4FMTA

Crystal structure of a chpt protein (cc_3470) from caulobacter crescentus cb15 at 2.30 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
209
Chain Sequence
DVQGPDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Branched signal wiring of an essential bacterial cell-cycle phosphotransfer protein.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
molecule keywords ChpT protein
total genus 71
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fmtA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fmtA02
1YESA 2QM7A 4WUDA 1UYGA 1ZW9A 2XHTA 4MB9A 4JASA 4XC0A 2E0AA 1BKNA 3A0YA 4CWNA 2XDLA 4XTJA 3K97A 2O1WA 1B3QA 3INXA 2XDXA 2VWCA 2YEBA 4BQGA 3TZ4A 1QYEA 4NH8A 5CTWA 4PRXA 1NHHA 3O0IA 4BAEA 4XDMA 4JYBA 3TK1A 2CGFA 2XDKA 4WUCA 3GIFA 2YKBA 5M4PA 5FNFA 4LP0A 1JM6A 3ZRWB 2BU6A 4JAVA 2AKPA 2YGAA 2CG9A 3ZRXA 4XITA 4HY1A 3R4MA 2YEDA 3PEJA 1Z5CA 2H8MA 4KSHA 2XABA 3OWDA 3A0RA 2O1VA 4CWFA 3NXSA 3R91A 2YJWA 4FMTA 3LNUA 4YKYA 1Y8NA 2QG2A 2VCIA 2XJGA 4EFUA 5L3JA 4LWHA 2FXSA 3KE6A 1YS3A 1BXDA 3O6OA 1Z59A 3CRLA 4B7PA 4ASGA 4R1FA 1ID0A 2WEPA 2HG1A 2WI2A 5D6PA 1YSZA 3SL2A 2UWDA 1UYLA 4L94A 4CWOA 4KFGA 2YKEA 2XJXA 4O09A 2K5BA 5J6AA 1Y8OA 4CWRA 4EMVA 4KQVA 2BZ5A 1UY7A 4MPCA 3B26A 2FWZA 3EHHA 4EGIA 2YE5A 3A0WA 4EFTA 3EHGA 4ZVIA 1UYKA 4L8ZA 2BU8A 4BQJA 4BXIA 3BMYA 5FNDA 2BTZA 2YEGA 2QF6A 4NH9A 4YKWA 4MT8A 4URMA 1UYDA 1YT1A 2WEQA 2YEEA 3B24A 3VHAA 2XX2A 3BM9A 4DZYA 3HYZA 3U2DA 2IOPA 3VADA 1UYCA 1EI1A 3FT5A 2ZBKB 3T1KA 4QPJA 5F5RA 2JKIA 4EGHA 4MOTA 4XIPA 4YKRA 1UYHA 3ZKBA 4CWTA 4GT8A 4XIRA 4V26A 1AM1A 4YKUA 1Z5AA 2YE4A 3GIGB 1UYFA 4XKKA 4XKOA 2IWXA 4ASFA 4GCZA 2YEHA 3GIEA 2IWUA 4O07A 2XX5A 2YJXA 4L90A 4XKAA 5M4HA 2HCHA 5D6QA 3ZXQA 2ZDYA 4FCPA 4O0BA 4PL9A 4ASAA 1AH6A 3EKRA 4DUHA 2PNRA 3CGYA 3Q5KA 3K60A 2LFRA 1GJVA 2XHXA 4CE1A 3CGZA 1MU5A 2BU2A 1YC1A 1BYQA 2BU7A 3TZ5A 4BIUA 4KSGA 3ZXOA 4O05A 3B25A 2YEJA 3A0TA 4LWEA 4LWGA 4UROA 3TZ2A 5BODA 5FNCA 2WI1A 1I59A 4H7QA 3T10A 1YSRA 4U7OA 5D7RA 2HKJA 3T0ZA 3P32A 1AJ6A 3HZ1A 4X9LA 1JOYA 3G7EA 1I5BA 3ZRVA 2YKIA 4XD8A 2YI7A 4BIZA 5M4EA 3GIGA 3INWA 4AWOA 2YEIA 5FWKA 4E02A 2WERA 3VHDA 2YE7A 1TIDA 3R4OA 1QY8A 3T0HA 3NMQA 1MX0A 1YT2A 4AS9A 2XX4A 2WI4A 2CCUA 1NHJA 2ZKJA 2FTKA 3HHUA 4R3MA 4YKXA 2XDUA 4CWSA 4HZ0A 4HXZA 1S16A 3TTZA 4HZ5A 2JJCA 3H80A 3VHCA 1B63A 3D2RA 3U67A 2CCSA 5CTXA 4H85A 3D36A 1AMWA 5M4KA 1US7A 3G7BA 5D7CA 1TBWA 1YT0A 4QPKA 4U7NA 2Q8GA 4LPBA 1Y8PA 5CTYA 2O1UA 4PRVA 2WI6A 4EEHA 2VCJA 4O04A 3RLRA 2XDSA 1Y4UA 1THNA 4MTXA 4EM7A 2YE2A 4XIQA 5IN9A 4JAUA 3ZKDA 4I3HA 1YETA 3OWBA 3G75A 4CWPA 4XCJA 1ZXNA 4R3AA 2XD6A 1I5DA 4FCQA 1IXMA 4P7AA 1GKZA 2YE6A 4B6CA 1UY8A 5CTUA 4U93A 1ZXMA 4AWPA 1ZWHA 2XCMA 1I5CA 2XJJA 3C0EA 4HYPA 5CF0A 1UYIA 4LWFA 2YGFA 4WUBA 1UYMA 1YC4A 4KP4A 1KZNA 1H7UA 3RLQA 5IDMA 4MPNA 4PU9A 1Z5BA 4W7TA 4GFNA 4URLA 1I5AA 4GEEA 3TUHA 1PVGA 5GGZA 1AH8A 2ZDXA 2XK2A 3JZ3A 2EXLA 4Q20A 4XCLA 2BT0A 4HYMA 2Q8IA 4CE3A 4L91A 2YK2A 1GKXA 3ZRWA 3OMUA 2LFSA 2WI7A 4XE2A 3RLPA 3OW6A 2BYIA 4NH7A 2P67A 2H55A 1TILA 2GQPA 3Q5JA 4E01A 3FV5A 1BGQA 5C93A 2YEFA 2QM8A 2VW5A 1B62A 4HXWA 2IORA 3H4LA 3HEKA 2QFOA 3RKZA 4EGKA 4HY6A 5CPHA 3IEDA 1TC0A 4CWQA 4H81A 4LWIA 2FYPA 4MP7A 1QZRA 2ESAA 4YKTA 5BOCA 2WI3A 3EHJA 3LPSA 3ZCCA 1L0OA 2YE8A 3CWVA 4KTNA 2YE9A 4I5SA 3A0XA 3O2FA 2BSMA 3C11A 2YI0A 5M4NA 4GT1A 1YC3A 2YECA 1U0ZA 2YKCA 3TZ0A 5D7DA 3R92A 2Q2EB 2Q8HA 3DGEA 4GGLA 2IOQA 3R4PA 3B28A 2CH4A 3T2SA 2XHRA 4JYCA 3HYYA 3CRKA 2YK9A 4GQTA 4MPEA 3Q5LA 3EKOA 2BYHA 2YE3A 1Y4SA 4MP2A 4L93A 4ASBA 4P8OA 4E00A 2C2AA 3U2KA 2GFDA 3D0BA 2BREA 2IWSA 4CE2A 1U2OA 3K98A 4YKQA 3R4NA 5M4MA 3A0ZA 3EHFA 1I58A 4ZKIA 2YKJA 4YKZA 2BU5A 4LC1A 4URNA 5J71A 4K4OA 5IDJA 2WI5A 3B27A 3ZM7A 1H7SA 2YGEA 5F3KA 1A4HA 3FT8A 2YI6A 4FPPA 3PEHA 3OPDA 3QTFA 1OSFA 4MBCA 3QDDA 2YEAA 3MD0A 1EA6A 3WQ9A 1S14A 4AWQA 2WWWA 2Q8FA 3HZ5A 1NHIA 2YI5A 1F51A 4FCRA 2FWYA 4V25A 3MNRP 5B1OA 1R62A 2QG0A 1KIJA 1UYEA 2CCTA 3WHAA 3K99A 1YERA 5B1NA 2BRCA 4JQLA 1UY9A 1TH8A 1UY6A 1TC6A
chains in the Genus database with same CATH superfamily
4WUDA 2K1EA 2X6CA 3RVYA 4JASA 2A06H 1IX9A 4JI8O 3M99B 3IFXA 1BKNA 2O1WA 1VEWA 4RUFA 1N32B 2ZR3A 4DV3B 1WB7A 1HW7A 3OEHG 1EN6A 4BWAA 4RO2A 2XDXA 2W0XA 3W7WA 2YEBA 1QR9A 4O4JB 1RSOA 5CTWA 4J7KA 3O0IA 3B40A 4DXWA 3JASB 5B1BC 4WFGA 4BAEA 1QVFU 2PF4E 4LWSB 4JI5O 3OGCC 1XUQA 3N27A 3TK1A 2CGFA 4WUCA 3H9VA 2L6LA 5LMNB 1K8AW 1XNRO 1IZ3A 2DN9A 2HKOA 1I0HA 1PL4A 1JMKC 2DYSB 3ZRWB 4JAVA 2UXDO 3I56V 2YGAA 2CG9A 2HJFC 2HR3A 2Q6AA 1Z5CA 4KSHA 2XABA 3BCCH 1SESA 4QE7A 3OWDA 4B7KA 1MSDA 4YKYA 2VCIA 3K06A 4B3SB 2CE4A 2GUZA 5J2UA 2YIAA 1Z59A 4OPHA 1URFA 4IIJB 3P3PA 4R1FA 3H01A 1S76D 5KUMA 1SQXH 4R6ZA 2WSSG 3HKCA 1PM9A 3FB5C 1IBLB 1YSZA 3SL2A 3H1KH 3M7MX 3SPCA 4YIOA 1KB9F 4CWOA 3T1YO 2HLDG 4KFGA 4B7EA 3TXQA 2YKEA 2VQFB 2K5BA 1N8RW 1JCHA 1Y8OA 4DR6O 2QM4A 5KLVH 2E74B 2F95B 3JALA 3SDLA 3ML0A 3HKBB 1VQ9V 4HZ3A 3LSSA 3E86A 1UJWB 3OTOB 3TCUA 2FWZA 3OTOO 2EJ7A 2YE5A 4IT5A 2XNDG 3S3XA 3ABKB 1HNXO 1UFIA 2YICA 2L35A 4L8ZA 4DR4B 5D5QA 4LF5B 1I94O 2GBOA 4X66B 2Y48A 3H1LH 1TAEA 1WN7A 4RWUA 4GYCB 4RQEA 4URMA 1UYDA 4EB6A 3RGBA 4FLUA 1YT1A 2YEEA 2WLJA 2UUBB 4ZIBA 3BM9A 3DTUB 5IYZA 3U2DA 2IOPA 4AQYO 2PY5A 1SRYA 1UYCA 3P30A 2XHBA 3HR0A 1MZEA 2N05A 2PTMA 2ZQMA 4MOTA 4XIPA 4EGHA 4YKRA 4DR5O 4J9YB 3ZKBA 3O9OA 2EZPA 1K5SA 3JSLA 4XIRA 4GZRB 4I9QA 5K1XA 4ASFA 2IH3C 2B9ZA 4D6TH 4TQDA 2Y4TA 4LF5O 4O07A 1H8EG 1MG1A 2NR5A 3SPGA 2DYSC 4J80A 1HNXB 3RYIA 5D6QA 1YI2V 4NYKA 2PI5A 3OMNB 3ZXQA 4O0BA 2X6AA 1DK1A 3ZMSA 4JI0O 4HYOA 2PNRA 2WA4A 3OR6C 3SJCC 1SA0B 5LGUA 1GJVA 4FM1A 4DR7O 3K9SA 1S5HC 4GUNA 1M57B 2B5UA 3B25A 4UVAA 3A0TA 4LWEA 3TZ2A 3CC7V 5BODA 4WBNB 2DWDC 5BMVA 4U7OA 1YSRA 1QLEB 5EZYB 2HKJA 1XDCA 1JOYA 3VBBA 1DF5A 1DLBA 3G7EA 1NTMH 4EFBA 3QO7A 3E2EA 4BIZA 1EZVH 3GIGA 3CE2A 1BT8A 2D2CB 1GH6A 3APQA 5JCOC 3VHDA 1ZWIC 2JGDB 1QY8A 3U0ZA 2IM9A 3T0HA 1VIBA 1Q43A 4JI1O 4AS9A 2ZM6O 2WI4A 2LQTA 5EYPA 4JYYA 4R3MA 3L75H 3RBZA 4CWSA 5JVDB 2QE7G 4JI3B 4FLVA 4CS3A 4LCUC 1FS0G 1I5YA 2QTSA 1LUWA 3VHCA 1K9MW 3D2RA 1G8MA 2QA4V 4NR1A 4LFAB 2ZT9B 2WLKA 4W4KA 4H85A 3D36A 3PJSK 4LFCB 4YXWG 2JJ1G 3SPIA 4BAYA 4BIOA 2BOCC 5H6RA 1YT0A 2ODMA 1AVMA 2ARHA 4U7NA 4DV4O 2Q8GA 4LPBA 1RFYA 5EIBC 5L3BA 4YIPA 1VQ4V 4O04A 1WP7A 2LP7A 5H6QA 3A2FA 3W7UA 4LF9B 1OCCC 4MTXA 1VQPV 2YE2A 4MS2A 3X2QC 3CCUV 5TISZ 1YIJV 2RN9A 1GN2A 3KCXA 3E35A 5LHHA 3OGIB 5BR8B 1YETA 4N23A 3ZBHA 4JF3A 5IJ0A 3KKYA 3T1CA 4XCJA 5J9PC 3EHBB 3S3WA 1ZXNA 3FFQA 3UT5A 3WFVA 4JI7B 3LSQA 5L3GA 3F5WC 3CCEV 3BABA 4K0KO 2R9AA 4QGPA 1I94B 3ZEDA 4P7AA 4KL1A 2YE6A 2CDYA 2EZOA 1G4YB 1V55C 2W0FC 4HYPA 1O9HA 1K7DA 1UYIA 4LWFA 1PP9H 1IBKB 1DTOA 3K5MA 5IT9N 1BSMA 3N2GB 4KP4A 1EN4A 2DQ0A 1KZNA 4DV4B 2ITDC 2HFEC 1Z5BA 3JD1A 4E72A 1S0VA 4CS2A 4LFCO 1AROP 2YXYA 1WNSA 2ZDXA 1HP8A 4MSWC 4TUYA 4YY3B 4TV9A 1BL8A 2K9PA 1FXKA 5FLXN 4MTFA 2Q5ZA 1Q6UA 5KA5A 1GKXA 2Z3YA 1SZTA 4U3JA 4BW9A 2OTLV 4UV8A 2WI7A 3ZS8C 1FAFA 4NH7A 2H55A 2X7RB 1TILA 3F7VC 3Q5JA 1NKDA 1SZXA 4JPRA 2DQ3A 5L3CA 1SQPH 1B62A 3G80A 2G38A 2QFOA 2ZXWB 2P90A 4EGKA 4HY6A 1TC0A 3CS5A 4H81A 1VF6C 4R50A 4XBFA 1QZRA 1JJOA 1I7FA 4RAIA 1F7YA 3EHJA 3ZCCA 5LBQA 2EJRA 2YE8A 4I5SA 3ZMUA 1Z5WA 2PGGA 3GWKC 5JVDA 3JARA 4LF4B 4GX2A 1IBLO 3J81N 5EYPB 4AHCA 3C11A 2YI0A 1JR9A 3AG1C 3CCQV 2RDCA 4PV1B 2YXHA 2LGQA 2FYUH 2YECA 1HNWO 2YKCA 3STZC 4CH6A 2JGDA 4E4EA 4P2ZA 3QNEA 1FJGO 3JAMN 2IOQA 3CCJV 5DM6V 3D8CA 2XHRA 1TUEB 1CP9A 4MW8A 4JYCA 1K33A 3HYYA 2ZM6B 2YK9A 4MVOA 1Q86W 3EKOA 4YJ2B 2BYHA 1Y4SA 2YE3A 4MP2A 3EXAA 4DR3O 3U2KA 4G28B 2AW9A 3D0BA 1IXBA 2Y0IA 4DR3B 2XAGA 2JEUA 3S5TA 4J42A 4DUZB 4UVCA 3L71H 1XMOO 2ZXWC 4I9WA 3EHFA 1I58A 3OTFA 1YEWA 4B3RO 2BU5A 3AEIA 2GHYA 1VQOV 4AQYB 3B27A 4DV6O 1A4HA 1OCOC 2XASA 3RYIB 2YI6A 4FPPA 2BOBC 4J9ZB 2XUMA 3QDDA 3U10A 5IYBO 1Q6HA 2NN4A 2Q8FA 1K4DC 1NBMG 5BY1A 3UKMA 1R1BA 1NHIA 3OMAB 1N4CA 2XAJA 4V25A 1SF9A 5FNVA 3MNRP 2ZIOA 1KIJA 4NTWA 1AI6A 1EN5A 4FZ1A 1GO3F 5EC2C 2BRCA 3K5OA 1M90W 1TH8A 1UY6A 4G27B 2PUSA 3DC6A 3GB7C 3K0DA 3BA9A 4ZI7B 1N0NA 2IU0A 1QHTA 1CEZA 4CWNA 1XNQB 4JI2O 1ZL8A 4EFEA 3UO2A 4X1YA 2PZSA 2P5OA 3INXA 3FB6C 1GN6A 1QU7A 3J7AU 4BQGA 1QYEA 4NH8A 5DECA 4NXMO 1NHHA 3MHSC 4E2LA 4JYBA 1NI8A 2NLJC 4PA7A 1P7BA 2W6JG 3GIFA 1Y4MA 4PI2A 4X1IB 2YKBA 3RVZA 2LO1A 3HKBA 