4FMTA

Crystal structure of a chpt protein (cc_3470) from caulobacter crescentus cb15 at 2.30 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
209
Chain Sequence
b'DVQGPDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChpT protein
publication title Branched signal wiring of an essential bacterial cell-cycle phosphotransfer protein.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 71
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fmtA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fmtA02
3EHGA 5M4KA 2YI6A 4U7NA 3DGEA 3TZ4A 3FT5A 5L3JA 4CE2A 4YKRA 1UYEA 3IEDA 2BYIA 4EM7A 3INWA 2XJGA 2JJCA 2IORA 3ZKDA 1ID0A 4JYBA 5M4PA 2YJWA 2WI6A 3T10A 1TILA 2YKBA 3A0XA 4MPCA 1BXDA 2XDSA 4MTXA 1ZXMA 4HY6A 1UYLA 4R3MA 3ZRWA 2WERA 4O09A 2FTKA 4LWIA 1YT1A 4DZYA 4DUHA 2FXSA 2YI0A 4XE2A 4H85A 1TH8A 2XCMA 4MOTA 4GGLA 1YS3A 2CCSA 2XJXA 5F3KA 3K97A 2BTZA 1S16A 1YERA 1AH8A 4XCJA 4CWOA 3C11A 4URMA 2ZDYA 4JQLA 4XITA 3R4NA 1UYKA 1UYMA 3FT8A 5D6PA 4P8OA 2IWXA 3ZRWB 1GKZA 3CWVA 1JM6A 1TC6A 3SL2A 5CTUA 4O0BA 2CCUA 1Z59A 3G7BA 4YKYA 2VCIA 3QDDA 4GT8A 3TZ5A 3K99A 1ZW9A 4XD8A 4I3HA 2K5BA 4ASBA 1JOYA 2XDKA 4CE1A 2QF6A 1YT0A 2GQPA 3ZXOA 3NMQA 3B25A 5BODA 1R62A 3BM9A 4R3AA 1Y4SA 3GIGA 2HKJA 3GIEA 4XIPA 2BYHA 1QY8A 5IDMA 1UYCA 4QPJA 5FNCA 1MX0A 1EA6A 1QYEA 1YSRA 1NHIA 2BU5A 2YI5A 2YEJA 4PU9A 2YEHA 3H80A 4HXWA 2VWCA 4E02A 4XIQA 1ZXNA 4FPPA 2YKIA 1B63A 3HZ1A 1Z5AA 2LFRA 1YESA 3U2KA 4CWFA 4YKUA 4EGKA 3ZRVA 5FNFA 3HYZA 4EGIA 1UY7A 3O2FA 4U7OA 1I5CA 3CGYA 2YE8A 4E00A 2Q8HA 2XHRA 2AKPA 4XCLA 1BGQA 2QM7A 2XHTA 4XIRA 3WQ9A 3VHCA 2BU7A 4LWHA 5IDJA 5CTWA 1A4HA 3FV5A 3K60A 3BMYA 4U93A 1Y8NA 3MD0A 2XK2A 4MP2A 4MBCA 4W7TA 5M4NA 2CGFA 4MP7A 1AJ6A 3ZKBA 1NHJA 5F5RA 2WI2A 3B28A 3PEHA 2VW5A 3QTFA 3A0YA 5B1OA 4XDMA 4XKAA 4BAEA 1UYFA 3TTZA 4MB9A 4HY1A 5M4HA 2HCHA 1Y4UA 4BQJA 4JAUA 