4FMTA

Crystal structure of a chpt protein (cc_3470) from caulobacter crescentus cb15 at 2.30 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
209
Chain Sequence
DVQGPDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Branched signal wiring of an essential bacterial cell-cycle phosphotransfer protein.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
molecule keywords ChpT protein
total genus 71
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fmtA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fmtA02
4BAEA 2XX5A 4JQLA 3G7EA 4GT8A 4O0BA 2FYPA 4XTJA 1UYGA 1R62A 1US7A 4U7NA 2BT0A 3TZ0A 3U2DA 4O04A 3INXA 4GCZA 5B1OA 2XX2A 1UYEA 3C0EA 3JZ3A 3DGEA 3VHCA 4O05A 4GEEA 3EHHA 3ZRWB 2BTZA 4LP0A 4LWHA 3HEKA 4CE3A 4CWPA 4MOTA 3R92A 3T0HA 3WQ9A 4FPPA 2XDLA 4XKAA 2YE9A 3BMYA 2YI7A 1UYIA 2BYIA 2GFDA 1NHIA 1Y8PA 2QFOA 2WEPA 4BXIA 5B1NA 4B6CA 1Y4UA 2YKCA 3K99A 3G7BA 4R3AA 4EFUA 1EA6A 3Q5JA 1S16A 4YKWA 3TZ2A 2IWUA 3O0IA 2YI6A 1KZNA 1ZW9A 3INWA 5F3KA 1Y8OA 3TK1A 3H4LA 2BSMA 3A0RA 4CWFA 4YKXA 2CGFA 4CE1A 1MX0A 4FCRA 2YKBA 3Q5LA 2CCSA 2VWCA 1L0OA 1YERA 1TH8A 4L91A 3ZKDA 2HCHA 4GFNA 3D36A 2XHRA 1I58A 4LWFA 2YEGA 2QF6A 4YKRA 4MP2A 2XJGA 4HYPA 3OWBA 2YGEA 2WEQA 4HXZA 2XK2A 4Q20A 3CGZA 3PEHA 3CWVA 4H85A 2AKPA 3NMQA 4HYMA 3LPSA 4HXWA 1YT2A 1TC6A 3B24A 5BODA 3IEDA 3SL2A 4LPBA 3R4OA 3FT5A 2IOPA 1UY8A 2CCTA 1AH6A 2Q8GA 5M4EA 5CTUA 2EXLA 4AWPA 1GKZA 1YC4A 2ESAA 2YKIA 5IN9A 1AM1A 2BU5A 2HKJA 4NH8A 4LWIA 3HYZA 4HY6A 3RLPA 1GJVA 4QPKA 2YGFA 5FNDA 4AWQA 2XX4A 4CWRA 4ZVIA 3BM9A 4WUDA 4K4OA 2XDXA 2YKEA 4URLA 4EGKA 4R1FA 4DUHA 2JJCA 2WI5A 3T0ZA 4E00A 3QTFA 4MBCA 3EHJA 3D0BA 5CTWA 4PRXA 5IDJA 4URNA 3HZ1A 1NHHA 4XKKA 1B62A 3ZCCA 2XJJA 4GGLA 4KFGA 4EGIA 2WWWA 2YE5A 3B26A 5CF0A 3K98A 1I5BA 3HHUA 3ZRWA 3CGYA 2YE2A 2IOQA 4KSGA 3TTZA 4ASAA 3MD0A 2XHTA 3ZKBA 2XJXA 4LWGA 1ID0A 1UYDA 5D6PA 2WI1A 4O07A 2O1UA 4YKZA 3H80A 2K5BA 4H7QA 1H7UA 1UYLA 3O6OA 5D6QA 2QM7A 2BU6A 2YI5A 3GIFA 2BU2A 2VW5A 5FNFA 2IWXA 4MPNA 4EGHA 1YC3A 4URMA 4EEHA 2LFRA 2UWDA 4KP4A 1B3QA 4XCLA 3ZRXA 1MU5A 4MP7A 4JAVA 2YECA 3RKZA 3RLQA 2WI2A 2YEBA 2YGAA 3T1KA 4CWSA 4GQTA 1QYEA 1Y8NA 4NH7A 2YEJA 2XCMA 1JOYA 4JYCA 5M4KA 5D7CA 4CWQA 3U67A 1AH8A 4EFTA 1UYFA 3PEJA 1Z5CA 1Y4SA 4BIUA 3HZ5A 2P67A 3T10A 2XDKA 1BGQA 2BYHA 2XDSA 1ZXNA 5D7RA 3A0WA 2VCJA 4U7OA 2QG0A 5M4NA 1A4HA 1UYCA 1UYMA 3TZ4A 3NXSA 3ZRVA 4YKTA 3FV5A 2YEHA 2YEAA 4ASBA 4MPEA 2WI4A 3O2FA 2XHXA 1Z5AA 4X9LA 4XC0A 5J71A 3ZM7A 2IWSA 2H8MA 5CPHA 4W7TA 1YSRA 2XDUA 3QDDA 1OSFA 4KQVA 2PNRA 1BKNA 3LNUA 2VCIA 4XE2A 1NHJA 5M4PA 1YT1A 4L8ZA 4R3MA 1YETA 1UYKA 1YSZA 1JM6A 1TC0A 3Q5KA 3ZXOA 2CH4A 5L3JA 5CTYA 4CWOA 5J6AA 4FCQA 1TIDA 1UY7A 2YKJA 4YKYA 5CTXA 1UYHA 3T2SA 4BIZA 4KTNA 4BQJA 3R91A 1B63A 2BREA 5FWKA 1AMWA 2FTKA 3A0XA 2YEIA 3B27A 3P32A 2YEDA 3GIGA 3G75A 2BU8A 4MTXA 4P7AA 4UROA 4XKOA 1THNA 4YKUA 4GT1A 4KSHA 3CRKA 5M4MA 1S14A 2BU7A 1YS3A 2H55A 2Q8IA 2GQPA 1I5AA 1Z59A 5BOCA 2YJXA 5FNCA 2YE4A 3R4MA 4PU9A 2IORA 3EKOA 3B28A 2YEEA 4FMTA 4BQGA 4JASA 4CE2A 5D7DA 2ZKJA 1F51A 4MT8A 2ZDYA 1YT0A 5F5RA 1H7SA 3VHAA 3D2RA 3VADA 4I3HA 3EKRA 4XDMA 3C11A 1UY6A 4O09A 3RLRA 4PRVA 4H81A 4L90A 4I5SA 3EHFA 1UY9A 2FWYA 3OWDA 1GKXA 2BRCA 1BXDA 2WI7A 2Q8FA 4HZ5A 3K97A 4CWTA 2FWZA 4E02A 2Q2EB 4XD8A 4CWNA 3EHGA 2YI0A 4HY1A 2QG2A 2YJWA 1I59A 4V25A 4XCJA 3CRLA 4LWEA 1BYQA 2YE3A 2QM8A 2BZ5A 3R4PA 3U2KA 1ZWHA 3A0YA 4V26A 3WHAA 4AS9A 2O1VA 4DZYA 2FXSA 2YK9A 4YKQA 1I5CA 1KIJA 2O1WA 4QPJA 4JAUA 1TILA 3A0TA 3FT8A 4ASGA 4B7PA 4EMVA 1Z5BA 2YK2A 5M4HA 3GIEA 5C93A 3R4NA 1QZRA 3ZXQA 3VHDA 2LFSA 2JKIA 4JYBA 2YE7A 3K60A 1YESA 4U93A 2WI6A 4HZ0A 3OMUA 2ZDXA 2WERA 4MB9A 4XITA 1QY8A 3B25A 1U0ZA 2CCUA 2E0AA 2YE8A 2ZBKB 3GIGB 1AJ6A 3A0ZA 4ASFA 4XIQA 2WI3A 5GGZA 2YE6A 4NH9A 3HYYA 1U2OA 1EI1A 2XABA 1IXMA 2HG1A 4E01A 3OW6A 2Q8HA 1ZXMA 3OPDA 4FCPA 4ZKIA 4XIPA 3TZ5A 4L93A 4WUBA 2YEFA 4XIRA 4P8OA 5IDMA 4EM7A 4LC1A 1TBWA 3MNRP 4AWOA 3KE6A 2C2AA 2CG9A 4L94A 3TUHA 4PL9A 2XD6A 1YC1A 1PVGA 1I5DA 4MPCA 4WUCA
chains in the Genus database with same CATH superfamily
4JQLA 3G7EA 4O0BA 1VIBA 2EILB 4XTJA 1R62A 3RGBA 1WN7A 4JI2B 4DR4B 3TZ0A 1BHBA 4GCZA 4U3JB 3J80N 3RN4A 3CE2A 1YTFD 4FZ1A 3ZRWB 2BTZA 4ZOLB 1YJWV 4LP0A 4LWHA 1JPXA 2K9PA 3T1YB 2HVJC 3WQ9A 2CH7B 2HVKC 3PJSK 4FPPA 2E75B 2WLIA 3ABMC 4HYOA 1IBMB 2XDLA 1K73W 4XKAA 1UYIA 1DF5A 4JI6O 3GB7C 1I94B 3ZN0A 1Y76A 1NHIA 3LNNA 1X4TA 2CDYA 4B3MO 4BXIA 4MW8A 4R3AA 3SGIA 5JVDA 1PNLA 1VMGA 1EA6A 1F23A 4YKWA 4UUJC 3NR7A 1MZFA 5EK0A 1SQVH 3APOA 3FAVA 4E72A 3UO3A 2OTJV 3E8GA 1XHXA 1KC8W 4GX2A 4UCVA 4LF7B 4OX9O 3CRQA 1JCHA 4C7UA 1VQ8V 1Y8OA 1AJPA 3JSNA 1FXKB 1HP8A 1VF5B 2BSMA 1YITV 1SESA 4KXRA 3W7XA 1Q43A 2IU3A 4WBNA 4OPAA 3QO7A 2CCSA 1VQ5V 1Q82W 2VWCA 3FKSG 5IJ0B 4UB6Z 4WCEV 3CC2V 4X1KA 1TH8A 1YIJV 1THZA 4PDMA 4L91A 3LDDA 2ZQMA 3B40A 2HCHA 1M57C 4GFNA 5GONA 1LR1A 4DK1A 2Q5ZA 3OFNG 3UT5B 2QF6A 1AILA 1XNRB 4AHCA 2WEQA 2JRIA 2WAMA 4XDKA 4LF8O 3CGZA 1YF2A 4I0XB 1W59A 4DV4O 4MVQA 5EC2C 4BR6A 4ABMA 3ZEDA 4NR1A 5AG2A 2R9IA 1VEWA 3B77A 2Y0PA 5BODA 1R1BA 3E2EA 3SL2A 4LPBA 3R4OA 4B3SB 2Q8VA 1EFRG 3E22A 3ZMTA 3CCUV 1PP9H 1IURA 4Q6GA 2Q8GA 2DOSA 2DQ0A 3FAVB 4P2ZA 4X89A 1HNWO 5CTUA 4B3SO 3BY6A 3R65A 4GLXA 2QA4V 3QG5A 2P90A 2EIMB 4NH8A 3K0DA 3JARA 1R6KA 1QU7A 5FNDA 4AWQA 3T1HB 4GKJB 1WA8B 1QNMA 4DR3O 4JI7B 2ZIMA 2YKEA 2YEVA 4EFBA 2IBZH 2X6CA 3HKCA 1EBOA 4WFFA 2P06A 3X2QB 4YHHO 1YTFB 1BHAA 1JFFA 4TSFG 4QGPA 3QTFA 2ZR2A 2R72A 2ZCEA 4N21A 5IDJA 2PYJA 3HZ1A 2X6BA 3KCYA 2AHYA 4XKKA 1XHZA 4KFGA 1GM7A 1K7DA 4J42A 4EGIA 2LP7A 2YS8A 3B26A 4O4HB 3K98A 5JQGB 1HR0O 4JI8B 2QWNB 1XMQO 2EBOA 2L35A 3WB1A 3CGYA 4PDVA 4K3AA 4NTYA 4KSGA 2XHTA 4O07A 1ENVA 2AZ0A 1OCRC 4I7ZB 2YI5A 3GIFA 1YSCA 1QVGU 1H2GA 5L3CA 3CC7V 4EGHA 4EEHA 1BCCH 3Q4HA 1FJGO 2YIBD 4QE9A 1TVKB 4MVUA 3RYIA 3ZRXA 1ORQC 4HAMA 4H0LB 2QTOA 1SETA 3T1KA 3M7MX 2DWDC 4CS4A 1QYEA 3WFVA 1L8DA 2YEJA 5FNVB 3D36C 2YEVB 3UT5A 4J7KA 4BIOA 3U67A 1AH8A 5CN0A 1N33B 4X66B 4PD4F 1Y74B 3FB6C 5D7RA 2QKAA 1D5AA 3A0WA 5IYZB 1E1RG 1XOUA 5M4NA 2KG7B 1OCZB 4YJ3A 1PPJH 2ZM6O 3H1IH 1QVFU 1UYMA 5LXTA 3TZ4A 2E5LB 4YKTA 1Q6IA 5CA1A 5GW7A 1K92A 2NNUA 5LOVB 2ITCC 4PI0A 1K5SA 3RYCA 2UUAB 4DV5O 2XHXA 1S5JA 1K3EA 3R66A 4X9LA 4XC0A 3K5LA 3QTCA 1N32B 3ZM7A 4W7TA 1YSRA 3H1LH 5JCOC 4GKKB 4GYCB 4KQVA 3JD0A 3M99B 2ZINA 2AW9A 4PELA 1YETA 4R50A 1YSZA 1BMFG 4RUEA 3O65A 4TUYB 3Q5KA 1XREA 3JAWB 3O9OA 3UCSC 3CCLV 2WLMA 3K0GA 2FB5A 5CTXA 1WP7A 3OE7G 4O2AA 2OTLV 1E79G 4B7EA 1AJNA 5FWKA 3GVMA 3WG7B 2RDCA 1UFIA 4LNUB 5IJ9A 1MOFA 3GIGA 1Q8IA 2BU8A 3G75A 2WLJA 4UROA 4XKOA 1THNA 1R6TA 3CRKA 1V55C 2ADPA 4NXMO 1N0NA 2YXYA 2Z3YA 1WB8A 3J81N 3UM7A 2GQPA 4KUMA 5CBHA 2EJRA 1TUBA 1DTOA 4FM1A 1NJIW 1HNZO 5LP6B 2X6AA 1KECA 5H5NA 5HFMA 4BQGA 4CE2A 4MT8A 1FYJA 2IJHA 2ZDYA 4R7CA 3ETGA 4NXNB 4I3HA 2CTRA 1UY6A 4O09A 4YIOA 4DV3B 3RLRA 4PRVA 4H81A 4I5SA 2JIZG 2FWYA 3H1KH 3K79A 3OWDA 3K9SA 2PGGA 4HZ5A 2B1GA 3K97A 1YXBA 3OR6C 1NVPD 4IGGA 2Q2EB 3JD1A 4KFMA 3VBBA 3W7UA 4AQYO 3N2KA 1ZLZA 4LCUC 1VQ9V 4TQFA 5H6RA 2H94A 1CPYA 4QIWF 1BYQA 1AB3A 4O2AB 2YE3A 5TISZ 3JASA 3CP1A 5B5EZ 1GM9A 4V26A 4ICGA 2O1VA 3E8HA 1RM1C 3F5TA 4YKQA 2O1WA 1SZTA 4R8CA 4IL6Z 4ASGA 4B7PA 1AR5A 1TUBB 4RQEA 3EHBB 4D7SA 2A0LA 5JQGA 1QZRA 4J7ZA 1N0JA 1CP9A 3H9VA 3ZXQA 2JKIA 4JYBA 4FLWA 3K60A 1GTOA 2WI6A 2PI5A 3IC7A 1MNGA 4HZ0A 3TXQA 4EB6A 2MW2B 3JCZA 4XITA 2CCUA 4UVBA 5IWAO 2ZBKB 3GIGB 2QKCA 4DV7O 4DR5B 2FL4A 5J2UB 5CB4B 3SJBC 2JEUA 2ZIOA 1OCCB 1U2OA 2XABA 1PL4A 3BCCH 4E01A 5K1PA 1SQXH 4YY3B 1FFXA 5DEDA 3D8CA 2AGAA 4O2BB 4JI2O 1I08A 4GX5A 2N05A 1WPBA 4DO2A 3TZ5A 4L93A 2DW4A 4DW1A 3JAKB 2YEFA 5LHHA 5IDMA 2GUZA 3CCSV 3MNRP 2NN4A 3A8TA 1Y67A 2C2AA 2OIGA 2CG9A 3JSLA 3L71H 4LFAB 3E8FA 3FB8C 2DYRB 2ZNJA 1RP3B 5LP6A 1TAEA 1OHHG 1Y74A 3FD9A 2FYPA 2Q7GA 2BT0A 4U7NA 4JI5O 1M5IA 1ZL8A 1I94O 3U2DA 2CAZC 3MHHC 3ABLC 5B1OA 1I0HA 4F4LA 1F4NA 1JJOA 2XX2A 2KG7A 4QJFB 3C0EA 1AP5A 3E83A 3DGEA 4TQDA 3N2GB 1GAXA 4GEEA 3EHHA 1US6A 1XNQO 4JTDB 3OEEG 4IYHA 4CWPA 1BGYH 3AG1C 3R92A 3I56V 2PZSA 4DUYB 2EIJB 3K58A 1Q90D 1V54C 1IBLB 2EZOA 3HKDB 4LFBO 1XILA 2F93B 1YDXA 4O4JB 3N2KB 2F23A 5KX5A 1R3LC 3QO5A 1QHTA 2EJ7A 3SJAC 5IE9A 4XBFA 3TZ2A 2IWUA 4FLZA 3GWKC 1WP8A 1DF4A 2H8PC 2OYQA 3O0IA 5KA5A 2MK3A 2OWOA 3JAMN 1KZNA 4X62B 3BPZA 2YIAA 