3RYFB 4PD4F 5M4PA 4LR3A 1NS1A 2P4KA 5FNFA 5B3SC 3SGIA 4TV8B 3ZRXA 4HY1A 3R4MA 3I55V 2YEDA 4B08A 1R3IC 2F4VB 2MK3A 4XDLA 3ASNB 4H37A 4CWFA 4JI0B 4FMTA 1KD1W 2YJWA 4EFUA 1M93A 2ZDIA 1KMIZ 5J2TB 2QDOA 1VQKV 1Y66A 1PNLA 1TVKB 1ID0A 2HHHO 2YEVB 3TXSA 2WEPA 3CXCU 1BGYH 5CBFA 2Q7HA 2JS3A 1TA8A 2UWDA 4JAAA 3LDCA 3F7YC 3EFFK 1YJ9V 4O09A 1VARA 1HNWB 1YJNV 2IH1C 3N2KA 5J6AA 1GMGA 2RNBA 3BY6A 4CWRA 4EMVA 1M4UA 1FXHA 2X0LA 2Y69B 1D5AA 3B8NA 1W0KG 3K5LA 4KQVA 1UY7A 3C90A 4GKKB 1YCIA 3EHHA 3OM3B 1OCRB 4ZOLB 3UCSC 3RFRA 3APOA 1H8HG 4EFTA 1UYKA 4ZBMA 2LW1A 5CA0B 4BXIA 1YJWV 3HKDB 2BTZA 2P22C 4YKWA 2HHHB 4O4JA 5JCOA 4FZ0A 4Z1MG 3FYEB 4I0XB 1KQSU 3B77A 4DZYA 4X64B 5EIBD 3VADA 4KXRA 2QR4A 2Q0OC 3T1KA 1ROPA 5F5RA 2JGUA 1A32A 2JKIA 2GTSA 2Q8VA 3RYHA 3HPLC 4X9QA 1HR0B 3LNMB 3ZN0A 3T1YB 3A0HZ 4KHPB 4YY3O 4TWKA 3JATB 4V26A 3CWBH 4YKUA 4JYAO 2WPDG 4LF6O 2C1GA 4XKOA 2IWXA 4FIPC 5LXTB 4KUMA 1AR4A 4F6RA 5JH7A 2XX5A 3BVOA 4MVSA 4K8XA 1AP6A 2YJXA 4UCUA 4L90A 4XKAA 5M4HA 2ZDYA 3AG4B 4FCPA 3KG2A 4DUZO 1AI5A 3ETGA 3CP1A 1AH6A 1JFFA 2ITCC 1HNZO 1SERA 1THZA 3K58A 4DUHA 3CXHF 3UO3A 3Q5KA 4I50A 2EIMB 2LFRA 2XHXA 3CGZA 1XMOB 2BU7A 3ZXOA 2LJ2A 4JZ2A 4O05A 4NB5A 2ADPA 2YEJA 4UCOA 1W0JG 3ABLB 2EULA 1I59A 1NTKH 1S77D 5D7RA 1HR0O 2ZNJA 1AJ6A 2V1DA 3HZ1A 1RPOA 1V54B 4X9LA 1B06A 5LGTA 3T1HB 3RYFA 1I5BA 2P4VA 2YKIA 3E22A 4XD8A 2YI7A 2YEIA 2WERA 1AR5A 5CA1B 1VP7A 2YE7A 1TIDA 4MVMA 1AJNA 5LMUB 3RT3C 1XI1A 1Q8IA 1MX0A 5IE9A 3RYHB 1IBMB 2QKAA 2YUAA 1FFXA 5B5EZ 1OZ0A 4FJCC 4JI2B 2CCUA 4GX0A 1NHJA 3HHUA 4X1YB 1ZL8B 3CMEV 3K04A 4HZ0A 4HXZA 1S16A 3TTZA 4B3SO 3H80A 3ABMC 1S3JA 3JCUZ 1YDXA 4DV0B 5DN6G 4TOIA 4OPAA 3THOA 1DGSA 4PA4A 5D7CA 4LF9O 5CA0A 2R9IA 1K3EA 5FNVB 5L3FA 4PRVA 4ZOLA 5H9CA 1ENVA 1Y4UA 1THNA 2WLNA 1GKFA 1P4RA 4P9OA 3CC4V 3CB2A 3OUFA 1SQGA 4LF7B 1BMFG 1JA8A 1Y76A 1ZX3A 3UM7A 2UXBO 4X88A 3G75A 3N2KB 2UUAO 4R3AA 4NXNO 1W59A 2Q9LA 4HNAA 2YXLA 1I5DA 1XREA 1D2DA 3OR7C 1IVSA 3DC5A 1AP5A 4AWPA 1SKVA 2YEVA 2H3OA 2XJJA 5CF0A 4HBNA 3HKEB 1H2NA 4AILC 1FFTB 3AG4C 1UYMA 2A7WA 2VQEO 1XNQO 3RLQA 3CMAV 1H7UA 5J2TA 4MPNA 3CYOA 4MVUA 1V55B 1M9NA 3IC9A 4GEEA 1PVGA 1N34O 1OCZC 3L70H 3ZHVA 3JZ3A 5KX5B 4NVPA 4HYMA 2Q8IA 4L91A 4TV8A 4KHPO 1WA8B 2PYJA 1M5IA 3OMUA 1XILA 2OYQA 1H2SB 5H2FZ 2Q67A 2KQXA 4JYAB 3E8HA 4XE2A 1FPOA 2D3OW 2BYIA 1KP3A 4DV5O 4X8AA 4X1IA 4DV5B 3FV5A 3LSUA 2YEFA 4HXWA 2JS5A 3HEKA 5GONB 2MW2B 2AXTZ 2JEXA 1VF6A 4LWIA 1VF7A 2JDIG 3JAWA 4MP7A 3K57A 2ESAA 3O65A 4K35A 3IJ4A 2DE0X 5B1AB 3OEEG 3CPWU 3OW2U 4LF4O 1K4CC 2HJDA 3K3WA 1BE3H 2YE9A 1H2LA 4DK1A 3CWVA 4LH6A 1EFRG 2CK3G 5AG2A 4PDRA 3K0GA 4ZI7A 4YHHO 1MA1A 3O2FA 1Q81W 4O4LB 2JJ2G 4O2AA 3ASOC 1Q7YW 4JI5B 4GT1A 1U96A 2XAHA 2DOSA 4U3JB 1VQ7V 2ZKOA 5KUKA 4LBEC 4CBCA 2OCCC 4N21A 3CCLV 2Q73A 3MDSA 4LF7O 4GKKO 3OD4A 2FKXA 3CD6V 1H2KA 4QNHB 4GGLA 2OIEA 2UUAB 2CH4A 3T2MA 2ZE7A 2M6YA 3BPZA 5KMGA 1AI7A 2GTAA 2YIBD 2C2AA 2BE3A 4CS4A 2GFDA 2A3QA 4O2BB 1YHQV 1LNQA 2IWSA 2ETNA 4MVRA 4UV9A 4CZZA 1T5EA 2QWQB 3TJTA 5LP6C 4LC1A 4O4IB 4K4OA 1NJIW 1R3JC 3UT5B 2VQEB 1E1RG 4J7JA 3RWRD 3RN4A 3CCVV 1VQ6V 3FT8A 3SPJA 2ZR2A 3G71V 4PDMA 3MD0A 4UCTA 1S14A 2ZD9A 3CRCA 1JX9A 4LF6B 4I55A 1BHAA 2YI5A 3FX7A 3ZMTA 4FCRA 4BR6A 5B1OA 2QG0A 1UYEA 1FXKC 3B4SA 3K99A 3ZRSA 1YERA 1X4TA 5B1NA 5E79Z 5D5PA 5B66Z 4MVQA 2UXXA 2WLIB 1VQMV 1YESA 2QM7A 4WFHA 1ZW9A 2XHTA 4FFBA 4XDKA 3BEHA 5IYCO 4XC0A 3JARB 2E0AA 3A0YA 4MTOA 4XTJA 3K97A 2YSUB 1H2GA 4FFBB 1BQ0A 2QWRB 2RJZA 2WLIA 1K92A 5DEDA 3TZ4A 3GVMA 5L3DA 1E79G 4BW5A 4DV0O 4PRXA 5GTIZ 4X89A 3G67A 3ETEA 3U11A 3ZMVA 4FLZA 1TGOA 5KAIZ 1SS3A 4UXNA 5B1AC 4IYHA 4I55B 4DR2B 2XDKA 1BQZA 2EIJB 3AG2C 3SYPA 4Z1VA 1ZUQA 4OXSA 5IY5B 3CJHA 1Z5VA 2BU6A 2WLMA 1E1QG 2AKPA 3AG3B 5BMVB 2E5LO 4WBNA 1YTFB 4TV9B 3RYCA 4TUYB 4O4IA 1YITV 3ZHTA 2KSDA 3OE7G 3PEJA 5HFLA 3FYIB 2RQ6A 3A0RA 2O1VA 3R91A 1SA0A 2Q4PA 2XJGA 2FXSA 3KE6A 2YI9A 1NTZH 1YS3A 4LF8O 4H44B 2AGAA 3N2GA 1BXDA 3CRLA 2F1MA 1X59A 3KZIZ 3FD9A 1MNGA 1KKDA 5KHJA 3L72H 2W6IG 1UYLA 3EVKA 2PYLA 3STLC 1M1KW 4U3FH 3B2EE 3FKSG 2DMXA 5IJ0B 4JV5O 2UXDB 1P7GA 1PV0A 3ZIAG 5IY5C 3Q4HA 4O4LA 1MABG 2EILB 4EGIA 3DXRA 1YZBA 2YIDA 3A0WA 1GN4A 1SQFA 1V54C 3QF7A 4MW3A 4ZVIA 2BU8A 1JVMA 2UU9B 4JI3O 2JIZG 4BQJA 2H94A 3K59A 1NH2B 5CB4B 4X66O 1QCEA 2UXNA 4MT8A 2IU3A 1VQNV 5GONA 5CMUA 2QKSA 3GWOA 2XX2A 2EX3A 3HYZA 2ZDIC 4JI4O 3A8TA 3QO5A 3FT5A 1EI1A 1NZ6A 4QPJA 5ITZB 2OT5A 4PA6A 3TGUH 1Q5OA 3H1HH 2VQFO 1UYHA 4JTAB 1ZLZA 1L1FA 4X62O 4PDLA 3K08A 4K8ZA 4GT8A 1AM1A 2YE4A 1J95A 1MSWD 5LMUO 1VQ5V 1GM9A 1UYFA 3GIGB 2NNUA 2EINB 4GCZA 1SQQH 3HKCB 1FJGB 3JCZA 4UB6Z 4TSFG 2DWEC 1QNMA 3BA8A 4JI6O 1FD9A 4PL9A 2A9HA 1N36O 3B09A 3HKEA 3EKRA 3CGYA 2Z5UA 4WF9V 4CE1A 3ZHQA 2AZ2A 4LH7A 1MU5A 1YC1A 5EBLC 3TZ5A 4BIUA 4YHHB 1KBHA 1LR1A 4HNAB 4LWGA 3SPHA 2WI1A 4D7TA 2Y69C 3ZJZA 3T0ZA 1XL4A 1ORQC 4PELA 1Y76B 2ILMA 3W7TA 4DUYO 2ZNIA 1US6A 1WJZA 2P06A 1Y67A 3MAQA 5M4EA 1QLNA 5FWKA 1RP3B 4X65O 5A2QN 1Q6IA 4JTDB 1KYOF 2EIMC 3NMQA 1TUBB 4KFMA 2Q7EA 5LHGA 2XX4A 3CHXA 4O4HA 1IURA 4WCEV 4JI6B 2ZKJA 4YKXA 2XDUA 2CTPA 2JRIA 3BAAA 4J7ZA 4FK5C 4WFAV 4X64O 3ZHSA 1P49A 2UUBO 3U67A 4QE9A 3LMMA 1FFXB 1RM1B 2QWOB 1AMWA 5M4KA 1US7A 3G7BA 3CCMV 2CH7B 3WB2A 3D3QA 4QPKA 3WU2Z 1Y8PA 5CTYA 5JQGB 5H5NA 2EIKC 2WI6A 1I5XA 2VCJA 1SETA 3JD3A 4DW1A 5CA1A 2XDSA 3BHPA 4IYIA 1N0JA 1BHBA 1COWG 3E22B 3AG3C 4B3MO 4XIQA 4H13B 5IN9A 3JALB 4XDJA 4I3HA 1QLEC 1K73W 3L73H 4X1KB 4J41A 2IJJA 2XD6A 1IXMA 4C7UA 3P3NA 4QIWF 3OAAG 1UY8A 5CTUA 4U93A 3J80N 4CC5A 2ZE8A 1CXZB 1I5CA 3C0EA 1N32O 3IAYA 2EBOA 1JFFB 2FL4A 4IIJA 1KU9A 1B04A 4PHZA 4JI8B 1YC4A 4WUBA 5LGNA 3W7XA 5IDMA 2GUZB 1GAXA 4PU9A 1NU1H 5JH7B 5FPOA 4URLA 1I5AA 3LNNA 3TUHA 4MVZA 5GGZA 1AILA 2XK2A 4DR2O 4TQFA 2EXLA 3JATA 4Q20A 5JJJB 2FB5A 2BT0A 4CE3A 3CRRA 1AJQA 2YK2A 2R9RB 3ZRWA 2LFSA 2UXBB 2H8PC 1IBMO 3OW6A 3X2QB 1JPXA 1BGQA 2Y4UA 4PA3A 2YC0A 4CH5A 2E5LB 2IORA 4I0XA 4DR1O 2CH7A 3JASA 3IEDA 2FYPA 1R3LC 4YKTA 3WB1A 3HKDA 3LPSA 1IDSA 1L0OA 5JENA 2AHYA 4FLXA 4R7CA 1YF2A 4WFFA 1OCRC 3FAVA 1NQTA 1DF4A 5KAFZ 4O4HB 4DK0A 2BSMA 5KHKA 1GN3A 3SYCA 4H33A 2UUCB 2WAMA 5M4NA 5C8YA 1EM1A 4UFZA 3ZN1A 4RUEA 1TUBA 1U0ZA 2HP8A 3TZ0A 4L8JA 2GSMB 2CAZC 2Q8HA 3AG1B 3DGEA 3T4DA 2YI8A 4IHJA 2V4DA 4NTXA 4R8CA 3B28A 4NTYA 2P7TC 4DR1B 4LNUB 4LP8A 4CH4A 1NT2B 1Y74B 5LYJB 3CRKA 3CRQA 2DYRB 4I7ZB 2QWPB 1TVKA 4RQFA 4ICGA 2X6BA 2CTWA 4DV3O 2VWKA 1XMQO 3ETQA 1JQ0A 4CE2A 1L8DA 4YKQA 3K98A 3R4NA 1M57C 1XQ8A 3ABTA 4B3TB 1J5EB 5LA6B 4L87A 4DR7B 3W7SA 2YKJA 1V9PA 3RW0A 2BTQB 4URNA 2ATKC 1H38A 4JI4B 5IDJA 3ZM7A 2YGEA 5F3KA 2AHZA 1VMGA 3PEHA 3OPDA 3QTFA 2KG7B 2Q68A 1KUQA 2YEAA 2UUCO 1EA6A 4DV7O 3WQ9A 1H2MA 5IWAO 2WWWA 2V7QG 3HZ5A 2DW4A 3CC2V 3SYOA 4ASUG 3QO8A 2Z0AA 4CH3A 1F51A 3JSNA 5LOVA 2FWYA 3OMIB 3WHAA 5B1BB 2HG5C 1PKXA 4IGGA 3AK2A 4FLYA 2F93B 5ITZA 4JQLA 4J11A 1TC6A 1NVPD 1SQVH 1UYGA 4MB9A 1NR1A 4GX1A 3H1IH 2R72A 2VRZA 5IJ9B 2XDLA 2ZINA 1IBKO 1XMQB 1B3QA 2BSKA 4I4TB 4P9PA 4ZHQA 3K5NA 2BTOA 2VWCA 2XT9A 2Q0AA 3G4SV 3WG7B 1HWYA 1PNMA 1YSCA 4FFKA 4X20A 4DRXA 5CB4A 2ZE5A 1K34A 4XDMA 2QJ1A 2RMKB 3ZHRA 1PL0A 1LUVA 5EBMC 1XL6A 3DXRB 5FPRA 5LP6A 2N74A 3NR7A 1BZKA 5KHGA 5BR8O 3Q4HB 5IWAB 3FB8C 3VOUA 5JJNB 1R73A 4LP0A 4DR5B 1JM6A 2CGOA 4YJ3B 4XITA 1F23A 2H8MA 1M56C 3NXSA 1KC8W 3LNUA 3T4ZA 1Y8NA 2KKWA 2QG2A 5L3JA 1WLEA 4LWHA 2QKCA 1S5JA 2EINC 5EBWC 3O6OA 1O9GA 2HHIA 3CEIA 4B7PA 4ASGA 4B3RB 1PNKA 2E3CA 1GM8A 3LUTB 4YJ2A 2GDSA 4OX9B 2HG1A 2WI2A 5KHIA 5D6PA 2LGWA 4NXMB 1R3KC 3ICXA 4FLTA 1QR8A 1EZJA 2IW5A 3LDDA 1YTFD 4L94A 4PDVA 4A5UB 1R6KA 3RYCB 4P30A 2XJXA 1L0LH 1N33B 3G6BA 2VWJA 4GX5A 3KCYA 4DV7B 3CJHB 4DR6B 4PA9A 5LMNO 2BZ5A 2XAFA 2WLLB 4MPCA 3B26A 1XNRB 5EC1C 3MHHC 1RPRA 1U97A 3C3TA 4K0KB 3LDEA 3QVNA 4D7SA 4FM0A 3H1JH 3EHGA 2CGNA 3ABUA 1MMMA 4W4LA 3BMYA 5FNDA 1W2BU 3ABLC 1YXBA 1Q82W 2YEGA 1SQBH 2QF6A 1Q3EA 2YIBA 4NH9A 1J5EO 3QTCA 4DV1O 4AI8A 2WEQA 3B24A 3VHAA 3VQWA 3E83A 4UVBA 1YVWA 5K1PA 1FYJA 2ZBKB 2OCHA 3T1HO 4EEQA 3K9AA 4DUYB 3E89A 4JZGA 3BRCA 2ADQB 2YS8A 1FXKB 1MZFA 4CWTA 1GRJA 1SC5B 1NR7A 1Z5AA 1XBLA 4PI0A 2N04A 4XKKA 3CCSV 5CA3A 2YEHA 4PJ0Z 3GIEA 4H0LB 2IWUA 2IJKA 2HCHA 2RCVA 3CX5F 2IJIA 5EK0A 2ZE6A 4ASAA 3JAKB 4EKWA 2CTRA 3CRMA 2OTJV 2CTQA 2UXCO 3K60A 2A0LA 1QVGU 2BU2A 1BYQA 4DV6B 4OX9O 4KSGA 2JVDA 4O2BA 1ZSPA 4UROA 3JAKA 