7A 4JAUA 3A0YA 3DGEA 4B7PA 2O1WA 1GKXA 2YI5A 5CTYA 3CGZA 3EKRA 5B1OA 1AMWA 3BMYA 2WI7A 2YECA 2PNRA 1MU5A 2YE4A 3GIEA 4GQTA 4URLA 2WERA 4Q20A 3R4MA 4WUBA 1UY7A 2FTKA 2HCHA 4EMVA 3ZKDA 5D6QA 3K99A 2BU8A 3A0TA 3D0BA 2BTZA 2YI7A 1UYIA 4FCRA 2IWSA 2QG2A 1YC3A 5M4MA 5J6AA 3GIGA 4W7TA 4KP4A 2BYIA 4MPEA 2YE2A 4BXIA 1YSRA 1U0ZA 3T2SA 4NH7A 2CCUA 4CE2A 4PL9A 4GCZA 2XD6A 4U93A 2Q8IA 3EHFA 2YJWA 3A0ZA 1TIDA 5BOCA 3GIGB 1TH8A 2XDXA 1A4HA 1YC1A 1IXMA 3HHUA 2VW5A 2IWUA 1UYMA 3O6OA 1I5CA 1TC0A 2YEFA 4B6CA 1GJVA 4K4OA 1Z5BA 2VWCA 4CE3A 4XC0A 5M4EA 2YE7A 3D36A 2YE8A 2YEBA 1ZW9A 1I5AA 4MBCA 3U2KA 2HG1A 2ZDXA 2XK2A 3H4LA 4AWOA 2YKJA 3T0HA 2XHXA 1B3QA 2GQPA 2BU5A 1I5DA 3HYZA 2IWXA 3WQ9A 3ZCCA 4L93A 3HYYA 4YKQA 3PEJA 3RLPA 2YE5A 2XDLA 3HEKA 2QM8A 4LP0A 3LPSA 1KZNA 1UYHA 3G75A 3ZRVA 1BGQA 3INWA 4HXWA 2YEHA 4MOTA 2CH4A 2YE6A 3JZ3A 1UYEA 2XCMA 4MPCA 4V25A 2YEDA 1L0OA 4O07A 5IDMA 3R91A 3LNUA 4URMA 4XKOA 3TZ4A 4R3MA 4PRVA 4JYBA 1Z59A 5L3JA 2QF6A 2BSMA 2XJXA 1B62A 4MT8A 1Z5CA 1AM1A 4BQGA 1YT0A 2YEEA 4O04A 3T0ZA 4LC1A 5F3KA 3A0RA 2ZBKB 1F51A 1JOYA 2XHTA 1EI1A 4XDMA 3RLQA 5D7CA 4KTNA 2LFSA 4JYCA 4EGIA 2YJXA 3OWDA 1YT2A 3Q5LA 2FWYA 4AWQA 1UYCA 2BT0A 4QPKA 4H81A 1YETA 2BREA 4GT8A 4E00A 4JQLA 2WI3A 2YEAA 2H55A 4LWEA 4KSGA 2YK9A 5FNFA 4NH8A 3ZKBA 2XX2A 3RLRA 2Q8HA 4CWRA 2VCIA 4CWQA 1NHJA 3CGYA 4LWHA 1PVGA 2WEQA 1Y4SA 1H7SA 1Y8PA 1GKZA 2YGFA 2Q2EB 2YEIA 3KE6A 1Y8OA 1MX0A 3B26A 3D2RA 4KQVA 2Q8FA 5D6PA 4YKUA 4CWOA 2XJGA 4XD8A 4XKAA 4XCJA 2O1VA 1QY8A 2BRCA 4FMTA 2CG9A 3B27A 3TUHA 1UY6A 3VHAA 3OMUA 4NH9A 4P7AA 2CCTA 2CGFA 1R62A 3VADA 4LPBA 2XX5A 1EA6A 3FT5A 3HZ1A 3EHHA 1AJ6A 1Y8NA 2YK2A 3INXA 4E02A 2ZKJA 1BKNA 4WUDA 2EXLA 1NHIA
chains in the Genus database with same CATH superfamily
3SPHA 3LSUA 5KA5A 1QLEB 1S72V 1QLNA 3N2KB 1H2NA 1VF6C 1AR4A 4JASA 4ZI7A 4MPNA 3RBZA 3WB2A 4BW5A 3CEIA 1SETA 3GVMA 3OEEG 3K97A 4LWGA 1H8EG 1FKAO 1JPXA 3RVZA 2LW7A 1HNZO 1DTOA 1R3LC 1SQXH 2FL4A 2X6BA 3OAAG 4WUCA 5LGNA 1ZXNA 3L71H 2XOKG 2QKSA 3CD6V 1UYKA 3A0BZ 2H94A 2FWZA 1AI5A 1N0JA 3T4ZA 5JVDB 1YTFD 3FB6C 5LP6B 2P4KA 1NH2B 4NXMB 2WLIB 4GEEA 4E72A 2QEXV 3ETDA 3S3XA 4I50A 1YHQV 1OCOB 1FPOA 2XTAA 3E83A 4NTYA 1S16A 4I7ZB 2QFOA 1ZL8B 4XKKA 4HZ5A 4I0XB 1Q6HA 1TILA 2BSKB 1M4UA 2H3OA 3FX7A 1H8HG 2RDCA 1B63A 2UU9O 4LWFA 4X9LA 4LFAO 1LUWA 4DUHA 1K33A 1UYLA 2DOSA 4H37A 1CXZB 4UCOA 3OR6C 3ZJZA 2OTLV 2PYLA 1OCRB 5FWKA 2CCSA 2HG5C 1HNWB 3SJAC 2ADQB 1VQLV 1VQ9V 4K0KB 2CK3G 4LFCB 2QM7A 4F4LA 3U2DA 4XTJA 4CWNA 4YJ3B 4NR1A 3TZ2A 1FJGO 2O1UA 3FD9A 4EGHA 4LH7A 1UY9A 1F4NA 2DQ0A 1VQ5V 3ZXQA 2VCJA 3M99B 3JASB 1JVMA 4P9OA 3ZMVA 2F4VO 3CYGA 3ZN0A 1S14A 4JI8O 1WP7A 2W6JG 3CRCA 4LF4O 5B3SB 1SQFA 1S5LZ 1P84F 1Y4UA 2E76B 2FKXA 4B3TO 2IJKA 1CP9A 2Q8GA 4YHHB 3BAAA 4GT1A 1FYJA 2OCCB 2Y69C 4NXNB 3NXSA 3D8CA 4FLYA 1H2KA 4CH5A 2ZCEA 3JAWB 4EB6B 3F5WC 3OMAB 4J80A 2AKPA 2YSUB 3CWVA 4Q6GA 1SA0A 4CWTA 1AB3A 3ZMZA 4KFMA 3E86A 1TBWA 2FB5A 2A9HA 3EHBB 4PHZA 2ZE6A 2EIKB 2D2CB 5LHIA 3FFQA 4XIRA 2GFDA 2W6IG 1Q5OA 2QWPB 1P7BA 1WA8A 3SGIA 3OW6A 4U7OA 5IWAO 2A3QA 4KUMA 2A0LA 4CE1A 1Z5VA 3VQXA 2WI1A 2XDKA 4EFUA 3N27A 3JD4A 4E4EA 3B40A 2O57A 1I59A 1I5XA 4GKKO 2PI5A 2JGUA 1O9HA 5GW7A 1Q86W 3APQA 2DN9A 3IC7A 3OW2U 5CA1A 1LNQA 3T1YB 4AILC 1X4TA 3CX5F 5C8YA 1DF4A 2YEGA 3NMQA 2XUMA 4ASAA 2BTOA 1HDJA 1BYQA 2DYRB 3LNMB 4O05A 2ZDIC 3ABMC 5CTXA 2BYHA 1FS0G 4I50B 2BOBC 2EZPA 1YT1A 2UXCO 4AHCA 2ESAA 3ZM7A 1FXKA 5CTUA 3H80A 2PI4A 1YF2A 3U0ZA 2QE7G 4DV4B 4LF8O 4B7PA 3ABTA 4G28B 3RVYA 1GKXA 3CGZA 5B1OA 4X66O 2WI7A 3EFFK 4H0LB 2CDYA 2OIEA 4Q20A 4X62O 5B66Z 4MTOA 2FTKA 2HCHA 2D3OW 4EMVA 4DV5B 5IYCO 3OFNG 1KP2A 2BU8A 1NR1A 3D0BA 2EJ7A 3OGCC 2IWSA 2ZT9B 3KCYA 4MVRA 5M4MA 3JARA 4JGSA 4PELA 2KB1A 2ZM6O 3E8HA 1XOUA 4DR7B 2PUSA 2CTRA 1TUBA 1U0ZA 5BZBA 3T2SA 4NH7A 4DR3B 4CE2A 4LP8A 1IBLB 2XD6A 3LSSA 3EHFA 5ITZA 3OR7C 1W0JG 3B4SA 1QNMA 3AG4C 5LA6A 4DV2B 3ETGA 3VOUA 4NTXA 3K3WA 3CCMV 5KHJA 1I94B 1AJNA 1YC1A 1IXMA 1NS1A 3D3QA 2VW5A 2P5OA 5JJEB 3BY6A 1I5CA 4MS2A 3B8NA 4XBFA 2YEFA 2KKWA 2RQ6A 3G6BA 2G38A 4TSFG 4J11A 3B8MA 2E5LB 3A2FA 2YEBA 1ZW9A 4LFBO 2AGAA 1H2SB 3Q4HB 1TAEA 1PD3A 5LHHA 2JJ2G 3U2KA 2JK5C 2HG1A 2ZDXA 2A79B 1NH2D 4DR1O 2HP8A 3ICXA 4C7UA 5IYZA 1YZBA 4AWOA 1SA0B 2IWXA 1BS3A 2JVDA 1IXBA 2Q5ZA 4NYKA 4DR5O 3HYYA 5IYBO 4DK0A 3CCEV 4YKQA 3H1JH 2YE5A 4P2ZA 4LP0A 3BABA 2UUAO 1NVPB 3CB2A 1KZNA 4RUFA 2YC0A 1TVKA 1BGQA 2OWOA 4FM0A 4FFKA 2UXBO 3JD0A 3SYAA 5IY5C 5IJ9A 2OT5A 2WSSG 3H9VA 1MNGA 2XCMA 1R6NA 3ASOB 2K9PA 1NKDA 1SC5B 3K9SA 1G6UA 5DN6G 5IDMA 1WPXA 3JATA 2WAMA 1N36B 3H1LH 3SPIA 5CA1B 1HWYA 4JYBA 5L3JA 2PTMA 1V54C 2GDSA 2BSMA 4E2LA 1JJ2U 3FYEB 4DW1A 3SR2C 4CH4A 3TGUH 4L87A 1HNXO 2EIJC 4BQGA 4F6RA 1U97A 2X6CA 4IL6Z 5F3KA 1XQ8A 2DJVA 1K8AW 1F51A 1IBMO 4H33A 1MABG 1FXKB 2LFSA 1Y76A 4JYAB 3ZIAG 1PP9H 5JJNB 5FNVB 2GSMB 2R72A 2DE0X 1JFFA 4OPHA 3CRRA 4YY3B 1YETA 2BREA 4X20B 1PKXA 3GWKC 3LNNA 1H2GA 1MOFA 4GUNA 4J10A 2YK9A 2OYQA 3ZKBA 3RLRA 2Y4TA 2NR5A 2HKOA 1K7DA 4DV6B 1NHJA 4X9QA 2WEQA 2Q68A 3CCJV 4DV7O 1GKZA 3H1IH 1NTMH 4PDLA 4W4KA 4XDKA 4PDVA 4JI1B 1WPBA 1ZTEA 3OTOB 2DWDC 3FB7C 3OEHG 5KX5B 2RNBA 1BQZA 2WLHA 4XCJA 5L3EA 2O1VA 3JARB 4NXMO 4A5UB 2BRCA 1KYOF 2CG9A 3TUHA 1Y6XA 4J41A 4H13B 4YJ2B 3BA8A 4LF6B 2Q73A 4DV3B 2CGFA 2CTWA 2VRZA 2F1MA 4UVAA 3CYOA 1TGOA 3FT5A 1NI8A 5LA6B 3INXA 1BKNA 2VQEO 5LHGA 4X1YB 2EXLA 5CTYA 1YJ9V 4CWPA 3O2FA 1Y74B 3OPDA 2WLNA 2XAGA 3S5TA 2HHHB 5EBMC 3IGAC 4JI3B 4GX5A 1VQNV 4OGQB 2KQXA 3WHAA 5EZYB 5B5EZ 1HNWO 3E2EA 3TTZA 5IYZB 2AXTZ 4J9ZB 1Y4MA 5GGZA 3CRQA 4G27B 3KG2A 3STLC 2ILMA 3F7VC 5A2QN 3VBBA 2R9AA 4JZ2A 4XE2A 2WLIA 4KHPB 2WWWA 1R6KA 2EIMC 1G1XB 3AG1C 1YESA 3RKZA 3BA9A 5AG2A 1TVKB 2IOPA 2VWKA 3CMAV 4MB9A 3ZHUA 1XNQB 1NR7A 4AS9A 4I0XA 3QO5A 4JAVA 2N04A 3RYHB 5IJ9B 3JALA 3TCUA 3L74H 2KG7A 4MVQA 4YHHO 4L90A 3TXQA 2QWOB 3JATB 2CTPA 4NXNO 2LGWA 5CA3A 4AWPA 3CS5A 4B7KA 4JI7B 5B1NA 4H7QA 4GGLA 3CSXA 4U3FH 2XHRA 1I5YA 3ASNC 1R3IC 3TK1A 2IORA 3SJCC 3G7BA 2XASA 4PRXA 1KU9A 5FNCA 4L94A 5FPRA 5FL7G 4LR3A 4O2AB 5BR8O 4LF5O 4DRXA 2BU2A 3KKYA 1M90W 2NN4A 3UKMA 3L9DA 1Y76B 1AH6A 4I5SA 4YKWA 3RYIA 1I0HA 3CJHB 1VQ7V 4HZ0A 3K79A 3JASA 3U67A 2Y0PA 2ZXWC 2B1GA 5D7DA 1R3KC 2EZOA 2YGAA 5GTIZ 5JCOA 1BGYH 1BZKA 3A0XA 1QBZA 1I58A 1N33B 3AG3C 1JA8A 2B9ZA 1US6A 1WB7A 4R1FA 3T1YO 1S5JA 3K08A 2UWDA 4UB8Z 3X2QC 1EN6A 3HZ5A 4J7JA 3U10A 4ASBA 2MW2B 2YI6A 1T5EA 1NTKH 2R9RB 1UYGA 4CWFA 1NVPD 1GM8A 5GONA 5TISZ 3FT8A 3VQVA 4ASFA 1DGSA 1Y67A 2EINB 2P90A 4BIUA 2WA4A 2IOQA 5E79Z 3OUFA 2LQTA 4DV4O 1WJZA 3BFRA 4X1KA 1YJWV 1KIJA 3HR0A 3LDEA 3WG7B 2C1GA 1S77D 1IVSA 4IHJB 1SQQH 2K5BA 2YEVA 1GO3F 4WFHA 3SL2A 1VQ8V 2DW4A 3FYIB 4DV5O 4TQDA 4KL1A 4JI6B 4FCPA 5KMGA 4PA9A 2YS8A 5KHGA 4B08A 2VQFB 1WB8A 1I08A 1IBKO 1N32B 3UT5A 1AP6A 3ZXOA 5EYPA 3C11A 1VF7A 3CC2V 4B7EA 4DR7O 1XHZA 1PM9A 1ZWHA 4O0BA 1Q81W 3OMIB 1DLBA 1M5IA 4DR3O 4JI2B 1THNA 2YXHA 1IBLO 4JTDB 1K9MW 3R4NA 2ZDYA 4PV1B 3CHXA 3O0IA 1YVWA 4DV2O 5KHHA 1I94O 4I9QA 2DMXA 3QG5A 3TETA 1Z2GA 3JALB 4TT3G 4H85A 1RM1C 2KG7B 3VHCA 1VQ6V 2ZQMA 4O4JA 1M57B 3T2MA 2E5LO 1NBMG 3CRKA 2EX3A 1N4CA 3ABLB 4EM7A 4UVCA 1GH6A 1YXBA 3DGEA 4RQEA 3DTUB 2JEXA 4BIOA 5L3BA 3D3IA 1X59A 1JCHA 4MVUA 2PF4E 1L0LH 1E1RG 1EZJA 4FZ1A 1NT2B 2RJZA 4DRXB 2YE4A 4URLA 2PY5A 1MSWD 4MTGA 5EBLC 2C1IA 2Y48A 3KCXA 2NLJC 3RYIB 3E8BA 4O4IA 5JH7A 2R9IA 3L75H 1KC8W 1HR0B 5JQGA 1W59A 2BTZA 2YI7A 1UYIA 1YC3A 2CUGA 1Q43A 1V55B 2E75B 3ZEDA 3CXHF 2BYIA 1RSOA 1RPRA 1M56B 4MPEA 1YSRA 5KAFZ 4X65B 2EILC 4PL9A 3QO8A 1N36O 3W7TA 4RUEA 3JD1A 2Q8IA 4LF9O 2YJWA 1TIDA 5BOCA 4TV9A 2DYSB 3ABUA 1UPGA 4H44B 1VQPV 1TH8A 1Y66A 2QJ1A 1A4HA 4KXRA 4WCEV 4O4LA 3Q4HA 2IWUA 3JD3A 2WLKA 4X88A 1UYMA 1TC0A 4ZIBA 1NU1H 3SJQC 3HPLC 3ZHQA 4CE3A 4XC0A 5M4EA 2JJ1G 5GONB 2YE7A 3D36A 3SDLA 4HNAA 4JYAO 1OCCC 1B04A 2XK2A 2YI8A 3K04A 2B5UA 3ZN1A 1B3QA 4X1KB 2GQPA 2ZE7A 1I5DA 3ETEA 3EVKA 2OIGA 4WFGA 5H5NA 1L1FA 1OCZB 4DV6O 2XAHA 2GBOA 2XDLA 2YEVB 3HEKA 2QM8A 4FFBA 1ROPA 4OX9B 2K1EA 2EBOA 3G4SV 4AQYB 4JI1O 1XMQB 