4ZVIA 2LFSA 2YE4A 3TZ2A 3U2DA 4NH9A 1YC4A 5FWKA 1THNA 4XC0A 1Z5CA 3OWBA 3D0BA 1UYGA 2WI3A 3VADA 3B26A 4HZ5A 5GGZA 4BIUA 4PL9A 3P32A 2FYPA 5M4MA 4CE3A 2PNRA 4O04A 2XHXA 5D7CA 4LP0A 1TC0A 1TIDA 2YJXA 2H8MA 3G7EA 4KTNA 3B24A 4CWQA 2XD6A 3R4MA 2YE5A 4EFUA 4I5SA 2BU2A 2BU6A 3T0HA 5CTYA 3OPDA 4K4OA 3A0RA 4BIZA 1GJVA 2HG1A 2WWWA 1EI1A 4ZKIA 5CTXA 1UYDA 3T2SA 3D2RA 3HHUA 2XABA 4CWSA 2WEPA 2Q8FA 3HEKA 4YKXA 1YETA 2IWSA 1UY8A 2QG2A 2WI4A 4HZ0A 1I5BA 3RLPA 2YE2A 4NH8A 4AWQA 2CH4A 4EEHA 2O1WA 2O1VA 1YT2A 2IWUA 4EMVA 3EHHA 3HYYA 5M4EA 4LWGA 4EFTA 4GT1A 1KIJA 4UROA 3GIGB 1US7A 2BRCA 4AWOA 1I58A 4AS9A 2ZKJA 4BQGA 3H4LA 3VHAA 2YEEA 2IOQA 3EKOA 5IN9A 4V26A 5D7DA 2QG0A 4MT8A 1I5DA 1H7UA 4BXIA 3O0IA 4LPBA 4WUCA 4CWPA 3RLQA 1I59A 4L91A 3LNUA 5CF0A 2Q8GA 4QPKA 4Q20A 2WI5A 2EXLA 1UYIA 2BT0A 3RLRA 3R92A 1Y8PA 3ZRXA 2XDXA 4KSHA 2XX5A 2QFOA 4X9LA 1U0ZA 1AMWA 1AM1A 2FWYA 3ZM7A 1BYQA 5FNDA 4HXZA 4V25A 1QZRA 4MPNA 4LC1A 2XDUA 2ESAA 3PEJA 3VHDA 4CWRA 3K98A 5J6AA 1AH6A 2YE3A 4LWFA 4YKTA 2P67A 2YKCA 3OMUA 4B6CA 2H55A 1YC3A 1H7SA 3A0WA 2E0AA 2YEAA 2QM8A 1GKXA 4YKZA 1B3QA 1YSZA 2ZDXA 4FCQA 5C93A 2GFDA 4JYCA 1UY6A 4CWTA 3A0ZA 3D36A 3T1KA 2VCJA 2XX4A 1PVGA 4XKKA 4YKQA 3CRLA 2YEIA 4URLA 3U67A 2ZBKB 4ASAA 1TBWA 1KZNA 3CGZA 2YEBA 2YEFA 4ASGA 2YK2A 3EKRA 3KE6A 2Q8IA 4EGHA 1IXMA 3NXSA 3TK1A 5D6QA 2XDLA 4JAVA 3G75A 4WUBA 3ZCCA 4KFGA 2WEQA 1YC1A 1I5AA 3EHFA 4NH7A 4O05A 5D7RA 2UWDA 4LWEA 1U2OA 2YGAA 2XJJA 3RKZA 1F51A 3R4PA 3INXA 4KSGA 4ASFA 2WI7A 2XX2A 2YKJA 1MU5A 4R1FA 1Y8OA 2IOPA 4L8ZA 4WUDA 4XTJA 1L0OA 2BZ5A 3JZ3A 3HZ5A 2CCTA 4PRXA 4GEEA 5J71A 3OWDA 4FMTA 3Q5KA 2YEDA 4YKWA 1UYHA 3R4OA 3TZ0A 3WHAA 4URNA 1B62A 2YI7A 4O07A 3C0EA 4H81A 2YE6A 4H7QA 2YKEA 3Q5JA 4PRVA 3EHJA 3MNRP 4KP4A 2YECA 4FCPA 3CRKA 3LPSA 4L90A 1Z5BA 1BKNA 4E01A 1ZWHA 4HYPA 4GFNA 3GIFA 3ZXQA 3Q5LA 1OSFA 2BSMA 4JASA 3R91A 2YEGA 4GCZA 3OW6A 3O6OA 2JKIA 2WI1A 4KQVA 2YE7A 4B7PA 2CG9A 2YK9A 2YGEA 5CPHA 2YE9A 3T0ZA 1NHHA 5BOCA 2Q2EB 3B27A 4P7AA 4L93A 3TUHA 3A0TA 4L94A 2FWZA 4MPEA 4CWNA 2YGFA 2BREA 4AWPA 5B1NA 4HYMA 2O1UA 4GQTA 1S14A 4XKOA 4FCRA 2BU8A 1UY9A 2C2AA