3I5DA 2XAQA 5FNCA 3C3SA 4H7QA 4UCVA 1D5NA 5FL7G 3T10A 3P32A 4ABMA 5KMGB 2AZ0A 1AJPA 3ZRVA 2Q69A 3WB0A 5JJEB 2QEXV 1KECA 1OCCB 5BXZA 1UPGA 1XHZA 3SR2C 3INWA 4AWOA 4E02A 4JV5B 3G6EV 1N33O 3R4OA 1NVPB 3FB7C 4DR4O 2YDEA 2B1IA 4DRXB 1XOUA 2BCCH 1YT2A 1RM1C 3IGAC 2F4VO 4O2AB 3VQXA 2WA3A 2Y0PA 3ABMB 5KA6A 3D3IA 1R6TA 2XOKG 4NXNB 2FTKA 2BSKB 4I4TA 3JD2A 5LHIA 1S5LZ 2IJHA 5IJ9A 2C1IA 1VQ8V 1GK9A 4HZ5A 2JJCA 1B63A 1KP2A 2OIGA 4DV2B 5E1AC 4DW0A 1BS3A 2FMLA 2CCSA 5CTXA 3HB3B 2E76B 3JAWB 4HAMA 4DV1B 2IBZH 1QBZA 1TBWA 1PD3A 2VS0A 5KHHA 2LW7A 5B3SB 2R70A 1Q90D 3CSXA 2O1UA 1L0NH 1QQCA 4EEHA 1MOFA 3RLRA 1OCOB 1BCCH 3ZHUA 3F5TA 4EM7A 3CCRV 3AG2B 2WLLA 3JYCA 2A79B 1EBOA 3SYAA 1KKCA 3SJBC 3SJAC 4JAUA 2JK5C 3ZKDA 2KG7A 1F4MA 5EZYA 3TETA 3OWBA 4Q6GA 1ZTEA 1WA8A 4CWPA 3JD0A 5A9GA 2CUGA 1K5QA 4GLXA 1AI4A 2EIJC 5CBHA 5KX5A 3AG7A 1AB3A 4FCQA 2PI4A 1PPJH 4OGQB 5LA6A 2DYRC 3PN1A 1GKZA 4Z2WA 4B6CA 4JI1B 4CC6A 3ABKC 1ZXMA 1NH2D 1ZWHA 2EILC 2OWOA 1N36B 2XCMA 4FM2A 3CYGA 4JTCB 1ZAUA 1AR1B 2YGFA 2WLHA 2F23A 4FLWA 4J10A 5LYJA 1Y74A 2UXCB 5BZBA 4W7TA 4GFNA 3K79A 3OFNG 1AH8A 3ASOB 4IHJB 3JD4A 4XCLA 1VQLV 3VQVA 1WAZA 2P6JA 4YJ3A 4LFBO 1K97A 3QG5A 1OJHA 3RLPA 5GW7A 2P67A 5F2VO 2GQPA 3AK1A 4E01A 5C93A 5IYZB 1P84F 5LP6B 2QM8A 3FAVB 4DO2A 2VW5A 2ZIMA 3H4LA 3RKZA 1M56B 4JI7O 5CPHA 4X20B 4CWQA 2XTAA 4EB6B 1WPXA 4NKGB 4B3TO 2QSAA 5BOCA 2ZCEA 2WI3A 4ZHQB 1I08A 4QJFB 4DV2O 2GV9A 4KTNA 1R6NA 4F4LA 3OUSA 4DYLA 4FVMA 2F66C 2O57A 3A0BZ 5CN0A 3A0XA 4GKJO 2B1GA 1WP8A 3ETDA 2M7WA 1OCZB 1YC3A 1G6UA 1WB8A 3ZX6A 1HDJA 3SJQC 2HVJC 5D7DA 2HVKC 3R92A 2QWNB 5LOVB 2Q2EB 5L3EA 4B3MB 1S72V 5GTHZ 4X62B 3L74H 1Z2GA 3R4PA 3T2SA 4G2KA 1B6QA 2OCCB 3L9DA 2KB1A 1OV9A 3AK3A 1XEQA 1G1XB 4UCSA 5IYDO 1JJ2U 3E8FA 4GQTA 4MPEA 3Q5LA 4L93A 4ASBA 4P8OA 3K03A 2UU9O 4LF8B 4E00A 4WFBV 3B8MA 5J2UB 4K3AA 5JWPA 1HNZB 2BTQA 2BREA 1U2OA 5HFMA 5M4MA 3R66A 3IC7A 3ASNC 3UQ8A 3A0ZA 2F43G 1VF5B 1OHHG 4I50B 4F6EA 3VQYA 4UUJC 4ZKIA 4YKZA 3M8AA 4UCRA 3E8GA 5CBGA 3E8BA 5J71A 2WI5A 1F4NA 1H7SA 1GTOA 4LFAO 1Y6XA 4GKJB 3OT7A 1N34B 4X1KA 1GM7A 2DJVA 2EIKB 1XHXA 1WPBA 1OSFA 4MBCA 4F6RB 4LNUA 4UB8Z 4WFEA 5LXTA 3BFRA 4AWQA 2Q7GA 3R65A 3SYQA 2E75B 4TT3G 4X65B 3DSQA 3CRAA 5LL6Y 2QTOA 5JQGA 4LFBB 4LWSA 3D36C 1R62A 2CCTA 4IL6Z 1FXVA 2QGNA 3WG7C 1CPYA 4MTGA 4JGSA 5C8YB 1RSOB 1FKAO 1UY9A 2HEPA 3ZMZA
chains in the Genus database with same CATH topology
1YESA 2QM7A 4G27B 2K1EA 2X6CA 1NVPD 3GB7C 3K0DA 4WFHA 3RVYA 1UYGA 1ZW9A 2XHTA 4MB9A 4JASA 1NR1A 4XDKA 3BEHA 5IYCO 4GX1A 4XC0A 2IU0A 2E0AA 3M99B 3IFXA 1CEZA 1BKNA 3A0YA 4CWNA 4MTOA 2XDLA 4XTJA 3K97A 2O1WA 2YSUB 1H2GA 4RUFA 4P9PA 1B3QA 2ZR3A 3INXA 3FB6C 3OEHG 4RO2A 2XDXA 2WLIA 3W7WA 2VWCA 1K92A 2YEBA 3TZ4A 1QR9A 5L3DA 1QYEA 1E79G 4NH8A 4BQGA 4BW5A 5CTWA 3G4SV 4PRXA 3WG7B 1NHHA 3O0IA 1HWYA 1PNMA 1YSCA 3MHSC 4DXWA 4X89A 5B1BC 3ZMVA 3ETEA 1K34A 4WFGA 4E2LA 4BAEA 4XDMA 4JYBA 1PL0A 2NLJC 1QVFU 4PA7A 5EBMC 3OGCC 1XL6A 1P7BA 4UXNA 5B1AC 3TK1A 2CGFA 2XDKA 2W6JG 4WUCA 2EIJB 3GIFA 3AG2C 1Y4MA 3SYPA 2YKBA 3FB8C 3RVZA 1K8AW 4OXSA 2HKOA 3VOUA 5IY5B 1R73A 5M4PA 5FNFA 4LP0A 2DYSB 1JM6A 5B3SC 3ZRWB 2WLMA 4JAVA 1E1QG 2AKPA 2BU6A 3I56V 3AG3B 2YGAA 2CG9A 3ZRXA 4XITA 1YTFB 4HY1A 3R4MA 3I55V 2HJFC 2HR3A 2YEDA 1F23A 1YITV 2Q6AA 3OE7G 1Z5CA 2H8MA 1R3IC 5HFLA 2MK3A 1M56C 3FYIB 4XDLA 3ASNB 2XABA 1SESA 4QE7A 3OWDA 3A0RA 2O1VA 4H37A 4CWFA 3NXSA 3R91A 2YJWA 4FMTA 1KC8W 1KD1W 3T4ZA 3LNUA 1Y8NA 2QG2A 2VCIA 2XJGA 4YKYA 4EFUA 2ZDIA 5L3JA 1WLEA 4LWHA 3K06A 2FXSA 3KE6A 1YS3A 2EINC 5EBWC 1BXDA 1Z59A 3CRLA 3O6OA 4B7PA 1VQKV 4ASGA 1Y66A 4R1FA 1PNLA 1ID0A 1PNKA 1GM8A 3LUTB 3H01A 1S76D 5KUMA 2YEVB 2WEPA 2HG1A 2WI2A 3CXCU 4R6ZA 2WSSG 5CBFA 5D6PA 1KKDA 1R3KC 3FB5C 1QR8A 1YSZA 1EZJA 2IW5A 3LDDA 2UWDA 3SL2A 4XKOA 1YTFD 2W6IG 3SPCA 3LDCA 1UYLA 4L94A 4CWOA 4PDVA 2HLDG 4KFGA 3F7YC 1R6KA 3EFFK 2YKEA 4P30A 1YJ9V 2XJXA 4O09A 2K5BA 1N8RW 3STLC 2IH1C 1YJNV 1M1KW 1JCHA 5J6AA 1GMGA 3FKSG 3BY6A 1Y8OA 4CWRA 4GX5A 4EMVA 1FXHA 2X0LA 3ML0A 2Y69B 3ZIAG 1VQ9V 5IY5C 3B8NA 1W0KG 4HZ3A 3LSSA 4PA9A 1UY7A 2XAFA 2WLLB 3E86A 1UJWB 2BZ5A 3B26A 4MPCA 3TCUA 5EC1C 2FWZA 3EHHA 3OM3B 1MABG 2EILB 1RPRA 3MHHC 2YE5A 4EGIA 1OCRB 3LDEA 2XNDG 3A0WA 3ABKB 1H8HG 1V54C 4MW3A 1UYKA 3EHGA 4L8ZA 2BU8A 1JVMA 4ZVIA 4ZBMA 2JIZG 3ABUA 4BQJA 2H94A 4WUDA 4BXIA 1YJWV 1NH2B 3BMYA 5FNDA 5M4HA 1W2BU 3ABLC 2BTZA 1Q82W 2YEGA 1QCEA 2Y48A 2QF6A 4NH9A 2UXNA 4YKWA 4RQEA 4MT8A 4URMA 1UYDA 2IU3A 1VQNV 4Z1MG 3FYEB 4EFTA 1YT1A 2WEQA 2YEEA 1KQSU 3B24A 2WLJA 5CMUA 3VHAA 2QKSA 3GWOA 3B77A 2XX2A 3BM9A 3DTUB 3E83A 4UVBA 4DZYA 3HYZA 2ZDIC 3U2DA 2IOPA 3VADA 1SRYA 3QO5A 1UYCA 1EI1A 3FT5A 3P30A 2ZBKB 3T1KA 4QPJA 1ROPA 5F5RA 2OT5A 2JKIA 2ZQMA 3K9AA 4PA6A 4MOTA 4XIPA 4EGHA 3E89A 4YKRA 3HPLC 1UYHA 4JTAB 3LNMB 4J9YB 1L1FA 3ZN0A 3ZKBA 4PDLA 1FXKB 2EZPA 3K08A 4CWTA 4TWKA 1K5SA 4GT8A 4XIRA 4V26A 1AM1A 4MPEA 4YKUA 1NR7A 1Z5AA 2YE4A 1J95A 1MSWD 1UYFA 1VQ5V 1GM9A 2WPDG 3GIGB 2NNUA 2EINB 4XKKA 3CCSV 2IWXA 4GCZA 5CA3A 2YEHA 2IH3C 4FIPC 4ASFA 3GIEA 4KUMA 2IWUA 4O07A 1H8EG 2XX5A 2IJKA 3JCZA 4MVSA 4TSFG 1MG1A 3SPGA 2DWEC 2YJXA 2DYSC 2HCHA 4L90A 4XKAA 5D6QA 1YI2V 3AG4B 2PI5A 3OMNB 2IJIA 3KG2A 5EK0A 2ZDYA 4FCPA 4O0BA 1AI5A 3ETGA 4PL9A 2A9HA 3CP1A 1AH6A 2X6AA 2ITCC 4EKWA 3ZMSA 1SERA 4ASAA 1THZA 4HYOA 3EKRA 4DUHA 2PNRA 3CGYA 2Z5UA 4WF9V 2OTJV 3Q5KA 3OR6C 2EIMB 3K60A 2LFRA 5LGUA 1GJVA 2XHXA 2A0LA 4CE1A 3CGZA 1QVGU 1MU5A 1YC1A 1BYQA 2BU7A 5EBLC 2BU2A 3TZ5A 1S5HC 4BIUA 4KSGA 3ZXOA 1M57B 4O05A 2B5UA 3B25A 4UVAA 2YEJA 3A0TA 4LWEA 3SPHA 3CC7V 4LWGA 4UROA 1W0JG 3TZ2A 5BODA 2XAQA 5FNCA 3ABLB 2WI1A 1I59A 4H7QA 2DWDC 5FL7G 4U7OA 1YSRA 1QLEB 5D7RA 2Y69C 1S77D 2Q8FA 3T10A 3ZJZA 2HKJA 3P32A 1XL4A 1ORQC 4PELA 1AJ6A 3T0ZA 2V1DA 3W7TA 1RPOA 1V54B 1JOYA 3VBBA 1DF5A 1DLBA 5LGTA 1AJPA 3G7EA 1I5BA 3ZRVA 2Q69A 2QEXV 2YKIA 3E2EA 3QO7A 2YI7A 1KECA 1OCCB 4XD8A 4BIZA 5M4EA 3GIGA 3INWA 1QLNA 3RLRA 2YEIA 4AWOA 4E02A 5FWKA 2WERA 3VHDA 1ZWIC 3G6EV 2YE7A 1TIDA 4MVMA 1AJNA 3R4OA 1QY8A 4JTDB 2EIMC 1NVPB 3T0HA 3FB7C 3NMQA 2B1IA 1MX0A 1YT2A 4KFMA 1RM1C 4AS9A 3IGAC 5LHGA 2XX4A 1OZ0A 3HZ1A 2WI4A 3ABMB 4FJCC 4X9LA 5KA6A 2CCUA 4GX0A 3D3IA 2XOKG 4WCEV 1NHJA 2ZKJA 2FTKA 3HHUA 4R3MA 3JD2A 3RBZA 2XDUA 4YKXA 5LHIA 3CMEV 4CWSA 2QE7G 3K04A 2IJHA 4HZ0A 4HXZA 1VQ8V 1GK9A 4LCUC 1S16A 3TTZA 4FK5C 4HZ5A 1FS0G 1I5YA 4WFAV 2JJCA 3H80A 3ABMC 1S3JA 3VHCA 1K9MW 1B63A 3D2RA 1G8MA 1KP2A 2QA4V 3U67A 4QE9A 5E1AC 2WLKA 5DN6G 2CCSA 5CTXA 1RM1B 3HB3B 4H85A 3D36A 4HAMA 1AMWA 3PJSK 5M4KA 1US7A 1QBZA 4YXWG 3G7BA 2JJ1G 4PA4A 1TBWA 1PD3A 3CCMV 5D7CA 3SPIA 4BAYA 1YT0A 2BOCC 5H6RA 5B3SB 2R9IA 4QPKA 4U7NA 2Q8GA 4LPBA 1K3EA 1Y8PA 5CTYA 5L3FA 2O1UA 5L3BA 4PRVA 2EIKC 2WI6A 4EEHA 1I5XA 1MOFA 2VCJA 1VQ4V 1SETA 3JD3A 1OCOB 2LP7A 5H9CA 5H6QA 3W7UA 2XDSA 4O04A 1ENVA 1Y4UA 1OCCC 4MTXA 1BHBA 1THNA 1COWG 3CCRV 2WLNA 4MS2A 3AG2B 3X2QC 2WLLA 1VQPV 2YE2A 1GKFA 3JYCA 3CCUV 1P4RA 2A79B 3AG3C 4P9OA 1YIJV 3CC4V 4XIQA 1EBOA 3E35A 3SYAA 5IN9A 3OUFA 5LHHA 4JAUA 2JK5C 1BMFG 3ZKDA 4I3HA 4XDJA 1QLEC 3UM7A 1YETA 4N23A 1F4MA 4JF3A 3TETA 4X88A 1K73W 3OWBA 3G75A 4CWPA 3T1CA 4XCJA 5J9PC 3EHBB 3JD0A 1ZXNA 4KSHA 1K5QA 3WFVA 2IJJA 2XD6A 4R3AA 1AI4A 2EIJC 3LSQA 5CBHA 5L3GA 3F5WC 3CCEV 4EM7A 1I5DA 4FCQA 2PI4A 1IXMA 3OR7C 4P7AA 2DYRC 1GKZA 2YE6A 4QIWF 4B6CA 3OAAG 1UY8A 5CTUA 4U93A 2EZOA 3ABKC 1ZXMA 1G4YB 1NH2D 4AWPA 1V55C 1ZWHA 2W0FC 2EILC 2XCMA 2YEVA 1I5CA 2XJJA 3C0EA 1K7DA 1UYIA 4HYPA 5CF0A 4JTCB 4KTNA 2EBOA 4LWFA 1FFTB 1AR1B 2YGFA 1DTOA 3AG4C 4WUBA 1UYMA 1YC4A 2WLHA 5LGNA 4KP4A 3W7XA 2DQ0A 3CMAV 1H7UA 1KZNA 3RLQA 5IDMA 4MPNA 3PEJA 2ITDC 3CYOA 2HFEC 1Z5BA 5BZBA 4PU9A 3JD1A 1S0VA 4MVUA 4W7TA 4GFNA 1V55B 4URLA 1M9NA 1AROP 1I5AA 3K79A 4GEEA 3TUHA 4MVZA 1PVGA 3OFNG 1AH8A 1OCZC 3ASOB 2ZDXA 5GGZA 2XK2A 3JZ3A 3JD4A 4MSWC 2EXLA 4Q20A 1BL8A 4XCLA 1VQLV 2BT0A 4HYMA 1FXKA 4L91A 2Q8IA 1AJQA 2P6JA 4CE3A 2YK2A 4MTFA 1K97A 2R9RB 3ZRWA 5KA5A 1GKXA 3OMUA 2LFSA 2Z3YA 5J71A 1SZTA 2Q67A 4UV8A 2OTLV 2WI7A 3E8HA 2H8PC 2D3OW 4XE2A 3RLPA 2BYIA 3OW6A 5GW7A 4NH7A 1KP3A 2P67A 4X8AA 2H55A 2X7RB 1TILA 3F7VC 2GQPA 3Q5JA 3X2QB 3FV5A 1JPXA 1BGQA 4E01A 5C93A 1NKDA 2YEFA 2QM8A 4JPRA 2DQ3A 4PA3A 5L3CA 4DO2A 2VW5A 1B62A 4HXWA 2IORA 3H4LA 2QFOA 3HEKA 2ZXWB 1M56B 2P90A 3RKZA 4EGKA 4HY6A 5CPHA 2JEXA 3IEDA 1TC0A 4CWQA 1WPXA 