1WB7A 5EC1C 4LNUA 5IJ9B 2CGFA 1TGOA 4CE1A 3I55V 1N36B 4FCRA 3HKBB 3JATA 1XQ8A 5DM6V 4W4LA 1F7YA 2C1GA 4TV8B 4JI3B 2PTMA 1GRJA 1W2BU 2QM4A 2B1IA 3L74H 1N36O 5KMGB 4O2BA 1I58A 1KU9A 4LWFA 4DV2O 1K4CC 2JS5A 4MP2A 4HYPA 2W0FC 1OCOB 4OPHA 2YGEA 2DQ3A 1U97A 2PY5A 5E79Z 2Q7EA 5JENA 4TWKA 3CD6V 1XMOO 2FMLA 5LYJB 3E89A 1QLEB 3NMQA 2HP8A 4HYMA 4JZGA 4O4LA 4HXWA 4FFBA 1TC6A 5ITZB 4UXNA 1KKCA 3STZC 1IZ3A 3IFXA 4K8XA 4OGQB 1L0NH 2XAQA 1VQMV 1QBZA 1ZUQA 4MVMA 2IOPA 1JQ0A 3AEIA 2B9ZA 5BZBA 3JAWA 3BA9A 3ZMUA 1JJ2U 2RMKB 3RYFB 2EXLA 4AWPA 4LWSB 1GKZA 4P9PA 2HKOA 1SC5B 2ESAA 1AM1A 2BU5A 3JALA 3CRAA 4HY6A 1VQ6V 4QPKA 1GJVA 2YGFA 1M57B 1AP6A 4X1YA 4JI1O 2UU9O 3BM9A 2Y0IA 3OGCC 4PA9A 1SERA 1NTKH 4URLA 2Q67A 3FB7C 1AI4A 4X8AA 4E00A 2EINB 4CBCA 4IIJB 1EZJA 5FL7G 4PRXA 5EYPA 4HNAA 2LGQA 1KMIZ 2XJJA 4GGLA 2A7WA 2WWWA 5EZYB 3WU2Z 2F66C 2XASA 4B3RO 1M90W 4JI7O 1SA0B 1I5BA 4JI3O 4GUNA 3MDSA 1S5HC 1A32A 4FFBB 3TTZA 5J2TB 5L3GA 2M7WA 5CA3A 2ZT9B 4DV2B 4ASAA 4CH5A 2Q73A 2OIEA 3TCUA 3TGUH 5D6PA 1P84F 4G27B 2K5BA 3B8MA 4HBNA 3ABMB 2QM7A 3SYQA 4DUZB 5BMVA 2BU2A 2UUAO 3LSSA 5FNFA 3AG7A 1BQZA 2IWXA 4X66O 4DV0B 3CCRV 5IYDO 1YC3A 3FX7A 1MSWD 2UWDA 4RWUA 5LYJA 4RAIA 4KP4A 1F4MA 3ABKB 4MP7A 3OEHG 2YECA 1H2SB 4MS2A 4DV1O 1S76D 3LMMA 2WI2A 4CWSA 1S3JA 4NH7A 3OUFA 2WPDG 4FZ0A 2XCMA 2EILC 5D7CA 4MSWC 1JA8A 2LW7A 4FLXA 4F6RA 1Q3EA 3JARB 3S3WA 3CMEV 3QO8A 1HNXB 3KKYA 4YJ3B 2XDSA 1KYOF 2UU9B 2VCJA 5BY1A 4W4KA 1K5QA 1UYCA 1LUWA 3SJQC 1GO3F 4I0XA 3ZRVA 4UV8A 5KHGA 3EFFK 3ZS8C 2CGNA 4ASBA 4X1IA 3VQYA 1MZEA 3O2FA 1Z5AA 3E35A 4FLYA 1MSDA 1OCCC 5J71A 3LDCA 1VQNV 4X65B 1Q81W 1RSOB 1XEQA 5B3SB 5D5QA 2H8MA 2XDUA 1H2LA 1BKNA 2VCIA 1NHJA 1YT1A 4L8ZA 2ZD9A 4I50B 1AR4A 1IVSA 4R3MA 1UYKA 2LGWA 4X65O 5B1BB 1AVMA 2D3OW 1O9HA 4WBNB 3ZXOA 5CA0A 3CCJV 4NVPA 4JPRA 3ZRSA 3ZIAG 5J6AA 3P3NA 2JJ2G 1P7GA 3HR0A 5EBMC 2YKJA 1G1XB 1UYHA 1K8AW 1MABG 4BIZA 4KTNA 1V9PA 3R91A 2HHHB 1GKFA 4MVZA 4MVSA 4LF5B 1NR7A 2YC0A 5LA6B 1Z5VA 2YEIA 3B27A 4D6TH 4P7AA 1L0LH 2YICA 4DYLA 3K5NA 4KSHA 3OTFA 1OCZC 5EBWC 3SR2C 1ZL8B 2YI8A 1BT8A 3LUTB 2JEXA 2Q8IA 4DR7O 3ZMZA 1Z59A 5BOCA 1LNQA 4PDRA 5FNCA 4L8JA 1AR1B 3B28A 2R9RB 1W0KG 1NT2B 2YEEA 4I55A 4JV5B 3QF7A 2ZKJA 1KB9F 2KSDA 1VF6C 2PF4E 5KAIZ 5F5RA 3CWBH 1H7SA 1R3JC 4XDMA 1L1FA 3F7VC 5IYZA 4BW5A 1NKDA 4L90A 3ASNC 3DXRB 3EHFA 5EBLC 1UY9A 4F6RB 3CB2A 3RVYA 1M9NA 1YHQV 5CA1B 2BRCA 1BXDA 2WI7A 4LF4B 4X64O 2A3QA 4RO2A 4CWTA 2QWPB 4JAAA 1R6NA 4FVMA 4JF3A 4CH6A 5EYPB 5IY5B 4XD8A 2YI0A 4CZZA 3G80A 4MTGA 3BFRA 4XCJA 1AI7A 4LWEA 3ABLB 2X0LA 4XDLA 4JYAB 5FPRA 4UCUA 5K1XA 4YY3O 3HKDA 2V4DA 3R4PA 3U2KA 1ZWHA 1HNZB 3CMAV 3A0HZ 2Q9LA 2ZKOA 1JMKC 3JCUZ 1I5CA 2HEPA 1AI6A 3RYHB 2DYRC 1M56C 4JAUA 1IBMO 1I5XA 1QLNA 4EMVA 5GTIZ 2P22C 4DV3O 3GIEA 3UKMA 2E74B 2YI9A 1FXVA 4DV6O 5LOVA 2LFSA 4JGSA 4JI5B 3DSQA 3ZX6A 4Z2WA 3OMUA 2WERA 3DC6A 4KHPB 4ZIBA 1QY8A 3B25A 2EIMC 4PHZA 2HG5C 1AJ6A 5CA0B 4ASFA 3SPHA 4LF7O 4KL1A 1QR8A 3L70H 4MTOA 1HW7A 2L6LA 1Z5WA 2WI3A 3RWRD 3FB5C 1JR9A 4AILC 4NH9A 1QQCA 1EI1A 4DUYO 1YVWA 5FNVA 2LQTA 5KHKA 4A5UB 4PJ0Z 1Q7YW 1N34O 4PA6A 1DK1A 4ZKIA 4FCPA 4LFBB 1MA1A 2VS0A 2P7TC 4O4LB 4P8OA 3K3WA 1NTZH 1ROPA 4AWOA 4H13B 4L94A 4WFEA 4X64B 1XNRO 1YC1A 1KP2A 4LF6B 1PVGA 2GTSA 2CTWA 4J7JA 3HPLC 4WUCA 2BOBC 4TT3G 4BAEA 2YXLA 3OTOB 4GT8A 5KLVH 3ZHQA 2VWJA 4IHJA 1US7A 4F6EA 3OR7C 4JTCB 2LO1A 2ILMA 3KCXA 5BR8B 3INXA 4HNAB 5JH7A 1H2NA 3JZ3A 1MG1A 3VHCA 4LFCB 2VQEB 1K34A 2DYSB 4K0KO 4CE3A 2VWKA 2W6IG 3T0HA 1PKXA 1K97A 5DN6G 4B3MB 2RNBA 3JYCA 3BVOA 3K5MA 3BMYA 3K06A 1EN5A 1VF7A 2BYIA 2R9AA 1Y8PA 3SYCA 2QFOA 2WEPA 4B6CA 3K99A 4EFUA 4ZBMA 3RT3C 1H8EG 3BEHA 1XNQB 1R3KC 2CGOA 3K9AA 1S16A 3Q5JA 4QE7A 3WB2A 2JGUA 4KHPO 1YI2V 2YI6A 5KHIA 1ZW9A 3INWA 1KQSU 3RYCB 1WLEA 3H4LA 2O57A 3CYOA 2CTPA 2PUSA 2WA3A 4YKXA 1XBLA 3WB0A 3CCQV 3P30A 2P6JA 1MX0A 5JWPA 4OX9B 2YKBA 4FJCC 1YJNV 3Q5LA 1L0OA 3SYPA 1N34B 1YERA 1X59A 2BTOA 1Y4MA 2ZE7A 5BXZA 3ZKDA 3ZHRA 2VRZA 2UXDO 4LBEC 4G28B 1PV0A 2Z0AA 4X62O 1BS3A 1DGSA 2YEGA 4YKRA 2XJGA 3OWBA 4K8ZA 5JVDB 5KHJA 4HXZA 1SF9A 2XK2A 1H8HG 4Q20A 3OW2U 2BTQB 1XUQA 2AKPA 3OMNB 3L75H 4GZRB 1YT2A 2Q7HA 3T4ZA 3BRCA 1AROP 3B24A 3L9DA 3IEDA 2F4VB 3OMAB 4B3RB 2DWEC 4FLVA 4UV9A 4WFAV 1XDCA 3CJHB 4E4EA 3OD4A 4J10A 4LH7A 4Z1MG 1AH6A 4PA3A 4LP8A 2E3CA 3C90A 3E86A 1YC4A 2RN9A 4J11A 2DMXA 2YKIA 4P9OA 5IN9A 1VQKV 3GWOA 2HKJA 4LWIA 3HYZA 3AK3A 3RLPA 3TJTA 2CUGA 3W7WA 2EX3A 1J5EB 2XX4A 4CWRA 4ZVIA 5KAFZ 2QTSA 1NH2B 4K4OA 3T4DA 4IT5A 3M8AA 2D2CB 4EGKA 4DUHA 2P4KA 3ZHVA 3CC4V 1KBHA 3ETEA 2WI5A 4I50A 4CC5A 1EM1A 1EN4A 4CH4A 1XMOB 1M1KW 4MBCA 3G4SV 3SPJA 4DR2B 2HR3A 1QR9A 2F1MA 3RYIB 5KHHA 1S77D 1M93A 3BHPA 3ZHSA 4YHHB 4EEQA 5D5PA 2YE5A 4ASUG 5CF0A 3A2FA 4DV0O 5C8YB 1W0JG 3HHUA 3CRCA 3ZRWA 2YE2A 1BL8A 2IOQA 4GX1A 5EIBC 3D3QA 3CX5F 2R70A 4L87A 3MD0A 1JX9A 1HR0B 1ID0A 1UYDA 1JVMA 2XAFA 1AJQA 2GUZB 2WI1A 4PDLA 4JI4B 1XL4A 4EB6B 4YKZA 1S5LZ 5DECA 3H80A 4H7QA 3K5OA 3SJCC 1UYLA 2BU6A 4FFKA 5IY5C 2KB1A 2VW5A 3BA8A 3JD4A 1LUVA 4RUFA 1EN6A 2GSMB 2WLNA 2LFRA 3WG7C 3H01A 5A9GA 2Y4TA 2BTQA 1S72V 1B3QA 1MU5A 3IAYA 3W7SA 1N4CA 1KD1W 2F4VO 2YEBA 4BWAA 2YGAA 4J80A 4GQTA 4QNHB 1JOYA 4JYCA 5M4KA 2CTQA 1FXKA 4CWQA 3F5WC 2QWRB 1HNWB 4EFTA 2WLLB 1UYFA 1KKDA 3CJHA 3PEJA 1Z5CA 1Y4SA 3CRMA 5HFLA 3UQ8A 4ZOLA 2JVDA 1V54B 4UB8Z 5IT9N 1ZXNA 2Y69C 5CBFA 5LMUB 1H38A 3AG1B 2JGDB 4DR3B 2EZPA 4DRXB 1A4HA 1VARA 3K03A 1FFTB 3NXSA 4IIJA 2YEAA 4MPEA 2WI4A 1RSOA 5B66Z 4DR7B 2YDEA 4CS3A 2HHHO 5CPHA 3ASOC 1UPGA 4EFEA 3QDDA 1OSFA 2B5UA 2XHBA 4XE2A 5B1AB 5M4PA 4X9QA 4PI2A 3RFRA 1P4RA 1SQQH 3BABA 2W6JG 5KUMA 2IW5A 4JI8O 1TC0A 5CMUA 2CE4A 5LGUA 2V1DA 3RYFA 4B3TO 3HKBA 5B1AC 2CH4A 5CTYA 1YZBA 4PV1B 5B3SC 4YKYA 1IBKB 1IDSA 3T2SA 4LF4O 1XI1A 5JCOA 2LJ2A 1HNXO 3TXSA 3CXCU 1IBKO 2YEDA 2BCCH 5KX5B 4YKUA 3ETQA 5FLXN 2YSUB 2BU7A 3AG4B 3T1CA 2H55A 3D3IA 1KUQA 5LMNB 1Y76B 2QDOA 1SKVA 1I5AA 4RQFA 1S0VA 2QKSA 2YJXA 2XAJA 3R4MA 4I4TB 4PU9A 2AHZA 2PYLA 3EKOA 4X1YB 1ZX3A 2NR5A 2V7QG 4LF5O 4FM2A 2XNDG 2P4VA 4JASA 3ZN1A 5IJ0A 1F51A 2CK3G 4UVCA 1YT0A 3G6EV 4JI0B 1B06A 3EKRA 5LGNA 3N27A 2CH7A 4IHJB 5LHIA 2ATKC 3LSQA 3JALB 3K08A 4OXSA 1GKXA 1NVPB 1XL6A 2DJVA 4X1IB 2QWQB 3OUSA 4LFAO 2FWZA 1ZSPA 4X1KB 1NU1H 4R6ZA 4E02A 4I9WA 4YXWG 2JGDA 2Y4UA 1YJ9V 2X7RB 4HY1A 2QG2A 2YJWA 2ITDC 3K59A 2YIBA 3G67A 2WLKA 2JDIG 2A9HA 2WLLA 2WLHA 3AG2C 4DV6B 4O4HA 2QM8A 3ZMVA 4AQYB 3CSXA 4H37A 3A0YA 3WHAA 3EXAA 4AS9A 2JK5C 4DR1O 1NH2D 4LF9B 2ZDIC 2K1EA 4BW9A 1PNMA 4JV5O 3ETDA 1I7FA 4YIPA 1RPRA 1ZWIC 1TILA 2Q68A 3A0TA 2XT9A 3JAKA 3FT8A 4LWSA 4MTFA 3CHXA 2YK2A 3SYAA 1WA8A 3ML0A 3E22B 4JYAO 3UO2A 3VHDA 4DV7B 1P7BA 2YE7A 2G38A 1YESA 4U93A 5IYBO 3C3SA 1GH6A 2HLDG 4DR4O 3KG2A 2ZXWC 2FYUH 4GX0A 2PI4A 1HDJA 2ZDXA 4U3FH 5BR8O 1YCIA 3U11A 1RM1B 1U0ZA 3A0ZA 4XIQA 4WF9V 2IH1C 3ZMSA 1CEZA 2YUAA 5GGZA 2YE6A 3HB3B 2UUBB 3HYYA 3Q4HB 1IXMA 3CCVV 3DC5A 3OW6A 2Q8HA 1ZXMA 3CS5A 3OPDA 3S3XA 4B7KA 4FIPC 1FKAO 3LDEA 1COWG 2ZE8A 4EM7A 1SRYA 4LC1A 3RVZA 5JJNB 3KE6A 4K0KB 2HJFC 5J2TA 2VQFO 3FFQA 4O4JA 3TUHA 1OV9A 1I5DA 3SDLA 4MPCA 1OCOC 2XX5A 4CS2A 2ADQB 4NB5A 4JZ2A 3HKEB 1UYGA 1GN6A 1SQFA 1GM8A 1NTMH 2AXTZ 5EZYA 2EIKC 1NR1A 3CCMV 4O04A 1OZ0A 1UYEA 1VF6A 3K04A 1GK9A 3OMIB 4O05A 4TUYA 2Z5UA 4PA4A 2YXHA 4DR1B 3P3PA 3AG3C 1FD9A 3HEKA 4MOTA 3FYEB 2W0XA 3AG3B 2LW1A 3CCEV 3CPWU 3OTOO 2A79B 3DXRA 2DN9A 2YE9A 2YI7A 2Q6AA 5BMVB 3ASNB 2GFDA 5B1NA 1Y4UA 2YKCA 1GMGA 3G7BA 3B2EE 1IBLO 4LH6A 2M6YA 3OM3B 3MHSC 5LA6A 1K9MW 2KKWA 4TV9B 5KA6A 3CYGA 4LF6O 2BSKB 2UXXA 5JJJB 4N23A 3ABTA 5IWAB 5C8YA 5JJEB 3ZJZA 4UFZA 4DR5O 5F3KA 3F7YC 4YJ2B 3THOA 3TK1A 3C3TA 2EIJC 1VP7A 1WPXA 2Q4PA 4UCOA 2ARHA 3A0RA 4FK5C 3IC9A 2ZNIA 4CWFA 3QNEA 1GN2A 4NKGB 4XDJA 4P30A 2ZE5A 4LFCO 2N04A 2DYSC 4O4IA 3BAAA 4EKWA 3FYIB 1K33A 1I5YA 4G2KA 2RCVA 1VQPV 3VQXA 2GBOA 2EIKB 3G6BA 3D36A 1IX9A 2XHRA 3T1HO 1PL0A 3J7AU 3L72H 2FKXA 4DW0A 4JI6B 5E1AC 3B4SA 2OCCC 5LGTA 3EVKA 3PEHA 3APQA 3CWVA 5H6QA 4H85A 5LXTB 2UXBO 3LPSA 2XUMA 5LL6Y 3JASB 1GN3A 3CXHF 3HKEA 4MVRA 3OT7A 4J9ZB 1G6UA 4FLUA 3FT5A 3VOUA 1UY8A 2CCTA 4MW3A 5J2UA 4DRXA 2N74A 5M4EA 3SPGA 2BSKA 4JI1B 4DR2O 4H33A 4DV4B 1CXZB 2OCCB 3B8NA 1NI8A 2Y69B 3AG2B 3ZBHA 1UJWB 4LR3A 1T5EA 2UUCB 4WUDA 1SQGA 1BSMA 2BOCC 2XDXA 4WFHA 4R1FA 3K57A 1HWYA 2WLIB 1FJGB 2JJCA 4DXWA 3T0ZA 4LF8B 