1GM7A 4HXWA 3OTOO 2YEHA 3GB7C 4DYLA 2DWEC 5K1XA 5KMGB 4MOTA 2YE6A 4JI5B 2IJIA 5KA6A 1K5QA 4R8CA 4BR6A 3UT5B 2YEDA 5EYPB 1D5AA 1YEWA 4O07A 2F43G 4O2BB 3ABKC 2HLDG 3K5LA 5KHKA 4URMA 4LF6O 5B1BC 4JTCB 1R73A 4R3MA 1S76D 1Z59A 1JR9A 1FAFA 2YUAA 2QF6A 1Q90D 1HP8A 5FNVA 1B62A 4MT8A 5H2FZ 1Z5CA 3F5TA 3S3WA 1UFIA 4X20A 2JRIA 2YEEA 2ETNA 2YICA 3RYCA 1N0NA 4XDMA 3DSQA 4GX1A 5D7CA 4KTNA 4JYCA 4O4JB 3CRAA 3E8GA 4JI3O 4FLZA 5JENA 1ZLZA 1UYCA 4HAMA 5L3GA 4H81A 2IBZH 2UXDB 1KUQA 4JQLA 1YCIA 2JGDB 2JS5A 3APOA 1Z5WA 2H55A 2QR4A 4K35A 3H01A 5FNFA 3CMEV 1K97A 4X8AA 5KX5A 3P3PA 3AG2B 1H7SA 1Y8PA 1K5SA 4BW9A 2YGFA 1MSDA 4DUZO 1BCCH 5CBHA 3I56V 3B26A 4O4IB 5JH7B 3GWOA 4KQVA 3CC7V 4CWOA 5JQGB 4YJ2A 1H2LA 5LMUB 2A06H 1VARA 2BE3A 1H38A 4PDRA 1NJIW 2P6JA 1XL4A 3J80N 3MAQA 1RSOB 4FMTA 3B27A 1ZWIC 4PD4F 5LOVA 4X1YA 2YI9A 1WNSA 4P7AA 1S3JA 1Y74A 1BE3H 4DUYO 2HFEC 3PJSK 2UUBB 1EA6A 4TV9B 3HZ1A 3EHHA 2YK2A 4E02A 2ZKJA 4JI7O 1FD9A 5EZYA 4O4LB 3JAMN 4WUDA 2AW9A 4ZOLB 5FNDA 4BQJA 4L91A 2OCHA 2QSAA 1EN4A 4WF9V 1XEQA 4DR4B 4B3MB 3C0EA 1JQ0A 4HYPA 1SQBH 4GKJO 5LBQA 5CBGA 2YIDA 4X64B 2ZDIA 5A9GA 1YC4A 5EIBD 2WI4A 4HNAB 2WLLB 2M6YA 2HJFC 3QO7A 5D5PA 2UU9B 1XNRB 3ZRXA 1LUVA 4LFAB 3CCRV 1BQ0A 1PPJH 3A8TA 1OZ0A 3HKBA 4J42A 2YI0A 3AK1A 3BVOA 4WFBV 1XMOB 1OHHG 2WEPA 5L3FA 2FYPA 5B1AC 4FM2A 1TA8A 5IN9A 4CC5A 4XIQA 4K8ZA 2Q7GA 3THOA 5M4KA 4FFBB 3RYHA 3A0WA 1N33O 3OM3B 2GUZA 4FLVA 3BM9A 1RP3B 2W0XA 1QLEC 1FJGB 2HKJA 4MSWC 1AILA 5J71A 3CCUV 4LH6A 3K58A 2Q0AA 2CTQA 4OXSA 5EBWC 2QG0A 4UROA 2XNDG 5M4NA 4JI8B 1ID0A 4YKYA 4LWSA 4LCUC 3UO2A 1UJWB 1M93A 2ZE8A 3T4DA 1OV9A 3U11A 2IU0A 2YE9A 3P32A 2N74A 4B3TB 4O2AA 2LP7A 2Q7EA 3OWBA 1KB9F 3PEHA 4HYMA 1TUEB 1ZXMA 3BCCH 3SYCA 3CJHA 2Z0AA 2Q8VA 3G80A 3W7WA 3EHJA 1WAZA 3RYCB 1PV0A 3LDDA 1QHTA 3ETQA 4JYYA 5LP6C 2JJCA 5M4HA 4ASGA 3UM7A 1OCOC 3SYQA 3JSLA 1DK1A 4JI6O 2Y69B 4FM1A 2VQFO 2QM4A 2ITDC 2LW1A 5CF0A 1N32O 5IWAB 2LFRA 1XILA 2XABA 3ML0A 3OTFA 3K98A 4WFEA 3T1HB 5CBFA 2RMKB 4JI2O 1GN4A 1R6TA 5FLXN 2IW5A 2QA4V 4IYIA 1UYFA 2H8MA 3GIFA 4QIWF 4FZ0A 4JV5B 3QDDA 2IM9A 4EEHA 2RCVA 2X6AA 4ICGA 1OCRC 3CCQV 3TXSA 5BMVA 4MP2A 2UXNA 3N2GB 4CZZA 1YERA 2HJDA 2BZ5A 3O65A 5LOVB 4QE9A 2Y0IA 1YI2V 2YKIA 4L8ZA 5J2UA 4BAEA 4IHJA 1W0KG 3IJ4A 5H6RA 1G4YB 1QR8A 1VQMV 2C2AA 4IT5A 1SQPH 1I7FA 4R3AA 4BIZA 4B3SB 3MHSC 4LWIA 4DXWA 1SQVH 5D5QA 3STZC 2E74B 2UUCB 3JCUZ 3AK3A 4K0KO 4UXNA 4LFCO 1OSFA 1S5HC 3AEIA 2VWJA 3R4PA 3K60A 3P30A 4MW3A 4FIPC 5B3SC 1Q82W 3ABMB 3JYCA 5JCOC 5FPOA 3K59A 2BU7A 2HVKC 3RGBA 3FAVA 2VS0A 3C90A 3HKBB 4IIJB 4CWSA 3B09A 5J2TA 1AI7A 1HR0O 4KFGA 4EGKA 2XHBA 5JWPA 1N34B 2OCCC 1I5BA 2P7TC 3MD0A 3CP1A 1RFYA 4ZHQA 4PA3A 1L8DA 5CTWA 5L3DA 4EFTA 3HKDB 4CBCA 3Q5JA 3T1KA 3T1CA 3M7MX 2GUZB 2Q7HA 4CS3A 2XX4A 1J95A 3K9AA 1J5EB 2CGNA 4O09A 4FPPA 3ZHVA 1AJPA 2EIKC 2QDOA 5IDJA 3IEDA 3MHHC 4I3HA 2FMLA 3JSNA 3OE7G 2FXSA 4R6ZA 4NTWA 1VIBA 3ZS8C 4NB5A 3O9OA 4UV8A 4PDMA 4LWSB 2V1DA 4FJCC 4RWUA 4MVMA 1SERA 2Y4UA 4YKZA 4E01A 5CMUA 4JZGA 2Z3YA 3HKEB 1GKFA 2GTSA 2QTSA 4YKTA 4RAIA 2Q4PA 4IYHA 4JAUA 3A0YA 2FYUH 2O1WA 1THZA 2V7QG 1NTZH 3EKRA 2F95B 2LGQA 1VQKV 5CA0B 3BMYA 2YECA 4I9WA 1QQCA 2HEPA 3AG4B 1YDXA 1MU5A 4DK1A 2ZINA 3R4MA 4WUBA 2DYRC 1UY7A 2P06A 3K5NA 3ZBHA 5D6QA 1B6QA 2XAQA 4DR5B 5BY1A 1XMQO 4FCRA 1K4DC 4FK5C 4JI5O 3J81N 5J6AA 2ZNIA 5LGTA 4KP4A 1SQGA 4O4HA 3W7UA 4OPAA 1K3EA 1XL6A 4TOIA 1ORQC 4G2KA 2IJJA 4RQFA 3ZMUA 1EN5A 2L6LA 4FLXA 2QGNA 2GHYA 3OUSA 3GIGB 4UUJC 3JCZA 4JPRA 4MW8A 4TUYA 3HHUA 1JMKC 3O6OA 1HW7A 3FB8C 2EJRA 3OGIB 4FVMA 5BMVB 3SPCA 1GJVA 2MK3A 3G67A 1D5NA 1Z5BA 2VWCA 3HKCA 4WBNB 1AR5A 2YE8A 3JAKA 2IJHA 5IY5B 4FLUA 4N23A 5J2UB 4MBCA 1QU7A 5LYJA 1SKVA 1AJQA 2Q0OC 3ZHRA 1JJOA 3E8FA 1COWG 2UXDO 1GM9A 3H4LA 3DC6A 2YKJA 3T0HA 1IBMB 2ZNJA 4PJ0Z 2BU5A 3VQYA 1KECA 3WQ9A 2IH1C 1V54B 5F2VO 3PEJA 1R1BA 2ATKC 3WU2Z 3RLPA 2EIJB 3LPSA 5CN0A 3FAVB 3G75A 3ZRVA 2XAJA 1BL8A 4B3RB 3INWA 4O2BA 5J2TB 4XDLA 4JI0B 2JDIG 2PGGA 1B06A 5LMNB 4DV7B 2CH4A 4L8JA 5LMUO 1SESA 3J7AU 1EM1A 3BEHA 1O9GA 4ZHQB 3JZ3A 1E1QG 4DV0B 3SYPA 4PA7A 2PZSA 1KKCA 3R66A 3RFRA 1L0OA 1Q6IA 4JI4B 1WP8A 4U3JB 3LNUA 4XKOA 2QWNB 2WPDG 4MVSA 3D36C 4PRVA 2ODMA 2UUBO 4WFAV 5L3CA 2F66C 5H6QA 3K0GA 4WFFA 1GN2A 1AM1A 4DR6B 1PL0A 2JGDA 1WN7A 4RO2A 3A0RA 4GLXA 4EFEA 3IAYA 4B3MO 4DR4O 2ZBKB 2Q9LA 3B2EE 3WFVA 1LR1A 2YJXA 4EGIA 1XDCA 3DC5A 4X64O 1YT2A 3CE2A 2VQEB 4DO2A 4FLTA 3Q5LA 3K5OA 2Q69A 4BAYA 3ASOC 1XNRO 4GT8A 4E00A 3K0DA 2AHZA 2WI3A 4W4LA 3E22A 3VQWA 2YEAA 4QJFB 1AVMA 4NH8A 1XMOO 1PNLA 4LF7B 2XX2A 2Q8HA 1VF6A 4CWRA 5LL6Y 2VCIA 1KQSU 2HVJC 4CWQA 1Y4SA 1GRJA 4PA6A 4CS2A 3K57A 4K8XA 2Q2EB 1KMIZ 2YEIA 3KE6A 1KP3A 2M7WA 1M1KW 1MX0A 2L35A 3RW0A 3ZMSA 2XJGA 4XD8A 4X1IB 1VQOV 5KAIZ 4XKAA 1FFTB 1NZ6A 1FXKC 4D7TA 5J9PC 1QY8A 2ZR2A 5HFLA 4O4HB 1YIJV 3R65A 1UY6A 3IC9A 4CH3A 3K06A 4P9PA 4TV8B 4ZOLA 3G71V 2XT9A 4DV1B 5CB4A 1R62A 4JF3A 2PYJA 1VF5B 2XX5A 1PNMA 4QGPA 2F93B 4R7CA 1XHXA 3E89A 1OJHA 2EIMB 4CH6A 2WLLA 2WLJA 4TUYB 2R70A 3AG1B 5LXTA 4EFBA 2YIBA 4YY3O 4HXZA 2JS3A 3I5DA 4XITA 2Q6AA 2IH3C 3ZRWA 1JX9A 5JJJB 3HKCB 4FLWA 1P7GA 4UCTA 2X0LA 3JAKB 4D7SA 3CRLA 4NKGB 1EFRG 3KZIZ 2Q67A 4ZVIA 1MG1A 5LYJB 5C93A 3K5MA 4TQFA 5BR8B 3QF7A 4LF5B 4DZYA 3L72H 4X89A 3ZHTA 2YEJA 4ZI7B 1QYEA 1SZXA 3LUTB 2JKIA 3B25A 4FCQA 2GV9A 2YGEA 2AZ0A 1UYDA 1K34A 1VEWA 2DQ3A 3T1HO 2UXXA 3ASNB 4N21A 1VQ4V 2BCCH 3EXAA 4DR2B 3OD4A 4QPJA 4YKXA 3R92A 3DXRA 3HB3B 3VHDA 1MZFA 3BPZA 4DV3O 3FV5A 2YKEA 4JV5O 2YXLA 3FB5C 1QZRA 4PA4A 2YKBA 3CWBH 2ZD9A 2V4DA 1F4MA 4I4TA 1ZUQA 4EEQA 1WLEA 2E0AA 2ZXWB 1W2BU 3SPGA 1JM6A 2X7RB 4V26A 2HHHO 1YS3A 5F5RA 4I55A 2ZIOA 3G6EV 3AG3B 4UCUA 4B3SO 2EULA 4XCLA 5H9CA 2UUCO 4P8OA 4PU9A 2Z5UA 1PL4A 1F23A 1US7A 2CGOA 4MTFA 2XAFA 2H8PC 2WLMA 3CXCU 4P30A 4CS4A 1QVGU 4KSHA 3B24A 3X2QB 5CPHA 3Q5KA 5HFMA 2ZKOA 3UCSC 1UY8A 2NNUA 1BT8A 3H1KH 3TZ5A 3RT3C 1URFA 1GN6A 5DEDA 1Z5AA 4J7KA 1YITV 2CH7A 3E22B 4KHPO 1G8MA 1Q3EA 5BODA 1IDSA 1N34O 1TC6A 3CCLV 4XIPA 4MP7A 2YE3A 4K3AA 3T10A 1HNZB 4JAAA 1NHHA 2XDUA 3RWRD 1BXDA 1XNQO 1QCEA 2LO1A 2YIAA 2XDSA 2ITCC 2ADPA 4JTAB 3MNRP 3TJTA 3A0HZ 1BHAA 2BU6A 3EHGA 3N2GA 4AI8A 1KKDA 1DF5A 3L73H 3OT7A 1IBKB 3R4OA 1J5EO 2B1IA 3H1HH 3ZMTA 3ZX6A 3CCVV 4ZKIA 3CPWU 5IYDO 1YSCA 1U2OA 5BXZA 5M4PA 2JIZG 3EKOA 4URNA 4YIPA 3RN4A 1GAXA 2WI2A 4UV9A 4UB6Z 5CB4B 3BHPA 2W0FC 5EC2C 2HR3A 1ZAUA 4YXWG 4GFNA 1GN3A 2YDEA 2BTQA 3QNEA 4HBNA 1AH8A 5LXTB 4XDJA 1IZ3A 4IIJA 1NQTA 3TZ0A 1KBHA 5E1AC 4EKWA 3ZRWB 4YKRA 4CC6A 1QVFU 1AI6A 2CAZC 2YKCA 1M9NA 4U7NA 3HKDA 1ZSPA 2WI5A 4GX0A 3QTFA 2P67A 1RM1B 3UQ8A 1YSZA 5KUMA 4HY6A 1PNKA 4MTXA 1H7UA 2JEUA 1ENVA 1D2DA 2EINC 3K03A 1WA8B 1SS3A 3G7EA 1IX9A 3B28A 2F4VB 1QR9A 3RYFA 4GX2A 3WG7C 4LF4B 4Z1MG 4J9YB 3DXRB 2ZE5A 4Z1VA 1K4CC 4F6EA 4LNUA 3HKEA 5KHIA 2XJJA 5D7RA 4TWKA 5EC1C 3ZRSA 1CEZA 2WI6A 2OTJV 1KD1W 4LF9B 1U96A 4I4TB 4J7ZA 3SPJA 5C8YB 5CA0A 4ZBMA 5KLVH 4HY1A 4HZ3A 4QNHB 3LDCA 4GYCB 2ZIMA 4UCSA 4UCRA 4I55B 2YI5A 2EILB 1YTFB 1AMWA 1FFXA 2PNRA 5EIBC 5IJ0A 4GQTA 1GTOA 4BWAA 3GIEA 2WERA 3QVNA 1EZVH 1AR1B 2BOCC 4MVZA 1BHBA 3ZKDA 3K99A 5LGUA 3B77A 1AROP 3L70H 3A0TA 3OMNB 4B3RO 2CH7B 4HYOA 3W7SA 4JI0O 2QG2A 5LMNO 3LMMA 1M57C 4UFZA 3SJBC 1AP5A 4GKKB 4GZRB 1OCCB 3GIGA 4W7TA 3ABLC 3P3NA 4DV0O 1MZEA 1H2MA 2CE4A 2YE2A 4BXIA 1A32A 4JI4O 2CCUA 3AK2A 4GCZA 3I55V 4U93A 3FKSG 1R3JC 5GTHZ 3A0ZA 2QWQB 1FXHA 4WBNA 2F23A 2XDXA 1TUBB 1GK9A 4DR6O 4QE7A 2AZ2A 3E35A 2UXCB 3WB1A 1YJNV 3N2KA 4B6CA 4K4OA 5ITZB 3MDSA 2GTAA 1V55C 1I5AA 5IT9N 4LF8B 1S0VA 1IURA 1M56C 2AHYA 3ABKB 2XHXA 3PN1A 2BTQB 4ASUG 5B1BB 4X66B 3HYZA 2HHIA 3ZCCA 4L93A 4LF7O 4DW0A 2A7WA 2DYSC 1BMFG 4X62B 1EBOA 3M8AA 1E79G 5KUKA 1RPOA 1UYHA 2QTOA 5JVDA 4U3JA 2QKCA 5LP6A 4X65O 4R50A 2RN9A 1Q6UA 3AG7A 2ZM6B 4DUZB 1UYEA 4MPCA 4V25A 1K92A 1XUQA 1BSMA 1XREA 3R91A 3IFXA 2LJ2A 1MA1A 1ZL8A 3TZ4A 4D6TH 4DV1O 2ZR3A 1F7YA 3RYFB 3C3SA 2KSDA 2BSKA 3CCSV 1P49A 2YXYA 1OCZC 1N8RW 2XJXA 3NR7A 4LNUB 3C3TA 3SYOA 1SRYA 1YT0A 4DUYB 1VMGA 4O04A 3T0ZA 2P4VA 4LC1A 3UO3A 4MVOA 2XHTA 1JOYA 1AI4A 1GMGA 1EI1A 3RLQA 3WB0A 4NVPA 4YIOA 5EK0A 3OWDA 4LFBB 4PI2A 3LSQA 2FWYA 4AWQA 2BT0A 4QPKA 1SZTA 3W7XA 4F6RB 1L0NH 4DR1B 1FXVA 2E3CA 2QKAA 3F7YC 4GKJB 4LWEA 4Z2WA 4OX9O 2P22C 3JD2A 4KSGA 5IE9A 4YJ3A 1MMMA 1FFXB 2N05A 4PI0A 4AQYO 1V9PA 4X1IA 5IJ0B 1JFFB 3CGYA 4LWHA 1PVGA 5DM6V 1ZX3A 1Q8IA 2UUAB 3QTCA 1Y8OA 3D2RA 2Q8FA 5D6PA 4IGGA 4DR2O 4UVBA 4YKUA 2UXBB 4TV8A 3CC4V 2YIBD 4UCVA 1P4RA 1SF9A 1K73W 1Q7YW 5DECA 2WA3A 3VHAA 4LBEC 5K1PA 3OMUA 4NH9A 2CCTA 2IU3A 2QWRB 1XI1A 3VADA 5B1AB 4LPBA 2ARHA 3JAWA 4EB6A 4ABMA 1AJ6A 1Y8NA 3ZHSA 1CPYA 3AG2C 3BRCA 3CRMA 1XBLA 1HNXB 1VP7A 1NHIA