4H81A 4LWIA 2JDIG 2FYPA 4R50A 1R3LC 4XBFA 1QZRA 4MP7A 2ESAA 4YKTA 5BOCA 4RAIA 2WI3A 3EHJA 3OW2U 5B1AB 3OEEG 3CPWU 3LPSA 3ZCCA 4QJFB 5LBQA 1L0OA 4K4OA 1K4CC 2AHYA 1R6NA 2EJRA 3K3WA 4F4LA 2YE8A 2YE9A 3CWVA 3OUSA 1EFRG 4R7CA 4WFFA 1OCRC 2CK3G 4I5SA 3ZMUA 5CN0A 4GX2A 4PDRA 3A0XA 1NQTA 1DF4A 2B1GA 3K0GA 3ETDA 3O2FA 2M7WA 2BSMA 1Q81W 3C11A 2YI0A 2JJ2G 3AG1C 3SYCA 1OCZB 3ASOC 4H33A 2WAMA 1Q7YW 5M4NA 4GT1A 1YC3A 2XAHA 1VQ7V 3ZN1A 3CCQV 4RUEA 5KUKA 2YECA 3SJQC 1U0ZA 2YKCA 4LBEC 4CBCA 2OCCC 3TZ0A 2HVJC 4N21A 3STZC 3CCLV 2HVKC 5D7DA 2GSMB 3R92A 2Q2EB 2Q8HA 5L3EA 3AG1B 1S72V 3CD6V 3DGEA 3T4DA 4P2ZA 3QNEA 4QNHB 4GGLA 2IOQA 3CCJV 4R8CA 2CH4A 3B28A 4G2KA 5DM6V 3R4PA 1B6QA 3T2MA 3T2SA 2OCCB 2P7TC 2KB1A 2XHRA 1TUEB 1CP9A 4LP8A 4MW8A 4JYCA 1K33A 3HYYA 5IYDO 1JJ2U 3E8FA 3CRKA 2YK9A 4GQTA 1AI7A 4MVOA 1Q86W 2DYRB 2BYHA 2YE3A 1Y4SA 3EKOA 3Q5LA 4L93A 4MP2A 4P8OA 3ZXQA 3K03A 4RQFA 4ASBA 4E00A 2C2AA 4WFBV 3B8MA 2X6BA 4G28B 3U2KA 2GFDA 3D0BA 1YHQV 2XAGA 2JEUA 1LNQA 2BREA 1JQ0A 2IWSA 4CE2A 1U2OA 3K98A 4YKQA 4UVCA 5HFMA 4MVRA 1M57C 4UV9A 3R4NA 5M4MA 4CZZA 3IC7A 2ZXWC 4KQVA 3ASNC 4I9WA 3ABTA 3A0ZA 3EHFA 2F43G 1I58A 1OHHG 4L87A 3W7SA 4ZKIA 4UUJC 2YKJA 4YKZA 2BU5A 3RW0A 3AEIA 4LC1A 4URNA 2GHYA 1VQOV 2ATKC 3E8GA 3E8BA 5CBGA 5IDJA 1F4NA 1NJIW 1R3JC 1H38A 1GTOA 1H7SA 2WI5A 2YGEA 3B27A 5F3KA 2AHZA 1A4HA 1E1RG 3CCVV 1OCOC 1VQ6V 3FT8A 1GM7A 2EIKB 2XASA 2YI6A 4FPPA 2BOBC 3PEHA 4J9ZB 3SPJA 3OPDA 3QTFA 1OSFA 2Q68A 4MBCA 2ZR2A 3ZM7A 3G71V 2YEAA 4PDMA 3QDDA 3MD0A 1EA6A 3WQ9A 1S14A 4WFEA 2ZD9A 4AWQA 2WWWA 5IYBO 3R65A 3SYQA 2V7QG 3HZ5A 1K4DC 1NBMG 4TT3G 3UKMA 1JX9A 2DW4A 3CC2V 3SYOA 1NHIA 3OMAB 4ASUG 1BHAA 2YI5A 3QO8A 1F51A 2QTOA 3ZMTA 4FCRA 2XAJA 2FWYA 4V25A 3OMIB 5B1OA 2QG0A 1R62A 3MNRP 5B1BB 1FXKC 1KIJA 1UYEA 2CCTA 3WHAA 3K99A 1FXVA 2HG5C 3ZRSA 1YERA 3WG7C 1CPYA 1PKXA 4MTGA 5B1NA 1AI6A 4JGSA 1GO3F 5EC2C 2BRCA 4MVQA 1UY9A 1M90W 2UXXA 1TH8A 1UY6A 4JQLA 2WLIB 3ZMZA 1TC6A 1VQMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YES A;  2QM7 A;  4WUD A;  1UYG A;  1ZW9 A;  2XHT A;  4MB9 A;  4JAS A;  4XC0 A;  2E0A A;  1BKN A;  3A0Y A;  4CWN A;  2XDL A;  4XTJ A;  3K97 A;  2O1W A;  1B3Q A;  3INX A;  2XDX A;  2VWC A;  2YEB A;  4BQG A;  3TZ4 A;  1QYE A;  4NH8 A;  5CTW A;  4PRX A;  1NHH A;  3O0I A;  4BAE A;  4XDM A;  4JYB A;  3TK1 A;  2CGF A;  2XDK A;  4WUC A;  3GIF A;  2YKB A;  5M4P A;  5FNF A;  4LP0 A;  1JM6 A;  3ZRW B;  2BU6 A;  4JAV A;  2AKP A;  2YGA A;  2CG9 A;  3ZRX A;  4XIT A;  4HY1 A;  3R4M A;  2YED A;  3PEJ A;  1Z5C A;  2H8M A;  4KSH A;  2XAB A;  3OWD A;  3A0R A;  2O1V A;  4CWF A;  3NXS A;  3R91 A;  2YJW A;  4FMT A;  3LNU A;  4YKY A;  1Y8N A;  2QG2 A;  2VCI A;  2XJG A;  4EFU A;  5L3J A;  4LWH A;  2FXS A;  3KE6 A;  1YS3 A;  1BXD A;  3O6O A;  1Z59 A;  3CRL A;  4B7P A;  4ASG A;  4R1F A;  1ID0 A;  2WEP A;  2HG1 A;  2WI2 A;  5D6P A;  1YSZ A;  3SL2 A;  2UWD A;  1UYL A;  4L94 A;  4CWO A;  4KFG A;  2YKE A;  2XJX A;  4O09 A;  2K5B A;  5J6A A;  1Y8O A;  4CWR A;  4EMV A;  4KQV A;  2BZ5 A;  1UY7 A;  4MPC A;  3B26 A;  2FWZ A;  3EHH A;  4EGI A;  2YE5 A;  3A0W A;  4EFT A;  3EHG A;  4ZVI A;  1UYK A;  4L8Z A;  2BU8 A;  4BQJ A;  4BXI A;  3BMY A;  5FND A;  2BTZ A;  2YEG A;  2QF6 A;  4NH9 A;  4YKW A;  4MT8 A;  4URM A;  1UYD A;  1YT1 A;  2WEQ A;  2YEE A;  3B24 A;  3VHA A;  2XX2 A;  3BM9 A;  4DZY A;  3HYZ A;  3U2D A;  2IOP A;  3VAD A;  1UYC A;  1EI1 A;  3FT5 A;  2ZBK B;  3T1K A;  4QPJ A;  5F5R A;  2JKI A;  4EGH A;  4MOT A;  4XIP A;  4YKR A;  1UYH A;  3ZKB A;  4CWT A;  4GT8 A;  4XIR A;  4V26 A;  1AM1 A;  4YKU A;  1Z5A A;  2YE4 A;  3GIG B;  1UYF A;  4XKK A;  4XKO A;  2IWX A;  4ASF A;  4GCZ A;  2YEH A;  3GIE A;  2IWU A;  4O07 A;  2XX5 A;  2YJX A;  4L90 A;  4XKA A;  5M4H A;  2HCH A;  5D6Q A;  3ZXQ A;  2ZDY A;  4FCP A;  4O0B A;  4PL9 A;  4ASA A;  1AH6 A;  3EKR A;  4DUH A;  2PNR A;  3CGY A;  3Q5K A;  3K60 A;  2LFR A;  1GJV A;  2XHX A;  4CE1 A;  3CGZ A;  1MU5 A;  2BU2 A;  1YC1 A;  1BYQ A;  2BU7 A;  3TZ5 A;  4BIU A;  4KSG A;  3ZXO A;  4O05 A;  3B25 A;  2YEJ A;  3A0T A;  4LWE A;  4LWG A;  4URO A;  3TZ2 A;  5BOD A;  5FNC A;  2WI1 A;  1I59 A;  4H7Q A;  3T10 A;  1YSR A;  4U7O A;  5D7R A;  2HKJ A;  3T0Z A;  3P32 A;  1AJ6 A;  3HZ1 A;  4X9L A;  1JOY A;  3G7E A;  1I5B A;  3ZRV A;  2YKI A;  4XD8 A;  2YI7 A;  4BIZ A;  5M4E A;  3GIG A;  3INW A;  4AWO A;  2YEI A;  5FWK A;  4E02 A;  2WER A;  3VHD A;  2YE7 A;  1TID A;  3R4O A;  1QY8 A;  3T0H A;  3NMQ A;  1MX0 A;  1YT2 A;  4AS9 A;  2XX4 A;  2WI4 A;  2CCU A;  1NHJ A;  2ZKJ A;  2FTK A;  3HHU A;  4R3M A;  4YKX A;  2XDU A;  4CWS A;  4HZ0 A;  4HXZ A;  1S16 A;  3TTZ A;  4HZ5 A;  2JJC A;  3H80 A;  3VHC A;  1B63 A;  3D2R A;  3U67 A;  2CCS A;  5CTX A;  4H85 A;  3D36 A;  1AMW A;  5M4K A;  1US7 A;  3G7B A;  5D7C A;  1TBW A;  1YT0 A;  4QPK A;  4U7N A;  2Q8G A;  4LPB A;  1Y8P A;  5CTY A;  2O1U A;  4PRV A;  2WI6 A;  4EEH A;  2VCJ A;  4O04 A;  3RLR A;  2XDS A;  1Y4U A;  1THN A;  4MTX A;  4EM7 A;  2YE2 A;  4XIQ A;  5IN9 A;  4JAU A;  3ZKD A;  4I3H A;  1YET A;  3OWB A;  3G75 A;  4CWP A;  4XCJ A;  1ZXN A;  4R3A A;  2XD6 A;  1I5D A;  4FCQ A;  1IXM A;  4P7A A;  1GKZ A;  2YE6 A;  4B6C A;  1UY8 A;  5CTU A;  4U93 A;  1ZXM A;  4AWP A;  1ZWH A;  2XCM A;  1I5C A;  2XJJ A;  3C0E A;  4HYP A;  5CF0 A;  1UYI A;  4LWF A;  2YGF A;  4WUB A;  1UYM A;  1YC4 A;  4KP4 A;  1KZN A;  1H7U A;  3RLQ A;  5IDM A;  4MPN A;  4PU9 A;  1Z5B A;  4W7T A;  4GFN A;  4URL A;  1I5A A;  4GEE A;  3TUH A;  1PVG A;  5GGZ A;  1AH8 A;  2ZDX A;  2XK2 A;  3JZ3 A;  2EXL A;  4Q20 A;  4XCL A;  2BT0 A;  4HYM A;  2Q8I A;  4CE3 A;  4L91 A;  2YK2 A;  1GKX A;  3ZRW A;  3OMU A;  2LFS A;  2WI7 A;  4XE2 A;  3RLP A;  3OW6 A;  2BYI A;  4NH7 A;  2P67 A;  2H55 A;  1TIL A;  2GQP A;  3Q5J A;  4E01 A;  3FV5 A;  1BGQ A;  5C93 A;  2YEF A;  2QM8 A;  2VW5 A;  1B62 A;  4HXW A;  2IOR A;  3H4L A;  3HEK A;  2QFO A;  3RKZ A;  4EGK A;  4HY6 A;  5CPH A;  3IED A;  1TC0 A;  4CWQ A;  4H81 A;  4LWI A;  2FYP A;  4MP7 A;  1QZR A;  2ESA A;  4YKT A;  5BOC A;  2WI3 A;  3EHJ A;  3LPS A;  3ZCC A;  1L0O A;  2YE8 A;  3CWV A;  4KTN A;  2YE9 A;  4I5S A;  3A0X A;  3O2F A;  2BSM A;  3C11 A;  2YI0 A;  5M4N A;  4GT1 A;  1YC3 A;  2YEC A;  1U0Z A;  2YKC A;  3TZ0 A;  5D7D A;  3R92 A;  2Q2E B;  2Q8H A;  3DGE A;  4GGL A;  2IOQ A;  3R4P A;  3B28 A;  2CH4 A;  3T2S A;  2XHR A;  4JYC A;  3HYY A;  3CRK A;  2YK9 A;  4GQT A;  4MPE A;  3Q5L A;  3EKO A;  2BYH A;  2YE3 A;  1Y4S A;  4MP2 A;  4L93 A;  4ASB A;  4P8O A;  4E00 A;  2C2A A;  3U2K A;  2GFD A;  3D0B A;  2BRE A;  2IWS A;  4CE2 A;  1U2O A;  3K98 A;  4YKQ A;  3R4N A;  5M4M A;  3A0Z A;  3EHF A;  1I58 A;  4ZKI A;  2YKJ A;  4YKZ A;  2BU5 A;  4LC1 A;  4URN A;  5J71 A;  4K4O A;  5IDJ A;  2WI5 A;  3B27 A;  3ZM7 A;  1H7S A;  2YGE A;  5F3K A;  1A4H A;  3FT8 A;  2YI6 A;  4FPP A;  3PEH A;  3OPD A;  3QTF A;  1OSF A;  4MBC A;  3QDD A;  2YEA A;  3MD0 A;  1EA6 A;  3WQ9 A;  1S14 A;  4AWQ A;  2WWW A;  2Q8F A;  3HZ5 A;  1NHI A;  2YI5 A;  1F51 A;  4FCR A;  2FWY A;  4V25 A;  3MNR P;  5B1O A;  1R62 A;  2QG0 A;  1KIJ A;  1UYE A;  2CCT A;  3WHA A;  3K99 A;  1YER A;  5B1N A;  2BRC A;  4JQL A;  1UY9 A;  1TH8 A;  1UY6 A;  1TC6 A; 
#chains in the Genus database with same CATH topology