1B6QA 1E1QG 1N8RW 2UUCO 1Z2GA 3EHJA 5LHGA 1D5NA 3HKCB 3D0BA 5CTWA 3ABUA 4UCSA 5A2QN 2RJZA 5JH7B 4JI4O 4URNA 5L3EA 2XAHA 1NHHA 1G4YB 1FPOA 3ZCCA 1B62A 1B04A 3CEIA 1J5EO 4YJ2A 3IJ4A 3H1JH 1Q5OA 2ZDIA 2DE0X 4TOIA 2KQXA 3N2GA 2Y48A 4TV9A 4DUZO 2BE3A 5IYCO 3ZKBA 2XJXA 4WFGA 4LWGA 4Z1VA 3RW0A 1VQ7V 5J9PC 2O1UA 3H1HH 1SQBH 4UVAA 2GV9A 1H7UA 3O6OA 2GHYA 5D6QA 3U10A 1YEWA 3I5DA 4GKJO 2NLJC 3CRRA 2UXBB 4MPNA 4URMA 1N32O 4PA7A 1XMQB 4E2LA 4XCLA 3RKZA 3RLQA 2UXNA 4JAVA 4O4IB 5LMUO 1Y8NA 2ZM6B 3G71V 2EINC 4B3TB 1FFXB 1P49A 2IJIA 2JS3A 1SA0A 5KUKA 4DV1B 4NTWA 1EZVH 3STLC 1BQ0A 1RFYA 2IJJA 4BIUA 4FLTA 3HZ5A 1PD3A 2P67A 3T10A 2XDKA 4UCRA 1BGQA 1GN4A 3AK2A 4GKKO 5L3DA 5CB4A 2BYHA 3AG4C 1H2KA 1URFA 2UXCB 5H2FZ 2GTAA 2XAGA 1WNSA 4U7OA 2QG0A 3A0BZ 1ZAUA 4ZHQA 1J95A 3FV5A 2A06H 2F95B 1D2DA 2YEHA 1O9GA 4X88A 1N33O 2IWSA 1SZXA 1TUEB 3DTUB 2E76B 1G8MA 3RBZA 1M4UA 3OGIB 2PNRA 3LNUA 3W7TA 5L3FA 4TV8A 1FXHA 4I55B 4JI0O 1NBMG 1JM6A 3IGAC 5L3JA 1MMMA 1PNKA 4CWOA 5KMGA 4FCQA 2JJ1G 1U96A 2QWOB 1TIDA 1UY7A 2H3OA 4BQJA 3ZHTA 4UCTA 2XTAA 1B63A 2BREA 1AMWA 3ZHUA 2FTKA 2RQ6A 3A0XA 5L3BA 4NYKA 1WAZA 3P32A 2YIDA 4MTXA 2IU0A 4NXNO 4GT1A 2E5LO 5M4MA 2WSSG 4B08A 1S14A 2IM9A 3KZIZ 1YS3A 4I4TA 3LNMB 2QE7G 2QGNA 2IH3C 2IJKA 4DV5B 1FXKC 4X20A 3VQWA 1OCRB 4ZI7B 1RPOA 2HJDA 2AZ2A 2YE4A 4J41A 1FS0G 2IORA 4LF9O 4FMTA 1VQ4V 1VQLV 1NQTA 4D7TA 4WFBV 5D7DA 5CBGA 1IXBA 2C1IA 3RYHA 2QR4A 3VHAA 3D2RA 3VADA 3C11A 3ABKC 5F2VO 4BAYA 1BE3H 2UXCO 2GDSA 4MVOA 5LMNO 3AK1A 2OT5A 4DR6O 2Q8FA 3JATB 1H2MA 3X2QC 2HFEC 3JD3A 3SPCA 4CWNA 3EHGA 2ODMA 5ITZA 1BZKA 1I59A 4DR6B 1KP3A 4V25A 1DLBA 1TVKA 5LP6C 3CRLA 1SQPH 4NXMB 1R73A 3PN1A 5EIBD 3JD2A 3S5TA 2BZ5A 4HZ3A 1Y66A 2QSAA 3QVNA 2VQEO 2ETNA 1V55B 1OJHA 3U0ZA 4DZYA 2Q0OC 4NTXA 2FXSA 2YK9A 4ZHQB 1KIJA 3T1YO 1VQOV 4QPJA 1SS3A 3VQVA 1JFFB 4U3JA 1Z5BA 2UUBO 2QEXV 5M4HA 3B09A 4FM0A 5C93A 2QJ1A 3R4NA 4DK0A 3TETA 3MAQA 1WJZA 4I9QA 4AI8A 5LBQA 1QLEC 2ZR3A 5H9CA 1Y6XA 3ICXA 5B1BC 2F43G 4H44B 4MB9A 4IYIA 2WA4A 2HHIA 2E0AA 2YE8A 1NS1A 3OAAG 4JTAB 2VQFB 4J9YB 4CH3A 3ASOB 2P5OA 1NZ6A 2ZE6A 1Q6HA 2HG1A 2ZXWB 3LSUA 1QCEA 4ZI7A 1Q86W 5GONB 3E8BA 1K4DC 3SYOA 2EULA 4XIPA 3T2MA 1AI5A 2Q69A 1TA8A 4WUBA 4XIRA 2Q0AA 2OCHA 1TBWA 2UXDB 1Q6UA 1R3IC 2XOKG 1ZTEA 4CC6A 3SPIA 1PM9A 4PL9A 4K35A 2XD6A 1M56B 4JYYA 5GTHZ 4X20B 5FPOA 1FAFA 3L73H
chains in the Genus database with same CATH topology
2BOBC 1OCOC 4TT3G 2XX5A 2Q8IA 4JQLA 4BAEA 1OHHG 3G7EA 4GT8A 4O0BA 2EILB 2FYPA 1UYGA 4XTJA 1R62A 1US7A 4U7NA 2BT0A 3OR7C 4JTCB 1GM8A 1BHBA 3TZ0A 3U2DA 2EIKC 1NR1A 3CCMV 3Q5LA 4O04A 3INXA 3MHHC 4GCZA 3T0ZA 3ABLC 1OZ0A 5B1OA 4F4LA 1F4NA 1UYEA 2XX2A 3K04A 4QJFB 3C0EA 3JZ3A 3E83A 1MG1A 1GK9A 3DGEA 1YTFD 3VHCA 3OMIB 4O05A 4GEEA 1K34A 2Z5UA 2DYSB 4PA4A 3EHHA 3ZRWB 2BTZA 3AG3C 4JTDB 1YJWV 4LP0A 4LWHA 3HEKA 4CE3A 3OEEG 1JPXA 4CWPA 4MOTA 3FYEB 3AG1C 4XE2A 3R92A 3I56V 2W6IG 3T0HA 1PKXA 1K97A 5DN6G 2HVJC 3WQ9A 3JYCA 2EIJB 2HVKC 3AG3B 3PJSK 4FPPA 2WLIA 3ABMC 4HYOA 1V54C 3CPWU 3CCEV 2EZOA 2A79B 1K73W 2YE9A 3BMYA 2YI7A 3K06A 4XKAA 1UYIA 1DF5A 2Q6AA 3RKZA 3GB7C 2BYIA 3ASNB 3ZN0A 1NHIA 2GFDA 1Y8PA 3SYCA 2QFOA 2WEPA 4BXIA 5B1NA 4MW8A 4B6CA 1Y4UA 2YKCA 3K99A 1GMGA 3G7BA 4R3AA 4EFUA 4ZBMA 1R3LC 3QO5A 1PNLA 3OM3B 1H8EG 3MHSC 3BEHA 1K9MW 1EA6A 5KA6A 1F23A 1R3KC 3K9AA 4UUJC 4XBFA 1S16A 5EK0A 4QE7A 2IWUA 3Q5JA 4YKWA 3TZ2A 1DF4A 2UXXA 2OTJV 3E8GA 4N23A 1YI2V 2H8PC 3ABTA 1KC8W 3O0IA 4GX2A 2MK3A 5KA5A 2YI6A 3ZJZA 1KZNA 1ZW9A 3INWA 1JCHA 1KQSU 5F3KA 1VQ8V 1Y8OA 3F7YC 1AJPA 3TK1A 1WLEA 3H4LA 1FXKB 2EIJC 5EC1C 1WPXA 3CYOA 2BSMA 3A0RA 4FK5C 1YITV 4CWFA 3QNEA 1SESA 4YKXA 2CGFA 3W7XA 4XDJA 4CE1A 3CCQV 3P30A 2P6JA 4P30A 3I55V 1MX0A 4FCRA 2YKBA 2IU3A 4FJCC 3QO7A 1YJNV 2CCSA 1VQ5V 2DYSC 1Q82W 3SYPA 5DM6V 3FKSG 1L0OA 4WCEV 3CC2V 1YERA 1TH8A 4EKWA 3FYIB 1YIJV 1K33A 1I5YA 1THZA 4PDMA 1Y4MA 1W2BU 4G2KA 2B1IA 1VQPV 4L91A 3ZKDA 3LDDA 2ZQMA 2HCHA 2EIKB 1M57C 4GFNA 4LBEC 3D36A 4G28B 2XHRA 1I58A 1PL0A 4LWFA 2YEGA 1K4CC 3OFNG 2QF6A 4YKRA 4MP2A 5E1AC 2XJGA 4HYPA 3OWBA 2OCCC 2W0FC 1OCOB 2YGEA 2DQ3A 2WEQA 4HXZA 2WAMA 4XDKA 2XK2A 5LGTA 1H8HG 4Q20A 3OW2U 4TWKA 3CD6V 2XDLA 3CGZA 3PEHA 3CWVA 3E89A 5H6QA 1QLEB 4H85A 2AKPA 3NMQA 4HYMA 3OMNB 3LPSA 4HXWA 1YT2A 4MVQA 5EC2C 3T4ZA 1TC6A 4UXNA 3STZC 3IFXA 5IDMA 1AROP 2R9IA 3B77A 3B24A 2XAQA 5BODA 1VQMV 4MVRA 3IEDA 4J9ZB 1QBZA 3OMAB 4MVMA 3E2EA 2DWEC 3R4OA 4LPBA 3SL2A 4UV9A 3FT5A 1EFRG 4WFAV 2IOPA 1JQ0A 3VOUA 3ZMTA 1UY8A 3CCUV 2CCTA 3AEIA 4MW3A 4Z1MG 5BZBA 1AH6A 2Q8GA 4PA3A 4LP8A 2DQ0A 5M4EA 3SPGA 3E86A 4P2ZA 3ZMUA 4H33A 4X89A 1JJ2U 5CTUA 2EXLA 4AWPA 1GKZA 1YC4A 4P9PA 2HKOA 3BY6A 3R65A 2ESAA 2YKIA 2OCCB 3B8NA 4P9OA 2QA4V 1VQKV 3GWOA 1AM1A 2BU5A 2HKJA 2Y69B 5IN9A 2P90A 2EIMB 4NH8A 3AG2B 3HYZA 4LWIA 4HY6A 3ZKBA 1VQ6V 3RLPA 3K0DA 4QPKA 1UJWB 3W7WA 1GJVA 1R6KA 2YGFA 5FNDA 1M57B 2XX4A 4AWQA 4CWRA 4ZVIA 3BM9A 3OGCC 1NH2B 4WUDA 4K4OA 4PA9A 3T4DA 2BOCC 2XDXA 1SERA 2YEVA 4WFHA 2YKEA 4EGKA 4URLA 4R1FA 4DUHA 1HWYA 2WLIB 3CC4V 2X6CA 3ETEA 4DXWA 2JJCA 2Q67A 2WI5A 3FB7C 1AI4A 1EBOA 4WFFA 4X8AA 1B6QA 3X2QB 1E1QG 1YTFB 1N8RW 1BHAA 4TSFG 1M1KW 4E00A 3QTFA 2EINB 2ZR2A 3G4SV 3EHJA 4CBCA 3SPJA 1EZJA 5LHGA 2HR3A 5FL7G 3D0BA 1QR9A 5CTWA 3ABUA 4PRXA 4N21A 5IDJA 4URNA 5L3EA 3HZ1A 2X6BA 2XAHA 1NHHA 1S77D 1G4YB 2AHYA 4XKKA 3ZCCA 1B62A 2XJJA 4GGLA 4KFGA 1GM7A 1K7DA 4EGIA 2WWWA 2YE5A 2LP7A 4ASUG 3B26A 2XASA 5CF0A 1M90W 3K98A 1I5BA 2ZDIA 2EBOA 1S5HC 1W0JG 2Y48A 3HHUA 3ZRWA 3CGYA 2YE2A 4PDVA 1BL8A 2IOQA 4GX1A 4KSGA 3TTZA 5L3GA 2M7WA 4L87A 5CA3A 4ASAA 3MD0A 5IYCO 2XHTA 1JX9A 4WFGA 2XJXA 1ID0A 3TCUA 1JVMA 2XAFA 1AJQA 1UYDA 2WI1A 3RW0A 4G27B 4PDLA 5J9PC 1XL4A 1VQ7V 2O1UA 4O07A 4YKZA 1ENVA 3H80A 2K5BA 1OCRC 3B8MA 4H7QA 4UVAA 1H7UA 3ABMB 1UYLA 2GHYA 3O6OA 2QM7A 5D6QA 3SYQA 2BU6A 2YI5A 5IY5C 2KB1A 1YSCA 3JD4A 1QVGU 2BU2A 3LSSA 2VW5A 4RUFA 3GIFA 5FNFA 1H2GA 5L3CA 2GSMB 2NLJC 3CC7V 2IWXA 4MPNA 4EGHA 2WLNA 3CCRV 5IYDO 1YC3A 4URMA 2LFRA 1MSWD 4EEHA 4PA7A 2UWDA 3WG7C 3H01A 4E2LA 4QE9A 4MVUA 1S72V 4KP4A 1F4MA 3ABKB 4RAIA 3ZRXA 1B3QA 1ORQC 2UXNA 3OEHG 4HAMA 2QTOA 4JAVA 3W7SA 4MS2A 1S76D 2YECA 1SETA 2WI2A 1KD1W 2YEBA 2YGAA 3T1KA 4CWSA 2DWDC 1S3JA 4GQTA 1QYEA 1Y8NA 3WFVA 3G71V 4NH7A 4QNHB 2EINC 2YEJA 3OUFA 2WPDG 2XCMA 1JOYA 2EILC 4JYCA 5M4KA 2YEVB 2IJIA 5D7CA 1FXKA 4CWQA 3F5WC 5KUKA 4MSWC 3U67A 1AH8A 4EFTA 2WLLB 1UYFA 5CN0A 1KKDA 3PEJA 1Z5CA 3STLC 1Y4SA 2IJJA 4BIUA 3CMEV 3HZ5A 1PD3A 2P67A 5HFLA 3T10A 2XDKA 3QO8A 3FB6C 1BGQA 1V54B 5L3DA 2BYHA 2XDSA 5BOCA 3AG4C 1ZXNA 5D7RA 2Y69C 2XAGA 3A0WA 2VCJA 5CBFA 1E1RG 4U7OA 2QG0A 1H38A 3AG1B 2EZPA 5M4NA 1OCZB 1A4HA 1K5QA 1UYCA 3SJQC 1GO3F 1QVFU 1UYMA 3K03A 3TZ4A 1FFTB 3NXSA 3ZRVA 4YKTA 1J95A 4UV8A 3FV5A 3EFFK 5GW7A 2YEHA 1K92A 2NNUA 2YEAA 4ASBA 2ITCC 4MPEA 2WI4A 4X88A 1K5SA 3O2FA 2XHXA 1Z5AA 1K3EA 3E35A 4X9LA 1OCCC 4XC0A 3LDCA 1VQNV 5J71A 1Q81W 3ZM7A 5B3SB 2IWSA 2H8MA 5CPHA 4W7TA 3ASOC 1YSRA 2XDUA 1TUEB 3DTUB 1G8MA 3QDDA 3RBZA 1OSFA 2VWCA 4KQVA 2PNRA 2B5UA 1BKNA 3JD0A 5B1AB 3W7TA 1NHJA 2VCIA 3M99B 1YT1A 2ZD9A 3LNUA 1P4RA 5L3FA 4L8ZA 4R3MA 4PELA 2W6JG 4R50A 1FXHA 1UYKA 5KUMA 1YETA 1YSZA 2IW5A 1BMFG 5B1BB 1NBMG 1JM6A 4RUEA 1TC0A 2D3OW 5CMUA 5LGUA 2V1DA 3Q5KA 3ZXOA 5B1AC 3CCJV 3IGAC 2CH4A 5CTYA 4JPRA 5L3JA 1PNKA 3ZRSA 3ZIAG 3CCLV 4CWOA 5J6AA 4FCQA 2JJ1G 2WLMA 3K0GA 1TIDA 5B3SC 2JJ2G 5EBMC 1UY7A 2YKJA 4YKYA 5CTXA 1UYHA 3OE7G 1K8AW 3T2SA 1MABG 4BIZA 2OTLV 4KTNA 4BQJA 1E79G 3R91A 1AJNA 1GKFA 1B63A 2BREA 4MVZA 4MVSA 1AMWA 5FWKA 2FTKA 1NR7A 3WG7B 5L3BA 3CXCU 3A0XA 2YEIA 3B27A 1MOFA 3P32A 2YEDA 3GIGA 2BU8A 3G75A 2WLJA 4MTXA 2IU0A 4P7AA 4UROA 1THNA 4XKOA 4YKUA 4GT1A 4KSHA 3CRKA 5M4MA 2WSSG 1V55C 2YSUB 1OCZC 5EBWC 3AG4B 1S14A 2BU7A 3T1CA 5M4PA 1YS3A 4MBCA 2Z3YA 2H55A 3D3IA 3LNMB 2QE7G 3LUTB 3UM7A 2JEXA 2GQPA 2IH3C 2IJKA 4KUMA 3ZMZA 5CBHA 1FXKC 2EJRA 4RQFA 1S0VA 1I5AA 1Z59A 1DTOA 1NJIW 4LWGA 1OCRB 2QKSA 2YJXA 1LNQA 2XAJA 1RPOA 4PDRA 2YE4A 3R4MA 5FNCA 4PU9A 2X6AA 1FS0G 2AHZA 1KECA 2IORA 3EKOA 1AR1B 3B28A 2R9RB 2V7QG 1W0KG 2YEEA 4FMTA 2XNDG 1VQ4V 3ZN1A 4JASA 5HFMA 1VQLV 4BQGA 1NQTA 4WFBV 4CE2A 5D7DA 2ZKJA 1F51A 5CBGA 2CK3G 4MT8A 4UVCA 2IJHA 2ZDYA 1YT0A 3G6EV 1H7SA 5F5RA 4R7CA 3D2RA 3ETGA 1R3JC 3VADA 3VHAA 4I3HA 3EKRA 4XDMA 5LGNA 3C11A 1UY6A 1L1FA 3F7VC 4O09A 3ABKC 4BW5A 3RLRA 1NKDA 