chains in the Genus database with same CATH superfamily
4I50B 4J7ZA 3TZ4A 3FT5A 2CTPA 4D7SA 5L3JA 3DC5A 4B3RO 1UYEA 1PNKA 4O4JB 2YS8A 3INWA 2E76B 3HKCB 4NXMB 3APQA 3ZHRA 3ZKDA 4JYBA 2VQEB 4TOIA 2O57A 1AROP 5B3SC 2YJWA 2WI6A 4ZHQA 5AG2A 1VQ9V 4MPCA 3IAYA 1K4DC 1ZXMA 2N05A 1XNRB 1WA8B 4R3MA 1QR8A 5KAIZ 3ZRWA 2WERA 4O09A 2FB5A 3CCJV 4DUHA 2FXSA 2YI0A 3UO2A 1I5XA 1ZTEA 2IJIA 5EIBD 4X65B 4WCEV 4UVBA 1TH8A 1YS3A 2A06H 2Q69A 4WBNA 1M1KW 4IGGA 2M7WA 2WPDG 4PDRA 5LYJA 5BR8O 3CC7V 2YI8A 1UYMA 1P4RA 1VF5B 1VQNV 3FT8A 5DECA 2IWXA 3OMAB 1TVKA 4JI0O 5LMNO 5GTIZ 1TC6A 4O0BA 2X6BA 3K79A 2XAQA 3JARA 1FXHA 4B3TO 4UXNA 3K5MA 2GBOA 3ICXA 3K99A 4XD8A 1M4UA 3RYFA 1DLBA 2XAHA 4ASBA 3UM7A 1JOYA 1GAXA 2XDKA 4CE1A 4FFBA 1YT0A 2GQPA 1TUBB 3NMQA 1YSCA 1OCCB 2XOKG 2WLLB 4TUYA 5FL7G 3GIGA 1DGSA 3CSXA 1XHXA 2OCCB 1VQ7V 1S5HC 5IDMA 1UYCA 1Y4MA 1VQ6V 1AILA 4LFAO 2R9RB 1P7BA 4O4LA 5CA1A 1EA6A 3ZHQA 1QYEA 5IWAB 1NHIA 2YI5A 3ZX6A 4PU9A 4DUYO 2H94A 5IJ9A 2Q67A 2LFRA 4O4IB 5L3FA 4CWFA 3RVYA 1HNWB 2IJJA 4YKUA 2EIKB 1J95A 1NQTA 3LUTB 2LGQA 1NTKH 4RAIA 1UY7A 3RYIB 5FNVB 4U7OA 1SQXH 5B66Z 3ZHSA 2AKPA 3RT3C 1BGQA 2XHTA 4XIRA 1AP6A 4BR6A 4CH4A 2YDEA 1A4HA 3K60A 3BMYA 1K5SA 3MD0A 2WAMA 2XK2A 1H2KA 2OCHA 3STZC 2E5LB 2K1EA 3ZKBA 3SYCA 1GN4A 3MAQA 1Q6IA 4J9ZB 2P06A 1R6NA 3B28A 3ZHVA 3PEHA 4YIOA 3BVOA 5CBGA 3C3SA 1US6A 4ZOLB 3A0YA 4F4LA 4J7KA 4XDMA 2HFEC 1VQPV 2EINB 4MB9A 1WP7A 1OCCC 4UCUA 4L8JA 4BQJA 2CGNA 3TZ2A 4NH9A 1YC4A 3G71V 1Z5CA 2OCCC 3FB5C 2QWOB 3PN1A 3QG5A 1BZKA 2WA3A 2QSAA 3BA8A 2YC0A 4FLTA 4IHJB 4BIUA 4NKGB 3TXQA 2FYPA 4CE3A 1IXBA 3K0GA 2VQFB 1AI6A 1EN6A 