 4WUD A;  2K1E A;  2X6C A;  3RVY A;  4JAS A;  2A06 H;  1IX9 A;  4JI8 O;  3M99 B;  3IFX A;  1BKN A;  2O1W A;  1VEW A;  4RUF A;  1N32 B;  2ZR3 A;  4DV3 B;  1WB7 A;  1HW7 A;  3OEH G;  1EN6 A;  4BWA A;  4RO2 A;  2XDX A;  2W0X A;  3W7W A;  2YEB A;  1QR9 A;  4O4J B;  1RSO A;  5CTW A;  4J7K A;  3O0I A;  3B40 A;  4DXW A;  3JAS B;  5B1B C;  4WFG A;  4BAE A;  1QVF U;  2PF4 E;  4LWS B;  4JI5 O;  3OGC C;  1XUQ A;  3N27 A;  3TK1 A;  2CGF A;  4WUC A;  3H9V A;  2L6L A;  5LMN B;  1K8A W;  1XNR O;  1IZ3 A;  2DN9 A;  2HKO A;  1I0H A;  1PL4 A;  1JMK C;  2DYS B;  3ZRW B;  4JAV A;  2UXD O;  3I56 V;  2YGA A;  2CG9 A;  2HJF C;  2HR3 A;  2Q6A A;  1Z5C A;  4KSH A;  2XAB A;  3BCC H;  1SES A;  4QE7 A;  3OWD A;  4B7K A;  1MSD A;  4YKY A;  2VCI A;  3K06 A;  4B3S B;  2CE4 A;  2GUZ A;  5J2U A;  2YIA A;  1Z59 A;  4OPH A;  1URF A;  4IIJ B;  3P3P A;  4R1F A;  3H01 A;  1S76 D;  5KUM A;  1SQX H;  4R6Z A;  2WSS G;  3HKC A;  1PM9 A;  3FB5 C;  1IBL B;  1YSZ A;  3SL2 A;  3H1K H;  3M7M X;  3SPC A;  4YIO A;  1KB9 F;  4CWO A;  3T1Y O;  2HLD G;  4KFG A;  4B7E A;  3TXQ A;  2YKE A;  2VQF B;  2K5B A;  1N8R W;  1JCH A;  1Y8O A;  4DR6 O;  2QM4 A;  5KLV H;  2E74 B;  2F95 B;  3JAL A;  3SDL A;  3ML0 A;  3HKB B;  1VQ9 V;  4HZ3 A;  3LSS A;  3E86 A;  1UJW B;  3OTO B;  3TCU A;  2FWZ A;  3OTO O;  2EJ7 A;  2YE5 A;  4IT5 A;  2XND G;  3S3X A;  3ABK B;  1HNX O;  1UFI A;  2YIC A;  2L35 A;  4L8Z A;  4DR4 B;  5D5Q A;  4LF5 B;  1I94 O;  2GBO A;  4X66 B;  2Y48 A;  3H1L H;  1TAE A;  1WN7 A;  4RWU A;  4GYC B;  4RQE A;  4URM A;  1UYD A;  4EB6 A;  3RGB A;  4FLU A;  1YT1 A;  2YEE A;  2WLJ A;  2UUB B;  4ZIB A;  3BM9 A;  3DTU B;  5IYZ A;  3U2D A;  2IOP A;  4AQY O;  2PY5 A;  1SRY A;  1UYC A;  3P30 A;  2XHB A;  3HR0 A;  1MZE A;  2N05 A;  2PTM A;  2ZQM A;  4MOT A;  4XIP A;  4EGH A;  4YKR A;  4DR5 O;  4J9Y B;  3ZKB A;  3O9O A;  2EZP A;  1K5S A;  3JSL A;  4XIR A;  4GZR B;  4I9Q A;  5K1X A;  4ASF A;  2IH3 C;  2B9Z A;  4D6T H;  4TQD A;  2Y4T A;  4LF5 O;  4O07 A;  1H8E G;  1MG1 A;  2NR5 A;  3SPG A;  2DYS C;  4J80 A;  1HNX B;  3RYI A;  5D6Q A;  1YI2 V;  4NYK A;  2PI5 A;  3OMN B;  3ZXQ A;  4O0B A;  2X6A A;  1DK1 A;  3ZMS A;  4JI0 O;  4HYO A;  2PNR A;  2WA4 A;  3OR6 C;  3SJC C;  1SA0 B;  5LGU A;  1GJV A;  4FM1 A;  4DR7 O;  3K9S A;  1S5H C;  4GUN A;  1M57 B;  2B5U A;  3B25 A;  4UVA A;  3A0T A;  4LWE A;  3TZ2 A;  3CC7 V;  5BOD A;  4WBN B;  2DWD C;  5BMV A;  4U7O A;  1YSR A;  1QLE B;  5EZY B;  2HKJ A;  1XDC A;  1JOY A;  3VBB A;  1DF5 A;  1DLB A;  3G7E A;  1NTM H;  4EFB A;  3QO7 A;  3E2E A;  4BIZ A;  1EZV H;  3GIG A;  3CE2 A;  1BT8 A;  2D2C B;  1GH6 A;  3APQ A;  5JCO C;  3VHD A;  1ZWI C;  2JGD B;  1QY8 A;  3U0Z A;  2IM9 A;  3T0H A;  1VIB A;  1Q43 A;  4JI1 O;  4AS9 A;  2ZM6 O;  2WI4 A;  2LQT A;  5EYP A;  4JYY A;  4R3M A;  3L75 H;  3RBZ A;  4CWS A;  5JVD B;  2QE7 G;  4JI3 B;  4FLV A;  4CS3 A;  4LCU C;  1FS0 G;  1I5Y A;  2QTS A;  1LUW A;  3VHC A;  1K9M W;  3D2R A;  1G8M A;  2QA4 V;  4NR1 A;  4LFA B;  2ZT9 B;  2WLK A;  4W4K A;  4H85 A;  3D36 A;  3PJS K;  4LFC B;  4YXW G;  2JJ1 G;  3SPI A;  4BAY A;  4BIO A;  2BOC C;  5H6R A;  1YT0 A;  2ODM A;  1AVM A;  2ARH A;  4U7N A;  4DV4 O;  2Q8G A;  4LPB A;  1RFY A;  5EIB C;  5L3B A;  4YIP A;  1VQ4 V;  4O04 A;  1WP7 A;  2LP7 A;  5H6Q A;  3A2F A;  3W7U A;  4LF9 B;  1OCC C;  4MTX A;  1VQP V;  2YE2 A;  4MS2 A;  3X2Q C;  3CCU V;  5TIS Z;  1YIJ V;  2RN9 A;  1GN2 A;  3KCX A;  3E35 A;  5LHH A;  3OGI B;  5BR8 B;  1YET A;  4N23 A;  3ZBH A;  4JF3 A;  5IJ0 A;  3KKY A;  3T1C A;  4XCJ A;  5J9P C;  3EHB B;  3S3W A;  1ZXN A;  3FFQ A;  3UT5 A;  3WFV A;  4JI7 B;  3LSQ A;  5L3G A;  3F5W C;  3CCE V;  3BAB A;  4K0K O;  2R9A A;  4QGP A;  1I94 B;  3ZED A;  4P7A A;  4KL1 A;  2YE6 A;  2CDY A;  2EZO A;  1G4Y B;  1V55 C;  2W0F C;  4HYP A;  1O9H A;  1K7D A;  1UYI A;  4LWF A;  1PP9 H;  1IBK B;  1DTO A;  3K5M A;  5IT9 N;  1BSM A;  3N2G B;  4KP4 A;  1EN4 A;  2DQ0 A;  1KZN A;  4DV4 B;  2ITD C;  2HFE C;  1Z5B A;  3JD1 A;  4E72 A;  1S0V A;  4CS2 A;  4LFC O;  1ARO P;  2YXY A;  1WNS A;  2ZDX A;  1HP8 A;  4MSW C;  4TUY A;  4YY3 B;  4TV9 A;  1BL8 A;  2K9P A;  1FXK A;  5FLX N;  4MTF A;  2Q5Z A;  1Q6U A;  5KA5 A;  1GKX A;  2Z3Y A;  1SZT A;  4U3J A;  4BW9 A;  2OTL V;  4UV8 A;  2WI7 A;  3ZS8 C;  1FAF A;  4NH7 A;  2H55 A;  2X7R B;  1TIL A;  3F7V C;  3Q5J A;  1NKD A;  1SZX A;  4JPR A;  2DQ3 A;  5L3C A;  1SQP H;  1B62 A;  3G80 A;  2G38 A;  2QFO A;  2ZXW B;  2P90 A;  4EGK A;  4HY6 A;  1TC0 A;  3CS5 A;  4H81 A;  1VF6 C;  4R50 A;  4XBF A;  1QZR A;  1JJO A;  1I7F A;  4RAI A;  1F7Y A;  3EHJ A;  3ZCC A;  5LBQ A;  2EJR A;  2YE8 A;  4I5S A;  3ZMU A;  1Z5W A;  2PGG A;  3GWK C;  5JVD A;  3JAR A;  4LF4 B;  4GX2 A;  1IBL O;  3J81 N;  5EYP B;  4AHC A;  3C11 A;  2YI0 A;  1JR9 A;  3AG1 C;  3CCQ V;  2RDC A;  4PV1 B;  2YXH A;  2LGQ A;  2FYU H;  2YEC A;  1HNW O;  2YKC A;  3STZ C;  4CH6 A;  2JGD A;  4E4E A;  4P2Z A;  3QNE A;  1FJG O;  3JAM N;  2IOQ A;  3CCJ V;  5DM6 V;  3D8C A;  2XHR A;  1TUE B;  1CP9 A;  4MW8 A;  4JYC A;  1K33 A;  3HYY A;  2ZM6 B;  2YK9 A;  4MVO A;  1Q86 W;  3EKO A;  4YJ2 B;  2BYH A;  1Y4S A;  2YE3 A;  4MP2 A;  3EXA A;  4DR3 O;  3U2K A;  4G28 B;  2AW9 A;  3D0B A;  1IXB A;  2Y0I A;  4DR3 B;  2XAG A;  2JEU A;  3S5T A;  4J42 A;  4DUZ B;  4UVC A;  3L71 H;  1XMO O;  2ZXW C;  4I9W A;  3EHF A;  1I58 A;  3OTF A;  1YEW A;  4B3R O;  2BU5 A;  3AEI A;  2GHY A;  1VQO V;  4AQY B;  3B27 A;  4DV6 O;  1A4H A;  1OCO C;  2XAS A;  3RYI B;  2YI6 A;  4FPP A;  2BOB C;  4J9Z B;  2XUM A;  3QDD A;  3U10 A;  5IYB O;  1Q6H A;  2NN4 A;  2Q8F A;  1K4D C;  1NBM G;  5BY1 A;  3UKM A;  1R1B A;  1NHI A;  3OMA B;  1N4C A;  2XAJ A;  4V25 A;  1SF9 A;  5FNV A;  3MNR P;  2ZIO A;  1KIJ A;  4NTW A;  1AI6 A;  1EN5 A;  4FZ1 A;  1GO3 F;  5EC2 C;  2BRC A;  3K5O A;  1M90 W;  1TH8 A;  1UY6 A;  4G27 B;  2PUS A;  3DC6 A;  3GB7 C;  3K0D A;  3BA9 A;  4ZI7 B;  1N0N A;  2IU0 A;  1QHT A;  1CEZ A;  4CWN A;  1XNQ B;  4JI2 O;  1ZL8 A;  4EFE A;  3UO2 A;  4X1Y A;  2PZS A;  2P5O A;  3INX A;  3FB6 C;  1GN6 A;  1QU7 A;  3J7A U;  4BQG A;  1QYE A;  4NH8 A;  5DEC A;  4NXM O;  1NHH A;  3MHS C;  4E2L A;  4JYB A;  1NI8 A;  2NLJ C;  4PA7 A;  1P7B A;  2W6J G;  3GIF A;  1Y4M A;  4PI2 A;  4X1I B;  2YKB A;  3RVZ A;  2LO1 A;  3HKB A;  3RYF B;  4PD4 F;  5M4P A;  4LR3 A;  1NS1 A;  2P4K A;  5FNF A;  5B3S C;  3SGI A;  4TV8 B;  3ZRX A;  4HY1 A;  3R4M A;  3I55 V;  2YED A;  4B08 A;  1R3I C;  2F4V B;  2MK3 A;  4XDL A;  3ASN B;  4H37 A;  4CWF A;  4JI0 B;  4FMT A;  1KD1 W;  2YJW A;  4EFU A;  1M93 A;  2ZDI A;  1KMI Z;  5J2T B;  2QDO A;  1VQK V;  1Y66 A;  1PNL A;  1TVK B;  1ID0 A;  2HHH O;  2YEV B;  3TXS A;  2WEP A;  3CXC U;  1BGY H;  5CBF A;  2Q7H A;  2JS3 A;  1TA8 A;  2UWD A;  4JAA A;  3LDC A;  3F7Y C;  3EFF K;  1YJ9 V;  4O09 A;  1VAR A;  1HNW B;  1YJN V;  2IH1 C;  3N2K A;  5J6A A;  1GMG A;  2RNB A;  3BY6 A;  4CWR A;  4EMV A;  1M4U A;  1FXH A;  2X0L A;  2Y69 B;  1D5A A;  3B8N A;  1W0K G;  3K5L A;  4KQV A;  1UY7 A;  3C90 A;  4GKK B;  1YCI A;  3EHH A;  3OM3 B;  1OCR B;  4ZOL B;  3UCS C;  3RFR A;  3APO A;  1H8H G;  4EFT A;  1UYK A;  4ZBM A;  2LW1 A;  5CA0 B;  4BXI A;  1YJW V;  3HKD B;  2BTZ A;  2P22 C;  4YKW A;  2HHH B;  4O4J A;  5JCO A;  4FZ0 A;  4Z1M G;  3FYE B;  4I0X B;  1KQS U;  3B77 A;  4DZY A;  4X64 B;  5EIB D;  3VAD A;  4KXR A;  2QR4 A;  2Q0O C;  3T1K A;  1ROP A;  5F5R A;  2JGU A;  1A32 A;  2JKI A;  2GTS A;  2Q8V A;  3RYH A;  3HPL C;  4X9Q A;  1HR0 B;  3LNM B;  3ZN0 A;  3T1Y B;  3A0H Z;  4KHP B;  4YY3 O;  4TWK A;  3JAT B;  4V26 A;  3CWB H;  4YKU A;  4JYA O;  2WPD G;  4LF6 O;  2C1G A;  4XKO A;  2IWX A;  4FIP C;  5LXT B;  4KUM A;  1AR4 A;  4F6R A;  5JH7 A;  2XX5 A;  3BVO A;  4MVS A;  4K8X A;  1AP6 A;  2YJX A;  4UCU A;  4L90 A;  4XKA A;  5M4H A;  2ZDY A;  3AG4 B;  4FCP A;  3KG2 A;  4DUZ O;  1AI5 A;  3ETG A;  3CP1 A;  1AH6 A;  1JFF A;  2ITC C;  1HNZ O;  1SER A;  1THZ A;  3K58 A;  4DUH A;  3CXH F;  3UO3 A;  3Q5K A;  4I50 A;  2EIM B;  2LFR A;  2XHX A;  3CGZ A;  1XMO B;  2BU7 A;  3ZXO A;  2LJ2 A;  4JZ2 A;  4O05 A;  4NB5 A;  2ADP A;  2YEJ A;  4UCO A;  1W0J G;  3ABL B;  2EUL A;  1I59 A;  1NTK H;  1S77 D;  5D7R A;  1HR0 O;  2ZNJ A;  1AJ6 A;  2V1D A;  3HZ1 A;  1RPO A;  1V54 B;  4X9L A;  1B06 A;  5LGT A;  3T1H B;  3RYF A;  1I5B A;  2P4V A;  2YKI A;  3E22 A;  4XD8 A;  2YI7 A;  2YEI A;  2WER A;  1AR5 A;  5CA1 B;  1VP7 A;  2YE7 A;  1TID A;  4MVM A;  1AJN A;  5LMU B;  3RT3 C;  1XI1 A;  1Q8I A;  1MX0 A;  5IE9 A;  3RYH B;  1IBM B;  2QKA A;  2YUA A;  1FFX A;  5B5E Z;  1OZ0 A;  4FJC C;  4JI2 B;  2CCU A;  4GX0 A;  1NHJ A;  3HHU A;  4X1Y B;  1ZL8 B;  3CME V;  3K04 A;  4HZ0 A;  4HXZ A;  1S16 A;  3TTZ A;  4B3S O;  3H80 A;  3ABM C;  1S3J A;  3JCU Z;  1YDX A;  4DV0 B;  5DN6 G;  4TOI A;  4OPA A;  3THO A;  1DGS A;  4PA4 A;  5D7C A;  4LF9 O;  5CA0 A;  2R9I A;  1K3E A;  5FNV B;  5L3F A;  4PRV A;  4ZOL A;  5H9C A;  1ENV A;  1Y4U A;  1THN A;  2WLN A;  1GKF A;  1P4R A;  4P9O A;  3CC4 V;  3CB2 A;  3OUF A;  1SQG A;  4LF7 B;  1BMF G;  1JA8 A;  1Y76 A;  1ZX3 A;  3UM7 A;  2UXB O;  4X88 A;  3G75 A;  3N2K B;  2UUA O;  4R3A A;  4NXN O;  1W59 A;  2Q9L A;  4HNA A;  2YXL A;  1I5D A;  1XRE A;  1D2D A;  3OR7 C;  1IVS A;  3DC5 A;  1AP5 A;  4AWP A;  1SKV