chains in the Genus database with same CATH topology
3SPHA 5KA5A 1QLEB 1S72V 1QLNA 4JASA 4MPNA 3RBZA 4BW5A 1SETA 3OEEG 3K97A 4LWGA 1H8EG 1JPXA 3RVZA 1DTOA 1R3LC 2X6BA 3OAAG 4WUCA 5LGNA 1ZXNA 2XOKG 2QKSA 3CD6V 1UYKA 2H94A 2FWZA 1AI5A 3T4ZA 1YTFD 3FB6C 1NH2B 4GEEA 2WLIB 2QEXV 3ETDA 1YHQV 1OCOB 3E83A 1S16A 2QFOA 4XKKA 4HZ5A 1TILA 1H8HG 1B63A 4LWFA 4X9LA 4DUHA 1K33A 1UYLA 4H37A 3OR6C 3ZJZA 2OTLV 1OCRB 5FWKA 2CCSA 2HG5C 1VQLV 1VQ9V 2CK3G 2QM7A 4F4LA 3U2DA 4XTJA 4CWNA 3TZ2A 2O1UA 4EGHA 1UY9A 1F4NA 2DQ0A 1VQ5V 3ZXQA 2VCJA 3M99B 1JVMA 4P9OA 3ZMVA 3ZN0A 1S14A 2W6JG 5B3SB 1Y4UA 2IJKA 1CP9A 2Q8GA 4GT1A 2OCCB 2Y69C 3NXSA 3F5WC 3OMAB 2AKPA 2YSUB 3CWVA 4CWTA 3ZMZA 4KFMA 3E86A 1TBWA 2A9HA 3EHBB 2EIKB 5LHIA 4XIRA 2GFDA 2W6IG 1P7BA 3OW6A 4U7OA 4KUMA 2A0LA 4CE1A 2WI1A 2XDKA 4EFUA 3JD4A 1I59A 1I5XA 2PI5A 5GW7A 1Q86W 3IC7A 3OW2U 1LNQA 2YEGA 1DF4A 3NMQA 4ASAA 1BYQA 2DYRB 3LNMB 4O05A 2ZDIC 3ABMC 5CTXA 2BYHA 1FS0G 2BOBC 2EZPA 1YT1A 2ESAA 3ZM7A 1FXKA 5CTUA 3H80A 2PI4A 2QE7G 4B7PA 3ABTA 4G28B 3RVYA 1GKXA 3CGZA 5B1OA 2WI7A 3EFFK 4Q20A 4MTOA 2FTKA 2HCHA 2D3OW 4EMVA 5IYCO 3OFNG 1KP2A 2BU8A 1NR1A 3D0BA 3OGCC 2IWSA 4MVRA 5M4MA 4JGSA 4PELA 2KB1A 3E8HA 1U0ZA 5BZBA 3T2SA 4NH7A 4CE2A 4LP8A 2XD6A 3LSSA 3EHFA 3OR7C 1W0JG 3AG4C 3ETGA 3VOUA 3K3WA 3CCMV 1YC1A 1AJNA 1IXMA 2VW5A 3BY6A 1I5CA 4MS2A 3B8NA 4XBFA 2YEFA 4TSFG 3B8MA 2YEBA 1ZW9A 1PD3A 5LHHA 2JJ2G 3U2KA 2JK5C 2HG1A 2ZDXA 2A79B 1NH2D 4AWOA 2IWXA 3HYYA 5IYBO 3CCEV 4YKQA 2YE5A 4P2ZA 4LP0A 1NVPB 1KZNA 4RUFA 1BGQA 3JD0A 3SYAA 5IY5C 2XCMA 2OT5A 2WSSG 1R6NA 3ASOB 1NKDA 5DN6G 5IDMA 1WPXA 2WAMA 3SPIA 1HWYA 4JYBA 5L3JA 1V54C 2BSMA 4E2LA 1JJ2U 3FYEB 4L87A 2EIJC 4BQGA 2X6CA 5F3KA 1K8AW 1F51A 4H33A 1MABG 1FXKB 2LFSA 3ZIAG 2GSMB 1YETA 2BREA 1PKXA 1H2GA 1MOFA 2YK9A 3ZKBA 3RLRA 2HKOA 1K7DA 1NHJA 2WEQA 2Q68A 3CCJV 1GKZA 4PDLA 4XDKA 4PDVA 2DWDC 3FB7C 3OEHG 2WLHA 4XCJA 5L3EA 2O1VA 2BRCA 2CG9A 3TUHA 2CGFA 3CYOA 4UVAA 3FT5A 3INXA 1BKNA 5LHGA 5CTYA 2EXLA 1YJ9V 4CWPA 3O2FA 3OPDA 2WLNA 2XAGA 5EBMC 3IGAC 4GX5A 1VQNV 3WHAA 3E2EA 3TTZA 4J9ZB 1Y4MA 5GGZA 4G27B 3KG2A 3STLC 3F7VC 3VBBA 4XE2A 2WLIA 2WWWA 1R6KA 2EIMC 3AG1C 1YESA 3RKZA 2IOPA 3CMAV 4MB9A 1NR7A 4AS9A 3QO5A 4JAVA 3TCUA 4MVQA 4L90A 5CA3A 4AWPA 5B1NA 4H7QA 4GGLA 2XHRA 1I5YA 3ASNC 1R3IC 3TK1A 2IORA 4PRXA 3G7BA 2XASA 5FNCA 4L94A 5FL7G 2BU2A 1M90W 3UKMA 1AH6A 4I5SA 4YKWA 1VQ7V 4HZ0A 3K79A 3U67A 2ZXWC 2B1GA 5D7DA 1R3KC 2EZOA 2YGAA 3A0XA 1QBZA 1I58A 3AG3C 4R1FA 3K08A 2UWDA 3X2QC 3HZ5A 4ASBA 2YI6A 2R9RB 1UYGA 4CWFA 1NVPD 1GM8A 3FT8A 4ASFA 2EINB 2P90A 4BIUA 2IOQA 3OUFA 1YJWV 1KIJA 3LDEA 3WG7B 1S77D 2K5BA 2YEVA 1GO3F 4WFHA 3SL2A 1VQ8V 2DW4A 3FYIB 4FCPA 4PA9A 3ZXOA 3C11A 3CC2V 1ZWHA 4O0BA 1Q81W 3OMIB 1DLBA 1THNA 4JTDB 1K9MW 3R4NA 2ZDYA 3O0IA 3TETA 4TT3G 4H85A 1RM1C 3VHCA 1VQ6V 2ZQMA 1M57B 3T2MA 1NBMG 3CRKA 3ABLB 4EM7A 4UVCA 3DGEA 4RQEA 3DTUB 2JEXA 5L3BA 3D3IA 1JCHA 4MVUA 1E1RG 1EZJA 2YE4A 4URLA 1MSWD 4MTGA 5EBLC 2Y48A 2NLJC 3E8BA 2R9IA 1KC8W 2BTZA 2YI7A 1UYIA 1YC3A 1V55B 2BYIA 1RPRA 1M56B 4MPEA 1YSRA 2EILC 4PL9A 3QO8A 3W7TA 4RUEA 3JD1A 2Q8IA 2YJWA 1TIDA 5BOCA 2DYSB 3ABUA 1VQPV 1TH8A 1Y66A 1A4HA 4WCEV 2IWUA 3JD3A 2WLKA 4X88A 1UYMA 1TC0A 3SJQC 3HPLC 4CE3A 4XC0A 5M4EA 2JJ1G 2YE7A 3D36A 1OCCC 2XK2A 3K04A 2B5UA 3ZN1A 1B3QA 2GQPA 1I5DA 3ETEA 4WFGA 1L1FA 1OCZB 2XAHA 2XDLA 2YEVB 3HEKA 2QM8A 1ROPA 2K1EA 2EBOA 3G4SV 4HXWA 1GM7A 2YEHA 3GB7C 2DWEC 4MOTA 2YE6A 2IJIA 5KA6A 1K5QA 4R8CA 2YEDA 4O07A 2F43G 3ABKC 2HLDG 4URMA 5B1BC 4JTCB 1R73A 4R3MA 1S76D 1Z59A 2QF6A 1B62A 4MT8A 1Z5CA 2YEEA 4XDMA 4GX1A 5D7CA 4KTNA 4JYCA 3E8GA 1UYCA 4HAMA 5L3GA 4H81A 4JQLA 2H55A 3H01A 5FNFA 3CMEV 1K97A 4X8AA 3AG2B 1H7SA 1Y8PA 1K5SA 2YGFA 5CBHA 3I56V 3B26A 3GWOA 4KQVA 3CC7V 4CWOA 1H38A 4PDRA 1NJIW 2P6JA 1XL4A 4FMTA 3B27A 1ZWIC 4P7AA 1S3JA 2HFEC 3PJSK 1EA6A 3HZ1A 3EHHA 2YK2A 4E02A 2ZKJA 4WUDA 5FNDA 4BQJA 4L91A 4WF9V 3C0EA 1JQ0A 4HYPA 5LBQA 5CBGA 2ZDIA 1YC4A 2WI4A 2WLLB 2HJFC 3QO7A 3ZRXA 3CCRV 1OZ0A 2YI0A 4WFBV 1OHHG 2WEPA 5L3FA 2FYPA 5B1AC 5IN9A 4XIQA 5M4KA 3A0WA 3OM3B 3BM9A 1QLEC 2HKJA 4MSWC 5J71A 3CCUV 4OXSA 5EBWC 2QG0A 4UROA 2XNDG 5M4NA 4YKYA 1ID0A 4LCUC 1UJWB 3T4DA 2IU0A 2YE9A 3P32A 2LP7A 3OWBA 3PEHA 4HYMA 1TUEB 1ZXMA 3SYCA 3W7WA 3EHJA 3LDDA 2JJCA 5M4HA 4ASGA 3UM7A 1OCOC 3SYQA 2Y69B 2ITDC 5CF0A 2LFRA 2XABA 3ML0A 3K98A 4WFEA 5CBFA 2IW5A 2QA4V 1UYFA 2H8MA 3GIFA 4QIWF 3QDDA 4EEHA 2X6AA 1OCRC 3CCQV 4MP2A 2UXNA 4CZZA 1YERA 2BZ5A 4QE9A 1YI2V 2YKIA 4L8ZA 4BAEA 1W0KG 5H6RA 1G4YB 1QR8A 1VQMV 2C2AA 4R3AA 4BIZA 3MHSC 4LWIA 4DXWA 3STZC 4UXNA 1OSFA 1S5HC 3AEIA 3R4PA 3K60A 3P30A 4MW3A 4FIPC 5B3SC 1Q82W 3ABMB 3JYCA 2BU7A 2HVKC 4CWSA 1AI7A 4KFGA 4EGKA 2OCCC 1I5BA 2P7TC 3MD0A 3CP1A 4PA3A 5CTWA 4EFTA 5L3DA 4CBCA 3Q5JA 3T1KA 3T1CA 2XX4A 1J95A 3K9AA 4O09A 4FPPA 1AJPA 2EIKC 5IDJA 3IEDA 3MHHC 4I3HA 3OE7G 2FXSA 4R6ZA 4UV8A 4PDMA 2V1DA 4FJCC 4MVMA 1SERA 4YKZA 4E01A 5CMUA 2Z3YA 1GKFA 4YKTA 4RAIA 4JAUA 3A0YA 2O1WA 1THZA 2V7QG 3EKRA 1VQKV 3BMYA 2YECA 4I9WA 3AG4B 1MU5A 3R4MA 4WUBA 2DYRC 1UY7A 5D6QA 1B6QA 2XAQA 4FCRA 1K4DC 4FK5C 5J6AA 5LGTA 4KP4A 3W7UA 1K3EA 1XL6A 1ORQC 4G2KA 2IJJA 4RQFA 3ZMUA 2GHYA 3OUSA 3GIGB 4UUJC 3JCZA 4JPRA 4MW8A 3HHUA 3O6OA 3FB8C 2EJRA 3SPCA 1GJVA 2MK3A 1Z5BA 2VWCA 2YE8A 2IJHA 5IY5B 4N23A 4MBCA 1AJQA 3E8FA 1COWG 1GM9A 3H4LA 2YKJA 3T0HA 2BU5A 1KECA 3WQ9A 2IH1C 1V54B 3PEJA 2ATKC 3RLPA 2EIJB 3LPSA 5CN0A 3G75A 3ZRVA 2XAJA 1BL8A 3INWA 4XDLA 2JDIG 2CH4A 1SESA 3BEHA 3JZ3A 1E1QG 3SYPA 4PA7A 1L0OA 3LNUA 4XKOA 2WPDG 4MVSA 4PRVA 4WFAV 5L3CA 5H6QA 3K0GA 4WFFA 1AM1A 1PL0A 4RO2A 3A0RA 2ZBKB 3WFVA 4EGIA 2YJXA 1YT2A 4DO2A 3Q5LA 4BAYA 2Q69A 3ASOC 4GT8A 4E00A 3K0DA 2AHZA 2WI3A 2YEAA 4QJFB 4NH8A 1PNLA 2XX2A 2Q8HA 4CWRA 2VCIA 1KQSU 2HVJC 4CWQA 1Y4SA 4PA6A 2Q2EB 2YEIA 3KE6A 1KP3A 2M7WA 1M1KW 1MX0A 3RW0A 3ZMSA 2XJGA 4XD8A 1VQOV 4XKAA 1FFTB 1FXKC 5J9PC 1QY8A 2ZR2A 5HFLA 1YIJV 3R65A 1UY6A 3K06A 4P9PA 3G71V 1R62A 4JF3A 2XX5A 1PNMA 4R7CA 3E89A 2EIMB 2WLLA 2WLJA 3AG1B 4HXZA 4XITA 2Q6AA 2IH3C 3ZRWA 1JX9A 2X0LA 3CRLA 1EFRG 2Q67A 4ZVIA 1MG1A 5C93A 4DZYA 4X89A 2YEJA 1QYEA 3LUTB 2JKIA 3B25A 4FCQA 2YGEA 1UYDA 1K34A 2DQ3A 2UXXA 3ASNB 4N21A 1VQ4V 4QPJA 4YKXA 3R92A 3HB3B 3VHDA 3FV5A 2YKEA 3FB5C 1QZRA 4PA4A 2YKBA 2ZD9A 1F4MA 1WLEA 2E0AA 2ZXWB 1W2BU 3SPGA 1JM6A 2X7RB 4V26A 1YS3A 5F5RA 3G6EV 3AG3B 4XCLA 5H9CA 4P8OA 4PU9A 2Z5UA 1F23A 1US7A 4MTFA 2XAFA 2H8PC 2WLMA 3CXCU 4P30A 1QVGU 4KSHA 3B24A 3X2QB 5CPHA 3Q5KA 5HFMA 1UY8A 2NNUA 3TZ5A 1Z5AA 1YITV 1G8MA 5BODA 1TC6A 3CCLV 4XIPA 4MP7A 2YE3A 3T10A 1NHHA 2XDUA 1BXDA 1QCEA 2XDSA 2ITCC 4JTAB 3MNRP 1BHAA 2BU6A 3EHGA 1KKDA 1DF5A 3R4OA 2B1IA 3ZMTA 3CCVV 4ZKIA 3CPWU 5IYDO 1YSCA 1U2OA 5M4PA 2JIZG 3EKOA 4URNA 2WI2A 4UV9A 2W0FC 5EC2C 2HR3A 4YXWG 4GFNA 3QNEA 1AH8A 4XDJA 1NQTA 3TZ0A 5E1AC 4EKWA 3ZRWB 4YKRA 1QVFU 1AI6A 2YKCA 1M9NA 4U7NA 2WI5A 4GX0A 3QTFA 2P67A 1RM1B 1YSZA 5KUMA 4HY6A 1PNKA 4MTXA 1H7UA 2JEUA 1ENVA 2EINC 3K03A 3G7EA 3B28A 1QR9A 4GX2A 3WG7C 4Z1MG 4J9YB 1K4CC 2XJJA 5D7RA 4TWKA 5EC1C 3ZRSA 1CEZA 2WI6A 2OTJV 1KD1W 3SPJA 4ZBMA 4HY1A 4HZ3A 4QNHB 3LDCA 2YI5A 2EILB 1YTFB 1AMWA 2PNRA 4GQTA 1GTOA 3GIEA 2WERA 1AR1B 2BOCC 4MVZA 1BHBA 3ZKDA 3K99A 5LGUA 3B77A 1AROP 3A0TA 3OMNB 4HYOA 3W7SA 2QG2A 1M57C 1OCCB 3GIGA 4W7TA 3ABLC 2YE2A 4BXIA 2CCUA 4GCZA 3I55V 4U93A 3FKSG 1R3JC 3A0ZA 1FXHA 2XDXA 1GK9A 4QE7A 4B6CA 3E35A 1YJNV 4K4OA 1V55C 1I5AA 1S0VA 1M56C 2AHYA 