4WFGA 1BQZA 2EIKC 4KTNA 3MHSC 4I55A 3WB0A 1R6KA 2YE5A 5JJJB 3S5TA 1WAZA 4LWSB 5D5PA 4YHHB 2BU6A 2A7WA 3ABLB 1L0LH 5CB4B 4K4OA 4BIZA 3C3TA 4ZKIA 5KA6A 4DR2O 4OPAA 4DW1A 3CCRV 1YTFB 3D2RA 3CP1A 3KG2A 2B1GA 2HKOA 4MW3A 2LW7A 2XAFA 2IWSA 2XT9A 4JYYA 4UV9A 2L6LA 3RLPA 2VWJA 4UCVA 3ZIAG 3M99B 4MVQA 4EKWA 5IT9N 1PPJH 2Y4UA 2XHBA 3N27A 1PV0A 1N8RW 2QWPB 4EMVA 2EINC 1OZ0A 4KL1A 2PUSA 5KAFZ 4EFTA 2FL4A 1PL4A 3AK1A 5BXZA 1RPRA 1MOFA 3H4LA 1QLEC 2H8PC 5EBLC 3CRCA 4LF9B 1JPXA 3QTCA 3F7VC 1YI2V 2DMXA 4WFEA 1TGOA 3QO7A 4MT8A 1I5DA 1H7UA 4BXIA 4DRXB 4WUCA 4CWPA 1I59A 4L91A 4X8AA 3U10A 3TCUA 1IBKO 4Q20A 2EZOA 1UYIA 2BT0A 4GZRB 1Y8PA 3E83A 3ZRXA 4QNHB 5IYZB 2UXBB 4O4JA 2JJ2G 3HKCA 4JZGA 1Y67A 3CRQA 1BYQA 4YY3B 1SQFA 4MPNA 1I5YA 2P7TC 2WSSG 1FAFA 3PEJA 2ZM6O 1FJGB 3M8AA 5LL6Y 1WA8A 2YE3A 2WLNA 2JEXA 2IH1C 1YJ9V 4EB6B 4JI3B 4AI8A 1BS3A 3E86A 2QM8A 1B3QA 2HJFC 2ZDXA 4FCQA 4EEQA 5F2VO 1M5IA 1U96A 4CWTA 3D36A 4JTAB 4LF4B 4B7KA 4YKQA 3CRLA 3SPJA 5EYPA 5GONB 4JI5B 3CC2V 1URFA 1SF9A 2B1IA 1H2SB 1RFYA 2ZCEA 2YEFA 2A79B 2YK2A 5LGNA 1NT2B 1SQVH 3KE6A 3I56V 4WFBV 2Q8IA 1YEWA 5KLVH 4GKKB 2JK5C 3O65A 4LH7A 5LHGA 2JIZG 2WLIA 3L75H 5JQGA 4KFGA 3BAAA 1K97A 3K9SA 2WLLA 2A3QA 1NTMH 3T1YB 4NH7A 2UWDA 4UCRA 2PZSA 5JCOA 2IM9A 4LF5B 4O2BB 4JYAB 3KCYA 1F51A 4YXWG 3INXA 1GM8A 1S0VA 1GO3F 4PHZA 3ZEDA 1NU1H 3ASNB 2CCTA 2XNDG 1MA1A 1MZFA 2RN9A 3OWDA 4NXMO 3UT5B 4PELA 3Q5KA 4O4IA 3A8TA 4X1KB 3WHAA 5IYBO 1W0KG 3GVMA 4MW8A 4NB5A 3H1KH 4O07A 4FK5C 3RYIA 3W7TA 1XNRO 4W4KA 5EBMC 4PRVA 4TV9A 2C1GA 3BHPA 3MNRP 1DTOA 3OUFA 5J9PC 4FCPA 1Q43A 2CK3G 2RCVA 4X65O 1Z5BA 2NN4A 4E01A 1XMOB 3LNMB 3FD9A 5CN0A 1J5EO 1AI7A 3GIFA 4DUZB 5CA0B 3Q5LA 2BSMA 1SERA 1QCEA 2JKIA 3BY6A 1XDCA 4J41A 4ZI7B 2YSUB 2YE9A 1NR1A 3ETQA 4MSWC 3E8HA 5JWPA 1RM1C 2ZXWB 3MHHC 3A0TA 1E1RG 4L94A 4PA4A 2IJHA 4CWNA 4FLZA 4ZOLA 3RVZA 2LQTA 4DW0A 