A;  2YEV A;  2H3O A;  2XJJ A;  5CF0 A;  4HBN A;  3HKE B;  1H2N A;  4AIL C;  1FFT B;  3AG4 C;  1UYM A;  2A7W A;  2VQE O;  1XNQ O;  3RLQ A;  3CMA V;  1H7U A;  5J2T A;  4MPN A;  3CYO A;  4MVU A;  1V55 B;  1M9N A;  3IC9 A;  4GEE A;  1PVG A;  1N34 O;  1OCZ C;  3L70 H;  3ZHV A;  3JZ3 A;  5KX5 B;  4NVP A;  4HYM A;  2Q8I A;  4L91 A;  4TV8 A;  4KHP O;  1WA8 B;  2PYJ A;  1M5I A;  3OMU A;  1XIL A;  2OYQ A;  1H2S B;  5H2F Z;  2Q67 A;  2KQX A;  4JYA B;  3E8H A;  4XE2 A;  1FPO A;  2D3O W;  2BYI A;  1KP3 A;  4DV5 O;  4X8A A;  4X1I A;  4DV5 B;  3FV5 A;  3LSU A;  2YEF A;  4HXW A;  2JS5 A;  3HEK A;  5GON B;  2MW2 B;  2AXT Z;  2JEX A;  1VF6 A;  4LWI A;  1VF7 A;  2JDI G;  3JAW A;  4MP7 A;  3K57 A;  2ESA A;  3O65 A;  4K35 A;  3IJ4 A;  2DE0 X;  5B1A B;  3OEE G;  3CPW U;  3OW2 U;  4LF4 O;  1K4C C;  2HJD A;  3K3W A;  1BE3 H;  2YE9 A;  1H2L A;  4DK1 A;  3CWV A;  4LH6 A;  1EFR G;  2CK3 G;  5AG2 A;  4PDR A;  3K0G A;  4ZI7 A;  4YHH O;  1MA1 A;  3O2F A;  1Q81 W;  4O4L B;  2JJ2 G;  4O2A A;  3ASO C;  1Q7Y W;  4JI5 B;  4GT1 A;  1U96 A;  2XAH A;  2DOS A;  4U3J B;  1VQ7 V;  2ZKO A;  5KUK A;  4LBE C;  4CBC A;  2OCC C;  4N21 A;  3CCL V;  2Q73 A;  3MDS A;  4LF7 O;  4GKK O;  3OD4 A;  2FKX A;  3CD6 V;  1H2K A;  4QNH B;  4GGL A;  2OIE A;  2UUA B;  2CH4 A;  3T2M A;  2ZE7 A;  2M6Y A;  3BPZ A;  5KMG A;  1AI7 A;  2GTA A;  2YIB D;  2C2A A;  2BE3 A;  4CS4 A;  2GFD A;  2A3Q A;  4O2B B;  1YHQ V;  1LNQ A;  2IWS A;  2ETN A;  4MVR A;  4UV9 A;  4CZZ A;  1T5E A;  2QWQ B;  3TJT A;  5LP6 C;  4LC1 A;  4O4I B;  4K4O A;  1NJI W;  1R3J C;  3UT5 B;  2VQE B;  1E1R G;  4J7J A;  3RWR D;  3RN4 A;  3CCV V;  1VQ6 V;  3FT8 A;  3SPJ A;  2ZR2 A;  3G71 V;  4PDM A;  3MD0 A;  4UCT A;  1S14 A;  2ZD9 A;  3CRC A;  1JX9 A;  4LF6 B;  4I55 A;  1BHA A;  2YI5 A;  3FX7 A;  3ZMT A;  4FCR A;  4BR6 A;  5B1O A;  2QG0 A;  1UYE A;  1FXK C;  3B4S A;  3K99 A;  3ZRS A;  1YER A;  1X4T A;  5B1N A;  5E79 Z;  5D5P A;  5B66 Z;  4MVQ A;  2UXX A;  2WLI B;  1VQM V;  1YES A;  2QM7 A;  4WFH A;  1ZW9 A;  2XHT A;  4FFB A;  4XDK A;  3BEH A;  5IYC O;  4XC0 A;  3JAR B;  2E0A A;  3A0Y A;  4MTO A;  4XTJ A;  3K97 A;  2YSU B;  1H2G A;  4FFB B;  1BQ0 A;  2QWR B;  2RJZ A;  2WLI A;  1K92 A;  5DED A;  3TZ4 A;  3GVM A;  5L3D A;  1E79 G;  4BW5 A;  4DV0 O;  4PRX A;  5GTI Z;  4X89 A;  3G67 A;  3ETE A;  3U11 A;  3ZMV A;  4FLZ A;  1TGO A;  5KAI Z;  1SS3 A;  4UXN A;  5B1A C;  4IYH A;  4I55 B;  4DR2 B;  2XDK A;  1BQZ A;  2EIJ B;  3AG2 C;  3SYP A;  4Z1V A;  1ZUQ A;  4OXS A;  5IY5 B;  3CJH A;  1Z5V A;  2BU6 A;  2WLM A;  1E1Q G;  2AKP A;  3AG3 B;  5BMV B;  2E5L O;  4WBN A;  1YTF B;  4TV9 B;  3RYC A;  4TUY B;  4O4I A;  1YIT V;  3ZHT A;  2KSD A;  3OE7 G;  3PEJ A;  5HFL A;  3FYI B;  2RQ6 A;  3A0R A;  2O1V A;  3R91 A;  1SA0 A;  2Q4P A;  2XJG A;  2FXS A;  3KE6 A;  2YI9 A;  1NTZ H;  1YS3 A;  4LF8 O;  4H44 B;  2AGA A;  3N2G A;  1BXD A;  3CRL A;  2F1M A;  1X59 A;  3KZI Z;  3FD9 A;  1MNG A;  1KKD A;  5KHJ A;  3L72 H;  2W6I G;  1UYL A;  3EVK A;  2PYL A;  3STL C;  1M1K W;  4U3F H;  3B2E E;  3FKS G;  2DMX A;  5IJ0 B;  4JV5 O;  2UXD B;  1P7G A;  1PV0 A;  3ZIA G;  5IY5 C;  3Q4H A;  4O4L A;  1MAB G;  2EIL B;  4EGI A;  3DXR A;  1YZB A;  2YID A;  3A0W A;  1GN4 A;  1SQF A;  1V54 C;  3QF7 A;  4MW3 A;  4ZVI A;  2BU8 A;  1JVM A;  2UU9 B;  4JI3 O;  2JIZ G;  4BQJ A;  2H94 A;  3K59 A;  1NH2 B;  5CB4 B;  4X66 O;  1QCE A;  2UXN A;  4MT8 A;  2IU3 A;  1VQN V;  5GON A;  5CMU A;  2QKS A;  3GWO A;  2XX2 A;  2EX3 A;  3HYZ A;  2ZDI C;  4JI4 O;  3A8T A;  3QO5 A;  3FT5 A;  1EI1 A;  1NZ6 A;  4QPJ A;  5ITZ B;  2OT5 A;  4PA6 A;  3TGU H;  1Q5O A;  3H1H H;  2VQF O;  1UYH A;  4JTA B;  1ZLZ A;  1L1F A;  4X62 O;  4PDL A;  3K08 A;  4K8Z A;  4GT8 A;  1AM1 A;  2YE4 A;  1J95 A;  1MSW D;  5LMU O;  1VQ5 V;  1GM9 A;  1UYF A;  3GIG B;  2NNU A;  2EIN B;  4GCZ A;  1SQQ H;  3HKC B;  1FJG B;  3JCZ A;  4UB6 Z;  4TSF G;  2DWE C;  1QNM A;  3BA8 A;  4JI6 O;  1FD9 A;  4PL9 A;  2A9H A;  1N36 O;  3B09 A;  3HKE A;  3EKR A;  3CGY A;  2Z5U A;  4WF9 V;  4CE1 A;  3ZHQ A;  2AZ2 A;  4LH7 A;  1MU5 A;  1YC1 A;  5EBL C;  3TZ5 A;  4BIU A;  4YHH B;  1KBH A;  1LR1 A;  4HNA B;  4LWG A;  3SPH A;  2WI1 A;  4D7T A;  2Y69 C;  3ZJZ A;  3T0Z A;  1XL4 A;  1ORQ C;  4PEL A;  1Y76 B;  2ILM A;  3W7T A;  4DUY O;  2ZNI A;  1US6 A;  1WJZ A;  2P06 A;  1Y67 A;  3MAQ A;  5M4E A;  1QLN A;  5FWK A;  1RP3 B;  4X65 O;  5A2Q N;  1Q6I A;  4JTD B;  1KYO F;  2EIM C;  3NMQ A;  1TUB B;  4KFM A;  2Q7E A;  5LHG A;  2XX4 A;  3CHX A;  4O4H A;  1IUR A;  4WCE V;  4JI6 B;  2ZKJ A;  4YKX A;  2XDU A;  2CTP A;  2JRI A;  3BAA A;  4J7Z A;  4FK5 C;  4WFA V;  4X64 O;  3ZHS A;  1P49 A;  2UUB O;  3U67 A;  4QE9 A;  3LMM A;  1FFX B;  1RM1 B;  2QWO B;  1AMW A;  5M4K A;  1US7 A;  3G7B A;  3CCM V;  2CH7 B;  3WB2 A;  3D3Q A;  4QPK A;  3WU2 Z;  1Y8P A;  5CTY A;  5JQG B;  5H5N A;  2EIK C;  2WI6 A;  1I5X A;  2VCJ A;  1SET A;  3JD3 A;  4DW1 A;  5CA1 A;  2XDS A;  3BHP A;  4IYI A;  1N0J A;  1BHB A;  1COW G;  3E22 B;  3AG3 C;  4B3M O;  4XIQ A;  4H13 B;  5IN9 A;  3JAL B;  4XDJ A;  4I3H A;  1QLE C;  1K73 W;  3L73 H;  4X1K B;  4J41 A;  2IJJ A;  2XD6 A;  1IXM A;  4C7U A;  3P3N A;  4QIW F;  3OAA G;  1UY8 A;  5CTU A;  4U93 A;  3J80 N;  4CC5 A;  2ZE8 A;  1CXZ B;  1I5C A;  3C0E A;  1N32 O;  3IAY A;  2EBO A;  1JFF B;  2FL4 A;  4IIJ A;  1KU9 A;  1B04 A;  4PHZ A;  4JI8 B;  1YC4 A;  4WUB A;  5LGN A;  3W7X A;  5IDM A;  2GUZ B;  1GAX A;  4PU9 A;  1NU1 H;  5JH7 B;  5FPO A;  4URL A;  1I5A A;  3LNN A;  3TUH A;  4MVZ A;  5GGZ A;  1AIL A;  2XK2 A;  4DR2 O;  4TQF A;  2EXL A;  3JAT A;  4Q20 A;  5JJJ B;  2FB5 A;  2BT0 A;  4CE3 A;  3CRR A;  1AJQ A;  2YK2 A;  2R9R B;  3ZRW A;  2LFS A;  2UXB B;  2H8P C;  1IBM O;  3OW6 A;  3X2Q B;  1JPX A;  1BGQ A;  2Y4U A;  4PA3 A;  2YC0 A;  4CH5 A;  2E5L B;  2IOR A;  4I0X A;  4DR1 O;  2CH7 A;  3JAS A;  3IED A;  2FYP A;  1R3L C;  4YKT A;  3WB1 A;  3HKD A;  3LPS A;  1IDS A;  1L0O A;  5JEN A;  2AHY A;  4FLX A;  4R7C A;  1YF2 A;  4WFF A;  1OCR C;  3FAV A;  1NQT A;  1DF4 A;  5KAF Z;  4O4H B;  4DK0 A;  2BSM A;  5KHK A;  1GN3 A;  3SYC A;  4H33 A;  2UUC B;  2WAM A;  5M4N A;  5C8Y A;  1EM1 A;  4UFZ A;  3ZN1 A;  4RUE A;  1TUB A;  1U0Z A;  2HP8 A;  3TZ0 A;  4L8J A;  2GSM B;  2CAZ C;  2Q8H A;  3AG1 B;  3DGE A;  3T4D A;  2YI8 A;  4IHJ A;  2V4D A;  4NTX A;  4R8C A;  3B28 A;  4NTY A;  2P7T C;  4DR1 B;  4LNU B;  4LP8 A;  4CH4 A;  1NT2 B;  1Y74 B;  5LYJ B;  3CRK A;  3CRQ A;  2DYR B;  4I7Z B;  2QWP B;  1TVK A;  4RQF A;  4ICG A;  2X6B A;  2CTW A;  4DV3 O;  2VWK A;  1XMQ O;  3ETQ A;  1JQ0 A;  4CE2 A;  1L8D A;  4YKQ A;  3K98 A;  3R4N A;  1M57 C;  1XQ8 A;  3ABT A;  4B3T B;  1J5E B;  5LA6 B;  4L87 A;  4DR7 B;  3W7S A;  2YKJ A;  1V9P A;  3RW0 A;  2BTQ B;  4URN A;  2ATK C;  1H38 A;  4JI4 B;  5IDJ A;  3ZM7 A;  2YGE A;  5F3K A;  2AHZ A;  1VMG A;  3PEH A;  3OPD A;  3QTF A;  2KG7 B;  2Q68 A;  1KUQ A;  2YEA A;  2UUC O;  1EA6 A;  4DV7 O;  3WQ9 A;  1H2M A;  5IWA O;  2WWW A;  2V7Q G;  3HZ5 A;  2DW4 A;  3CC2 V;  3SYO A;  4ASU G;  3QO8 A;  2Z0A A;  4CH3 A;  1F51 A;  3JSN A;  5LOV A;  2FWY A;  3OMI B;  3WHA A;  5B1B B;  2HG5 C;  1PKX A;  4IGG A;  3AK2 A;  4FLY A;  2F93 B;  5ITZ A;  4JQL A;  4J11 A;  1TC6 A;  1NVP D;  1SQV H;  1UYG A;  4MB9 A;  1NR1 A;  4GX1 A;  3H1I H;  2R72 A;  2VRZ A;  5IJ9 B;  2XDL A;  2ZIN A;  1IBK O;  1XMQ B;  1B3Q A;  2BSK A;  4I4T B;  4P9P A;  4ZHQ A;  3K5N A;  2BTO A;  2VWC A;  2XT9 A;  2Q0A A;  3G4S V;  3WG7 B;  1HWY A;  1PNM A;  1YSC A;  4FFK A;  4X20 A;  4DRX A;  5CB4 A;  2ZE5 A;  1K34 A;  4XDM A;  2QJ1 A;  2RMK B;  3ZHR A;  1PL0 A;  1LUV A;  5EBM C;  1XL6 A;  3DXR B;  5FPR A;  5LP6 A;  2N74 A;  3NR7 A;  1BZK A;  5KHG A;  5BR8 O;  3Q4H B;  5IWA B;  3FB8 C;  3VOU A;  5JJN B;  1R73 A;  4LP0 A;  4DR5 B;  1JM6 A;  2CGO A;  4YJ3 B;  4XIT A;  1F23 A;  2H8M A;  1M56 C;  3NXS A;  1KC8 W;  3LNU A;  3T4Z A;  1Y8N A;  2KKW A;  2QG2 A;  5L3J A;  1WLE A;  4LWH A;  2QKC A;  1S5J A;  2EIN C;  5EBW C;  3O6O A;  1O9G A;  2HHI A;  3CEI A;  4B7P A;  4ASG A;  4B3R B;  1PNK A;  2E3C A;  1GM8 A;  3LUT B;  4YJ2 A;  2GDS A;  4OX9 B;  2HG1 A;  2WI2 A;  5KHI A;  5D6P A;  2LGW A;  4NXM B;  1R3K C;  3ICX A;  4FLT A;  1QR8 A;  1EZJ A;  2IW5 A;  3LDD A;  1YTF D;  4L94 