4PRVA 4H81A 4L90A 4I5SA 3ASNC 2JIZG 4BAYA 5LHIA 4MVOA 5EBLC 1UY9A 2ATKC 3LSQA 2FWYA 3EHFA 3K79A 3RVYA 3K08A 1M9NA 4OXSA 1YHQV 1GKXA 3OWDA 4MP7A 2OT5A 2BRCA 1BXDA 1NVPB 1XL6A 2WI7A 2Q8FA 3OUSA 4HZ5A 2B1GA 3K97A 3OR6C 1NVPD 4RO2A 4CWTA 2FWZA 3X2QC 1R6NA 4JF3A 2HFEC 3JD3A 4R6ZA 4E02A 3SPCA 4I9WA 5IY5B 4YXWG 2Q2EB 4XD8A 4CWNA 1YJ9V 2YI0A 2X7RB 3EHGA 4HY1A 2QG2A 3JD1A 4KFMA 3VBBA 1MU5A 3W7UA 1I59A 4CZZA 2YJWA 1KP3A 2ITDC 4MTGA 4V25A 1DLBA 2WLKA 2JDIG 4LCUC 1VQ9V 4XCJA 5H6RA 1AI7A 2A9HA 3CRLA 2H94A 2WLLA 1CPYA 4LWEA 2WLHA 4QIWF 3ABLB 2X0LA 4XDLA 1BYQA 1R73A 2YE3A 3AG2C 3JD2A 2QM8A 3CP1A 2BZ5A 4HZ3A 3ZMVA 1Y66A 3R4PA 3U2KA 1ZWHA 1GM9A 4H37A 3A0YA 4V26A 3WHAA 1V55B 4AS9A 3CMAV 2JK5C 1NH2D 2O1VA 4DZYA 3E8HA 2ZDIC 2K1EA 1RM1C 2FXSA 2YK9A 4YKQA 1PNMA 1I5CA 1AI6A 2DYRC 1KIJA 2O1WA 3ETDA 4QPJA 1VQOV 1M56C 4JAUA 1RPRA 1ZWIC 1TILA 1SZTA 1I5XA 2Q68A 1QLNA 3A0TA 4R8CA 3FT8A 4ASGA 4B7PA 4MTFA 4EMVA 1Z5BA 2YK2A 2QEXV 4RQEA 3SYAA 3EHBB 5M4HA 3ML0A 3GIEA 3UKMA 2A0LA 5C93A 1FXVA 3R4NA 1QZRA 3ZXQA 3TETA 1CP9A 3VHDA 1P7BA 2LFSA 2JKIA 4JYBA 2YE7A 3K60A 1YESA 4U93A 1GTOA 4JGSA 5IYBO 2WI6A 5LBQA 1QLEC 2ZR3A 2HLDG 2PI5A 5H9CA 5D6PA 3IC7A 3KG2A 2ZXWC 4GX0A 5B1BC 2PI4A 3OMUA 2ZDXA 4HZ0A 2F43G 2WERA 4MB9A 3JCZA 4XITA 1QY8A 3B25A 1RM1B 2EIMC 1U0ZA 2CCUA 2HG5C 2E0AA 4UVBA 2YE8A 2ZBKB 3GIGB 1AJ6A 3A0ZA 3OAAG 4ASFA 4JTAB 3SPHA 1QR8A 4J9YB 4XIQA 4MTOA 4WF9V 2IH1C 3ASOB 3ZMSA 1CEZA 2WI3A 5GGZA 2JEUA 2YE6A 3HB3B 3FB5C 4NH9A 3HYYA 1OCCB 1U2OA 1EI1A 2XABA 1IXMA 2HG1A 4E01A 4EM7A 3CCVV 2ZXWB 4XCLA 1QCEA 1Q86W 3OW6A 2Q8HA 1ZXMA 3RLQA 3OPDA 3E8BA 1K4DC 1Q7YW 4PA6A 3SYOA 4GX5A 4FIPC 4ZKIA 4FCPA 3T2MA 4XIPA 1AI5A 3LDEA 2Q69A 4DO2A 1COWG 3TZ5A 4L93A 2DW4A 2P7TC 2YEFA 5LHHA 4P8OA 3K3WA 4WUBA 4XIRA 1SRYA 1ROPA 4LC1A 3RVZA 1R3IC 3CCSV 1TBWA 3MNRP 3KE6A 4AWOA 2C2AA 2XOKG 2HJFC 2CG9A 4L94A 3SPIA 4WFEA 3TUHA 4PL9A 2XD6A 1YC1A 1M56B 1KP2A 1PVGA 3E8FA 3FB8C 2DYRB 1I5DA 4MPCA 3HPLC 4WUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAE A;  2XX5 A;  4JQL A;  3G7E A;  4GT8 A;  4O0B A;  2FYP A;  4XTJ A;  1UYG A;  1R62 A;  1US7 A;  4U7N A;  2BT0 A;  3TZ0 A;  3U2D A;  4O04 A;  3INX A;  4GCZ A;  5B1O A;  2XX2 A;  1UYE A;  3C0E A;  3JZ3 A;  3DGE A;  3VHC A;  4O05 A;  4GEE A;  3EHH A;  3ZRW B;  2BTZ A;  4LP0 A;  4LWH A;  3HEK A;  4CE3 A;  4CWP A;  4MOT A;  3R92 A;  3T0H A;  3WQ9 A;  4FPP A;  2XDL A;  4XKA A;  2YE9 A;  3BMY A;  2YI7 A;  1UYI A;  2BYI A;  2GFD A;  1NHI A;  1Y8P A;  2QFO A;  2WEP A;  4BXI A;  5B1N A;  4B6C A;  1Y4U A;  2YKC A;  3K99 A;  3G7B A;  4R3A A;  4EFU A;  1EA6 A;  3Q5J A;  1S16 A;  4YKW A;  3TZ2 A;  2IWU A;  3O0I A;  2YI6 A;  1KZN A;  1ZW9 A;  3INW A;  5F3K A;  1Y8O A;  3TK1 A;  3H4L A;  2BSM A;  3A0R A;  4CWF A;  4YKX A;  2CGF A;  4CE1 A;  1MX0 A;  4FCR A;  2YKB A;  3Q5L A;  2CCS A;  2VWC A;  1L0O A;  1YER A;  1TH8 A;  4L91 A;  3ZKD A;  2HCH A;  4GFN A;  3D36 A;  2XHR A;  1I58 A;  4LWF A;  2YEG A;  2QF6 A;  4YKR A;  4MP2 A;  2XJG A;  4HYP A;  3OWB A;  2YGE A;  2WEQ A;  4HXZ A;  2XK2 A;  4Q20 A;  3CGZ A;  3PEH A;  3CWV A;  4H85 A;  2AKP A;  3NMQ A;  4HYM A;  3LPS A;  4HXW A;  1YT2 A;  1TC6 A;  3B24 A;  5BOD A;  3IED A;  3SL2 A;  4LPB A;  3R4O A;  3FT5 A;  2IOP A;  1UY8 A;  2CCT A;  1AH6 A;  2Q8G A;  5M4E A;  5CTU A;  2EXL A;  4AWP A;  1GKZ A;  1YC4 A;  2ESA A;  2YKI A;  5IN9 A;  1AM1 A;  2BU5 A;  2HKJ A;  4NH8 A;  4LWI A;  3HYZ A;  4HY6 A;  3RLP A;  1GJV A;  4QPK A;  2YGF A;  5FND A;  4AWQ A;  2XX4 A;  4CWR A;  4ZVI A;  3BM9 A;  4WUD A;  4K4O A;  2XDX A;  2YKE A;  4URL A;  4EGK A;  4R1F A;  4DUH A;  2JJC A;  2WI5 A;  3T0Z A;  4E00 A;  3QTF A;  4MBC A;  3EHJ A;  3D0B A;  5CTW A;  4PRX A;  5IDJ A;  4URN A;  3HZ1 A;  1NHH A;  4XKK A;  1B62 A;  3ZCC A;  2XJJ A;  4GGL A;  4KFG A;  4EGI A;  2WWW A;  2YE5 A;  3B26 A;  5CF0 A;  3K98 A;  1I5B A;  3HHU A;  3ZRW A;  3CGY A;  2YE2 A;  2IOQ A;  4KSG A;  3TTZ A;  4ASA A;  3MD0 A;  2XHT A;  3ZKB A;  2XJX A;  4LWG A;  1ID0 A;  1UYD A;  5D6P A;  2WI1 A;  4O07 A;  2O1U A;  4YKZ A;  3H80 A;  2K5B A;  4H7Q A;  1H7U A;  1UYL A;  3O6O A;  5D6Q A;  2QM7 A;  2BU6 A;  2YI5 A;  3GIF A;  2BU2 A;  2VW5 A;  5FNF A;  2IWX A;  4MPN A;  4EGH A;  1YC3 A;  4URM A;  4EEH A;  2LFR A;  2UWD A;  4KP4 A;  1B3Q A;  4XCL A;  3ZRX A;  1MU5 A;  4MP7 A;  4JAV A;  2YEC A;  3RKZ A;  3RLQ A;  2WI2 A;  2YEB A;  2YGA A;  3T1K A;  4CWS A;  4GQT A;  1QYE A;  1Y8N A;  4NH7 A;  2YEJ A;  2XCM A;  1JOY A;  4JYC A;  5M4K A;  5D7C A;  4CWQ A;  3U67 A;  1AH8 A;  4EFT A;  1UYF A;  3PEJ A;  1Z5C A;  1Y4S A;  4BIU A;  3HZ5 A;  2P67 A;  3T10 A;  2XDK A;  1BGQ A;  2BYH A;  2XDS A;  1ZXN A;  5D7R A;  3A0W A;  2VCJ A;  4U7O A;  2QG0 A;  5M4N A;  1A4H A;  1UYC A;  1UYM A;  3TZ4 A;  3NXS A;  3ZRV A;  4YKT A;  3FV5 A;  2YEH A;  2YEA A;  4ASB A;  4MPE A;  2WI4 A;  3O2F A;  2XHX A;  1Z5A A;  4X9L A;  4XC0 A;  5J71 A;  3ZM7 A;  2IWS A;  2H8M A;  5CPH A;  4W7T A;  1YSR A;  2XDU A;  3QDD A;  1OSF A;  4KQV A;  2PNR A;  1BKN A;  3LNU A;  2VCI A;  4XE2 A;  1NHJ A;  5M4P A;  1YT1 A;  4L8Z A;  4R3M A;  1YET A;  1UYK A;  1YSZ A;  1JM6 A;  1TC0 A;  3Q5K A;  3ZXO A;  2CH4 A;  5L3J A;  5CTY A;  4CWO A;  5J6A A;  4FCQ A;  1TID A;  1UY7 A;  2YKJ A;  4YKY A;  5CTX A;  1UYH A;  3T2S A;  4BIZ A;  4KTN A;  4BQJ A;  3R91 A;  1B63 A;  2BRE A;  5FWK A;  1AMW A;  2FTK A;  3A0X A;  2YEI A;  3B27 A;  3P32 A;  2YED A;  3GIG A;  3G75 A;  2BU8 A;  4MTX A;  4P7A A;  4URO A;  4XKO A;  1THN A;  4YKU A;  4GT1 A;  4KSH A;  3CRK A;  5M4M A;  1S14 A;  2BU7 A;  1YS3 A;  2H55 A;  2Q8I A;  2GQP A;  1I5A A;  1Z59 A;  5BOC A;  2YJX A;  5FNC A;  2YE4 A;  3R4M A;  4PU9 A;  2IOR A;  3EKO A;  3B28 A;  2YEE A;  4FMT A;  4BQG A;  4JAS A;  4CE2 A;  5D7D A;  2ZKJ A;  1F51 A;  4MT8 A;  2ZDY A;  1YT0 A;  5F5R A;  1H7S A;  3VHA A;  3D2R A;  3VAD A;  4I3H A;  3EKR A;  4XDM A;  3C11 A;  1UY6 A;  4O09 A;  3RLR A;  4PRV A;  4H81 A;  4L90 A;  4I5S A;  3EHF A;  1UY9 A;  2FWY A;  3OWD A;  1GKX A;  2BRC A;  1BXD A;  2WI7 A;  2Q8F A;  4HZ5 A;  3K97 A;  4CWT A;  2FWZ A;  4E02 A;  2Q2E B;  4XD8 A;  4CWN A;  3EHG A;  2YI0 A;  4HY1 A;  2QG2 A;  2YJW A;  1I59 A;  4V25 A;  4XCJ A;  3CRL A;  4LWE A;  1BYQ A;  2YE3 A;  2QM8 A;  2BZ5 A;  3R4P A;  3U2K A;  1ZWH A;  3A0Y A;  4V26 A;  3WHA A;  4AS9 A;  2O1V A;  4DZY A;  2FXS A;  2YK9 A;  4YKQ A;  1I5C A;  1KIJ A;  2O1W A;  4QPJ A;  4JAU A;  1TIL A;  3A0T A;  3FT8 A;  4ASG A;  4B7P A;  4EMV A;  1Z5B A;  2YK2 A;  5M4H A;  3GIE A;  5C93 A;  3R4N A;  1QZR A;  3ZXQ A;  3VHD A;  2LFS A;  2JKI A;  4JYB A;  2YE7 A;  3K60 A;  1YES A;  4U93 A;  2WI6 A;  4HZ0 A;  3OMU A;  2ZDX A;  2WER A;  4MB9 A;  4XIT A;  1QY8 A;  3B25 A;  1U0Z A;  2CCU A;  2E0A A;  2YE8 A;  2ZBK B;  3GIG B;  1AJ6 A;  3A0Z A;  4ASF A;  4XIQ A;  2WI3 A;  5GGZ A;  2YE6 A;  4NH9 A;  3HYY A;  1U2O A;  1EI1 A;  2XAB A;  1IXM A;  2HG1 A;  4E01 A;  3OW6 A;  2Q8H A;  1ZXM A;  3OPD A;  4FCP A;  4ZKI A;  4XIP A;  3TZ5 A;  4L93 A;  4WUB A;  2YEF A;  4XIR A;  4P8O A;  5IDM A;  4EM7 A;  4LC1 A;  1TBW A;  3MNR P;  4AWO A;  3KE6 A;  2C2A A;  2CG9 A;  4L94 A;  3TUH A;  4PL9 A;  2XD6 A;  1YC1 A;  1PVG A;  1I5D A;  4MPC A;  4WUC A; 
#chains in the Genus database with same CATH topology