4AWPA 4ICGA 2YXHA 4PDMA 1I94B 1S14A 2A0LA 2ZQMA 4XKOA 4DV6B 3FAVB 5GW7A 5IE9A 2EILB 1NR7A 3EHGA 1EN4A 2YI6A 3D3QA 4U7NA 4Z1VA 2UU9B 1BMFG 5CBHA 3VOUA 3B8MA 4YKRA 2BYIA 2KKWA 4IHJA 1XL6A 3ASNC 1MNGA 1ID0A 1YCIA 3T10A 1TILA 2YKBA 4DR3B 2XDSA 1Q81W 1HNWO 3WB1A 2RQ6A 3CD6V 5B1AC 1IX9A 4LWSA 1UFIA 5JH7A 2ZIMA 1B04A 2ITDC 5J2UA 5CB4A 2Q8VA 3JD3A 4MOTA 2XJXA 2IW5A 3BFRA 5F3KA 1M56B 2BTZA 2DE0X 3W7UA 1YERA 5EZYB 4URMA 1WB8A 2ZDYA 4JQLA 2DW4A 3SDLA 3R4NA 1QHTA 1UYKA 5LP6B 5FPOA 1QVFU 3LDDA 4UCOA 1D5NA 4P8OA 1GKZA 1KP2A 2P4KA 1GMGA 2PGGA 1N34B 1Z59A 1R3JC 4UB8Z 2Y69B 5JVDB 1GTOA 4PD4F 3G4SV 3Q4HA 1Q82W 3TZ5A 4I3HA 5L3GA 2K5BA 1WB7A 4MTGA 1QR9A 3DXRB 3D3IA 2QF6A 3H9VA 4Z2WA 2BOBC 2JGDB 2X0LA 3B25A 3SJQC 3K5OA 1BGYH 1ZAUA 3OE7G 5BY1A 5EC2C 1GN2A 1EN5A 2VS0A 3ASOC 4B3MB 3GIEA 1AR5A 1OHHG 3S3WA 4GX1A 1IBLB 2UXCO 4X1YB 2BU5A 3J7AU 1DF5A 2JRIA 5LMUO 3H80A 4E02A 1HNXB 2YIDA 4U3JB 4FPPA 4DRXA 3GB7C 4I0XB 5L3BA 1YESA 4DR5B 3M7MX 4J11A 3ZRVA 1Z5VA 1SQQH 2ARHA 4OGQB 1Y76B 5IYZA 3K58A 1JFFB 2HEPA 2MW2B 4NVPA 1GN6A 4UB6Z 3SPGA 4MVMA 2LP7A 4DV5B 1SS3A 1OCOB 3K59A 1H2GA 2P4VA 2JS5A 3HKDB 1GM7A 4JI4B 3L73H 1BHAA 5CTWA 2QKCA 3LSQA 4U93A 1Y8NA 1WNSA 3T2MA 4MP2A 2ZR2A 2X6AA 3A2FA 2CGFA 4MP7A 2OTLV 3CMEV 1AJ6A 3SYPA 4XDKA 3CE2A 4JV5B 3JD0A 4EB6A 2Y69C 4KUMA 1GN3A 2PYLA 2BSKB 1NHJA 5BMVA 4DR7B 2GUZB 3D8CA 3VQXA 2VW5A 3QTFA 3L70H 4F6RB 2DWDC 2BE3A 2ZD9A 2BTOA 4JI2B 4XKAA 1OCRC 4HY1A 1NJIW 1PP9H 4GKJB 2JJ1G 1BE3H 3ML0A 2QR4A 2XTAA 5GONA 1THNA 2XASA 5KMGA 3OWBA 3H1IH 3OM3B 3OGCC 4GX0A 2IU3A 3D0BA 2WI3A 3OD4A 3B26A 5L3DA 1M57B 2F93B 5GGZA 3B40A 4LF9O 3J80N 1R73A 3VBBA 1YITV 2QWRB 2YUAA 2KG7B 1G1XB 1W0JG 2QKSA 4HNAB 2CDYA 3TXSA 1IZ3A 2H8MA 2CH7A 3G7EA 3B24A 2JS3A 1OV9A 1Z5WA 5LXTB 1FXKA 1HP8A 3OPDA 3BRCA 1OCOC 3A0RA 1GJVA 4LF7O 4DV2O 2WWWA 3HKEB 4LF6O 4BW5A 4A5UB 3JALB 1UYDA 4JI6B 