A;  4PDV A;  4A5U B;  1R6K A;  3RYC B;  4P30 A;  2XJX A;  1L0L H;  1N33 B;  3G6B A;  2VWJ A;  4GX5 A;  3KCY A;  4DV7 B;  3CJH B;  4DR6 B;  4PA9 A;  5LMN O;  2BZ5 A;  2XAF A;  2WLL B;  4MPC A;  3B26 A;  1XNR B;  5EC1 C;  3MHH C;  1RPR A;  1U97 A;  3C3T A;  4K0K B;  3LDE A;  3QVN A;  4D7S A;  4FM0 A;  3H1J H;  3EHG A;  2CGN A;  3ABU A;  1MMM A;  4W4L A;  3BMY A;  5FND A;  1W2B U;  3ABL C;  1YXB A;  1Q82 W;  2YEG A;  1SQB H;  2QF6 A;  1Q3E A;  2YIB A;  4NH9 A;  1J5E O;  3QTC A;  4DV1 O;  4AI8 A;  2WEQ A;  3B24 A;  3VHA A;  3VQW A;  3E83 A;  4UVB A;  1YVW A;  5K1P A;  1FYJ A;  2ZBK B;  2OCH A;  3T1H O;  4EEQ A;  3K9A A;  4DUY B;  3E89 A;  4JZG A;  3BRC A;  2ADQ B;  2YS8 A;  1FXK B;  1MZF A;  4CWT A;  1GRJ A;  1SC5 B;  1NR7 A;  1Z5A A;  1XBL A;  4PI0 A;  2N04 A;  4XKK A;  3CCS V;  5CA3 A;  2YEH A;  4PJ0 Z;  3GIE A;  4H0L B;  2IWU A;  2IJK A;  2HCH A;  2RCV A;  3CX5 F;  2IJI A;  5EK0 A;  2ZE6 A;  4ASA A;  3JAK B;  4EKW A;  2CTR A;  3CRM A;  2OTJ V;  2CTQ A;  2UXC O;  3K60 A;  2A0L A;  1QVG U;  2BU2 A;  1BYQ A;  4DV6 B;  4OX9 O;  4KSG A;  2JVD A;  4O2B A;  1ZSP A;  4URO A;  3JAK A;  3I5D A;  2XAQ A;  5FNC A;  3C3S A;  4H7Q A;  4UCV A;  1D5N A;  5FL7 G;  3T10 A;  3P32 A;  4ABM A;  5KMG B;  2AZ0 A;  1AJP A;  3ZRV A;  2Q69 A;  3WB0 A;  5JJE B;  2QEX V;  1KEC A;  1OCC B;  5BXZ A;  1UPG A;  1XHZ A;  3SR2 C;  3INW A;  4AWO A;  4E02 A;  4JV5 B;  3G6E V;  1N33 O;  3R4O A;  1NVP B;  3FB7 C;  4DR4 O;  2YDE A;  2B1I A;  4DRX B;  1XOU A;  2BCC H;  1YT2 A;  1RM1 C;  3IGA C;  2F4V O;  4O2A B;  3VQX A;  2WA3 A;  2Y0P A;  3ABM B;  5KA6 A;  3D3I A;  1R6T A;  2XOK G;  4NXN B;  2FTK A;  2BSK B;  4I4T A;  3JD2 A;  5LHI A;  1S5L Z;  2IJH A;  5IJ9 A;  2C1I A;  1VQ8 V;  1GK9 A;  4HZ5 A;  2JJC A;  1B63 A;  1KP2 A;  2OIG A;  4DV2 B;  5E1A C;  4DW0 A;  1BS3 A;  2FML A;  2CCS A;  5CTX A;  3HB3 B;  2E76 B;  3JAW B;  4HAM A;  4DV1 B;  2IBZ H;  1QBZ A;  1TBW A;  1PD3 A;  2VS0 A;  5KHH A;  2LW7 A;  5B3S B;  2R70 A;  1Q90 D;  3CSX A;  2O1U A;  1L0N H;  1QQC A;  4EEH A;  1MOF A;  3RLR A;  1OCO B;  1BCC H;  3ZHU A;  3F5T A;  4EM7 A;  3CCR V;  3AG2 B;  2WLL A;  3JYC A;  2A79 B;  1EBO A;  3SYA A;  1KKC A;  3SJB C;  3SJA C;  4JAU A;  2JK5 C;  3ZKD A;  2KG7 A;  1F4M A;  5EZY A;  3TET A;  3OWB A;  4Q6G A;  1ZTE A;  1WA8 A;  4CWP A;  3JD0 A;  5A9G A;  2CUG A;  1K5Q A;  4GLX A;  1AI4 A;  2EIJ C;  5CBH A;  5KX5 A;  3AG7 A;  1AB3 A;  4FCQ A;  2PI4 A;  1PPJ H;  4OGQ B;  5LA6 A;  2DYR C;  3PN1 A;  1GKZ A;  4Z2W A;  4B6C A;  4JI1 B;  4CC6 A;  3ABK C;  1ZXM A;  1NH2 D;  1ZWH A;  2EIL C;  2OWO A;  1N36 B;  2XCM A;  4FM2 A;  3CYG A;  4JTC B;  1ZAU A;  1AR1 B;  2YGF A;  2WLH A;  2F23 A;  4FLW A;  4J10 A;  5LYJ A;  1Y74 A;  2UXC B;  5BZB A;  4W7T A;  4GFN A;  3K79 A;  3OFN G;  1AH8 A;  3ASO B;  4IHJ B;  3JD4 A;  4XCL A;  1VQL V;  3VQV A;  1WAZ A;  2P6J A;  4YJ3 A;  4LFB O;  1K97 A;  3QG5 A;  1OJH A;  3RLP A;  5GW7 A;  2P67 A;  5F2V O;  2GQP A;  3AK1 A;  4E01 A;  5C93 A;  5IYZ B;  1P84 F;  5LP6 B;  2QM8 A;  3FAV B;  4DO2 A;  2VW5 A;  2ZIM A;  3H4L A;  3RKZ A;  1M56 B;  4JI7 O;  5CPH A;  4X20 B;  4CWQ A;  2XTA A;  4EB6 B;  1WPX A;  4NKG B;  4B3T O;  2QSA A;  5BOC A;  2ZCE A;  2WI3 A;  4ZHQ B;  1I08 A;  4QJF B;  4DV2 O;  2GV9 A;  4KTN A;  1R6N A;  4F4L A;  3OUS A;  4DYL A;  4FVM A;  2F66 C;  2O57 A;  3A0B Z;  5CN0 A;  3A0X A;  4GKJ O;  2B1G A;  1WP8 A;  3ETD A;  2M7W A;  1OCZ B;  1YC3 A;  1G6U A;  1WB8 A;  3ZX6 A;  1HDJ A;  3SJQ C;  2HVJ C;  5D7D A;  2HVK C;  3R92 A;  2QWN B;  5LOV B;  2Q2E B;  5L3E A;  4B3M B;  1S72 V;  5GTH Z;  4X62 B;  3L74 H;  1Z2G A;  3R4P A;  3T2S A;  4G2K A;  1B6Q A;  2OCC B;  3L9D A;  2KB1 A;  1OV9 A;  3AK3 A;  1XEQ A;  1G1X B;  4UCS A;  5IYD O;  1JJ2 U;  3E8F A;  4GQT A;  4MPE A;  3Q5L A;  4L93 A;  4ASB A;  4P8O A;  3K03 A;  2UU9 O;  4LF8 B;  4E00 A;  4WFB V;  3B8M A;  5J2U B;  4K3A A;  5JWP A;  1HNZ B;  2BTQ A;  2BRE A;  1U2O A;  5HFM A;  5M4M A;  3R66 A;  3IC7 A;  3ASN C;  3UQ8 A;  3A0Z A;  2F43 G;  1VF5 B;  1OHH G;  4I50 B;  4F6E A;  3VQY A;  4UUJ C;  4ZKI A;  4YKZ A;  3M8A A;  4UCR A;  3E8G A;  5CBG A;  3E8B A;  5J71 A;  2WI5 A;  1F4N A;  1H7S A;  1GTO A;  4LFA O;  1Y6X A;  4GKJ B;  3OT7 A;  1N34 B;  4X1K A;  1GM7 A;  2DJV A;  2EIK B;  1XHX A;  1WPB A;  1OSF A;  4MBC A;  4F6R B;  4LNU A;  4UB8 Z;  4WFE A;  5LXT A;  3BFR A;  4AWQ A;  2Q7G A;  3R65 A;  3SYQ A;  2E75 B;  4TT3 G;  4X65 B;  3DSQ A;  3CRA A;  5LL6 Y;  2QTO A;  5JQG A;  4LFB B;  4LWS A;  3D36 C;  1R62 A;  2CCT A;  4IL6 Z;  1FXV A;  2QGN A;  3WG7 C;  1CPY A;  4MTG A;  4JGS A;  5C8Y B;  1RSO B;  1FKA O;  1UY9 A;  2HEP A;  3ZMZ A; 
#chains in the Genus database with same CATH homology
 1YES A;  2QM7 A;  4G27 B;  2K1E A;  2X6C A;  1NVP D;  3GB7 C;  3K0D A;  4WFH A;  3RVY A;  1UYG A;  1ZW9 A;  2XHT A;  4MB9 A;  4JAS A;  1NR1 A;  4XDK A;  3BEH A;  5IYC O;  4GX1 A;  4XC0 A;  2IU0 A;  2E0A A;  3M99 B;  3IFX A;  1CEZ A;  1BKN A;  3A0Y A;  4CWN A;  4MTO A;  2XDL A;  4XTJ A;  3K97 A;  2O1W A;  2YSU B;  1H2G A;  4RUF A;  4P9P A;  1B3Q A;  2ZR3 A;  3INX A;  3FB6 C;  3OEH G;  4RO2 A;  2XDX A;  2WLI A;  3W7W A;  2VWC A;  1K92 A;  2YEB A;  3TZ4 A;  1QR9 A;  5L3D A;  1QYE A;  1E79 G;  4NH8 A;  4BQG A;  4BW5 A;  5CTW A;  3G4S V;  4PRX A;  3WG7 B;  1NHH A;  3O0I A;  1HWY A;  1PNM A;  1YSC A;  3MHS C;  4DXW A;  4X89 A;  5B1B C;  3ZMV A;  3ETE A;  1K34 A;  4WFG A;  4E2L A;  4BAE A;  4XDM A;  4JYB A;  1PL0 A;  2NLJ C;  1QVF U;  4PA7 A;  5EBM C;  3OGC C;  1XL6 A;  1P7B A;  4UXN A;  5B1A C;  3TK1 A;  2CGF A;  2XDK A;  2W6J G;  4WUC A;  2EIJ B;  3GIF A;  3AG2 C;  1Y4M A;  3SYP A;  2YKB A;  3FB8 C;  3RVZ A;  1K8A W;  4OXS A;  2HKO A;  3VOU A;  5IY5 B;  1R73 A;  5M4P A;  5FNF A;  4LP0 A;  2DYS B;  1JM6 A;  5B3S C;  3ZRW B;  2WLM A;  4JAV A;  1E1Q G;  2AKP A;  2BU6 A;  3I56 V;  3AG3 B;  2YGA A;  2CG9 A;  3ZRX A;  4XIT A;  1YTF B;  4HY1 A;  3R4M A;  3I55 V;  2HJF C;  2HR3 A;  2YED A;  1F23 A;  1YIT V;  2Q6A A;  3OE7 G;  1Z5C A;  2H8M A;  1R3I C;  5HFL A;  2MK3 A;  1M56 C;  3FYI B;  4XDL A;  3ASN B;  2XAB A;  1SES A;  4QE7 A;  3OWD A;  3A0R A;  2O1V A;  4H37 A;  4CWF A;  3NXS A;  3R91 A;  2YJW A;  4FMT A;  1KC8 W;  1KD1 W;  3T4Z A;  3LNU A;  1Y8N A;  2QG2 A;  2VCI A;  2XJG A;  4YKY A;  4EFU A;  2ZDI A;  5L3J A;  1WLE A;  4LWH A;  3K06 A;  2FXS A;  3KE6 A;  1YS3 A;  2EIN C;  5EBW C;  1BXD A;  1Z59 A;  3CRL A;  3O6O A;  4B7P A;  1VQK V;  4ASG A;  1Y66 A;  4R1F A;  1PNL A;  1ID0 A;  1PNK A;  1GM8 A;  3LUT B;  3H01 A;  1S76 D;  5KUM A;  2YEV B;  2WEP A;  2HG1 A;  2WI2 A;  3CXC U;  4R6Z A;  2WSS G;  5CBF A;  5D6P A;  1KKD A;  1R3K C;  3FB5 C;  1QR8 A;  1YSZ A;  1EZJ A;  2IW5 A;  3LDD A;  2UWD A;  3SL2 A;  4XKO A;  1YTF D;  2W6I G;  3SPC A;  3LDC A;  1UYL A;  4L94 A;  4CWO A;  4PDV A;  2HLD G;  4KFG A;  3F7Y C;  1R6K A;  3EFF K;  2YKE A;  4P30 A;  1YJ9 V;  2XJX A;  4O09 A;  2K5B A;  1N8R W;  3STL C;  2IH1 C;  1YJN V;  1M1K W;  1JCH A;  5J6A A;  1GMG A;  3FKS G;  3BY6 A;  1Y8O A;  4CWR A;  4GX5 A;  4EMV A;  1FXH A;  2X0L A;  3ML0 A;  2Y69 B;  3ZIA G;  1VQ9 V;  5IY5 C;  3B8N A;  1W0K G;  4HZ3 A;  3LSS A;  4PA9 A;  1UY7 A;  2XAF A;  2WLL B;  3E86 A;  1UJW B;  2BZ5 A;  3B26 A;  4MPC A;  3TCU A;  5EC1 C;  2FWZ A;  3EHH A;  3OM3 B;  1MAB G;  2EIL B;  1RPR A;  3MHH C;  2YE5 A;  4EGI A;  1OCR B;  3LDE A;  2XND G;  3A0W A;  3ABK B;  1H8H G;  1V54 C;  4MW3 A;  1UYK A;  3EHG A;  4L8Z A;  2BU8 A;  1JVM A;  4ZVI A;  4ZBM A;  2JIZ G;  3ABU A;  4BQJ A;  2H94 A;  4WUD A;  4BXI A;  1YJW V;  1NH2 B;  3BMY A;  5FND A;  5M4H A;  1W2B U;  3ABL C;  2BTZ A;  1Q82 W;  2YEG A;  1QCE A;  2Y48 A;  2QF6 A;  4NH9 A;  2UXN A;  4YKW A;  4RQE A;  4MT8 A;  4URM A;  1UYD A;  2IU3 A;  1VQN V;  4Z1M G;  3FYE B;  4EFT A;  1YT1 A;  2WEQ A;  2YEE A;  1KQS U;  3B24 A;  2WLJ A;  5CMU A;  3VHA A;  2QKS A;  3GWO A;  3B77 A;  2XX2 A;  3BM9 A;  3DTU B;  3E83 A;  4UVB A;  4DZY A;  3HYZ A;  2ZDI C;  3U2D A;  2IOP A;  3VAD A;  1SRY A;  3QO5 A;  1UYC A;  1EI1 A;  3FT5 A;  3P30 A;  2ZBK B;  3T1K A;  4QPJ A;  1ROP A;  5F5R A;  2OT5 A;  2JKI A;  2ZQM A;  3K9A A;  4PA6 A;  4MOT A;  4XIP A;  4EGH A;  3E89 A;  4YKR A;  3HPL C;  1UYH A;  4JTA B;  3LNM