3ABKB 2XHXA 4ASUG 5B1BB 3HYZA 3ZCCA 4L93A 2DYSC 1BMFG 1EBOA 1E79G 5KUKA 1RPOA 1UYHA 2QTOA 4R50A 1UYEA 4V25A 4MPCA 1K92A 3R91A 3IFXA 3TZ4A 2ZR3A 3CCSV 1OCZC 1N8RW 2XJXA 3SYOA 1SRYA 1YT0A 4O04A 3T0ZA 4LC1A 4MVOA 2XHTA 1JOYA 1AI4A 1GMGA 1EI1A 3RLQA 5EK0A 3OWDA 3LSQA 2FWYA 4AWQA 2BT0A 4QPKA 1SZTA 3W7XA 1FXVA 3F7YC 4LWEA 3JD2A 4KSGA 3CGYA 4LWHA 1PVGA 5DM6V 1Y8OA 3D2RA 2Q8FA 5D6PA 4YKUA 4UVBA 3CC4V 1P4RA 1K73W 1Q7YW 3VHAA 4LBEC 3OMUA 4NH9A 2CCTA 2IU3A 3VADA 5B1AB 4LPBA 1AJ6A 1Y8NA 1CPYA 3AG2C 1NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FND A;  4BQJ A;  4L91 A;  3O2F A;  4CWP A;  4HXZ A;  3OPD A;  3C0E A;  4XIT A;  4HYP A;  4JAS A;  3ZRW A;  4MPN A;  1YC4 A;  3CRL A;  2WI4 A;  3WHA A;  3ZRX A;  4ZVI A;  5C93 A;  3TTZ A;  4DZY A;  3K97 A;  2YI0 A;  4LWG A;  2YEJ A;  5GGZ A;  1QYE A;  2WEP A;  2FYP A;  2JKI A;  3B25 A;  4FCQ A;  2YGE A;  5IN9 A;  1UYD A;  4XE2 A;  4XIQ A;  2WWW A;  5M4K A;  4WUC A;  3A0W A;  1ZXN A;  1YES A;  1UYK A;  3RKZ A;  3BM9 A;  2FWZ A;  2HKJ A;  5J71 A;  2IOP A;  4QPJ A;  4YKX A;  4MB9 A;  3R92 A;  3VHD A;  4AS9 A;  3FV5 A;  2YKE A;  4JAV A;  4GEE A;  1QZR A;  2YKB A;  2QG0 A;  4URO A;  5M4N A;  4YKY A;  1ID0 A;  4L90 A;  1S16 A;  2QFO A;  4XKK A;  2E0A A;  4HZ5 A;  2YE9 A;  3P32 A;  1JM6 A;  4AWP A;  1TIL A;  3OWB A;  3PEH A;  4V26 A;  5B1N A;  1YS3 A;  4HYM A;  4H7Q A;  5F5R A;  4GGL A;  1ZXM A;  1B63 A;  4LWF A;  2XHR A;  4XCL A;  4X9L A;  2IOR A;  3TK1 A;  4PRX A;  3G7B A;  5FNC A;  4L94 A;  3EHJ A;  4P8O A;  4DUH A;  4PU9 A;  1US7 A;  1UYL A;  2BU2 A;  4KSH A;  3B24 A;  5CPH A;  1AH6 A;  2JJC A;  3Q5K A;  5M4H A;  5FWK A;  4ASG A;  2CCS A;  4I5S A;  1UY8 A;  4YKW A;  3TZ5 A;  4HZ0 A;  1Z5A A;  2QM7 A;  5BOD A;  3U67 A;  1TC6 A;  3U2D A;  4XTJ A;  4CWN A;  4XIP A;  5D7D A;  4MP7 A;  2YE3 A;  3TZ2 A;  3T10 A;  5CF0 A;  2O1U A;  4EGH A;  2LFR A;  1NHH A;  2XDU A;  1UY9 A;  1BXD A;  2YGA A;  2XAB A;  2XDS A;  3A0X A;  3ZXQ A;  2VCJ A;  3K98 A;  1I58 A;  3MNR P;  2BU6 A;  3EHG A;  1S14 A;  4R1F A;  3R4O A;  1UYF A;  2H8M A;  3GIF A;  2UWD A;  1Y4U A;  3QDD A;  4EEH A;  4ZKI A;  3HZ5 A;  4ASB A;  2YI6 A;  1U2O A;  4MP2 A;  2Q8G A;  5M4P A;  1YER A;  1UYG A;  4GT1 A;  3EKO A;  2BZ5 A;  4URN A;  4CWF A;  2WI2 A;  3FT8 A;  3NXS A;  4ASF A;  2YKI A;  4L8Z A;  4BIU A;  4BAE A;  2IOQ A;  2C2A A;  4GFN A;  2AKP A;  3CWV A;  4CWT A;  4R3A A;  1AH8 A;  4BIZ A;  1KIJ A;  4LWI A;  1TBW A;  3TZ0 A;  1OSF A;  3R4P A;  3ZRW B;  2K5B A;  3K60 A;  4YKR A;  4XIR A;  2GFD A;  2YKC A;  3SL2 A;  4U7N A;  3OW6 A;  4U7O A;  2BU7 A;  2WI5 A;  3QTF A;  2P67 A;  4CWS A;  1YSZ A;  4CE1 A;  4FCP A;  4KFG A;  4EGK A;  2WI1 A;  2XDK A;  4EFU A;  4HY6 A;  1I5B A;  4MTX A;  3MD0 A;  1H7U A;  1I59 A;  5CTW A;  4EFT A;  3ZXO A;  3G7E A;  3C11 A;  3Q5J A;  3T1K A;  1ZWH A;  3B28 A;  4O0B A;  1THN A;  2XX4 A;  3R4N A;  2ZDY A;  2YEG A;  4O09 A;  4FPP A;  3O0I A;  3NMQ A;  4ASA A;  1BYQ A;  5IDJ A;  4O05 A;  3IED A;  4I3H A;  5CTX A;  2XJJ A;  5D7R A;  2BYH A;  2WI6 A;  2FXS A;  4H85 A;  1YT1 A;  3VHC A;  2ESA A;  3ZM7 A;  5CTU A;  4HY1 A;  3H80 A;  4YKZ A;  4E01 A;  3CRK A;  4YKT A;  4EM7 A;  4JAU A;  3A0Y A;  3DGE A;  4B7P A;  2O1W A;  1GKX A;  2YI5 A;  5CTY A;  3CGZ A;  3EKR A;  5B1O A;  1AMW A;  3BMY A;  2WI7 A;  2YEC A;  2PNR A;  1MU5 A;  2YE4 A;  3GIE A;  4GQT A;  4URL A;  2WER A;  4Q20 A;  3R4M A;  4WUB A;  1UY7 A;  2FTK A;  2HCH A;  4EMV A;  3ZKD A;  5D6Q A;  3K99 A;  2BU8 A;  3A0T A;  3D0B A;  2BTZ A;  2YI7 A;  1UYI A;  4FCR A;  2IWS A;  2QG2 A;  1YC3 A;  5M4M A;  5J6A A;  3GIG A;  4W7T A;  4KP4 A;  2BYI A;  4MPE A;  2YE2 A;  4BXI A;  1YSR A;  1U0Z A;  3T2S A;  4NH7 A;  2CCU A;  4CE2 A;  4PL9 A;  4GCZ A;  2XD6 A;  4U93 A;  2Q8I A;  3EHF A;  2YJW A;  3A0Z A;  1TID A;  5BOC A;  3GIG B;  1TH8 A;  2XDX A;  1A4H A;  1YC1 A;  1IXM A;  3HHU A;  2VW5 A;  2IWU A;  1UYM A;  3O6O A;  1I5C A;  1TC0 A;  2YEF A;  4B6C A;  1GJV A;  4K4O A;  1Z5B A;  2VWC A;  4CE3 A;  4XC0 A;  5M4E A;  2YE7 A;  3D36 A;  2YE8 A;  2YEB A;  1ZW9 A;  1I5A A;  4MBC A;  3U2K A;  2HG1 A;  2ZDX A;  2XK2 A;  3H4L A;  4AWO A;  2YKJ A;  3T0H A;  2XHX A;  1B3Q A;  2GQP A;  2BU5 A;  1I5D A;  3HYZ A;  2IWX A;  3WQ9 A;  3ZCC A;  4L93 A;  3HYY A;  4YKQ A;  3PEJ A;  3RLP A;  2YE5 A;  2XDL A;  3HEK A;  2QM8 A;  4LP0 A;  3LPS A;  1KZN A;  1UYH A;  3G75 A;  3ZRV A;  1BGQ A;  3INW A;  4HXW A;  2YEH A;  4MOT A;  2CH4 A;  2YE6 A;  3JZ3 A;  1UYE A;  2XCM A;  4MPC A;  4V25 A;  2YED A;  1L0O A;  4O07 A;  5IDM A;  3R91 A;  3LNU A;  4URM A;  4XKO A;  3TZ4 A;  4R3M A;  4PRV A;  4JYB A;  1Z59 A;  5L3J A;  2QF6 A;  2BSM A;  2XJX A;  1B62 A;  4MT8 A;  1Z5C A;  1AM1 A;  4BQG A;  1YT0 A;  2YEE A;  4O04 A;  3T0Z A;  4LC1 A;  5F3K A;  3A0R A;  2ZBK B;  1F51 A;  1JOY A;  2XHT A;  1EI1 A;  4XDM A;  3RLQ A;  5D7C A;  4KTN A;  2LFS A;  4JYC A;  4EGI A;  2YJX A;  3OWD A;  1YT2 A;  3Q5L A;  2FWY A;  4AWQ A;  1UYC A;  2BT0 A;  4QPK A;  4H81 A;  1YET A;  2BRE A;  4GT8 A;  4E00 A;  4JQL A;  2WI3 A;  2YEA A;  2H55 A;  4LWE A;  4KSG A;  2YK9 A;  5FNF A;  4NH8 A;  3ZKB A;  2XX2 A;  3RLR A;  2Q8H A;  4CWR A;  2VCI A;  4CWQ A;  1NHJ A;  3CGY A;  4LWH A;  1PVG A;  2WEQ A;  1Y4S A;  1H7S A;  1Y8P A;  1GKZ A;  2YGF A;  2Q2E B;  2YEI A;  3KE6 A;  1Y8O A;  1MX0 A;  3B26 A;  3D2R A;  4KQV A;  2Q8F A;  5D6P A;  4YKU A;  4CWO A;  2XJG A;  4XD8 A;  4XKA A;  4XCJ A;  2O1V A;  1QY8 A;  2BRC A;  4FMT A;  2CG9 A;  3B27 A;  3TUH A;  1UY6 A;  3VHA A;  3OMU A;  4NH9 A;  4P7A A;  2CCT A;  2CGF A;  1R62 A;  3VAD A;  4LPB A;  2XX5 A;  1EA6 A;  3FT5 A;  3HZ1 A;  3EHH A;  1AJ6 A;  1Y8N A;  2YK2 A;  3INX A;  4E02 A;  2ZKJ A;  1BKN A;  4WUD A;  2EXL A;  1NHI A; 
#chains in the Genus database with same CATH topology
 3SPH A;  3LSU A;  5KA5 A;  1QLE B;  1S72 V;  1QLN A;  3N2K B;  1H2N A;  1VF6 C;  1AR4 A;  4JAS A;  4ZI7 A;  4MPN A;  3RBZ A;  3WB2 A;  4BW5 A;  3CEI A;  1SET A;  3GVM A;  3OEE G;  3K97 A;  4LWG A;  1H8E G;  1FKA O;  1JPX A;  3RVZ A;  2LW7 A;  1HNZ O;  1DTO A;  1R3L C;  1SQX H;  2FL4 A;  2X6B A;  3OAA G;  4WUC A;  5LGN A;  1ZXN A;  3L71 H;  2XOK G;  2QKS A;  3CD6 V;  1UYK A;  3A0B Z;  2H94 A;  2FWZ A;  1AI5 A;  1N0J A;  3T4Z A;  5JVD B;  1YTF D;  3FB6 C;  5LP6 B;  2P4K A;  1NH2 B;  4NXM B;  2WLI B;  4GEE A;  4E72 A;  2QEX V;  3ETD A;  3S3X A;  4I50 A;  1YHQ V;  1OCO B;  1FPO A;  2XTA A;  3E83 A;  4NTY A;  1S16 A;  4I7Z B;  2QFO A;  1ZL8 B;  4XKK A;  4HZ5 A;  4I0X B;  1Q6H A;  1TIL A;  2BSK B;  1M4U A;  2H3O A;  3FX7 A;  1H8H G;  2RDC A;  1B63 A;  2UU9 O;  4LWF A;  4X9L A;  4LFA O;  1LUW A;  4DUH A;  1K33 A;  1UYL A;  2DOS A;  4H37 A;  1CXZ B;  4UCO A;  3OR6 C;  3ZJZ A;  2OTL V;  2PYL A;  1OCR B;  5FWK A;  2CCS A;  2HG5 C;  1HNW B;  3SJA C;  2ADQ B;  1VQL V;  1VQ9 V;  4K0K B;  2CK3 G;  4LFC B;  2QM7 A;  4F4L A;  3U2D A;  4XTJ A;  4CWN A;  4YJ3 B;  4NR1 A;  3TZ2 A;  1FJG O;  2O1U A;  3FD9 A;  4EGH A;  4LH7 A;  1UY9 A;  1F4N A;  2DQ0 A;  1VQ5 V;  3ZXQ A;  2VCJ A;  3M99 B;  3JAS B;  1JVM A;  4P9O A;  3ZMV A;  2F4V O;  3CYG A;  3ZN0 A;  1S14 A;  4JI8 O;  1WP7 A;  2W6J G;  3CRC A;  4LF4 O;  5B3S B;  1SQF A;  1S5L Z;  1P84 F;  1Y4U A;  2E76 B;  2FKX A;  4B3T O;  2IJK A;  1CP9 A;  2Q8G A;  4YHH B;  3BAA A;  4GT1 A;  1FYJ A;  2OCC B;  2Y69 C;  4NXN B;  3NXS A;  3D8C A;  4FLY A;  1H2K A;  4CH5 A;  2ZCE A;  3JAW B;  4EB6 B;  3F5W C;  3OMA B;  4J80 A;  2AKP A;  2YSU B;  3CWV A;  4Q6G A;  1SA0 A;  4CWT A;  1AB3 A;  3ZMZ A;  4KFM A;  3E86 A;  1TBW A;  2FB5 A;  2A9H A;  3EHB B;  4PHZ A;  2ZE6 A;  2EIK B;  2D2C B;  5LHI A;  3FFQ A;  4XIR A;  2GFD A;  2W6I G;  1Q5O A;  2QWP B;  1P7B A;  1WA8 A;  3SGI A;  3OW6 A;  4U7O A;  5IWA O;  2A3Q A;  4KUM A;  2A0L A;  4CE1 A;  1Z5V A;  3VQX A;  2WI1 A;  2XDK A;  4EFU A;  3N27 A;  3JD4 A;  4E4E A;  3B40 A;  2O57 A;  1I59 A;  1I5X A;  4GKK O;  2PI5 A;  2JGU A;  1O9H A;  5GW7 A;  1Q86 W;  3APQ A;  2DN9 A;  3IC7 A;  3OW2 U;  5CA1 A;  1LNQ A;  3T1Y B;  4AIL C;  1X4T A;  3CX5 F;  5C8Y A;  1DF4 A;  2YEG A;  3NMQ A;  2XUM A;  4ASA A;  2BTO A;  1HDJ A;  1BYQ A;  2DYR B;  3LNM B;  4O05 A;  2ZDI C;  3ABM C;  5CTX A;  2BYH A;  1FS0 G;  4I50 B;  2BOB C;  2EZP A;  1YT1 A;  2UXC O;  4AHC A;  2ESA A;  3ZM7 A;  1FXK A;  5CTU A;  3H80 A;  2PI4 A;  1YF2 A;  3U0Z A;  2QE7 G;  4DV4 B;  4LF8 O;  4B7P A;  3ABT A;  4G28 B;  3RVY A;  1GKX A;  3CGZ A;  5B1O A;  4X66 O;  2WI7 A;  3EFF K;  4H0L B;  2CDY A;  2OIE A;  4Q20 A;  4X62 O;  5B66 Z;  4MTO A;  2FTK A;  2HCH A;  2D3O W;  4EMV A;  4DV5 B;  5IYC O;  3OFN G;  1KP2 A;  2BU8 A;  1NR1 A;  3D0B A;  2EJ7 A;  3OGC C;  2IWS A;  2ZT9 B;  3KCY A;  4MVR A;  5M4M A;  3JAR A;  4JGS A;  4PEL A;  2KB1 A;  2ZM6 O;  3E8H A;  1XOU A;  4DR7 B;  2PUS A;  2CTR A;  1TUB A;  1U0Z A;  5BZB A;  3T2S A;  4NH7 A;  4DR3 B;  4CE2 A;  4LP8 A;  1IBL B;  2XD6 A;  3LSS A;  3EHF A;  5ITZ A;  3OR7 C;  1W0J G;  3B4S A;  1QNM A;  3AG4 C;  5LA6 A;  4DV2 B;  3ETG A;  3VOU A;  4NTX A;  3K3W A;  3CCM V;  5KHJ A;  1I94 B;  1AJN A;  1YC1 A;  1IXM A;  1NS1 A;  3D3Q A;  2VW5 A;  2P5O A;  5JJE B;  3BY6 A;  1I5C A;  4MS2 A;  3B8N A;  4XBF A;  2YEF A;  2KKW A;  2RQ6 A;  3G6B A;  2G38 A;  4TSF G;  4J11 A;  3B8M A;  2E5L B;  3A2F A;  2YEB A;  1ZW9 A;  4LFB O;  2AGA A;  1H2S B;  3Q4H B;  1TAE A;  1PD3 A;  5LHH A;  2JJ2 G;  3U2K A;  2JK5 C;  2HG1 A;  2ZDX A;  2A79 B;  1NH2 D;  4DR1 O;  2HP8 A;  3ICX A;  4C7U A;  5IYZ A;  1YZB A;  4AWO A;  1SA0 B;  2IWX A;  1BS3 A;  2JVD A;  1IXB A;  2Q5Z A;  4NYK A;  4DR5 O;  3HYY A;  5IYB O;  4DK0 A;  3CCE V;  4YKQ A;  3H1J H;  2YE5 A;  4P2Z A;  4LP0 A;  3BAB A;  2UUA O;  1NVP B;  3CB2 A;  1KZN A;  4RUF A;  2YC0 A;  1TVK A;  1BGQ A;  2OWO A;  4FM0 A;  4FFK A;  2UXB O;  3JD0 A;  3SYA A;  5IY5 C;  5IJ9 A;  2OT5 A;  2WSS G;  3H9V A;  1MNG A;  2XCM A;  1R6N A;  3ASO B;  2K9P A;  1NKD A;  1SC5 B;  3K9S A;  1G6U A;  5DN6 G;  5IDM A;  1WPX A;  3JAT A;  2WAM A;  1N36 B;  3H1L H;  3SPI A;  5CA1 B;  1HWY A;  4JYB A;  5L3J A;  2PTM A;  1V54 C;  2GDS A;  2BSM A;  4E2L A;  1JJ2 U;  3FYE B;  4DW1 A;  3SR2 C;  4CH4 A;  3TGU H;  4L87 A;  1HNX O;  2EIJ C;  4BQG A;  4F6R A;  1U97 A;  2X6C A;  4IL6 Z;  5F3K A;  1XQ8 A;  2DJV A;  1K8A W;  1F51 A;  1IBM O;  4H33 A;  1MAB G;  1FXK B;  2LFS A;  1Y76 A;  4JYA B;  3ZIA G;  1PP9 H;  5JJN B;  5FNV B;  2GSM B;  2R72 A;  2DE0 X;  1JFF A;  4OPH A;  3CRR A;  4YY3 B;  1YET A;  2BRE A;  4X20 B;  1PKX A;  3GWK C;  3LNN A;  1H2G A;  1MOF A;  4GUN A;  4J10 A;  2YK9 A;  2OYQ A;  3ZKB A;  3RLR A;  2Y4T A;  2NR5 A;  2HKO A;  1K7D A;  4DV6 B;  1NHJ A;  4X9Q A;  2WEQ A;  2Q68 A;  3CCJ V;  4DV7 O;  1GKZ A;  3H1I H;  1NTM H;  4PDL A;  4W4K A;  4XDK A;  4PDV A;  4JI1 B;  1WPB A;  1ZTE A;  3OTO B;  2DWD C;  3FB7 C;  3OEH G;  5KX5 B;  2RNB A;  1BQZ A;  2WLH A;  4XCJ A;  5L3E A;  2O1V A;  3JAR B;  4NXM O;  4A5U B;  2BRC A;  1KYO F;  2CG9 A;  3TUH A;  1Y6X A;  4J41 A;  4H13 B;  4YJ2 B;  3BA8 A;  4LF6 B;  2Q73 A;  4DV3 B;  2CGF A;  2CTW A;  2VRZ A;  2F1M A;  4UVA A;  3CYO A;  1TGO A;  3FT5 A;  1NI8 A;  5LA6 B;  3INX A;  1BKN A;  2VQE O;  5LHG A;  4X1Y B;  2EXL A;  5CTY A;  1YJ9 V;  4CWP A;  3O2F A;  1Y74 B;  3OPD A;  2WLN A;  2XAG A;  3S5T A;  2HHH B;  5EBM C;  3IGA C;  4JI3 B;  4GX5 A;  1VQN V;  4OGQ B;  2KQX A;  3WHA A;  5EZY B;  5B5E Z;  1HNW O;  3E2E A;  3TTZ A;  5IYZ B;  2AXT Z;  4J9Z B;  1Y4M A;  5GGZ A;  3CRQ A;  4G27 B;  3KG2 A;  3STL C;  2ILM A;  3F7V C;  5A2Q N;  3VBB A;  2R9A A;  4JZ2 A;  4XE2 A;  2WLI A;  4KHP B;  2WWW A;  1R6K A;  2EIM C;  1G1X B;  3AG1 C;  1YES A;  3RKZ A;  3BA9 A;  5AG2 A;  1TVK B;  2IOP A;  2VWK A;  3CMA V;  4MB9 A;  3ZHU A;  1XNQ B;  1NR7 A;  4AS9 A;  4I0X A;  3QO5 A;  4JAV A;  2N04 A;  3RYH B;  5IJ9 B;  3JAL A;  3TCU A;  3L74 H;  2KG7 A;  4MVQ A;  4YHH O;  4L90 A;  3TXQ A;  2QWO B;  3JAT B;  2CTP A;  4NXN O;  2LGW A;  5CA3 A;  4AWP A;  3CS5 A;  4B7K A;  4JI7 B;  5B1N A;  4H7Q A;  4GGL A;  3CSX A;  4U3F H;  2XHR A;  1I5Y A;  3ASN C;  1R3I C;  3TK1 A;  2IOR A;  3SJC C;  3G7B A;  2XAS A;  4PRX A;  1KU9 A;  5FNC A;  4L94 A;  5FPR A;  5FL7 G;  4LR3 A;  4O2A B;  5BR8 O;  4LF5 O;  4DRX A;  2BU2 A;  3KKY A;  1M90 W;  2NN4 A;  3UKM A;  3L9D A;  1Y76 B;  1AH6 A;  4I5S A;  4YKW A;  3RYI A;  1I0H A;  3CJH B;  1VQ7 V;  4HZ0 A;  3K79 A;  3JAS A;  3U67 A;  2Y0P A;  2ZXW C;  2B1G A;  5D7D A;  1R3K C;  2EZO A;  2YGA A;  5GTI Z;  5JCO A;  1BGY H;  1BZK A;  3A0X A;  1QBZ A;  1I58 A;  1N33 B;  3AG3 C;  1JA8 A;  2B9Z A;  1US6 A;  1WB7 A;  4R1F A;  3T1Y O;  1S5J A;  3K08 A;  2UWD A;  4UB8 Z;  3X2Q C;  1EN6 A;  3HZ5 A;  4J7J A;  3U10 A;  4ASB A;  2MW2 B;  2YI6 A;  1T5E A;  1NTK H;  2R9R B;  1UYG A;  4CWF A;  1NVP D;  1GM8 A;  5GON A;  5TIS Z;  3FT8 A;  3VQV A;  4ASF A;  1DGS A;  1Y67 A;  2EIN B;  2P90 A;  4BIU A;  2WA4 A;  2IOQ A;  5E79 Z;  3OUF A;  2LQT A;  4DV4 O;  1WJZ A;  3BFR A;  4X1K A;  1YJW V;  1KIJ A;  3HR0 A;  3LDE A;  3WG7 B;  2C1G A;  1S77 D;  1IVS A;  4IHJ B;  1SQQ H;  2K5B A;  2YEV A;  1GO3 F;  4WFH A;  3SL2 A;  1VQ8 V;  2DW4 A;  3FYI B;  4DV5 O;  4TQD A;  4KL1 A;  4JI6 B;  4FCP A;  5KMG A;  4PA9 A;  2YS8 A;  5KHG A;  4B08 A;  2VQF B;  1WB8 A;  1I08 A;  1IBK O;  1N32 B;  3UT5 A;  1AP6 A;  3ZXO A;  5EYP A;  3C11 A;  1VF7 A;  3CC2 V;  4B7E A;  4DR7 O;  1XHZ A;  1PM9 A;  1ZWH A;  4O0B A;  1Q81 W;  3OMI B;  1DLB A;  1M5I A;  4DR3 O;  4JI2 B;  1THN A;  2YXH A;  1IBL O;  4JTD B;  1K9M W;  3R4N A;  2ZDY A;  4PV1 B;  3CHX A;  3O0I A;  1YVW A;  4DV2 O;  5KHH A;  1I94 O;  4I9Q A;  2DMX A;  3QG5 A;  3TET A;  1Z2G A;  3JAL B;  4TT3 G;  4H85 A;  1RM1 C;  2KG7 B;  3VHC A;  1VQ6 V;  2ZQM A;  4O4J A;  1M57 B;  3T2M A;  2E5L O;  1NBM G;  3CRK A;  2EX3 A;  1N4C A;  3ABL B;  4EM7 A;  4UVC A;  1GH6 A;  1YXB A;  3DGE A;  4RQE A;  3DTU B;  2JEX A;  4BIO A;  5L3B A;  3D3I A;  1X59 A;  1JCH A;  4MVU A;  2PF4 E;  1L0L H;  1E1R G;  1EZJ A;  4FZ1 A;  1NT2 B;  2RJZ A;  4DRX B;  2YE4 A;  4URL A;  2PY5 A;  1MSW D;  4MTG A;  5EBL C;  2C1I A;  2Y48 A;  3KCX A;  2NLJ C;  3RYI B;  3E8B A;  4O4I A;  5JH7 A;  2R9I A;  3L75 H;  1KC8 W;  1HR0 B;  5JQG A;  1W59 A;  2BTZ A;  2YI7 A;  1UYI A;  1YC3 A;  2CUG A;  1Q43 A;  1V55 B;  2E75 B;  3ZED A;  3CXH F;  2BYI A;  1RSO A;  1RPR A;  1M56 B;  4MPE A;  1YSR A;  5KAF Z;  4X65 B;  2EIL C;  4PL9 A;  3QO8 A;  1N36 O;  3W7T A;  4RUE A;  3JD1 A;  2Q8I A;  4LF9 O;  2YJW A;  1TID A;  5BOC A;  4TV9 A;  2DYS B;  3ABU A;  1UPG A;  4H44 B;  1VQP V;  1TH8 A;  1Y66 A;  2QJ1 A;  1A4H A;  4KXR A;  4WCE V;  4O4L A;  3Q4H A;  2IWU A;  3JD3 A;  2WLK A;  4X88 A;  1UYM A;  1TC0 A;  4ZIB A;  1NU1 H;  3SJQ C;  3HPL C;  3ZHQ A;  4CE3 A;  4XC0 A;  5M4E A;  2JJ1 G;  5GON B;  2YE7 A;  3D36 A;  3SDL A;  4HNA A;  4JYA O;  1OCC C;  1B04 A;  2XK2 A;  2YI8 A;  3K04 A;  2B5U A;  3ZN1 A;  1B3Q A;  4X1K B;  2GQP A;  2ZE7 A;  1I5D A;  3ETE A;  3EVK A;  2OIG A;  4WFG A;  5H5N A;  1L1F A;  1OCZ B;  4DV6 O;  2XAH A;  2GBO A;  2XDL A;  2YEV B;  3HEK A;  2QM8 A;  4FFB A;  1ROP A;  4OX9 B;  2K1E A;  2EBO A;  3G4S V;  4AQY B;  4JI1 O;  1XMQ B;  1GM7 A;  4HXW A;  3OTO O;  2YEH A;  3GB7 C;  4DYL A;  2DWE C;  5K1X A;  5KMG B;  4MOT A;  2YE6 A;  4JI5 B;  2IJI A;  5KA6 A;  1K5Q A;  4R8C A;  4BR6 A;  3UT5 B;  2YED A;  5EYP B;  1D5A A;  1YEW A;  4O07 A;  2F43 G;  4O2B B;  3ABK C;  2HLD G;  3K5L A;  5KHK A;  4URM A;  4LF6 O;  5B1B C;  4JTC B;  1R73 A;  4R3M A;  1S76 D;  1Z59 A;  1JR9 A;  1FAF A;  2YUA A;  2QF6 A;  1Q90 D;  1HP8 A;  5FNV A;  1B62 A;  4MT8 A;  5H2F Z;  1Z5C A;  3F5T A;  3S3W A;  1UFI A;  4X20 A;  2JRI A;  2YEE A;  2ETN A;  2YIC A;  3RYC A;  1N0N A;  4XDM A;  3DSQ A;  4GX1 A;  5D7C A;  4KTN A;  4JYC A;  4O4J B;  3CRA A;  3E8G A;  4JI3 O;  4FLZ A;  5JEN A;  1ZLZ A;  1UYC A;  4HAM A;  5L3G A;  4H81 A;  2IBZ H;  2UXD B;  1KUQ A;  4JQL A;  1YCI A;  2JGD B;  2JS5 A;  3APO A;  1Z5W A;  2H55 A;  2QR4 A;  4K35 