4YY3O 2JGUA 5L3EA 2WEPA 3FB8C 3ZJZA 1UY8A 2ZE7A 3VQYA 4HZ0A 4DR6O 2G38A 4CH5A 4NH8A 2ZE8A 2H3OA 1AJNA 4I9WA 4H33A 1YT2A 1O9GA 4LR3A 3QF7A 2WLJA 4JZ2A 1V55B 1L1FA 5KUKA 1PL0A 5CA0A 3HYYA 4AILC 2Y0IA 2LGWA 1Q8IA 4Q6GA 4QGPA 3P3PA 4JPRA 4LF4O 4J10A 1HNZB 1XEQA 2UUCB 1US7A 5CMUA 1EM1A 4ZI7A 1N36O 1I58A 4AS9A 4AWOA 2W0XA 1B06A 1PNLA 4LNUB 1AR1B 1VMGA 2GDSA 2HG5C 3A0HZ 1Y6XA 4HBNA 3VQVA 4O2AB 3EKOA 2HVJC 4V26A 1M57C 4I4TB 2FYUH 2UXXA 2QG0A 3P30A 4YJ3B 5H6RA 2YXLA 3AG1B 1V54B 4LPBA 4PA3A 3OEHG 2R9IA 3N2KA 1H2NA 3T1YO 3LNUA 5CF0A 2QWNB 3RYHB 1KMIZ 2Q8GA 4QPKA 5KA5A 5KX5B 2EXLA 4JYAO 4LF5O 3RLRA 3ETEA 2CGOA 2ATKC 2XDXA 4RQFA 2ZE6A 2HHHB 4KHPB 4X9LA 3BA9A 4DV3B 1AM1A 1Q86W 1WN7A 2YI9A 4IT5A 3AG4C 5FPRA 3ZMVA 4IYHA 1JJ2U 3HR0A 3H01A 1S3JA 5EIBC 3JYCA 3EHBB 2AZ0A 1X59A 4LWFA 1OJHA 2RJZA 1QLEB 5H9CA 2F95B 1MABG 3GWKC 4FIPC 1HDJA 2UUAB 2UXDB 3A0WA 3WU2Z 3JAKB 3I55V 1GKXA 1YSZA 3JSLA 5EZYA 1XMOO 1V55C 2EZPA 5LOVA 1UY6A 2ZIOA 3A0ZA 4TSFG 4DUZO 4CH3A 3T1KA 2VCJA 5LP6A 1TUEB 3G6BA 1Q6HA 2YEIA 2VRZA 4PA9A 4ASAA 2XAGA 3K06A 1FXVA 4D6TH 3J81N 1YTFD 2ZKOA 3CXCU 2F4VB 3EKRA 5LGUA 3T1CA 5LBQA 4EGHA 3RYCA 1XILA 3NXSA 4JI8O 3TK1A 3DXRA 4KXRA 4MVSA 2XDLA 3G75A 3ZCCA 1S76D 3AG1C 1V54C 2JGDA 1YC1A 1G8MA 4G2KA 4HZ3A 4AQYB 3EHFA 4NTXA 2YIBA 3ZMSA 1N33B 2WA4A 4DV6O 1U2OA 3G67A 1YVWA 4AHCA 3RKZA 2ZT9B 4ASFA 3B09A 3QO8A 3OT7A 2LO1A 4X1YA 5K1PA 4YJ2B 1Y8OA 2IOPA 4L8ZA 4FJCC 4JGSA 4X20B 4NXNB 2KB1A 4PRXA 3ETGA 4U3JA 4PDLA 4RUFA 1VF6C 4I0XA 4X89A 1QNMA 3UCSC 1AI5A 3SJCC 1XI1A 4DV1B 4DR1O 1SETA 4H81A 3LMMA 1Q5OA 3RN4A 3TGUH 1NVPB 1NZ6A 2Q68A 1Z2GA 4WFFA 1JFFA 3N2GB 3TETA 2KSDA 3FYIB 4KP4A 2K9PA 2YECA 3CRKA 1BKNA 3HKDA 4GFNA 4PI2A 3ZXQA 3PJSK 4H13B 1SA0B 3CCEV 3E35A 1E79G 3QO5A 3OW6A 3IFXA 4KQVA 2YE7A 1MSWD 4I50A 4B7PA 2CG9A 3T0ZA 3T1HB 1NHHA 2Q2EB 1N0NA 3FB6C 2QGNA 1HR0B 2NLJC 4MPEA 1H2MA 