B;  4J9Y B;  1L1F A;  3ZN0 A;  3ZKB A;  4PDL A;  1FXK B;  2EZP A;  3K08 A;  4CWT A;  4TWK A;  1K5S A;  4GT8 A;  4XIR A;  4V26 A;  1AM1 A;  4MPE A;  4YKU A;  1NR7 A;  1Z5A A;  2YE4 A;  1J95 A;  1MSW D;  1UYF A;  1VQ5 V;  1GM9 A;  2WPD G;  3GIG B;  2NNU A;  2EIN B;  4XKK A;  3CCS V;  2IWX A;  4GCZ A;  5CA3 A;  2YEH A;  2IH3 C;  4FIP C;  4ASF A;  3GIE A;  4KUM A;  2IWU A;  4O07 A;  1H8E G;  2XX5 A;  2IJK A;  3JCZ A;  4MVS A;  4TSF G;  1MG1 A;  3SPG A;  2DWE C;  2YJX A;  2DYS C;  2HCH A;  4L90 A;  4XKA A;  5D6Q A;  1YI2 V;  3AG4 B;  2PI5 A;  3OMN B;  2IJI A;  3KG2 A;  5EK0 A;  2ZDY A;  4FCP A;  4O0B A;  1AI5 A;  3ETG A;  4PL9 A;  2A9H A;  3CP1 A;  1AH6 A;  2X6A A;  2ITC C;  4EKW A;  3ZMS A;  1SER A;  4ASA A;  1THZ A;  4HYO A;  3EKR A;  4DUH A;  2PNR A;  3CGY A;  2Z5U A;  4WF9 V;  2OTJ V;  3Q5K A;  3OR6 C;  2EIM B;  3K60 A;  2LFR A;  5LGU A;  1GJV A;  2XHX A;  2A0L A;  4CE1 A;  3CGZ A;  1QVG U;  1MU5 A;  1YC1 A;  1BYQ A;  2BU7 A;  5EBL C;  2BU2 A;  3TZ5 A;  1S5H C;  4BIU A;  4KSG A;  3ZXO A;  1M57 B;  4O05 A;  2B5U A;  3B25 A;  4UVA A;  2YEJ A;  3A0T A;  4LWE A;  3SPH A;  3CC7 V;  4LWG A;  4URO A;  1W0J G;  3TZ2 A;  5BOD A;  2XAQ A;  5FNC A;  3ABL B;  2WI1 A;  1I59 A;  4H7Q A;  2DWD C;  5FL7 G;  4U7O A;  1YSR A;  1QLE B;  5D7R A;  2Y69 C;  1S77 D;  2Q8F A;  3T10 A;  3ZJZ A;  2HKJ A;  3P32 A;  1XL4 A;  1ORQ C;  4PEL A;  1AJ6 A;  3T0Z A;  2V1D A;  3W7T A;  1RPO A;  1V54 B;  1JOY A;  3VBB A;  1DF5 A;  1DLB A;  5LGT A;  1AJP A;  3G7E A;  1I5B A;  3ZRV A;  2Q69 A;  2QEX V;  2YKI A;  3E2E A;  3QO7 A;  2YI7 A;  1KEC A;  1OCC B;  4XD8 A;  4BIZ A;  5M4E A;  3GIG A;  3INW A;  1QLN A;  3RLR A;  2YEI A;  4AWO A;  4E02 A;  5FWK A;  2WER A;  3VHD A;  1ZWI C;  3G6E V;  2YE7 A;  1TID A;  4MVM A;  1AJN A;  3R4O A;  1QY8 A;  4JTD B;  2EIM C;  1NVP B;  3T0H A;  3FB7 C;  3NMQ A;  2B1I A;  1MX0 A;  1YT2 A;  4KFM A;  1RM1 C;  4AS9 A;  3IGA C;  5LHG A;  2XX4 A;  1OZ0 A;  3HZ1 A;  2WI4 A;  3ABM B;  4FJC C;  4X9L A;  5KA6 A;  2CCU A;  4GX0 A;  3D3I A;  2XOK G;  4WCE V;  1NHJ A;  2ZKJ A;  2FTK A;  3HHU A;  4R3M A;  3JD2 A;  3RBZ A;  2XDU A;  4YKX A;  5LHI A;  3CME V;  4CWS A;  2QE7 G;  3K04 A;  2IJH A;  4HZ0 A;  4HXZ A;  1VQ8 V;  1GK9 A;  4LCU C;  1S16 A;  3TTZ A;  4FK5 C;  4HZ5 A;  1FS0 G;  1I5Y A;  4WFA V;  2JJC A;  3H80 A;  3ABM C;  1S3J A;  3VHC A;  1K9M W;  1B63 A;  3D2R A;  1G8M A;  1KP2 A;  2QA4 V;  3U67 A;  4QE9 A;  5E1A C;  2WLK A;  5DN6 G;  2CCS A;  5CTX A;  1RM1 B;  3HB3 B;  4H85 A;  3D36 A;  4HAM A;  1AMW A;  3PJS K;  5M4K A;  1US7 A;  1QBZ A;  4YXW G;  3G7B A;  2JJ1 G;  4PA4 A;  1TBW A;  1PD3 A;  3CCM V;  5D7C A;  3SPI A;  4BAY A;  1YT0 A;  2BOC C;  5H6R A;  5B3S B;  2R9I A;  4QPK A;  4U7N A;  2Q8G A;  4LPB A;  1K3E A;  1Y8P A;  5CTY A;  5L3F A;  2O1U A;  5L3B A;  4PRV A;  2EIK C;  2WI6 A;  4EEH A;  1I5X A;  1MOF A;  2VCJ A;  1VQ4 V;  1SET A;  3JD3 A;  1OCO B;  2LP7 A;  5H9C A;  5H6Q A;  3W7U A;  2XDS A;  4O04 A;  1ENV A;  1Y4U A;  1OCC C;  4MTX A;  1BHB A;  1THN A;  1COW G;  3CCR V;  2WLN A;  4MS2 A;  3AG2 B;  3X2Q C;  2WLL A;  1VQP V;  2YE2 A;  1GKF A;  3JYC A;  3CCU V;  1P4R A;  2A79 B;  3AG3 C;  4P9O A;  1YIJ V;  3CC4 V;  4XIQ A;  1EBO A;  3E35 A;  3SYA A;  5IN9 A;  3OUF A;  5LHH A;  4JAU A;  2JK5 C;  1BMF G;  3ZKD A;  4I3H A;  4XDJ A;  1QLE C;  3UM7 A;  1YET A;  4N23 A;  1F4M A;  4JF3 A;  3TET A;  4X88 A;  1K73 W;  3OWB A;  3G75 A;  4CWP A;  3T1C A;  4XCJ A;  5J9P C;  3EHB B;  3JD0 A;  1ZXN A;  4KSH A;  1K5Q A;  3WFV A;  2IJJ A;  2XD6 A;  4R3A A;  1AI4 A;  2EIJ C;  3LSQ A;  5CBH A;  5L3G A;  3F5W C;  3CCE V;  4EM7 A;  1I5D A;  4FCQ A;  2PI4 A;  1IXM A;  3OR7 C;  4P7A A;  2DYR C;  1GKZ A;  2YE6 A;  4QIW F;  4B6C A;  3OAA G;  1UY8 A;  5CTU A;  4U93 A;  2EZO A;  3ABK C;  1ZXM A;  1G4Y B;  1NH2 D;  4AWP A;  1V55 C;  1ZWH A;  2W0F C;  2EIL C;  2XCM A;  2YEV A;  1I5C A;  2XJJ A;  3C0E A;  1K7D A;  1UYI A;  4HYP A;  5CF0 A;  4JTC B;  4KTN A;  2EBO A;  4LWF A;  1FFT B;  1AR1 B;  2YGF A;  1DTO A;  3AG4 C;  4WUB A;  1UYM A;  1YC4 A;  2WLH A;  5LGN A;  4KP4 A;  3W7X A;  2DQ0 A;  3CMA V;  1H7U A;  1KZN A;  3RLQ A;  5IDM A;  4MPN A;  3PEJ A;  2ITD C;  3CYO A;  2HFE C;  1Z5B A;  5BZB A;  4PU9 A;  3JD1 A;  1S0V A;  4MVU A;  4W7T A;  4GFN A;  1V55 B;  4URL A;  1M9N A;  1ARO P;  1I5A A;  3K79 A;  4GEE A;  3TUH A;  4MVZ A;  1PVG A;  3OFN G;  1AH8 A;  1OCZ C;  3ASO B;  2ZDX A;  5GGZ A;  2XK2 A;  3JZ3 A;  3JD4 A;  4MSW C;  2EXL A;  4Q20 A;  1BL8 A;  4XCL A;  1VQL V;  2BT0 A;  4HYM A;  1FXK A;  4L91 A;  2Q8I A;  1AJQ A;  2P6J A;  4CE3 A;  2YK2 A;  4MTF A;  1K97 A;  2R9R B;  3ZRW A;  5KA5 A;  1GKX A;  3OMU A;  2LFS A;  2Z3Y A;  5J71 A;  1SZT A;  2Q67 A;  4UV8 A;  2OTL V;  2WI7 A;  3E8H A;  2H8P C;  2D3O W;  4XE2 A;  3RLP A;  2BYI A;  3OW6 A;  5GW7 A;  4NH7 A;  1KP3 A;  2P67 A;  4X8A A;  2H55 A;  2X7R B;  1TIL A;  3F7V C;  2GQP A;  3Q5J A;  3X2Q B;  3FV5 A;  1JPX A;  1BGQ A;  4E01 A;  5C93 A;  1NKD A;  2YEF A;  2QM8 A;  4JPR A;  2DQ3 A;  4PA3 A;  5L3C A;  4DO2 A;  2VW5 A;  1B62 A;  4HXW A;  2IOR A;  3H4L A;  2QFO A;  3HEK A;  2ZXW B;  1M56 B;  2P90 A;  3RKZ A;  4EGK A;  4HY6 A;  5CPH A;  2JEX A;  3IED A;  1TC0 A;  4CWQ A;  1WPX A;  4H81 A;  4LWI A;  2JDI G;  2FYP A;  4R50 A;  1R3L C;  4XBF A;  1QZR A;  4MP7 A;  2ESA A;  4YKT A;  5BOC A;  4RAI A;  2WI3 A;  3EHJ A;  3OW2 U;  5B1A B;  3OEE G;  3CPW U;  3LPS A;  3ZCC A;  4QJF B;  5LBQ A;  1L0O A;  4K4O A;  1K4C C;  2AHY A;  1R6N A;  2EJR A;  3K3W A;  4F4L A;  2YE8 A;  2YE9 A;  3CWV A;  3OUS A;  1EFR G;  4R7C A;  4WFF A;  1OCR C;  2CK3 G;  4I5S A;  3ZMU A;  5CN0 A;  4GX2 A;  4PDR A;  3A0X A;  1NQT A;  1DF4 A;  2B1G A;  3K0G A;  3ETD A;  3O2F A;  2M7W A;  2BSM A;  1Q81 W;  3C11 A;  2YI0 A;  2JJ2 G;  3AG1 C;  3SYC A;  1OCZ B;  3ASO C;  4H33 A;  2WAM A;  1Q7Y W;  5M4N A;  4GT1 A;  1YC3 A;  2XAH A;  1VQ7 V;  3ZN1 A;  3CCQ V;  4RUE A;  5KUK A;  2YEC A;  3SJQ C;  1U0Z A;  2YKC A;  4LBE C;  4CBC A;  2OCC C;  3TZ0 A;  2HVJ C;  4N21 A;  3STZ C;  3CCL V;  2HVK C;  5D7D A;  2GSM B;  3R92 A;  2Q2E B;  2Q8H A;  5L3E A;  3AG1 B;  1S72 V;  3CD6 V;  3DGE A;  3T4D A;  4P2Z A;  3QNE A;  4QNH B;  4GGL A;  2IOQ A;  3CCJ V;  4R8C A;  2CH4 A;  3B28 A;  4G2K A;  5DM6 V;  3R4P A;  1B6Q A;  3T2M A;  3T2S A;  2OCC B;  2P7T C;  2KB1 A;  2XHR A;  1TUE B;  1CP9 A;  4LP8 A;  4MW8 A;  4JYC A;  1K33 A;  3HYY A;  5IYD O;  1JJ2 U;  3E8F A;  3CRK A;  2YK9 A;  4GQT A;  1AI7 A;  4MVO A;  1Q86 W;  2DYR B;  2BYH A;  2YE3 A;  1Y4S A;  3EKO A;  3Q5L A;  4L93 A;  4MP2 A;  4P8O A;  3ZXQ A;  3K03 A;  4RQF A;  4ASB A;  4E00 A;  2C2A A;  4WFB V;  3B8M A;  2X6B A;  4G28 B;  3U2K A;  2GFD A;  3D0B A;  1YHQ V;  2XAG A;  2JEU A;  1LNQ A;  2BRE A;  1JQ0 A;  2IWS A;  4CE2 A;  1U2O A;  3K98 A;  4YKQ A;  4UVC A;  5HFM A;  4MVR A;  1M57 C;  4UV9 A;  3R4N A;  5M4M A;  4CZZ A;  3IC7 A;  2ZXW C;  4KQV A;  3ASN C;  4I9W A;  3ABT A;  3A0Z A;  3EHF A;  2F43 G;  1I58 A;  1OHH G;  4L87 A;  3W7S A;  4ZKI A;  4UUJ C;  2YKJ A;  4YKZ A;  2BU5 A;  3RW0 A;  3AEI A;  4LC1 A;  4URN A;  2GHY A;  1VQO V;  2ATK C;  3E8G A;  3E8B A;  5CBG A;  5IDJ A;  1F4N A;  1NJI W;  1R3J C;  1H38 A;  1GTO A;  1H7S A;  2WI5 A;  2YGE A;  3B27 A;  5F3K A;  2AHZ A;  1A4H A;  1E1R G;  3CCV V;  1OCO C;  1VQ6 V;  3FT8 A;  1GM7 A;  2EIK B;  2XAS A;  2YI6 A;  4FPP A;  2BOB C;  3PEH A;  4J9Z B;  3SPJ A;  3OPD A;  3QTF A;  1OSF A;  2Q68 A;  4MBC A;  2ZR2 A;  3ZM7 A;  3G71 V;  2YEA A;  4PDM A;  3QDD A;  3MD0 A;  1EA6 A;  3WQ9 A;  1S14 A;  4WFE A;  2ZD9 A;  4AWQ A;  2WWW A;  5IYB O;  3R65 A;  3SYQ A;  2V7Q G;  3HZ5 A;  1K4D C;  1NBM G;  4TT3 G;  3UKM A;  1JX9 A;  2DW4 A;  3CC2 V;  3SYO A;  1NHI A;  3OMA B;  4ASU G;  1BHA A;  2YI5 A;  3QO8 A;  1F51 A;  2QTO A;  3ZMT A;  4FCR A;  2XAJ A;  2FWY A;  4V25 A;  3OMI B;  5B1O A;  2QG0 A;  1R62 A;  3MNR P;  5B1B B;  1FXK C;  1KIJ A;  1UYE A;  2CCT A;  3WHA A;  3K99 A;  1FXV A;  2HG5 C;  3ZRS A;  1YER A;  3WG7 C;  1CPY A;  1PKX A;  4MTG A;  5B1N A;  1AI6 A;  4JGS A;  1GO3 F;  5EC2 C;  2BRC A;  4MVQ A;  1UY9 A;  1M90 W;  2UXX A;  1TH8 A;  1UY6 A;  4JQL A;  2WLI B;  3ZMZ A;  1TC6 A;  1VQM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...