A;  3H01 A;  5FNF A;  3CME V;  1K97 A;  4X8A A;  5KX5 A;  3P3P A;  3AG2 B;  1H7S A;  1Y8P A;  1K5S A;  4BW9 A;  2YGF A;  1MSD A;  4DUZ O;  1BCC H;  5CBH A;  3I56 V;  3B26 A;  4O4I B;  5JH7 B;  3GWO A;  4KQV A;  3CC7 V;  4CWO A;  5JQG B;  4YJ2 A;  1H2L A;  5LMU B;  2A06 H;  1VAR A;  2BE3 A;  1H38 A;  4PDR A;  1NJI W;  2P6J A;  1XL4 A;  3J80 N;  3MAQ A;  1RSO B;  4FMT A;  3B27 A;  1ZWI C;  4PD4 F;  5LOV A;  4X1Y A;  2YI9 A;  1WNS A;  4P7A A;  1S3J A;  1Y74 A;  1BE3 H;  4DUY O;  2HFE C;  3PJS K;  2UUB B;  1EA6 A;  4TV9 B;  3HZ1 A;  3EHH A;  2YK2 A;  4E02 A;  2ZKJ A;  4JI7 O;  1FD9 A;  5EZY A;  4O4L B;  3JAM N;  4WUD A;  2AW9 A;  4ZOL B;  5FND A;  4BQJ A;  4L91 A;  2OCH A;  2QSA A;  1EN4 A;  4WF9 V;  1XEQ A;  4DR4 B;  4B3M B;  3C0E A;  1JQ0 A;  4HYP A;  1SQB H;  4GKJ O;  5LBQ A;  5CBG A;  2YID A;  4X64 B;  2ZDI A;  5A9G A;  1YC4 A;  5EIB D;  2WI4 A;  4HNA B;  2WLL B;  2M6Y A;  2HJF C;  3QO7 A;  5D5P A;  2UU9 B;  1XNR B;  3ZRX A;  1LUV A;  4LFA B;  3CCR V;  1BQ0 A;  1PPJ H;  3A8T A;  1OZ0 A;  3HKB A;  4J42 A;  2YI0 A;  3AK1 A;  3BVO A;  4WFB V;  1XMO B;  1OHH G;  2WEP A;  5L3F A;  2FYP A;  5B1A C;  4FM2 A;  1TA8 A;  5IN9 A;  4CC5 A;  4XIQ A;  4K8Z A;  2Q7G A;  3THO A;  5M4K A;  4FFB B;  3RYH A;  3A0W A;  1N33 O;  3OM3 B;  2GUZ A;  4FLV A;  3BM9 A;  1RP3 B;  2W0X A;  1QLE C;  1FJG B;  2HKJ A;  4MSW C;  1AIL A;  5J71 A;  3CCU V;  4LH6 A;  3K58 A;  2Q0A A;  2CTQ A;  4OXS A;  5EBW C;  2QG0 A;  4URO A;  2XND G;  5M4N A;  4JI8 B;  1ID0 A;  4YKY A;  4LWS A;  4LCU C;  3UO2 A;  1UJW B;  1M93 A;  2ZE8 A;  3T4D A;  1OV9 A;  3U11 A;  2IU0 A;  2YE9 A;  3P32 A;  2N74 A;  4B3T B;  4O2A A;  2LP7 A;  2Q7E A;  3OWB A;  1KB9 F;  3PEH A;  4HYM A;  1TUE B;  1ZXM A;  3BCC H;  3SYC A;  3CJH A;  2Z0A A;  2Q8V A;  3G80 A;  3W7W A;  3EHJ A;  1WAZ A;  3RYC B;  1PV0 A;  3LDD A;  1QHT A;  3ETQ A;  4JYY A;  5LP6 C;  2JJC A;  5M4H A;  4ASG A;  3UM7 A;  1OCO C;  3SYQ A;  3JSL A;  1DK1 A;  4JI6 O;  2Y69 B;  4FM1 A;  2VQF O;  2QM4 A;  2ITD C;  2LW1 A;  5CF0 A;  1N32 O;  5IWA B;  2LFR A;  1XIL A;  2XAB A;  3ML0 A;  3OTF A;  3K98 A;  4WFE A;  3T1H B;  5CBF A;  2RMK B;  4JI2 O;  1GN4 A;  1R6T A;  5FLX N;  2IW5 A;  2QA4 V;  4IYI A;  1UYF A;  2H8M A;  3GIF A;  4QIW F;  4FZ0 A;  4JV5 B;  3QDD A;  2IM9 A;  4EEH A;  2RCV A;  2X6A A;  4ICG A;  1OCR C;  3CCQ V;  3TXS A;  5BMV A;  4MP2 A;  2UXN A;  3N2G B;  4CZZ A;  1YER A;  2HJD A;  2BZ5 A;  3O65 A;  5LOV B;  4QE9 A;  2Y0I A;  1YI2 V;  2YKI A;  4L8Z A;  5J2U A;  4BAE A;  4IHJ A;  1W0K G;  3IJ4 A;  5H6R A;  1G4Y B;  1QR8 A;  1VQM V;  2C2A A;  4IT5 A;  1SQP H;  1I7F A;  4R3A A;  4BIZ A;  4B3S B;  3MHS C;  4LWI A;  4DXW A;  1SQV H;  5D5Q A;  3STZ C;  2E74 B;  2UUC B;  3JCU Z;  3AK3 A;  4K0K O;  4UXN A;  4LFC O;  1OSF A;  1S5H C;  3AEI A;  2VWJ A;  3R4P A;  3K60 A;  3P30 A;  4MW3 A;  4FIP C;  5B3S C;  1Q82 W;  3ABM B;  3JYC A;  5JCO C;  5FPO A;  3K59 A;  2BU7 A;  2HVK C;  3RGB A;  3FAV A;  2VS0 A;  3C90 A;  3HKB B;  4IIJ B;  4CWS A;  3B09 A;  5J2T A;  1AI7 A;  1HR0 O;  4KFG A;  4EGK A;  2XHB A;  5JWP A;  1N34 B;  2OCC C;  1I5B A;  2P7T C;  3MD0 A;  3CP1 A;  1RFY A;  4ZHQ A;  4PA3 A;  1L8D A;  5CTW A;  5L3D A;  4EFT A;  3HKD B;  4CBC A;  3Q5J A;  3T1K A;  3T1C A;  3M7M X;  2GUZ B;  2Q7H A;  4CS3 A;  2XX4 A;  1J95 A;  3K9A A;  1J5E B;  2CGN A;  4O09 A;  4FPP A;  3ZHV A;  1AJP A;  2EIK C;  2QDO A;  5IDJ A;  3IED A;  3MHH C;  4I3H A;  2FML A;  3JSN A;  3OE7 G;  2FXS A;  4R6Z A;  4NTW A;  1VIB A;  3ZS8 C;  4NB5 A;  3O9O A;  4UV8 A;  4PDM A;  4LWS B;  2V1D A;  4FJC C;  4RWU A;  4MVM A;  1SER A;  2Y4U A;  4YKZ A;  4E01 A;  5CMU A;  4JZG A;  2Z3Y A;  3HKE B;  1GKF A;  2GTS A;  2QTS A;  4YKT A;  4RAI A;  2Q4P A;  4IYH A;  4JAU A;  3A0Y A;  2FYU H;  2O1W A;  1THZ A;  2V7Q G;  1NTZ H;  3EKR A;  2F95 B;  2LGQ A;  1VQK V;  5CA0 B;  3BMY A;  2YEC A;  4I9W A;  1QQC A;  2HEP A;  3AG4 B;  1YDX A;  1MU5 A;  4DK1 A;  2ZIN A;  3R4M A;  4WUB A;  2DYR C;  1UY7 A;  2P06 A;  3K5N A;  3ZBH A;  5D6Q A;  1B6Q A;  2XAQ A;  4DR5 B;  5BY1 A;  1XMQ O;  4FCR A;  1K4D C;  4FK5 C;  4JI5 O;  3J81 N;  5J6A A;  2ZNI A;  5LGT A;  4KP4 A;  1SQG A;  4O4H A;  3W7U A;  4OPA A;  1K3E A;  1XL6 A;  4TOI A;  1ORQ C;  4G2K A;  2IJJ A;  4RQF A;  3ZMU A;  1EN5 A;  2L6L A;  4FLX A;  2QGN A;  2GHY A;  3OUS A;  3GIG B;  4UUJ C;  3JCZ A;  4JPR A;  4MW8 A;  4TUY A;  3HHU A;  1JMK C;  3O6O A;  1HW7 A;  3FB8 C;  2EJR A;  3OGI B;  4FVM A;  5BMV B;  3SPC A;  1GJV A;  2MK3 A;  3G67 A;  1D5N A;  1Z5B A;  2VWC A;  3HKC A;  4WBN B;  1AR5 A;  2YE8 A;  3JAK A;  2IJH A;  5IY5 B;  4FLU A;  4N23 A;  5J2U B;  4MBC A;  1QU7 A;  5LYJ A;  1SKV A;  1AJQ A;  2Q0O C;  3ZHR A;  1JJO A;  3E8F A;  1COW G;  2UXD O;  1GM9 A;  3H4L A;  3DC6 A;  2YKJ A;  3T0H A;  1IBM B;  2ZNJ A;  4PJ0 Z;  2BU5 A;  3VQY A;  1KEC A;  3WQ9 A;  2IH1 C;  1V54 B;  5F2V O;  3PEJ A;  1R1B A;  2ATK C;  3WU2 Z;  3RLP A;  2EIJ B;  3LPS A;  5CN0 A;  3FAV B;  3G75 A;  3ZRV A;  2XAJ A;  1BL8 A;  4B3R B;  3INW A;  4O2B A;  5J2T B;  4XDL A;  4JI0 B;  2JDI G;  2PGG A;  1B06 A;  5LMN B;  4DV7 B;  2CH4 A;  4L8J A;  5LMU O;  1SES A;  3J7A U;  1EM1 A;  3BEH A;  1O9G A;  4ZHQ B;  3JZ3 A;  1E1Q G;  4DV0 B;  3SYP A;  4PA7 A;  2PZS A;  1KKC A;  3R66 A;  3RFR A;  1L0O A;  1Q6I A;  4JI4 B;  1WP8 A;  4U3J B;  3LNU A;  4XKO A;  2QWN B;  2WPD G;  4MVS A;  3D36 C;  4PRV A;  2ODM A;  2UUB O;  4WFA V;  5L3C A;  2F66 C;  5H6Q A;  3K0G A;  4WFF A;  1GN2 A;  1AM1 A;  4DR6 B;  1PL0 A;  2JGD A;  1WN7 A;  4RO2 A;  3A0R A;  4GLX A;  4EFE A;  3IAY A;  4B3M O;  4DR4 O;  2ZBK B;  2Q9L A;  3B2E E;  3WFV A;  1LR1 A;  2YJX A;  4EGI A;  1XDC A;  3DC5 A;  4X64 O;  1YT2 A;  3CE2 A;  2VQE B;  4DO2 A;  4FLT A;  3Q5L A;  3K5O A;  2Q69 A;  4BAY A;  3ASO C;  1XNR O;  4GT8 A;  4E00 A;  3K0D A;  2AHZ A;  2WI3 A;  4W4L A;  3E22 A;  3VQW A;  2YEA A;  4QJF B;  1AVM A;  4NH8 A;  1XMO O;  1PNL A;  4LF7 B;  2XX2 A;  2Q8H A;  1VF6 A;  4CWR A;  5LL6 Y;  2VCI A;  1KQS U;  2HVJ C;  4CWQ A;  1Y4S A;  1GRJ A;  4PA6 A;  4CS2 A;  3K57 A;  4K8X A;  2Q2E B;  1KMI Z;  2YEI A;  3KE6 A;  1KP3 A;  2M7W A;  1M1K W;  1MX0 A;  2L35 A;  3RW0 A;  3ZMS A;  2XJG A;  4XD8 A;  4X1I B;  1VQO V;  5KAI Z;  4XKA A;  1FFT B;  1NZ6 A;  1FXK C;  4D7T A;  5J9P C;  1QY8 A;  2ZR2 A;  5HFL A;  4O4H B;  1YIJ V;  3R65 A;  1UY6 A;  3IC9 A;  4CH3 A;  3K06 A;  4P9P A;  4TV8 B;  4ZOL A;  3G71 V;  2XT9 A;  4DV1 B;  5CB4 A;  1R62 A;  4JF3 A;  2PYJ A;  1VF5 B;  2XX5 A;  1PNM A;  4QGP A;  2F93 B;  4R7C A;  1XHX A;  3E89 A;  1OJH A;  2EIM B;  4CH6 A;  2WLL A;  2WLJ A;  4TUY B;  2R70 A;  3AG1 B;  5LXT A;  4EFB A;  2YIB A;  4YY3 O;  4HXZ A;  2JS3 A;  3I5D A;  4XIT A;  2Q6A A;  2IH3 C;  3ZRW A;  1JX9 A;  5JJJ B;  3HKC B;  4FLW A;  1P7G A;  4UCT A;  2X0L A;  3JAK B;  4D7S A;  3CRL A;  4NKG B;  1EFR G;  3KZI Z;  2Q67 A;  4ZVI A;  1MG1 A;  5LYJ B;  5C93 A;  3K5M A;  4TQF A;  5BR8 B;  3QF7 A;  4LF5 B;  4DZY A;  3L72 H;  4X89 A;  3ZHT A;  2YEJ A;  4ZI7 B;  1QYE A;  1SZX A;  3LUT B;  2JKI A;  3B25 A;  4FCQ A;  2GV9 A;  2YGE A;  2AZ0 A;  1UYD A;  1K34 A;  1VEW A;  2DQ3 A;  3T1H O;  2UXX A;  3ASN B;  4N21 A;  1VQ4 V;  2BCC H;  3EXA A;  4DR2 B;  3OD4 A;  4QPJ A;  4YKX A;  3R92 A;  3DXR A;  3HB3 B;  3VHD A;  1MZF A;  3BPZ A;  4DV3 O;  3FV5 A;  2YKE A;  4JV5 O;  2YXL A;  3FB5 C;  1QZR A;  4PA4 A;  2YKB A;  3CWB H;  2ZD9 A;  2V4D A;  1F4M A;  4I4T A;  1ZUQ A;  4EEQ A;  1WLE A;  2E0A A;  2ZXW B;  1W2B U;  3SPG A;  1JM6 A;  2X7R B;  4V26 A;  2HHH O;  1YS3 A;  5F5R A;  4I55 A;  2ZIO A;  3G6E V;  3AG3 B;  4UCU A;  4B3S O;  2EUL A;  4XCL A;  5H9C A;  2UUC O;  4P8O A;  4PU9 A;  2Z5U A;  1PL4 A;  1F23 A;  1US7 A;  2CGO A;  4MTF A;  2XAF A;  2H8P C;  2WLM A;  3CXC U;  4P30 A;  4CS4 A;  1QVG U;  4KSH A;  3B24 A;  3X2Q B;  5CPH A;  3Q5K A;  5HFM A;  2ZKO A;  3UCS C;  1UY8 A;  2NNU A;  1BT8 A;  3H1K H;  3TZ5 A;  3RT3 C;  1URF A;  1GN6 A;  5DED A;  