3E2EA 4F6RA 3DSQA 4HYMA 1ZWIC 4PA6A 1XMQO 4K0KB 1KBHA 2X6CA 3EVKA 4GQTA 1RPOA 4DXWA 4FCRA 1FS0G 2JEUA 1WJZA 3QVNA 2F1MA 2C2AA 4JAAA 1JR9A 5BZBA 4B3MO 3CXHF 5LGTA 3LNNA 1H2LA 3DGEA 4B3TB 1XUQA 1YXBA 4DK0A 4FM0A 4CE2A 1IBLO 2XJGA 2IORA 3B8NA 2EIJB 4JI7B 4X1IB 5M4PA 3AG2C 1HNXO 2QTSA 2WLKA 4HNAA 1P7GA 3U11A 1HWYA 5C8YB 1BXDA 4X66B 1ZUQA 3X2QC 4MTXA 4HY6A 4LFAB 1UYLA 2R70A 1AJQA 2UUBO 4EFBA 5LXTA 2GTAA 2FTKA 1A32A 2RNBA 4DZYA 4GUNA 4MTOA 1RM1B 4H85A 4FLVA 1R6TA 3CJHB 4UFZA 3HKBB 3HKEA 1S16A 3JALA 5IYCO 1TUBA 2MK3A 2Q6AA 3C11A 4ZHQB 1NBMG 4E2LA 1PKXA 2GV9A 4XITA 4LFCB 4I7ZB 2V1DA 3SPCA 4LF8O 5D6PA 3ZRWB 3F5WC 3KCXA 1JM6A 5CTUA 3CX5F 3ZN0A 4YKYA 2ZDIC 3QDDA 3E8BA 4GT8A 3OEEG 3BPZA 1ZW9A 1OCZB 3LDCA 1RSOB 3K3WA 4PV1B 1LNQA 4WBNB 2QM4A 2WLMA 4JI2O 5BODA 2VQEO 1R62A 5FLXN 1Y4SA 2AW9A 4GKJO 1B6QA 5B1BB 1NH2B 1XREA 3EXAA 3UQ8A 1TVKB 5FNVA 4LCUC 5B1AB 4ASUG 4QPJA 4O2AA 1U97A 3JARB 2NR5A 4UCTA 3OMNB 2BCCH 1SQGA 3P3NA 4YJ3A 1SRYA 4HXWA 4RO2A 3JASB 2EIJC 3KKYA 1PD3A 1CPYA 1ZXNA 2YKIA 4FFBB 1JX9A 1FD9A 2QE7G 3SYAA 2ZR3A 2AXTZ 4TUYB 3JD4A 3U2KA 2IU0A 1QQCA 2HLDG 3RYHA 1FKAO 1YF2A 4FVMA 4EGIA 4WFAV 3JATB 4O4LB 1KQSU 2YE8A 4E00A 2EJ7A 2Q8HA 2E75B 2XHRA 4XCLA 2EBOA 4P9OA 2P6JA 2YXYA 2QM7A 1KU9A 4P30A 3OUSA 1O9HA 1XHZA 3WFVA 4LWHA 5IJ9B 5EC1C 4JI6O 4FLYA 5CBFA 1N4CA 3CWBH 1KKCA 3TJTA 1G6UA 4W7TA 5DEDA 3ASOB 4E4EA 1P49A 1DK1A 2C1IA 5CA3A 3CEIA 5F5RA 2HJDA 1K7DA 2WI2A 1BSMA 3JAKA 1OCZC 3DTUB 5IWAO 5B1OA 2AHZA 1FFXB 4PA7A 4BAEA 3LSUA 1UYFA 1S77D 5M4HA 2HHIA 1W2BU 4JAUA 4ZVIA 5FWKA 5B1BC 4B3SB 2QJ1A 2UUCO 4N21A 5DM6V 3W7SA 1Q7YW 3OTFA 2DOSA 2F23A 3CB2A 1JVMA 1Q3EA 3AG7A 4MS2A 2E3CA 1PM9A 2CTQA 4DYLA 4HZ5A 4PL9A 3P32A 3SR2C 2QWQB 4Z1MG 2Y48A 3CHXA 4O04A 2XHXA 1TC0A 4F6EA 2CTWA 1TIDA 2YJXA 5IYDO 1WLEA 3H1HH 1S72V 3ZHTA 5J2TB 4CWQA 1Y74B 1IURA 2E5LO 3WG7B 1Q6UA 4ZIBA 3IJ4A 4I5SA 