 4JQL A;  3G7E A;  4O0B A;  1VIB A;  2EIL B;  4XTJ A;  1R62 A;  3RGB A;  1WN7 A;  4JI2 B;  4DR4 B;  3TZ0 A;  1BHB A;  4GCZ A;  4U3J B;  3J80 N;  3RN4 A;  3CE2 A;  1YTF D;  4FZ1 A;  3ZRW B;  2BTZ A;  4ZOL B;  1YJW V;  4LP0 A;  4LWH A;  1JPX A;  2K9P A;  3T1Y B;  2HVJ C;  3WQ9 A;  2CH7 B;  2HVK C;  3PJS K;  4FPP A;  2E75 B;  2WLI A;  3ABM C;  4HYO A;  1IBM B;  2XDL A;  1K73 W;  4XKA A;  1UYI A;  1DF5 A;  4JI6 O;  3GB7 C;  1I94 B;  3ZN0 A;  1Y76 A;  1NHI A;  3LNN A;  1X4T A;  2CDY A;  4B3M O;  4BXI A;  4MW8 A;  4R3A A;  3SGI A;  5JVD A;  1PNL A;  1VMG A;  1EA6 A;  1F23 A;  4YKW A;  4UUJ C;  3NR7 A;  1MZF A;  5EK0 A;  1SQV H;  3APO A;  3FAV A;  4E72 A;  3UO3 A;  2OTJ V;  3E8G A;  1XHX A;  1KC8 W;  4GX2 A;  4UCV A;  4LF7 B;  4OX9 O;  3CRQ A;  1JCH A;  4C7U A;  1VQ8 V;  1Y8O A;  1AJP A;  3JSN A;  1FXK B;  1HP8 A;  1VF5 B;  2BSM A;  1YIT V;  1SES A;  4KXR A;  3W7X A;  1Q43 A;  2IU3 A;  4WBN A;  4OPA A;  3QO7 A;  2CCS A;  1VQ5 V;  1Q82 W;  2VWC A;  3FKS G;  5IJ0 B;  4UB6 Z;  4WCE V;  3CC2 V;  4X1K A;  1TH8 A;  1YIJ V;  1THZ A;  4PDM A;  4L91 A;  3LDD A;  2ZQM A;  3B40 A;  2HCH A;  1M57 C;  4GFN A;  5GON A;  1LR1 A;  4DK1 A;  2Q5Z A;  3OFN G;  3UT5 B;  2QF6 A;  1AIL A;  1XNR B;  4AHC A;  2WEQ A;  2JRI A;  2WAM A;  4XDK A;  4LF8 O;  3CGZ A;  1YF2 A;  4I0X B;  1W59 A;  4DV4 O;  4MVQ A;  5EC2 C;  4BR6 A;  4ABM A;  3ZED A;  4NR1 A;  5AG2 A;  2R9I A;  1VEW A;  3B77 A;  2Y0P A;  5BOD A;  1R1B A;  3E2E A;  3SL2 A;  4LPB A;  3R4O A;  4B3S B;  2Q8V A;  1EFR G;  3E22 A;  3ZMT A;  3CCU V;  1PP9 H;  1IUR A;  4Q6G A;  2Q8G A;  2DOS A;  2DQ0 A;  3FAV B;  4P2Z A;  4X89 A;  1HNW O;  5CTU A;  4B3S O;  3BY6 A;  3R65 A;  4GLX A;  2QA4 V;  3QG5 A;  2P90 A;  2EIM B;  4NH8 A;  3K0D A;  3JAR A;  1R6K A;  1QU7 A;  5FND A;  4AWQ A;  3T1H B;  4GKJ B;  1WA8 B;  1QNM A;  4DR3 O;  4JI7 B;  2ZIM A;  2YKE A;  2YEV A;  4EFB A;  2IBZ H;  2X6C A;  3HKC A;  1EBO A;  4WFF A;  2P06 A;  3X2Q B;  4YHH O;  1YTF B;  1BHA A;  1JFF A;  4TSF G;  4QGP A;  3QTF A;  2ZR2 A;  2R72 A;  2ZCE A;  4N21 A;  5IDJ A;  2PYJ A;  3HZ1 A;  2X6B A;  3KCY A;  2AHY A;  4XKK A;  1XHZ A;  4KFG A;  1GM7 A;  1K7D A;  4J42 A;  4EGI A;  2LP7 A;  2YS8 A;  3B26 A;  4O4H B;  3K98 A;  5JQG B;  1HR0 O;  4JI8 B;  2QWN B;  1XMQ O;  2EBO A;  2L35 A;  3WB1 A;  3CGY A;  4PDV A;  4K3A A;  4NTY A;  4KSG A;  2XHT A;  4O07 A;  1ENV A;  2AZ0 A;  1OCR C;  4I7Z B;  2YI5 A;  3GIF A;  1YSC A;  1QVG U;  1H2G A;  5L3C A;  3CC7 V;  4EGH A;  4EEH A;  1BCC H;  3Q4H A;  1FJG O;  2YIB D;  4QE9 A;  1TVK B;  4MVU A;  3RYI A;  3ZRX A;  1ORQ C;  4HAM A;  4H0L B;  2QTO A;  1SET A;  3T1K A;  3M7M X;  2DWD C;  4CS4 A;  1QYE A;  3WFV A;  1L8D A;  2YEJ A;  5FNV B;  3D36 C;  2YEV B;  3UT5 A;  4J7K A;  4BIO A;  3U67 A;  1AH8 A;  5CN0 A;  1N33 B;  4X66 B;  4PD4 F;  1Y74 B;  3FB6 C;  5D7R A;  2QKA A;  1D5A A;  3A0W A;  5IYZ B;  1E1R G;  1XOU A;  5M4N A;  2KG7 B;  1OCZ B;  4YJ3 A;  1PPJ H;  2ZM6 O;  3H1I H;  1QVF U;  1UYM A;  5LXT A;  3TZ4 A;  2E5L B;  4YKT A;  1Q6I A;  5CA1 A;  5GW7 A;  1K92 A;  2NNU A;  5LOV B;  2ITC C;  4PI0 A;  1K5S A;  3RYC A;  2UUA B;  4DV5 O;  2XHX A;  1S5J A;  1K3E A;  3R66 A;  4X9L A;  4XC0 A;  3K5L A;  3QTC A;  1N32 B;  3ZM7 A;  4W7T A;  1YSR A;  3H1L H;  5JCO C;  4GKK B;  4GYC B;  4KQV A;  3JD0 A;  3M99 B;  2ZIN A;  2AW9 A;  4PEL A;  1YET A;  4R50 A;  1YSZ A;  1BMF G;  4RUE A;  3O65 A;  4TUY B;  3Q5K A;  1XRE A;  3JAW B;  3O9O A;  3UCS C;  3CCL V;  2WLM A;  3K0G A;  2FB5 A;  5CTX A;  1WP7 A;  3OE7 G;  4O2A A;  2OTL V;  1E79 G;  4B7E A;  1AJN A;  5FWK A;  3GVM A;  3WG7 B;  2RDC A;  1UFI A;  4LNU B;  5IJ9 A;  1MOF A;  3GIG A;  1Q8I A;  2BU8 A;  3G75 A;  2WLJ A;  4URO A;  4XKO A;  1THN A;  1R6T A;  3CRK A;  1V55 C;  2ADP A;  4NXM O;  1N0N A;  2YXY A;  2Z3Y A;  1WB8 A;  3J81 N;  3UM7 A;  2GQP A;  4KUM A;  5CBH A;  2EJR A;  1TUB A;  1DTO A;  4FM1 A;  1NJI W;  1HNZ O;  5LP6 B;  2X6A A;  1KEC A;  5H5N A;  5HFM A;  4BQG A;  4CE2 A;  4MT8 A;  1FYJ A;  2IJH A;  2ZDY A;  4R7C A;  3ETG A;  4NXN B;  4I3H A;  2CTR A;  1UY6 A;  4O09 A;  4YIO A;  4DV3 B;  3RLR A;  4PRV A;  4H81 A;  4I5S A;  2JIZ G;  2FWY A;  3H1K H;  3K79 A;  3OWD A;  3K9S A;  2PGG A;  4HZ5 A;  2B1G A;  3K97 A;  1YXB A;  3OR6 C;  1NVP D;  4IGG A;  2Q2E B;  3JD1 A;  4KFM A;  3VBB A;  3W7U A;  4AQY O;  3N2K A;  1ZLZ A;  4LCU C;  1VQ9 V;  4TQF A;  5H6R A;  2H94 A;  1CPY A;  4QIW F;  1BYQ A;  1AB3 A;  4O2A B;  2YE3 A;  5TIS Z;  3JAS A;  3CP1 A;  5B5E Z;  1GM9 A;  4V26 A;  4ICG A;  2O1V A;  3E8H A;  1RM1 C;  3F5T A;  4YKQ A;  2O1W A;  1SZT A;  4R8C A;  4IL6 Z;  4ASG A;  4B7P A;  1AR5 A;  1TUB B;  4RQE A;  3EHB B;  4D7S A;  2A0L A;  5JQG A;  1QZR A;  4J7Z A;  1N0J A;  1CP9 A;  3H9V A;  3ZXQ A;  2JKI A;  4JYB A;  4FLW A;  3K60 A;  1GTO A;  2WI6 A;  2PI5 A;  3IC7 A;  1MNG A;  4HZ0 A;  3TXQ A;  4EB6 A;  2MW2 B;  3JCZ A;  4XIT A;  2CCU A;  4UVB A;  5IWA O;  2ZBK B;  3GIG B;  2QKC A;  4DV7 O;  4DR5 B;  2FL4 A;  5J2U B;  5CB4 B;  3SJB C;  2JEU A;  2ZIO A;  1OCC B;  1U2O A;  2XAB A;  1PL4 A;  3BCC H;  4E01 A;  5K1P A;  1SQX H;  4YY3 B;  1FFX A;  5DED A;  3D8C A;  2AGA A;  4O2B B;  4JI2 O;  1I08 A;  4GX5 A;  2N05 A;  1WPB A;  4DO2 A;  3TZ5 A;  4L93 A;  2DW4 A;  4DW1 A;  3JAK B;  2YEF A;  5LHH A;  5IDM A;  2GUZ A;  3CCS V;  3MNR P;  2NN4 A;  3A8T A;  1Y67 A;  2C2A A;  2OIG A;  2CG9 A;  3JSL A;  3L71 H;  4LFA B;  3E8F A;  3FB8 C;  2DYR B;  2ZNJ A;  1RP3 B;  5LP6 A;  1TAE A;  1OHH G;  1Y74 A;  3FD9 A;  2FYP A;  2Q7G A;  2BT0 A;  4U7N A;  4JI5 O;  1M5I A;  1ZL8 A;  1I94 O;  3U2D A;  2CAZ C;  3MHH C;  3ABL C;  5B1O A;  1I0H A;  4F4L A;  1F4N A;  1JJO A;  2XX2 A;  2KG7 A;  4QJF B;  3C0E A;  1AP5 A;  3E83 A;  3DGE A;  4TQD A;  3N2G B;  1GAX A;  4GEE A;  3EHH A;  1US6 A;  1XNQ O;  4JTD B;  3OEE G;  4IYH A;  4CWP A;  1BGY H;  3AG1 C;  3R92 A;  3I56 V;  2PZS A;  4DUY B;  2EIJ B;  3K58 A;  1Q90 D;  1V54 C;  1IBL B;  2EZO A;  3HKD B;  4LFB O;  1XIL A;  2F93 B;  1YDX A;  4O4J B;  3N2K B;  2F23 A;  5KX5 A;  1R3L C;  3QO5 A;  1QHT A;  2EJ7 A;  3SJA C;  5IE9 A;  4XBF A;  3TZ2 A;  2IWU A;  4FLZ A;  3GWK C;  1WP8 A;  1DF4 A;  2H8P C;  2OYQ A;  3O0I A;  5KA5 A;  2MK3 A;  2OWO A;  3JAM N;  1KZN A;  4X62 B;  3BPZ A;  2YIA A;  1WB7 A;  5EC1 C;  4LNU A;  5IJ9 B;  2CGF A;  1TGO A;  4CE1 A;  3I55 V;  1N36 B;  4FCR A;  3HKB B;  3JAT A;  1XQ8 A;  5DM6 V;  4W4L A;  1F7Y A;  2C1G A;  4TV8 B;  4JI3 B;  2PTM A;  1GRJ A;  1W2B U;  2QM4 A;  2B1I A;  3L74 H;  1N36 O;  5KMG B;  4O2B A;  1I58 A;  1KU9 A;  4LWF A;  4DV2 O;  1K4C C;  2JS5 A;  4MP2 A;  4HYP A;  2W0F C;  1OCO B;  4OPH A;  2YGE A;  2DQ3 A;  1U97 A;  2PY5 A;  5E79 Z;  2Q7E A;  5JEN A;  4TWK A;  3CD6 V;  1XMO O;  2FML A;  5LYJ B;  3E89 A;  1QLE B;  3NMQ A;  2HP8 A;  4HYM A;  4JZG A;  4O4L A;  4HXW A;  4FFB A;  1TC6 A;  5ITZ B;  4UXN A;  1KKC A;  3STZ C;  1IZ3 A;  3IFX A;  4K8X A;  4OGQ B;  1L0N H;  2XAQ A;  1VQM V;  1QBZ A;  1ZUQ A;  4MVM A;  2IOP A;  1JQ0 A;  3AEI A;  2B9Z A;  5BZB A;  3JAW A;  3BA9 A;  3ZMU A;  1JJ2 U;  2RMK B;  3RYF B;  2EXL A;  4AWP A;  4LWS B;  1GKZ A;  4P9P A;  2HKO A;  1SC5 B;  2ESA A;  1AM1 A;  2BU5 A;  3JAL A;  3CRA A;  4HY6 A;  1VQ6 V;  4QPK A;  1GJV A;  2YGF A;  1M57 B;  1AP6 A;  4X1Y A;  4JI1 O;  2UU9 O;  3BM9 A;  2Y0I A;  3OGC C;  4PA9 A;  1SER A;  1NTK H;  4URL A;  2Q67 A;  3FB7 C;  1AI4 A;  4X8A A;  4E00 A;  2EIN B;  4CBC A;  4IIJ B;  1EZJ A;  5FL7 G;  4PRX A;  5EYP A;  4HNA A;  2LGQ A;  1KMI Z;  2XJJ A;  4GGL A;  2A7W A;  2WWW A;  5EZY B;  3WU2 Z;  2F66 C;  2XAS A;  4B3R O;  1M90 W;  4JI7 O;  1SA0 B;  1I5B A;  4JI3 O;  4GUN A;  3MDS A;  1S5H C;  1A32 A;  4FFB B;  3TTZ A;  5J2T B;  5L3G A;  2M7W A;  5CA3 A;  2ZT9 B;  4DV2 B;  4ASA A;  4CH5 A;  2Q73 A;  2OIE A;  3TCU A;  3TGU H;  5D6P A;  1P84 F;  4G27 B;  2K5B A;  3B8M A;  4HBN A;  3ABM B;  2QM7 A;  3SYQ A;  4DUZ B;  5BMV A;  2BU2 A;  2UUA O;  3LSS A;  5FNF A;  3AG7 A;  1BQZ A;  2IWX A;  4X66 O;  4DV0 B;  3CCR V;  5IYD O;  1YC3 A;  3FX7 A;  1MSW D;  2UWD A;  4RWU A;  5LYJ A;  4RAI A;  4KP4 A;  1F4M A;  3ABK B;  4MP7 A;  3OEH G;  2YEC A;  1H2S B;  4MS2 A;  4DV1 O;  1S76 D;  3LMM A;  2WI2 A;  4CWS A;  1S3J A;  4NH7 A;  3OUF A;  2WPD G;  4FZ0 A;  2XCM A;  2EIL C;  5D7C A;  4MSW C;  1JA8 A;  2LW7 A;  4FLX A;  4F6R A;  1Q3E A;  3JAR B;  3S3W A;  3CME V;  3QO8 A;  1HNX B;  3KKY A;  4YJ3 B;  2XDS A;  1KYO F;  2UU9 B;  2VCJ A;  5BY1 A;  4W4K A;  1K5Q A;  1UYC A;  1LUW A;  3SJQ C;  1GO3 F;  4I0X A;  3ZRV A;  4UV8 A;  5KHG A;  3EFF K;  3ZS8 C;  2CGN A;  4ASB A;  4X1I A;  3VQY A;  1MZE A;  3O2F A;  1Z5A A;  3E35 A;  4FLY A;  1MSD A;  1OCC C;  5J71 A;  3LDC A;  1VQN V;  4X65 B;  1Q81 W;  1RSO B;  1XEQ A;  5B3S B;  5D5Q A;  2H8M A;  2XDU A;  1H2L A;  1BKN A;  2VCI A;  1NHJ A;  1YT1 A;  4L8Z A;  2ZD9 A;  4I50 B;  1AR4 A;  1IVS A;  4R3M A;  1UYK A;  2LGW A;  4X65 O;  5B1B B;  1AVM A;  2D3O W;  1O9H A;  4WBN B;  3ZXO A;  5CA0 A;  3CCJ V;  4NVP A;  4JPR A;  3ZRS A;  3ZIA G;  5J6A A;  3P3N A;  2JJ2 G;  1P7G A;  3HR0 A;  5EBM C;  2YKJ A;  1G1X B;  1UYH A;  1K8A W;  1MAB G;  4BIZ A;  4KTN A;  1V9P A;  3R91 A;  2HHH B;  1GKF A;  4MVZ A;  4MVS A;  4LF5 B;  1NR7 A;  2YC0 A;  5LA6 B;  1Z5V A;  2YEI A;  3B27 A;  4D6T H;  4P7A A;  1L0L H;  2YIC A;  4DYL A;  3K5N A;  4KSH A;  3OTF A;  1OCZ C;  5EBW C;  3SR2 C;  1ZL8 B;  2YI8 A;  1BT8 A;  3LUT B;  2JEX A;  2Q8I A;  4DR7 O;  3ZMZ A;  1Z59 A;  5BOC A;  1LNQ A;  4PDR A;  5FNC A;  4L8J A;  1AR1 B;  3B28 A;  2R9R B;  1W0K G;  1NT2 B;  2YEE A;  4I55 A;  4JV5 B;  3QF7 A;  2ZKJ A;  1KB9 F;  2KSD A;  1VF6 C;  2PF4 E;  5KAI Z;  5F5R A;  3CWB H;  1H7S A;  1R3J C;  4XDM A;  1L1F A;  3F7V C;  5IYZ A;  4BW5 A;  1NKD A;  4L90 A;  3ASN C;  3DXR B;  3EHF A;  5EBL C;  1UY9 A;  4F6R B;  3CB2 A;  3RVY A;  1M9N A;  1YHQ V;  5CA1 B;  2BRC A;  1BXD A;  2WI7 A;  4LF4 B;  4X64 O;  2A3Q A;  4RO2 A;  4CWT A;  2QWP B;  4JAA A;  1R6N A;  4FVM A;  4JF3 A;  4CH6 A;  5EYP B;  5IY5 B;  4XD8 A;  2YI0 A;  4CZZ A;  3G80 A;  4MTG A;  3BFR A;  4XCJ A;  1AI7 A;  4LWE A;  3ABL B;  2X0L A;  4XDL A;  4JYA B;  5FPR A;  4UCU A;  5K1X A;  4YY3 O;  3HKD A;  2V4D A;  3R4P A;  3U2K A;  1ZWH A;  1HNZ B;  3CMA V;  3A0H Z;  2Q9L A;  2ZKO A;  1JMK C;  3JCU Z;  1I5C A;  2HEP A;  1AI6 A;  3RYH B;  2DYR C;  1M56 C;  4JAU A;  1IBM O;  1I5X A;  1QLN A;  4EMV A;  5GTI Z;  2P22 C;  4DV3 O;  3GIE A;  3UKM A;  2E74 B;  2YI9 A;  1FXV A;  4DV6 O;  5LOV A;  2LFS A;  4JGS A;  4JI5 B;  3DSQ A;  3ZX6 A;  4Z2W A;  3OMU A;  2WER A;  3DC6 A;  4KHP B;  4ZIB A;  1QY8 A;  3B25 A;  2EIM C;  4PHZ A;  2HG5 C;  1AJ6 A;  5CA0 B;  4ASF A;  3SPH A;  4LF7 O;  4KL1 A;  1QR8 A;  3L70 H;  4MTO A;  1HW7 A;  2L6L A;  1Z5W A;  2WI3 A;  3RWR D;  3FB5 C;  1JR9 A;  4AIL C;  4NH9 A;  1QQC A;  1EI1 A;  4DUY O;  1YVW A;  5FNV A;  2LQT A;  5KHK A;  4A5U B;  4PJ0 Z;  1Q7Y W;  1N34 O;  4PA6 A;  1DK1 A;  4ZKI A;  4FCP A;  4LFB B;  1MA1 A;  2VS0 A;  2P7T C;  4O4L B;  4P8O A;  3K3W A;  1NTZ H;  1ROP A;  4AWO A;  4H13 B;  4L94 A;  4WFE A;  4X64 B;  1XNR O;  1YC1 A;  1KP2 A;  4LF6 B;  1PVG A;  2GTS A;  2CTW A;  4J7J A;  3HPL C;  4WUC A;  2BOB C;  4TT3 G;  4BAE A;  2YXL A;  3OTO B;  4GT8 A;  5KLV H;  3ZHQ A;  2VWJ A;  4IHJ A;  1US7 A;  4F6E A;  3OR7 C;  4JTC B;  2LO1 A;  2ILM A;  3KCX A;  5BR8 B;  3INX A;  4HNA B;  5JH7 A;  1H2N A;  3JZ3 A;  1MG1 A;  3VHC A;  4LFC B;  2VQE B;  1K34 A;  2DYS B;  4K0K O;  4CE3 A;  2VWK A;  2W6I G;  3T0H A;  1PKX A;  1K97 A;  5DN6 G;  4B3M B;  2RNB A;  3JYC A;  3BVO A;  3K5M A;  3BMY A;  3K06 A;  1EN5 A;  1VF7 A;  2BYI A;  2R9A A;  1Y8P A;  3SYC A;  2QFO A;  2WEP A;  4B6C A;  3K99 A;  4EFU A;  4ZBM A;  3RT3 C;  1H8E G;  3BEH A;  1XNQ B;  1R3K C;  2CGO A;  3K9A A;  1S16 A;  3Q5J A;  4QE7 A;  3WB2 A;  2JGU A;  4KHP O;  1YI2 V;  2YI6 A;  5KHI A;  1ZW9 A;  3INW A;  1KQS U;  3RYC B;  1WLE A;  3H4L A;  2O57 A;  3CYO A;  2CTP A;  2PUS A;  2WA3 A;  4YKX A;  1XBL A;  3WB0 A;  3CCQ V;  3P30 A;  2P6J A;  1MX0 A;  5JWP A;  4OX9 B;  2YKB A;  4FJC C;  1YJN V;  3Q5L A;  1L0O A;  3SYP A;  1N34 B;  1YER A;  1X59 A;  2BTO A;  1Y4M A;  2ZE7 A;  5BXZ A;  3ZKD A;  3ZHR A;  2VRZ A;  2UXD O;  4LBE C;  4G28 B;  1PV0 A;  2Z0A A;  4X62 O;  1BS3 A;  1DGS A;  2YEG A;  4YKR A;  2XJG A;  3OWB A;  4K8Z A;  5JVD B;  5KHJ A;  4HXZ A;  1SF9 A;  2XK2 A;  1H8H G;  4Q20 A;  3OW2 U;  2BTQ B;  1XUQ A;  2AKP A;  3OMN B;  3L75 H;  4GZR B;  1YT2 A;  2Q7H A;  3T4Z A;  3BRC A;  1ARO P;  3B24 A;  3L9D A;  3IED A;  2F4V B;  3OMA B;  4B3R B;  2DWE C;  4FLV A;  4UV9 A;  4WFA V;  1XDC A;  3CJH B;  4E4E A;  3OD4 A;  4J10 A;  4LH7 A;  4Z1M G;  1AH6 A;  4PA3 A;  4LP8 A;  2E3C A;  3C90 A;  3E86 A;  1YC4 A;  2RN9 A;  4J11 A;  2DMX A;  2YKI A;  4P9O A;  5IN9 A;  1VQK V;  3GWO A;  2HKJ A;  4LWI A;  3HYZ A;  3AK3 A;  3RLP A;  3TJT A;  2CUG A;  3W7W A;  2EX3 A;  1J5E B;  2XX4 A;  4CWR A;  4ZVI A;  5KAF Z;  2QTS A;  1NH2 B;  4K4O A;  3T4D A;  4IT5 A;  3M8A A;  2D2C B;  4EGK A;  4DUH A;  2P4K A;  3ZHV A;  3CC4 V;  1KBH A;  3ETE A;  2WI5 A;  4I50 A;  4CC5 A;  1EM1 A;  1EN4 A;  4CH4 A;  1XMO B;  1M1K W;  4MBC A;  3G4S V;  3SPJ A;  4DR2 B;  2HR3 A;  1QR9 A;  2F1M A;  3RYI B;  5KHH A;  1S77 D;  1M93 A;  3BHP A;  3ZHS A;  4YHH B;  4EEQ A;  5D5P A;  2YE5 A;  4ASU G;  5CF0 A;  3A2F A;  4DV0 O;  5C8Y B;  1W0J G;  3HHU A;  3CRC A;  3ZRW A;  2YE2 A;  1BL8 A;  2IOQ A;  4GX1 A;  5EIB C;  3D3Q A;  3CX5 F;  2R70 A;  4L87 A;  3MD0 A;  1JX9 A;  1HR0 B;  1ID0 A;  1UYD A;  1JVM A;  2XAF A;  1AJQ A;  2GUZ B;  2WI1 A;  4PDL A;  4JI4 B;  1XL4 A;  4EB6 B;  4YKZ A;  1S5L Z;  5DEC A;  3H80 A;  4H7Q A;  3K5O A;  3SJC C;  1UYL A;  2BU6 A;  4FFK A;  5IY5 C;  2KB1 A;  2VW5 A;  3BA8 A;  3JD4 A;  1LUV A;  4RUF A;  1EN6 A;  2GSM B;  2WLN A;  2LFR A;  3WG7 C;  3H01 A;  5A9G A;  2Y4T A;  2BTQ A;  1S72 V;  1B3Q A;  1MU5 A;  3IAY A;  3W7S A;  1N4C A;  1KD1 W;  2F4V O;  2YEB A;  4BWA A;  2YGA A;  4J80 A;  4GQT A;  4QNH B;  1JOY A;  4JYC A;  5M4K A;  2CTQ A;  1FXK A;  4CWQ A;  3F5W C;  2QWR B;  1HNW B;  4EFT A;  2WLL B;  1UYF A;  1KKD A;  3CJH A;  3PEJ A;  1Z5C A;  1Y4S A;  3CRM A;  5HFL A;  3UQ8 A;  4ZOL A;  2JVD A;  1V54 B;  4UB8 Z;  5IT9 N;  1ZXN A;  2Y69 C;  5CBF A;  5LMU B;  1H38 A;  3AG1 B;  2JGD B;  4DR3 B;  2EZP A;  4DRX B;  1A4H A;  1VAR A;  3K03 A;  1FFT B;  3NXS A;  4IIJ A;  2YEA A;  4MPE A;  2WI4 A;  1RSO A;  5B66 Z;  4DR7 B;  2YDE A;  4CS3 A;  2HHH O;  5CPH A;  3ASO C;  1UPG A;  4EFE A;  3QDD A;  1OSF A;  2B5U A;  2XHB A;  4XE2 A;  5B1A B;  5M4P A;  4X9Q A;  4PI2 A;  3RFR A;  1P4R A;  1SQQ H;  3BAB A;  2W6J G;  5KUM A;  2IW5 A;  4JI8 O;  1TC0 A;  5CMU A;  2CE4 A;  5LGU A;  2V1D A;  3RYF A;  4B3T O;  3HKB A;  5B1A C;  2CH4 A;  5CTY A;  1YZB A;  4PV1 B;  5B3S C;  4YKY A;  1IBK B;  1IDS A;  3T2S A;  4LF4 O;  1XI1 A;  5JCO A;  2LJ2 A;  1HNX O;  3TXS A;  3CXC U;  1IBK O;  2YED A;  2BCC H;  5KX5 B;  4YKU A;  3ETQ A;  5FLX N;  2YSU B;  2BU7 A;  3AG4 B;  3T1C A;  2H55 A;  3D3I A;  1KUQ A;  5LMN B;  1Y76 B;  2QDO A;  1SKV A;  1I5A A;  4RQF A;  1S0V A;  2QKS A;  2YJX A;  2XAJ A;  3R4M A;  4I4T B;  4PU9 A;  2AHZ A;  2PYL A;  3EKO A;  4X1Y B;  1ZX3 A;  2NR5 A;  2V7Q G;  4LF5 O;  4FM2 A;  2XND G;  2P4V A;  4JAS A;  3ZN1 A;  5IJ0 A;  1F51 A;  2CK3 G;  4UVC A;  1YT0 A;  3G6E V;  4JI0 B;  1B06 A;  3EKR A;  5LGN A;  3N27 A;  2CH7 A;  4IHJ B;  5LHI A;  2ATK C;  3LSQ A;  3JAL B;  3K08 A;  4OXS A;  1GKX A;  1NVP B;  1XL6 A;  2DJV A;  4X1I B;  2QWQ B;  3OUS A;  4LFA O;  2FWZ A;  1ZSP A;  4X1K B;  1NU1 H;  4R6Z A;  4E02 A;  4I9W A;  4YXW G;  2JGD A;  2Y4U A;  1YJ9 V;  2X7R B;  4HY1 A;  2QG2 A;  2YJW A;  2ITD C;  3K59 A;  2YIB A;  3G67 A;  2WLK A;  2JDI G;  2A9H A;  2WLL A;  2WLH A;  3AG2 C;  4DV6 B;  4O4H A;  2QM8 A;  3ZMV A;  4AQY B;  3CSX A;  4H37 A;  3A0Y A;  3WHA A;  3EXA A;  4AS9 A;  2JK5 C;  4DR1 O;  1NH2 D;  4LF9 B;  2ZDI C;  2K1E A;  4BW9 A;  1PNM A;  4JV5 O;  3ETD A;  1I7F A;  4YIP A;  1RPR A;  1ZWI C;  1TIL A;  2Q68 A;  3A0T A;  2XT9 A;  3JAK A;  3FT8 A;  4LWS A;  4MTF A;  3CHX A;  2YK2 A;  3SYA A;  1WA8 A;  3ML0 A;  3E22 B;  4JYA O;  3UO2 A;  3VHD A;  4DV7 B;  1P7B A;  2YE7 A;  2G38 A;  1YES A;  4U93 A;  5IYB O;  3C3S A;  1GH6 A;  2HLD G;  4DR4 O;  3KG2 A;  2ZXW C;  2FYU H;  4GX0 A;  2PI4 A;  1HDJ A;  2ZDX A;  4U3F H;  5BR8 O;  1YCI A;  3U11 A;  1RM1 B;  1U0Z A;  3A0Z A;  4XIQ A;  4WF9 V;  2IH1 C;  3ZMS A;  1CEZ A;  2YUA A;  5GGZ A;  2YE6 A;  3HB3 B;  2UUB B;  3HYY A;  3Q4H B;  1IXM A;  3CCV V;  3DC5 A;  3OW6 A;  2Q8H A;  1ZXM A;  3CS5 A;  3OPD A;  3S3X A;  4B7K A;  4FIP C;  1FKA O;  3LDE A;  1COW G;  2ZE8 A;  4EM7 A;  1SRY A;  4LC1 A;  3RVZ A;  5JJN B;  3KE6 A;  4K0K B;  2HJF C;  5J2T A;  2VQF O;  3FFQ A;  4O4J A;  3TUH A;  1OV9 A;  1I5D A;  3SDL A;  4MPC A;  1OCO C;  2XX5 A;  4CS2 A;  2ADQ B;  4NB5 A;  4JZ2 A;  3HKE B;  1UYG A;  1GN6 A;  1SQF A;  1GM8 A;  1NTM H;  2AXT Z;  5EZY A;  2EIK C;  1NR1 A;  3CCM V;  4O04 A;  1OZ0 A;  1UYE A;  1VF6 A;  3K04 A;  1GK9 A;  3OMI B;  4O05 A;  4TUY A;  2Z5U A;  4PA4 A;  2YXH A;  4DR1 B;  3P3P A;  3AG3 C;  1FD9 A;  3HEK A;  4MOT A;  3FYE B;  2W0X A;  3AG3 B;  2LW1 A;  3CCE V;  3CPW U;  3OTO O;  2A79 B;  3DXR A;  2DN9 A;  2YE9 A;  2YI7 A;  2Q6A A;  5BMV B;  3ASN B;  2GFD A;  5B1N A;  1Y4U A;  2YKC A;  1GMG A;  3G7B A;  3B2E E;  1IBL O;  4LH6 A;  2M6Y A;  3OM3 B;  3MHS C;  5LA6 A;  1K9M W;  2KKW A;  4TV9 B;  5KA6 A;  3CYG A;  4LF6 O;  2BSK B;  2UXX A;  5JJJ B;  4N23 