1Z5A A;  4J7K A;  1YIT V;  2CH7 A;  3E22 B;  4KHP O;  1G8M A;  1Q3E A;  5BOD A;  1IDS A;  1N34 O;  1TC6 A;  3CCL V;  4XIP A;  4MP7 A;  2YE3 A;  4K3A A;  3T10 A;  1HNZ B;  4JAA A;  1NHH A;  2XDU A;  3RWR D;  1BXD A;  1XNQ O;  1QCE A;  2LO1 A;  2YIA A;  2XDS A;  2ITC C;  2ADP A;  4JTA B;  3MNR P;  3TJT A;  3A0H Z;  1BHA A;  2BU6 A;  3EHG A;  3N2G A;  4AI8 A;  1KKD A;  1DF5 A;  3L73 H;  3OT7 A;  1IBK B;  3R4O A;  1J5E O;  2B1I A;  3H1H H;  3ZMT A;  3ZX6 A;  3CCV V;  4ZKI A;  3CPW U;  5IYD O;  1YSC A;  1U2O A;  5BXZ A;  5M4P A;  2JIZ G;  3EKO A;  4URN A;  4YIP A;  3RN4 A;  1GAX A;  2WI2 A;  4UV9 A;  4UB6 Z;  5CB4 B;  3BHP A;  2W0F C;  5EC2 C;  2HR3 A;  1ZAU A;  4YXW G;  4GFN A;  1GN3 A;  2YDE A;  2BTQ A;  3QNE A;  4HBN A;  1AH8 A;  5LXT B;  4XDJ A;  1IZ3 A;  4IIJ A;  1NQT A;  3TZ0 A;  1KBH A;  5E1A C;  4EKW A;  3ZRW B;  4YKR A;  4CC6 A;  1QVF U;  1AI6 A;  2CAZ C;  2YKC A;  1M9N A;  4U7N A;  3HKD A;  1ZSP A;  2WI5 A;  4GX0 A;  3QTF A;  2P67 A;  1RM1 B;  3UQ8 A;  1YSZ A;  5KUM A;  4HY6 A;  1PNK A;  4MTX A;  1H7U A;  2JEU A;  1ENV A;  1D2D A;  2EIN C;  3K03 A;  1WA8 B;  1SS3 A;  3G7E A;  1IX9 A;  3B28 A;  2F4V B;  1QR9 A;  3RYF A;  4GX2 A;  3WG7 C;  4LF4 B;  4Z1M G;  4J9Y B;  3DXR B;  2ZE5 A;  4Z1V A;  1K4C C;  4F6E A;  4LNU A;  3HKE A;  5KHI A;  2XJJ A;  5D7R A;  4TWK A;  5EC1 C;  3ZRS A;  1CEZ A;  2WI6 A;  2OTJ V;  1KD1 W;  4LF9 B;  1U96 A;  4I4T B;  4J7Z A;  3SPJ A;  5C8Y B;  5CA0 A;  4ZBM A;  5KLV H;  4HY1 A;  4HZ3 A;  4QNH B;  3LDC A;  4GYC B;  2ZIM A;  4UCS A;  4UCR A;  4I55 B;  2YI5 A;  2EIL B;  1YTF B;  1AMW A;  1FFX A;  2PNR A;  5EIB C;  5IJ0 A;  4GQT A;  1GTO A;  4BWA A;  3GIE A;  2WER A;  3QVN A;  1EZV H;  1AR1 B;  2BOC C;  4MVZ A;  1BHB A;  3ZKD A;  3K99 A;  5LGU A;  3B77 A;  1ARO P;  3L70 H;  3A0T A;  3OMN B;  4B3R O;  2CH7 B;  4HYO A;  3W7S A;  4JI0 O;  2QG2 A;  5LMN O;  3LMM A;  1M57 C;  4UFZ A;  3SJB C;  1AP5 A;  4GKK B;  4GZR B;  1OCC B;  3GIG A;  4W7T A;  3ABL C;  3P3N A;  4DV0 O;  1MZE A;  1H2M A;  2CE4 A;  2YE2 A;  4BXI A;  1A32 A;  4JI4 O;  2CCU A;  3AK2 A;  4GCZ A;  3I55 V;  4U93 A;  3FKS G;  1R3J C;  5GTH Z;  3A0Z A;  2QWQ B;  1FXH A;  4WBN A;  2F23 A;  2XDX A;  1TUB B;  1GK9 A;  4DR6 O;  4QE7 A;  2AZ2 A;  3E35 A;  2UXC B;  3WB1 A;  1YJN V;  3N2K A;  4B6C A;  4K4O A;  5ITZ B;  3MDS A;  2GTA A;  1V55 C;  1I5A A;  5IT9 N;  4LF8 B;  1S0V A;  1IUR A;  1M56 C;  2AHY A;  3ABK B;  2XHX A;  3PN1 A;  2BTQ B;  4ASU G;  5B1B B;  4X66 B;  3HYZ A;  2HHI A;  3ZCC A;  4L93 A;  4LF7 O;  4DW0 A;  2A7W A;  2DYS C;  1BMF G;  4X62 B;  1EBO A;  3M8A A;  1E79 G;  5KUK A;  1RPO A;  1UYH A;  2QTO A;  5JVD A;  4U3J A;  2QKC A;  5LP6 A;  4X65 O;  4R50 A;  2RN9 A;  1Q6U A;  3AG7 A;  2ZM6 B;  4DUZ B;  1UYE A;  4MPC A;  4V25 A;  1K92 A;  1XUQ A;  1BSM A;  1XRE A;  3R91 A;  3IFX A;  2LJ2 A;  1MA1 A;  1ZL8 A;  3TZ4 A;  4D6T H;  4DV1 O;  2ZR3 A;  1F7Y A;  3RYF B;  3C3S A;  2KSD A;  2BSK A;  3CCS V;  1P49 A;  2YXY A;  1OCZ C;  1N8R W;  2XJX A;  3NR7 A;  4LNU B;  3C3T A;  3SYO A;  1SRY A;  1YT0 A;  4DUY B;  1VMG A;  4O04 A;  3T0Z A;  2P4V A;  4LC1 A;  3UO3 A;  4MVO A;  2XHT A;  1JOY A;  1AI4 A;  1GMG A;  1EI1 A;  3RLQ A;  3WB0 A;  4NVP A;  4YIO A;  5EK0 A;  3OWD A;  4LFB B;  4PI2 A;  3LSQ A;  2FWY A;  4AWQ A;  2BT0 A;  4QPK A;  1SZT A;  3W7X A;  4F6R B;  1L0N H;  4DR1 B;  1FXV A;  2E3C A;  2QKA A;  3F7Y C;  4GKJ B;  4LWE A;  4Z2W A;  4OX9 O;  2P22 C;  3JD2 A;  4KSG A;  5IE9 A;  4YJ3 A;  1MMM A;  1FFX B;  2N05 A;  4PI0 A;  4AQY O;  1V9P A;  4X1I A;  5IJ0 B;  1JFF B;  3CGY A;  4LWH A;  1PVG A;  5DM6 V;  1ZX3 A;  1Q8I A;  2UUA B;  3QTC A;  1Y8O A;  3D2R A;  2Q8F A;  5D6P A;  4IGG A;  4DR2 O;  4UVB A;  4YKU A;  2UXB B;  4TV8 A;  3CC4 V;  2YIB D;  4UCV A;  1P4R A;  1SF9 A;  1K73 W;  1Q7Y W;  5DEC A;  2WA3 A;  3VHA A;  4LBE C;  5K1P A;  3OMU A;  4NH9 A;  2CCT A;  2IU3 A;  2QWR B;  1XI1 A;  3VAD A;  5B1A B;  4LPB A;  2ARH A;  3JAW A;  4EB6 A;  4ABM A;  1AJ6 A;  1Y8N A;  3ZHS A;  1CPY A;  3AG2 C;  3BRC A;  3CRM A;  1XBL A;  1HNX B;  1VP7 A;  1NHI A; 
#chains in the Genus database with same CATH homology
 3SPH A;  5KA5 A;  1QLE B;  1S72 V;  1QLN A;  4JAS A;  4MPN A;  3RBZ A;  4BW5 A;  1SET A;  3OEE G;  3K97 A;  4LWG A;  1H8E G;  1JPX A;  3RVZ A;  1DTO A;  1R3L C;  2X6B A;  3OAA G;  4WUC A;  5LGN A;  1ZXN A;  2XOK G;  2QKS A;  3CD6 V;  1UYK A;  2H94 A;  2FWZ A;  1AI5 A;  3T4Z A;  1YTF D;  3FB6 C;  1NH2 B;  4GEE A;  2WLI B;  2QEX V;  3ETD A;  1YHQ V;  1OCO B;  3E83 A;  1S16 A;  2QFO A;  4XKK A;  4HZ5 A;  1TIL A;  1H8H G;  1B63 A;  4LWF A;  4X9L A;  4DUH A;  1K33 A;  1UYL A;  4H37 A;  3OR6 C;  3ZJZ A;  2OTL V;  1OCR B;  5FWK A;  2CCS A;  2HG5 C;  1VQL V;  1VQ9 V;  2CK3 G;  2QM7 A;  4F4L A;  3U2D A;  4XTJ A;  4CWN A;  3TZ2 A;  2O1U A;  4EGH A;  1UY9 A;  1F4N A;  2DQ0 A;  1VQ5 V;  3ZXQ A;  2VCJ A;  3M99 B;  1JVM A;  4P9O A;  3ZMV A;  3ZN0 A;  1S14 A;  2W6J G;  5B3S B;  1Y4U A;  2IJK A;  1CP9 A;  2Q8G A;  4GT1 A;  2OCC B;  2Y69 C;  3NXS A;  3F5W C;  3OMA B;  2AKP A;  2YSU B;  3CWV A;  4CWT A;  3ZMZ A;  4KFM A;  3E86 A;  1TBW A;  2A9H A;  3EHB B;  2EIK B;  5LHI A;  4XIR A;  2GFD A;  2W6I G;  1P7B A;  3OW6 A;  4U7O A;  4KUM A;  2A0L A;  4CE1 A;  2WI1 A;  2XDK A;  4EFU A;  3JD4 A;  1I59 A;  1I5X A;  2PI5 A;  5GW7 A;  1Q86 W;  3IC7 A;  3OW2 U;  1LNQ A;  2YEG A;  1DF4 A;  3NMQ A;  4ASA A;  1BYQ A;  2DYR B;  3LNM B;  4O05 A;  2ZDI C;  3ABM C;  5CTX A;  2BYH A;  1FS0 G;  2BOB C;  2EZP A;  1YT1 A;  2ESA A;  3ZM7 A;  1FXK A;  5CTU A;  3H80 A;  2PI4 A;  2QE7 G;  4B7P A;  3ABT A;  4G28 B;  3RVY A;  1GKX A;  3CGZ A;  5B1O A;  2WI7 A;  3EFF K;  4Q20 A;  4MTO A;  2FTK A;  2HCH A;  2D3O W;  4EMV A;  5IYC O;  3OFN G;  1KP2 A;  2BU8 A;  1NR1 A;  3D0B A;  3OGC C;  2IWS A;  4MVR A;  5M4M A;  4JGS A;  4PEL A;  2KB1 A;  3E8H A;  1U0Z A;  5BZB A;  3T2S A;  4NH7 A;  4CE2 A;  4LP8 A;  2XD6 A;  3LSS A;  3EHF A;  3OR7 C;  1W0J G;  3AG4 C;  3ETG A;  3VOU A;  3K3W A;  3CCM V;  1YC1 A;  1AJN A;  1IXM A;  2VW5 A;  3BY6 A;  1I5C A;  4MS2 A;  3B8N A;  4XBF A;  2YEF A;  4TSF G;  3B8M A;  2YEB A;  1ZW9 A;  1PD3 A;  5LHH A;  2JJ2 G;  3U2K A;  2JK5 C;  2HG1 A;  2ZDX A;  2A79 B;  1NH2 D;  4AWO A;  2IWX A;  3HYY A;  5IYB O;  3CCE V;  4YKQ A;  2YE5 A;  4P2Z A;  4LP0 A;  1NVP B;  1KZN A;  4RUF A;  1BGQ A;  3JD0 A;  3SYA A;  5IY5 C;  2XCM A;  2OT5 A;  2WSS G;  1R6N A;  3ASO B;  1NKD A;  5DN6 G;  5IDM A;  1WPX A;  2WAM A;  3SPI A;  1HWY A;  4JYB A;  5L3J A;  1V54 C;  2BSM A;  4E2L A;  1JJ2 U;  3FYE B;  4L87 A;  2EIJ C;  4BQG A;  2X6C A;  5F3K A;  1K8A W;  1F51 A;  4H33 A;  1MAB G;  1FXK B;  2LFS A;  3ZIA G;  2GSM B;  1YET A;  2BRE A;  1PKX A;  1H2G A;  1MOF A;  2YK9 A;  3ZKB A;  3RLR A;  2HKO A;  1K7D A;  1NHJ A;  2WEQ A;  2Q68 A;  3CCJ V;  1GKZ A;  4PDL A;  4XDK A;  4PDV A;  2DWD C;  3FB7 C;  3OEH G;  2WLH A;  4XCJ A;  5L3E A;  2O1V A;  2BRC A;  2CG9 A;  3TUH A;  2CGF A;  3CYO A;  4UVA A;  3FT5 A;  3INX A;  1BKN A;  5LHG A;  5CTY A;  2EXL A;  1YJ9 V;  4CWP A;  3O2F A;  3OPD A;  2WLN A;  2XAG A;  5EBM C;  3IGA C;  4GX5 A;  1VQN V;  3WHA A;  3E2E A;  3TTZ A;  4J9Z B;  1Y4M A;  5GGZ A;  4G27 B;  3KG2 A;  3STL C;  3F7V C;  3VBB A;  4XE2 A;  2WLI A;  2WWW A;  1R6K A;  2EIM C;  3AG1 C;  1YES A;  3RKZ A;  2IOP A;  3CMA V;  4MB9 A;  1NR7 A;  4AS9 A;  3QO5 A;  4JAV A;  3TCU A;  4MVQ A;  4L90 A;  5CA3 A;  4AWP A;  5B1N A;  4H7Q A;  4GGL A;  2XHR A;  1I5Y A;  3ASN C;  1R3I C;  3TK1 A;  2IOR A;  4PRX A;  3G7B A;  2XAS A;  5FNC A;  4L94 A;  5FL7 G;  2BU2 A;  1M90 W;  3UKM A;  1AH6 A;  4I5S A;  4YKW A;  1VQ7 V;  4HZ0 A;  3K79 A;  3U67 A;  2ZXW C;  2B1G A;  5D7D A;  1R3K C;  2EZO A;  2YGA A;  3A0X A;  1QBZ A;  1I58 A;  3AG3 C;  4R1F A;  3K08 A;  2UWD A;  3X2Q C;  3HZ5 A;  4ASB A;  2YI6 A;  2R9R B;  1UYG A;  4CWF A;  1NVP D;  1GM8 A;  3FT8 A;  4ASF A;  2EIN B;  2P90 A;  4BIU A;  2IOQ A;  3OUF A;  1YJW V;  1KIJ A;  3LDE A;  3WG7 B;  1S77 D;  2K5B A;  2YEV A;  1GO3 F;  4WFH A;  3SL2 A;  1VQ8 V;  2DW4 A;  3FYI B;  4FCP A;  4PA9 A;  3ZXO A;  3C11 A;  3CC2 V;  1ZWH A;  4O0B A;  1Q81 W;  3OMI B;  1DLB A;  1THN A;  4JTD B;  1K9M W;  3R4N A;  2ZDY A;  3O0I A;  3TET A;  4TT3 G;  4H85 A;  1RM1 C;  3VHC A;  1VQ6 V;  2ZQM A;  1M57 B;  3T2M A;  1NBM G;  3CRK A;  3ABL B;  4EM7 A;  4UVC A;  3DGE A;  4RQE A;  3DTU B;  2JEX A;  5L3B A;  3D3I A;  1JCH A;  4MVU A;  1E1R G;  1EZJ A;  2YE4 A;  4URL A;  1MSW D;  4MTG A;  5EBL C;  2Y48 A;  2NLJ C;  3E8B A;  2R9I A;  1KC8 W;  2BTZ A;  2YI7 A;  1UYI A;  1YC3 A;  1V55 B;  2BYI A;  1RPR A;  1M56 B;  4MPE A;  1YSR A;  2EIL C;  4PL9 A;  3QO8 A;  3W7T A;  4RUE A;  3JD1 A;  2Q8I A;  2YJW A;  1TID A;  5BOC A;  2DYS B;  3ABU A;  1VQP V;  1TH8 A;  1Y66 A;  1A4H A;  4WCE V;  2IWU A;  3JD3 A;  2WLK A;  4X88 A;  1UYM A;  1TC0 A;  3SJQ C;  3HPL C;  4CE3 A;  4XC0 A;  5M4E A;  2JJ1 G;  2YE7 A;  3D36 A;  1OCC C;  2XK2 A;  3K04 A;  2B5U A;  3ZN1 A;  1B3Q A;  2GQP A;  1I5D A;  3ETE A;  4WFG A;  1L1F A;  1OCZ B;  2XAH A;  2XDL A;  2YEV B;  3HEK A;  2QM8 A;  1ROP A;  2K1E A;  2EBO A;  3G4S V;  4HXW A;  1GM7 A;  2YEH A;  3GB7 C;  2DWE C;  4MOT A;  2YE6 A;  2IJI A;  5KA6 A;  1K5Q A;  4R8C A;  2YED A;  4O07 A;  2F43 G;  3ABK C;  2HLD G;  4URM A;  5B1B C;  4JTC B;  1R73 A;  4R3M A;  1S76 D;  1Z59 A;  2QF6 A;  1B62 A;  4MT8 A;  1Z5C A;  2YEE A;  4XDM A;  4GX1 A;  5D7C A;  4KTN A;  4JYC A;  3E8G A;  1UYC A;  4HAM A;  5L3G A;  4H81 A;  4JQL A;  2H55 A;  3H01 A;  5FNF A;  3CME V;  1K97 A;  4X8A A;  3AG2 B;  1H7S A;  1Y8P A;  1K5S A;  2YGF A;  5CBH A;  3I56 V;  3B26 A;  3GWO A;  4KQV A;  3CC7 V;  4CWO A;  1H38 A;  4PDR A;  1NJI W;  2P6J A;  1XL4 A;  4FMT A;  3B27 A;  1ZWI C;  4P7A A;  1S3J A;  2HFE C;  3PJS K;  1EA6 A;  3HZ1 A;  3EHH A;  2YK2 A;  4E02 A;  2ZKJ A;  4WUD A;  5FND A;  4BQJ A;  4L91 A;  4WF9 V;  3C0E A;  1JQ0 A;  4HYP A;  5LBQ A;  5CBG A;  2ZDI A;  1YC4 A;  2WI4 A;  2WLL B;  2HJF C;  3QO7 A;  3ZRX A;  3CCR V;  1OZ0 A;  2YI0 A;  4WFB V;  1OHH G;  2WEP A;  5L3F A;  2FYP A;  5B1A C;  5IN9 A;  4XIQ A;  5M4K A;  3A0W A;  3OM3 B;  3BM9 A;  1QLE C;  2HKJ A;  4MSW C;  5J71 A;  3CCU V;  4OXS A;  5EBW C;  2QG0 A;  4URO A;  2XND G;  5M4N A;  4YKY A;  1ID0 A;  4LCU C;  1UJW B;  3T4D A;  2IU0 A;  2YE9 A;  3P32 A;  2LP7 A;  3OWB A;  3PEH A;  4HYM A;  1TUE B;  1ZXM A;  3SYC A;  3W7W A;  3EHJ A;  3LDD A;  2JJC A;  5M4H A;  4ASG A;  3UM7 A;  1OCO C;  3SYQ A;  2Y69 B;  2ITD C;  5CF0 A;  2LFR A;  2XAB A;  3ML0 A;  3K98 A;  4WFE A;  5CBF A;  2IW5 A;  2QA4 V;  1UYF A;  2H8M A;  3GIF A;  4QIW F;  3QDD A;  4EEH A;  2X6A A;  1OCR C;  3CCQ V;  4MP2 A;  2UXN A;  4CZZ A;  1YER A;  2BZ5 A;  4QE9 A;  1YI2 V;  2YKI A;  4L8Z A;  4BAE A;  1W0K G;  5H6R A;  1G4Y B;  1QR8 A;  1VQM V;  2C2A A;  4R3A A;  4BIZ A;  3MHS C;  4LWI A;  4DXW A;  3STZ C;  4UXN A;  1OSF A;  1S5H C;  3AEI A;  3R4P A;  3K60 A;  3P30 A;  4MW3 A;  4FIP C;  5B3S C;  1Q82 W;  3ABM B;  3JYC A;  2BU7 A;  2HVK C;  4CWS A;  1AI7 A;  4KFG A;  4EGK A;  2OCC C;  1I5B A;  2P7T C;  3MD0 A;  3CP1 A;  4PA3 A;  5CTW A;  4EFT A;  5L3D A;  4CBC A;  3Q5J A;  3T1K A;  3T1C A;  2XX4 A;  1J95 A;  3K9A A;  4O09 A;  4FPP A;  1AJP A;  2EIK C;  5IDJ A;  3IED A;  3MHH C;  4I3H A;  3OE7 G;  2FXS A;  4R6Z A;  4UV8 A;  4PDM A;  2V1D A;  4FJC C;  4MVM A;  1SER A;  4YKZ A;  4E01 A;  5CMU A;  2Z3Y A;  1GKF A;  4YKT A;  4RAI A;  4JAU A;  3A0Y A;  2O1W A;  1THZ A;  2V7Q G;  3EKR A;  1VQK V;  3BMY A;  2YEC A;  4I9W A;  3AG4 B;  1MU5 A;  3R4M A;  4WUB A;  2DYR C;  1UY7 A;  5D6Q A;  1B6Q A;  2XAQ A;  4FCR A;  1K4D C;  4FK5 C;  5J6A A;  5LGT A;  4KP4 A;  3W7U A;  1K3E A;  1XL6 A;  1ORQ C;  4G2K A;  2IJJ A;  4RQF A;  3ZMU A;  2GHY A;  3OUS A;  3GIG B;  4UUJ C;  3JCZ A;  4JPR A;  4MW8 A;  3HHU A;  3O6O A;  3FB8 C;  2EJR A;  3SPC A;  1GJV A;  2MK3 A;  1Z5B A;  2VWC A;  2YE8 A;  2IJH A;  5IY5 B;  4N23 A;  4MBC A;  1AJQ A;  3E8F A;  1COW G;  1GM9 A;  3H4L A;  2YKJ A;  3T0H A;  2BU5 A;  1KEC A;  3WQ9 A;  2IH1 C;  1V54 B;  3PEJ A;  2ATK C;  3RLP A;  2EIJ B;  3LPS A;  5CN0 A;  3G75 A;  3ZRV A;  2XAJ A;  1BL8 A;  3INW A;  4XDL A;  2JDI G;  2CH4 A;  1SES A;  3BEH A;  3JZ3 A;  1E1Q G;  3SYP A;  4PA7 A;  1L0O A;  3LNU A;  4XKO A;  2WPD G;  4MVS A;  4PRV A;  4WFA V;  5L3C A;  5H6Q A;  3K0G A;  4WFF A;  1AM1 A;  1PL0 A;  4RO2 A;  3A0R A;  2ZBK B;  3WFV A;  4EGI A;  2YJX A;  1YT2 A;  4DO2 A;  3Q5L A;  4BAY A;  2Q69 A;  3ASO C;  4GT8 A;  4E00 A;  3K0D A;  2AHZ A;  2WI3 A;  2YEA A;  4QJF B;  4NH8 A;  1PNL A;  2XX2 A;  2Q8H A;  4CWR A;  2VCI A;  1KQS U;  2HVJ C;  4CWQ A;  1Y4S A;  4PA6 A;  2Q2E B;  2YEI A;  3KE6 A;  1KP3 A;  2M7W A;  1M1K W;  1MX0 A;  3RW0 A;  3ZMS A;  2XJG A;  4XD8 A;  1VQO V;  4XKA A;  1FFT B;  1FXK C;  5J9P C;  1QY8 A;  2ZR2 A;  5HFL A;  1YIJ V;  3R65 A;  1UY6 A;  3K06 A;  4P9P A;  3G71 V;  1R62 A;  4JF3 A;  2XX5 A;  1PNM A;  4R7C A;  3E89 A;  2EIM B;  2WLL A;  2WLJ A;  3AG1 B;  4HXZ A;  4XIT A;  2Q6A A;  2IH3 C;  3ZRW A;  1JX9 A;  2X0L A;  3CRL A;  1EFR G;  2Q67 A;  4ZVI A;  1MG1 A;  5C93 A;  4DZY A;  4X89 A;  2YEJ A;  1QYE A;  3LUT B;  2JKI A;  3B25 A;  4FCQ A;  2YGE A;  1UYD A;  1K34 A;  2DQ3 A;  2UXX A;  3ASN B;  4N21 A;  1VQ4 V;  4QPJ A;  4YKX A;  3R92 A;  3HB3 B;  3VHD A;  3FV5 A;  2YKE A;  3FB5 C;  1QZR A;  4PA4 A;  2YKB A;  2ZD9 A;  1F4M A;  1WLE A;  2E0A A;  2ZXW B;  1W2B U;  3SPG A;  1JM6 A;  2X7R B;  4V26 A;  1YS3 A;  5F5R A;  3G6E V;  3AG3 B;  4XCL A;  5H9C A;  4P8O A;  4PU9 A;  2Z5U A;  1F23 A;  1US7 A;  4MTF A;  2XAF A;  2H8P C;  2WLM A;  3CXC U;  4P30 A;  1QVG U;  4KSH A;  3B24 A;  3X2Q B;  5CPH A;  3Q5K A;  5HFM A;  1UY8 A;  2NNU A;  3TZ5 A;  1Z5A A;  1YIT V;  1G8M A;  5BOD A;  1TC6 A;  3CCL V;  4XIP A;  4MP7 A;  2YE3 A;  3T10 A;  1NHH A;  2XDU A;  1BXD A;  1QCE A;  2XDS A;  2ITC C;  4JTA B;  3MNR P;  1BHA A;  2BU6 A;  3EHG A;  1KKD A;  1DF5 A;  3R4O A;  2B1I A;  3ZMT A;  3CCV V;  4ZKI A;  3CPW U;  5IYD O;  1YSC A;  1U2O A;  5M4P A;  2JIZ G;  3EKO A;  4URN A;  2WI2 A;  4UV9 A;  2W0F C;  5EC2 C;  2HR3 A;  4YXW G;  4GFN A;  3QNE A;  1AH8 A;  4XDJ A;  1NQT A;  3TZ0 A;  5E1A C;  4EKW A;  3ZRW B;  4YKR A;  1QVF U;  1AI6 A;  2YKC A;  1M9N A;  4U7N A;  2WI5 A;  4GX0 A;  3QTF A;  2P67 A;  1RM1 B;  1YSZ A;  5KUM A;  4HY6 A;  1PNK A;  4MTX A;  1H7U A;  2JEU A;  1ENV A;  2EIN C;  3K03 A;  3G7E A;  3B28 A;  1QR9 A;  4GX2 A;  3WG7 C;  4Z1M G;  4J9Y B;  1K4C C;  2XJJ A;  5D7R A;  4TWK A;  5EC1 C;  3ZRS A;  1CEZ A;  2WI6 A;  2OTJ V;  1KD1 W;  3SPJ A;  4ZBM A;  4HY1 A;  4HZ3 A;  4QNH B;  3LDC A;  2YI5 A;  2EIL B;  1YTF B;  1AMW A;  2PNR A;  4GQT A;  1GTO A;  3GIE A;  2WER A;  1AR1 B;  2BOC C;  4MVZ A;  1BHB A;  3ZKD A;  3K99 A;  5LGU A;  3B77 A;  1ARO P;  3A0T A;  3OMN B;  4HYO A;  3W7S A;  2QG2 A;  1M57 C;  1OCC B;  3GIG A;  4W7T A;  3ABL C;  2YE2 A;  4BXI A;  2CCU A;  4GCZ A;  3I55 V;  4U93 A;  3FKS G;  1R3J C;  3A0Z A;  1FXH A;  2XDX A;  1GK9 A;  4QE7 A;  4B6C A;  3E35 A;  1YJN V;  4K4O A;  1V55 C;  1I5A A;  1S0V A;  1M56 C;  2AHY A;  3ABK B;  2XHX A;  4ASU G;  5B1B B;  3HYZ A;  3ZCC A;  4L93 A;  2DYS C;  1BMF G;  1EBO A;  1E79 G;  5KUK A;  1RPO A;  1UYH A;  2QTO A;  4R50 A;  1UYE A;  4V25 A;  4MPC A;  1K92 A;  3R91 A;  3IFX A;  3TZ4 A;  2ZR3 A;  3CCS V;  1OCZ C;  1N8R W;  2XJX A;  3SYO A;  1SRY A;  1YT0 A;  4O04 A;  3T0Z A;  4LC1 A;  4MVO A;  2XHT A;  1JOY A;  1AI4 A;  1GMG A;  1EI1 A;  3RLQ A;  5EK0 A;  3OWD A;  3LSQ A;  2FWY A;  4AWQ A;  2BT0 A;  4QPK A;  1SZT A;  3W7X A;  1FXV A;  3F7Y C;  4LWE A;  3JD2 A;  4KSG A;  3CGY A;  4LWH A;  1PVG A;  5DM6 V;  1Y8O A;  3D2R A;  2Q8F A;  5D6P A;  4YKU A;  4UVB A;  3CC4 V;  1P4R A;  1K73 W;  1Q7Y W;  3VHA A;  4LBE C;  3OMU A;  4NH9 A;  2CCT A;  2IU3 A;  3VAD A;  5B1A B;  4LPB A;  1AJ6 A;  1Y8N A;  1CPY A;  3AG2 C;  1NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...