A;  3ABT A;  5IWA B;  5C8Y A;  5JJE B;  3ZJZ A;  4UFZ A;  4DR5 O;  5F3K A;  3F7Y C;  4YJ2 B;  3THO A;  3TK1 A;  3C3T A;  2EIJ C;  1VP7 A;  1WPX A;  2Q4P A;  4UCO A;  2ARH A;  3A0R A;  4FK5 C;  3IC9 A;  2ZNI A;  4CWF A;  3QNE A;  1GN2 A;  4NKG B;  4XDJ A;  4P30 A;  2ZE5 A;  4LFC O;  2N04 A;  2DYS C;  4O4I A;  3BAA A;  4EKW A;  3FYI B;  1K33 A;  1I5Y A;  4G2K A;  2RCV A;  1VQP V;  3VQX A;  2GBO A;  2EIK B;  3G6B A;  3D36 A;  1IX9 A;  2XHR A;  3T1H O;  1PL0 A;  3J7A U;  3L72 H;  2FKX A;  4DW0 A;  4JI6 B;  5E1A C;  3B4S A;  2OCC C;  5LGT A;  3EVK A;  3PEH A;  3APQ A;  3CWV A;  5H6Q A;  4H85 A;  5LXT B;  2UXB O;  3LPS A;  2XUM A;  5LL6 Y;  3JAS B;  1GN3 A;  3CXH F;  3HKE A;  4MVR A;  3OT7 A;  4J9Z B;  1G6U A;  4FLU A;  3FT5 A;  3VOU A;  1UY8 A;  2CCT A;  4MW3 A;  5J2U A;  4DRX A;  2N74 A;  5M4E A;  3SPG A;  2BSK A;  4JI1 B;  4DR2 O;  4H33 A;  4DV4 B;  1CXZ B;  2OCC B;  3B8N A;  1NI8 A;  2Y69 B;  3AG2 B;  3ZBH A;  1UJW B;  4LR3 A;  1T5E A;  2UUC B;  4WUD A;  1SQG A;  1BSM A;  2BOC C;  2XDX A;  4WFH A;  4R1F A;  3K57 A;  1HWY A;  2WLI B;  1FJG B;  2JJC A;  4DXW A;  3T0Z A;  4LF8 B;  1B6Q A;  1E1Q G;  1N8R W;  2UUC O;  1Z2G A;  3EHJ A;  5LHG A;  1D5N A;  3HKC B;  3D0B A;  5CTW A;  3ABU A;  4UCS A;  5A2Q N;  2RJZ A;  5JH7 B;  4JI4 O;  4URN A;  5L3E A;  2XAH A;  1NHH A;  1G4Y B;  1FPO A;  3ZCC A;  1B62 A;  1B04 A;  3CEI A;  1J5E O;  4YJ2 A;  3IJ4 A;  3H1J H;  1Q5O A;  2ZDI A;  2DE0 X;  4TOI A;  2KQX A;  3N2G A;  2Y48 A;  4TV9 A;  4DUZ O;  2BE3 A;  5IYC O;  3ZKB A;  2XJX A;  4WFG A;  4LWG A;  4Z1V A;  3RW0 A;  1VQ7 V;  5J9P C;  2O1U A;  3H1H H;  1SQB H;  4UVA A;  2GV9 A;  1H7U A;  3O6O A;  2GHY A;  5D6Q A;  3U10 A;  1YEW A;  3I5D A;  4GKJ O;  2NLJ C;  3CRR A;  2UXB B;  4MPN A;  4URM A;  1N32 O;  4PA7 A;  1XMQ B;  4E2L A;  4XCL A;  3RKZ A;  3RLQ A;  2UXN A;  4JAV A;  4O4I B;  5LMU O;  1Y8N A;  2ZM6 B;  3G71 V;  2EIN C;  4B3T B;  1FFX B;  1P49 A;  2IJI A;  2JS3 A;  1SA0 A;  5KUK A;  4DV1 B;  4NTW A;  1EZV H;  3STL C;  1BQ0 A;  1RFY A;  2IJJ A;  4BIU A;  4FLT A;  3HZ5 A;  1PD3 A;  2P67 A;  3T10 A;  2XDK A;  4UCR A;  1BGQ A;  1GN4 A;  3AK2 A;  4GKK O;  5L3D A;  5CB4 A;  2BYH A;  3AG4 C;  1H2K A;  1URF A;  2UXC B;  5H2F Z;  2GTA A;  2XAG A;  1WNS A;  4U7O A;  2QG0 A;  3A0B Z;  1ZAU A;  4ZHQ A;  1J95 A;  3FV5 A;  2A06 H;  2F95 B;  1D2D A;  2YEH A;  1O9G A;  4X88 A;  1N33 O;  2IWS A;  1SZX A;  1TUE B;  3DTU B;  2E76 B;  1G8M A;  3RBZ A;  1M4U A;  3OGI B;  2PNR A;  3LNU A;  3W7T A;  5L3F A;  4TV8 A;  1FXH A;  4I55 B;  4JI0 O;  1NBM G;  1JM6 A;  3IGA C;  5L3J A;  1MMM A;  1PNK A;  4CWO A;  5KMG A;  4FCQ A;  2JJ1 G;  1U96 A;  2QWO B;  1TID A;  1UY7 A;  2H3O A;  4BQJ A;  3ZHT A;  4UCT A;  2XTA A;  1B63 A;  2BRE A;  1AMW A;  3ZHU A;  2FTK A;  2RQ6 A;  3A0X A;  5L3B A;  4NYK A;  1WAZ A;  3P32 A;  2YID A;  4MTX A;  2IU0 A;  4NXN O;  4GT1 A;  2E5L O;  5M4M A;  2WSS G;  4B08 A;  1S14 A;  2IM9 A;  3KZI Z;  1YS3 A;  4I4T A;  3LNM B;  2QE7 G;  2QGN A;  2IH3 C;  2IJK A;  4DV5 B;  1FXK C;  4X20 A;  3VQW A;  1OCR B;  4ZI7 B;  1RPO A;  2HJD A;  2AZ2 A;  2YE4 A;  4J41 A;  1FS0 G;  2IOR A;  4LF9 O;  4FMT A;  1VQ4 V;  1VQL V;  1NQT A;  4D7T A;  4WFB V;  5D7D A;  5CBG A;  1IXB A;  2C1I A;  3RYH A;  2QR4 A;  3VHA A;  3D2R A;  3VAD A;  3C11 A;  3ABK C;  5F2V O;  4BAY A;  1BE3 H;  2UXC O;  2GDS A;  4MVO A;  5LMN O;  3AK1 A;  2OT5 A;  4DR6 O;  2Q8F A;  3JAT B;  1H2M A;  3X2Q C;  2HFE C;  3JD3 A;  3SPC A;  4CWN A;  3EHG A;  2ODM A;  5ITZ A;  1BZK A;  1I59 A;  4DR6 B;  1KP3 A;  4V25 A;  1DLB A;  1TVK A;  5LP6 C;  3CRL A;  1SQP H;  4NXM B;  1R73 A;  3PN1 A;  5EIB D;  3JD2 A;  3S5T A;  2BZ5 A;  4HZ3 A;  1Y66 A;  2QSA A;  3QVN A;  2VQE O;  2ETN A;  1V55 B;  1OJH A;  3U0Z A;  4DZY A;  2Q0O C;  4NTX A;  2FXS A;  2YK9 A;  4ZHQ B;  1KIJ A;  3T1Y O;  1VQO V;  4QPJ A;  1SS3 A;  3VQV A;  1JFF B;  4U3J A;  1Z5B A;  2UUB O;  2QEX V;  5M4H A;  3B09 A;  4FM0 A;  5C93 A;  2QJ1 A;  3R4N A;  4DK0 A;  3TET A;  3MAQ A;  1WJZ A;  4I9Q A;  4AI8 A;  5LBQ A;  1QLE C;  2ZR3 A;  5H9C A;  1Y6X A;  3ICX A;  5B1B C;  2F43 G;  4H44 B;  4MB9 A;  4IYI A;  2WA4 A;  2HHI A;  2E0A A;  2YE8 A;  1NS1 A;  3OAA G;  4JTA B;  2VQF B;  4J9Y B;  4CH3 A;  3ASO B;  2P5O A;  1NZ6 A;  2ZE6 A;  1Q6H A;  2HG1 A;  2ZXW B;  3LSU A;  1QCE A;  4ZI7 A;  1Q86 W;  5GON B;  3E8B A;  1K4D C;  3SYO A;  2EUL A;  4XIP A;  3T2M A;  1AI5 A;  2Q69 A;  1TA8 A;  4WUB A;  4XIR A;  2Q0A A;  2OCH A;  1TBW A;  2UXD B;  1Q6U A;  1R3I C;  2XOK G;  1ZTE A;  4CC6 A;  3SPI A;  1PM9 A;  4PL9 A;  4K35 A;  2XD6 A;  1M56 B;  4JYY A;  5GTH Z;  4X20 B;  5FPO A;  1FAF A;  3L73 H; 
#chains in the Genus database with same CATH homology
 2BOB C;  1OCO C;  4TT3 G;  2XX5 A;  2Q8I A;  4JQL A;  4BAE A;  1OHH G;  3G7E A;  4GT8 A;  4O0B A;  2EIL B;  2FYP A;  1UYG A;  4XTJ A;  1R62 A;  1US7 A;  4U7N A;  2BT0 A;  3OR7 C;  4JTC B;  1GM8 A;  1BHB A;  3TZ0 A;  3U2D A;  2EIK C;  1NR1 A;  3CCM V;  3Q5L A;  4O04 A;  3INX A;  3MHH C;  4GCZ A;  3T0Z A;  3ABL C;  1OZ0 A;  5B1O A;  4F4L A;  1F4N A;  1UYE A;  2XX2 A;  3K04 A;  4QJF B;  3C0E A;  3JZ3 A;  3E83 A;  1MG1 A;  1GK9 A;  3DGE A;  1YTF D;  3VHC A;  3OMI B;  4O05 A;  4GEE A;  1K34 A;  2Z5U A;  2DYS B;  4PA4 A;  3EHH A;  3ZRW B;  2BTZ A;  3AG3 C;  4JTD B;  1YJW V;  4LP0 A;  4LWH A;  3HEK A;  4CE3 A;  3OEE G;  1JPX A;  4CWP A;  4MOT A;  3FYE B;  3AG1 C;  4XE2 A;  3R92 A;  3I56 V;  2W6I G;  3T0H A;  1PKX A;  1K97 A;  5DN6 G;  2HVJ C;  3WQ9 A;  3JYC A;  2EIJ B;  2HVK C;  3AG3 B;  3PJS K;  4FPP A;  2WLI A;  3ABM C;  4HYO A;  1V54 C;  3CPW U;  3CCE V;  2EZO A;  2A79 B;  1K73 W;  2YE9 A;  3BMY A;  2YI7 A;  3K06 A;  4XKA A;  1UYI A;  1DF5 A;  2Q6A A;  3RKZ A;  3GB7 C;  2BYI A;  3ASN B;  3ZN0 A;  1NHI A;  2GFD A;  1Y8P A;  3SYC A;  2QFO A;  2WEP A;  4BXI A;  5B1N A;  4MW8 A;  4B6C A;  1Y4U A;  2YKC A;  3K99 A;  1GMG A;  3G7B A;  4R3A A;  4EFU A;  4ZBM A;  1R3L C;  3QO5 A;  1PNL A;  3OM3 B;  1H8E G;  3MHS C;  3BEH A;  1K9M W;  1EA6 A;  5KA6 A;  1F23 A;  1R3K C;  3K9A A;  4UUJ C;  4XBF A;  1S16 A;  5EK0 A;  4QE7 A;  2IWU A;  3Q5J A;  4YKW A;  3TZ2 A;  1DF4 A;  2UXX A;  2OTJ V;  3E8G A;  4N23 A;  1YI2 V;  2H8P C;  3ABT A;  1KC8 W;  3O0I A;  4GX2 A;  2MK3 A;  5KA5 A;  2YI6 A;  3ZJZ A;  1KZN A;  1ZW9 A;  3INW A;  1JCH A;  1KQS U;  5F3K A;  1VQ8 V;  1Y8O A;  3F7Y C;  1AJP A;  3TK1 A;  1WLE A;  3H4L A;  1FXK B;  2EIJ C;  5EC1 C;  1WPX A;  3CYO A;  2BSM A;  3A0R A;  4FK5 C;  1YIT V;  4CWF A;  3QNE A;  1SES A;  4YKX A;  2CGF A;  3W7X A;  4XDJ A;  4CE1 A;  3CCQ V;  3P30 A;  2P6J A;  4P30 A;  3I55 V;  1MX0 A;  4FCR A;  2YKB A;  2IU3 A;  4FJC C;  3QO7 A;  1YJN V;  2CCS A;  1VQ5 V;  2DYS C;  1Q82 W;  3SYP A;  5DM6 V;  3FKS G;  1L0O A;  4WCE V;  3CC2 V;  1YER A;  1TH8 A;  4EKW A;  3FYI B;  1YIJ V;  1K33 A;  1I5Y A;  1THZ A;  4PDM A;  1Y4M A;  1W2B U;  4G2K A;  2B1I A;  1VQP V;  4L91 A;  3ZKD A;  3LDD A;  2ZQM A;  2HCH A;  2EIK B;  1M57 C;  4GFN A;  4LBE C;  3D36 A;  4G28 B;  2XHR A;  1I58 A;  1PL0 A;  4LWF A;  2YEG A;  1K4C C;  3OFN G;  2QF6 A;  4YKR A;  4MP2 A;  5E1A C;  2XJG A;  4HYP A;  3OWB A;  2OCC C;  2W0F C;  1OCO B;  2YGE A;  2DQ3 A;  2WEQ A;  4HXZ A;  2WAM A;  4XDK A;  2XK2 A;  5LGT A;  1H8H G;  4Q20 A;  3OW2 U;  4TWK A;  3CD6 V;  2XDL A;  3CGZ A;  3PEH A;  3CWV A;  3E89 A;  5H6Q A;  1QLE B;  4H85 A;  2AKP A;  3NMQ A;  4HYM A;  3OMN B;  3LPS A;  4HXW A;  1YT2 A;  4MVQ A;  5EC2 C;  3T4Z A;  1TC6 A;  4UXN A;  3STZ C;  3IFX A;  5IDM A;  1ARO P;  2R9I A;  3B77 A;  3B24 A;  2XAQ A;  5BOD A;  1VQM V;  4MVR A;  3IED A;  4J9Z B;  1QBZ A;  3OMA B;  4MVM A;  3E2E A;  2DWE C;  3R4O A;  4LPB A;  3SL2 A;  4UV9 A;  3FT5 A;  1EFR G;  4WFA V;  2IOP A;  1JQ0 A;  3VOU A;  3ZMT A;  1UY8 A;  3CCU V;  2CCT A;  3AEI A;  4MW3 A;  4Z1M G;  5BZB A;  1AH6 A;  2Q8G A;  4PA3 A;  4LP8 A;  2DQ0 A;  5M4E A;  3SPG A;  3E86 A;  4P2Z A;  3ZMU A;  4H33 A;  4X89 A;  1JJ2 U;  5CTU A;  2EXL A;  4AWP A;  1GKZ A;  1YC4 A;  4P9P A;  2HKO A;  3BY6 A;  3R65 A;  2ESA A;  2YKI A;  2OCC B;  3B8N A;  4P9O A;  2QA4 V;  1VQK V;  3GWO A;  1AM1 A;  2BU5 A;  2HKJ A;  2Y69 B;  5IN9 A;  2P90 A;  2EIM B;  4NH8 A;  3AG2 B;  3HYZ A;  4LWI A;  4HY6 A;  3ZKB A;  1VQ6 V;  3RLP A;  3K0D A;  4QPK A;  1UJW B;  3W7W A;  1GJV A;  1R6K A;  2YGF A;  5FND A;  1M57 B;  2XX4 A;  4AWQ A;  4CWR A;  4ZVI A;  3BM9 A;  3OGC C;  1NH2 B;  4WUD A;  4K4O A;  4PA9 A;  3T4D A;  2BOC C;  2XDX A;  1SER A;  2YEV A;  4WFH A;  2YKE A;  4EGK A;  4URL A;  4R1F A;  4DUH A;  1HWY A;  2WLI B;  3CC4 V;  2X6C A;  3ETE A;  4DXW A;  2JJC A;  2Q67 A;  2WI5 A;  3FB7 C;  1AI4 A;  1EBO A;  4WFF A;  4X8A A;  1B6Q A;  3X2Q B;  1E1Q G;  1YTF B;  1N8R W;  1BHA A;  4TSF G;  1M1K W;  4E00 A;  3QTF A;  2EIN B;  2ZR2 A;  3G4S V;  3EHJ A;  4CBC A;  3SPJ A;  1EZJ A;  5LHG A;  2HR3 A;  5FL7 G;  3D0B A;  1QR9 A;  5CTW A;  3ABU A;  4PRX A;  4N21 A;  5IDJ A;  4URN A;  5L3E A;  3HZ1 A;  2X6B A;  2XAH A;  1NHH A;  1S77 D;  1G4Y B;  2AHY A;  4XKK A;  3ZCC A;  1B62 A;  2XJJ A;  4GGL A;  4KFG A;  1GM7 A;  1K7D A;  4EGI A;  2WWW A;  2YE5 A;  2LP7 A;  4ASU G;  3B26 A;  2XAS A;  5CF0 A;  1M90 W;  3K98 A;  1I5B A;  2ZDI A;  2EBO A;  1S5H C;  1W0J G;  2Y48 A;  3HHU A;  3ZRW A;  3CGY A;  2YE2 A;  4PDV A;  1BL8 A;  2IOQ A;  4GX1 A;  4KSG A;  3TTZ A;  5L3G A;  2M7W A;  4L87 A;  5CA3 A;  4ASA A;  3MD0 A;  5IYC O;  2XHT A;  1JX9 A;  4WFG A;  2XJX A;  1ID0 A;  3TCU A;  1JVM A;  2XAF A;  1AJQ A;  1UYD A;  2WI1 A;  3RW0 A;  4G27 B;  4PDL A;  5J9P C;  1XL4 A;  1VQ7 V;  2O1U A;  4O07 A;  4YKZ A;  1ENV A;  3H80 A;  2K5B A;  1OCR C;  3B8M A;  4H7Q A;  4UVA A;  1H7U A;  3ABM B;  1UYL A;  2GHY A;  3O6O A;  2QM7 A;  5D6Q A;  3SYQ A;  2BU6 A;  2YI5 A;  5IY5 C;  2KB1 A;  1YSC A;  3JD4 A;  1QVG U;  2BU2 A;  3LSS A;  2VW5 A;  4RUF A;  3GIF A;  5FNF A;  1H2G A;  5L3C A;  2GSM B;  2NLJ C;  3CC7 V;  2IWX A;  4MPN A;  4EGH A;  2WLN A;  3CCR V;  5IYD O;  1YC3 A;  4URM A;  2LFR A;  1MSW D;  4EEH A;  4PA7 A;  2UWD A;  3WG7 C;  3H01 A;  4E2L A;  4QE9 A;  4MVU A;  1S72 V;  4KP4 A;  1F4M A;  3ABK B;  4RAI A;  3ZRX A;  1B3Q A;  1ORQ C;  2UXN A;  3OEH G;  4HAM A;  2QTO A;  4JAV A;  3W7S A;  4MS2 A;  1S76 D;  2YEC A;  1SET A;  2WI2 A;  1KD1 W;  2YEB A;  2YGA A;  3T1K A;  4CWS A;  2DWD C;  1S3J A;  4GQT A;  1QYE A;  1Y8N A;  3WFV A;  3G71 V;  4NH7 A;  4QNH B;  2EIN C;  2YEJ A;  3OUF A;  2WPD G;  2XCM A;  1JOY A;  2EIL C;  4JYC A;  5M4K A;  2YEV B;  2IJI A;  5D7C A;  1FXK A;  4CWQ A;  3F5W C;  5KUK A;  4MSW C;  3U67 A;  1AH8 A;  4EFT A;  2WLL B;  1UYF A;  5CN0 A;  1KKD A;  3PEJ A;  1Z5C A;  3STL C;  1Y4S A;  2IJJ A;  4BIU A;  3CME V;  3HZ5 A;  1PD3 A;  2P67 A;  5HFL A;  3T10 A;  2XDK A;  3QO8 A;  3FB6 C;  1BGQ A;  1V54 B;  5L3D A;  2BYH A;  2XDS A;  5BOC A;  3AG4 C;  1ZXN A;  5D7R A;  2Y69 C;  2XAG A;  3A0W A;  2VCJ A;  5CBF A;  1E1R G;  4U7O A;  2QG0 A;  1H38 A;  3AG1 B;  2EZP A;  5M4N A;  1OCZ B;  1A4H A;  1K5Q A;  1UYC A;  3SJQ C;  1GO3 F;  1QVF U;  1UYM A;  3K03 A;  3TZ4 A;  1FFT B;  3NXS A;  3ZRV A;  4YKT A;  1J95 A;  4UV8 A;  3FV5 A;  3EFF K;  5GW7 A;  2YEH A;  1K92 A;  2NNU A;  2YEA A;  4ASB A;  2ITC C;  4MPE A;  2WI4 A;  4X88 A;  1K5S A;  3O2F A;  2XHX A;  1Z5A A;  1K3E A;  3E35 A;  4X9L A;  1OCC C;  4XC0 A;  3LDC A;  1VQN V;  5J71 A;  1Q81 W;  3ZM7 A;  5B3S B;  2IWS A;  2H8M A;  5CPH A;  4W7T A;  3ASO C;  1YSR A;  2XDU A;  1TUE B;  3DTU B;  1G8M A;  3QDD A;  3RBZ A;  1OSF A;  2VWC A;  4KQV A;  2PNR A;  2B5U A;  1BKN A;  3JD0 A;  5B1A B;  3W7T A;  1NHJ A;  2VCI A;  3M99 B;  1YT1 A;  2ZD9 A;  3LNU A;  1P4R A;  5L3F A;  4L8Z A;  4R3M A;  4PEL A;  2W6J G;  4R50 A;  1FXH A;  1UYK A;  5KUM A;  1YET A;  1YSZ A;  2IW5 A;  1BMF G;  5B1B B;  1NBM G;  1JM6 A;  4RUE A;  1TC0 A;  2D3O W;  5CMU A;  5LGU A;  2V1D A;  3Q5K A;  3ZXO A;  5B1A C;  3CCJ V;  3IGA C;  2CH4 A;  5CTY A;  4JPR A;  5L3J A;  1PNK A;  3ZRS A;  3ZIA G;  3CCL V;  4CWO A;  5J6A A;  4FCQ A;  2JJ1 G;  2WLM A;  3K0G A;  1TID A;  5B3S C;  2JJ2 G;  5EBM C;  1UY7 A;  2YKJ A;  4YKY A;  5CTX A;  1UYH A;  3OE7 G;  1K8A W;  3T2S A;  1MAB G;  4BIZ A;  2OTL V;  4KTN A;  4BQJ A;  1E79 G;  3R91 A;  1AJN A;  1GKF A;  1B63 A;  2BRE A;  4MVZ A;  4MVS A;  1AMW A;  5FWK A;  2FTK A;  1NR7 A;  3WG7 B;  5L3B A;  3CXC U;  3A0X A;  2YEI A;  3B27 A;  1MOF A;  3P32 A;  2YED A;  3GIG A;  2BU8 A;  3G75 A;  2WLJ A;  4MTX A;  2IU0 A;  4P7A A;  4URO A;  1THN A;  4XKO A;  4YKU A;  4GT1 A;  4KSH A;  3CRK A;  5M4M A;  2WSS G;  1V55 C;  2YSU B;  1OCZ C;  5EBW C;  3AG4 B;  1S14 A;  2BU7 A;  3T1C A;  5M4P A;  1YS3 A;  4MBC A;  2Z3Y A;  2H55 A;  3D3I A;  3LNM B;  2QE7 G;  3LUT B;  3UM7 A;  2JEX A;  2GQP A;  2IH3 C;  2IJK A;  4KUM A;  3ZMZ A;  5CBH A;  1FXK C;  2EJR A;  4RQF A;  1S0V A;  1I5A A;  1Z59 A;  1DTO A;  1NJI W;  4LWG A;  1OCR B;  2QKS A;  2YJX A;  1LNQ A;  2XAJ A;  1RPO A;  4PDR A;  2YE4 A;  3R4M A;  5FNC A;  4PU9 A;  2X6A A;  1FS0 G;  2AHZ A;  1KEC A;  2IOR A;  3EKO A;  1AR1 B;  3B28 A;  2R9R B;  2V7Q G;  1W0K G;  2YEE A;  4FMT A;  2XND G;  1VQ4 V;  3ZN1 A;  4JAS A;  5HFM A;  1VQL V;  4BQG A;  1NQT A;  4WFB V;  4CE2 A;  5D7D A;  2ZKJ A;  1F51 A;  5CBG A;  2CK3 G;  4MT8 A;  4UVC A;  2IJH A;  2ZDY A;  1YT0 A;  3G6E V;  1H7S A;  5F5R A;  4R7C A;  3D2R A;  3ETG A;  1R3J C;  3VAD A;  3VHA A;  4I3H A;  3EKR A;  4XDM A;  5LGN A;  3C11 A;  1UY6 A;  1L1F A;  3F7V C;  4O09 A;  3ABK C;  4BW5 A;  3RLR A;  1NKD A;  4PRV A;  4H81 A;  4L90 A;  4I5S A;  3ASN C;  2JIZ G;  4BAY A;  5LHI A;  4MVO A;  5EBL C;  1UY9 A;  2ATK C;  3LSQ A;  2FWY A;  3EHF A;  3K79 A;  3RVY A;  3K08 A;  1M9N A;  4OXS A;  1YHQ V;  1GKX A;  3OWD A;  4MP7 A;  2OT5 A;  2BRC A;  1BXD A;  1NVP B;  1XL6 A;  2WI7 A;  2Q8F A;  3OUS A;  4HZ5 A;  2B1G A;  3K97 A;  3OR6 C;  1NVP D;  4RO2 A;  4CWT A;  2FWZ A;  3X2Q C;  1R6N A;  4JF3 A;  2HFE C;  3JD3 A;  4R6Z A;  4E02 A;  3SPC A;  4I9W A;  5IY5 B;  4YXW G;  2Q2E B;  4XD8 A;  4CWN A;  1YJ9 V;  2YI0 A;  2X7R B;  3EHG A;  4HY1 A;  2QG2 A;  3JD1 A;  4KFM A;  3VBB A;  1MU5 A;  3W7U A;  1I59 A;  4CZZ A;  2YJW A;  1KP3 A;  2ITD C;  4MTG A;  4V25 A;  1DLB A;  2WLK A;  2JDI G;  4LCU C;  1VQ9 V;  4XCJ A;  5H6R A;  1AI7 A;  2A9H A;  3CRL A;  2H94 A;  2WLL A;  1CPY A;  4LWE A;  2WLH A;  4QIW F;  3ABL B;  2X0L A;  4XDL A;  1BYQ A;  1R73 A;  2YE3 A;  3AG2 C;  3JD2 A;  2QM8 A;  3CP1 A;  2BZ5 A;  4HZ3 A;  3ZMV A;  1Y66 A;  3R4P A;  3U2K A;  1ZWH A;  1GM9 A;  4H37 A;  3A0Y A;  4V26 A;  3WHA A;  1V55 B;  4AS9 A;  3CMA V;  2JK5 C;  1NH2 D;  2O1V A;  4DZY A;  3E8H A;  2ZDI C;  2K1E A;  1RM1 C;  2FXS A;  2YK9 A;  4YKQ A;  1PNM A;  1I5C A;  1AI6 A;  2DYR C;  1KIJ A;  2O1W A;  3ETD A;  4QPJ A;  1VQO V;  1M56 C;  4JAU A;  1RPR A;  1ZWI C;  1TIL A;  1SZT A;  1I5X A;  2Q68 A;  1QLN A;  3A0T A;  4R8C A;  3FT8 A;  4ASG A;  4B7P A;  4MTF A;  4EMV A;  1Z5B A;  2YK2 A;  2QEX V;  4RQE A;  3SYA A;  3EHB B;  5M4H A;  3ML0 A;  3GIE A;  3UKM A;  2A0L A;  5C93 A;  1FXV A;  3R4N A;  1QZR A;  3ZXQ A;  3TET A;  1CP9 A;  3VHD A;  1P7B A;  2LFS A;  2JKI A;  4JYB A;  2YE7 A;  3K60 A;  1YES A;  4U93 A;  1GTO A;  4JGS A;  5IYB O;  2WI6 A;  5LBQ A;  1QLE C;  2ZR3 A;  2HLD G;  2PI5 A;  5H9C A;  5D6P A;  3IC7 A;  3KG2 A;  2ZXW C;  4GX0 A;  5B1B C;  2PI4 A;  3OMU A;  2ZDX A;  4HZ0 A;  2F43 G;  2WER A;  4MB9 A;  3JCZ A;  4XIT A;  1QY8 A;  3B25 A;  1RM1 B;  2EIM C;  1U0Z A;  2CCU A;  2HG5 C;  2E0A A;  4UVB A;  2YE8 A;  2ZBK B;  3GIG B;  1AJ6 A;  3A0Z A;  3OAA G;  4ASF A;  4JTA B;  3SPH A;  1QR8 A;  4J9Y B;  4XIQ A;  4MTO A;  4WF9 V;  2IH1 C;  3ASO B;  3ZMS A;  1CEZ A;  2WI3 A;  5GGZ A;  2JEU A;  2YE6 A;  3HB3 B;  3FB5 C;  4NH9 A;  3HYY A;  1OCC B;  1U2O A;  1EI1 A;  2XAB A;  1IXM A;  2HG1 A;  4E01 A;  4EM7 A;  3CCV V;  2ZXW B;  4XCL A;  1QCE A;  1Q86 W;  3OW6 A;  2Q8H A;  1ZXM A;  3RLQ A;  3OPD A;  3E8B A;  1K4D C;  1Q7Y W;  4PA6 A;  3SYO A;  4GX5 A;  4FIP C;  4ZKI A;  4FCP A;  3T2M A;  4XIP A;  1AI5 A;  3LDE A;  2Q69 A;  4DO2 A;  1COW G;  3TZ5 A;  4L93 A;  2DW4 A;  2P7T C;  2YEF A;  5LHH A;  4P8O A;  3K3W A;  4WUB A;  4XIR A;  1SRY A;  1ROP A;  4LC1 A;  3RVZ A;  1R3I C;  3CCS V;  1TBW A;  3MNR P;  3KE6 A;  4AWO A;  2C2A A;  2XOK G;  2HJF C;  2CG9 A;  4L94 A;  3SPI A;  4WFE A;  3TUH A;  4PL9 A;  2XD6 A;  1YC1 A;  1M56 B;  1KP2 A;  1PVG A;  3E8F A;  3FB8 C;  2DYR B;  1I5D A;  4MPC A;  3HPL C;  4WUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...