4YJ2A 1GH6A 3T0HA 3K57A 2ODMA 4X20A 3T4DA 2GSMB 2YIBD 4J9YB 2HG1A 4DV3O 5EK0A 1EI1A 3EFFK 5CTXA 1RP3B 3T2SA 1OCRB 1YZBA 3HHUA 3GWOA 3OMIB 3SPIA 2XABA 1IBKB 1K4CC 4NR1A 1I0HA 2Q8FA 4R50A 3JAMN 3N2GA 2YE2A 3RFRA 3CRMA 3A0BZ 1AJPA 2UXDO 5LA6B 2O1WA 4I9QA 1FFTB 4BIOA 1VQ4V 3EHHA 3B77A 1BT8A 1VARA 5M4EA 3IGAC 4LWGA 4GT1A 2VQFO 1KIJA 4N23A 3S3XA 2M6YA 4UROA 2BRCA 4FLWA 1BQ0A 4BQGA 2Q73A 2YEEA 1LUWA 2IOQA 4G27B 1TA8A 5IN9A 2ADPA 3CC4V 4LBEC 5H2FZ 3CRRA 3AG3B 4YHHO 3OAAG 1JA8A 3ZN1A 3CS5A 2PI4A 2BTQB 3RLQA 4IIJB 4JF3A 2E74B 1ZL8B 3O9OA 3SYOA 2ADQB 4TT3G 2V7QG 3ABTA 1N33O 5JENA 1K33A 3WG7C 3FFQA 2XUMA 1KC8W 2XX5A 4CS2A 4CH6A 4CS3A 3OW2U 1AMWA 1SZXA 3SPHA 4NXNO 2FWYA 1R1BA 5FNDA 4HXZA 4V25A 2N74A 2QEXV 1QZRA 1UJWB 4WF9V 4LC1A 4X64B 1XOUA 2ETNA 2ESAA 4QIWF 3VHDA 1BCCH 3ZMTA 1H8EG 3OTOB 1SZTA 4B08A 5B5EZ 3H1JH 3SJAC 2AZ2A 2Z0AA 1SQBH 2HR3A 4HAMA 2YKCA 3OMUA 4B6CA 3DC6A 1WPBA 1YC3A 3BABA 1H7SA 1NTZH 2YEAA 3CJHA 1VQ5V 3HKBA 1BHBA 4IYIA 5C93A 2Z5UA 4DV0B 1H38A 4JYCA 4O4HB 3OGIB 2XX4A 4OPHA 4DV4B 4O2BA 3G80A 4URLA 4FLXA 2Q7GA 1EBOA 3AEIA 3T1HO 3K04A 4JTCB 3RW0A 1FYJA 2UXBO 2ZE5A 3AG3C 1IXMA 1RSOA 3RGBA 1J5EB 2YIAA 1HR0O 2B9ZA 3LDEA 4L87A 4JAVA 1I7FA 4WUBA 3E8GA 3AG4B 3UT5A 1VP7A 4UVAA 3CCVV 1SC5B 1XNQB 1E1QG 2WEQA 5EBWC 3IC7A 4X1KA 1LR1A 4K0KO 2IH3C 1X4TA 2DYSB 2PTMA 2FMLA 5EYPB 4YIPA 4GX5A 1FJGO 1K73W 4KSGA 1QU7A 2OIGA 5IY5B 2WI7A 2Y4TA 1MU5A 1L0NH 3W7XA 4WUDA 1L0OA 2BZ5A 2ITCC 3JZ3A 3HZ5A 4JI3O 3JASA 2KQXA 3K0DA 2WLIB 5JQGB 3SJBC 4PJ0Z 4JI7O 2YEDA 4YKWA 1UYHA 4URNA 3RWRD 4LP8A 2YI7A 3ZMZA 4R6ZA 2YE6A 4X66O 3JATA 4H7QA 4DK1A 2YKEA 1N32B 3Q5JA 4OX9B 4JI5O 1LUVA 2DQ0A 4X9QA 4MVOA 4FM2A 4L90A 4DR4B 3THOA 3FKSG 1ZWHA 1I08A 4GKKO 2FKXA 2XAJA 2DQ3A 1KECA 2QDOA 3CMAV 1OSFA 1VQOV 4JASA 5ITZB 3FAVA 4LFCO 3O6OA 2WI1A 3U0ZA 4LFBB 2YK9A 2Q5ZA 2YGEA 5CPHA 4E72A 4TV9B 3TUHA 3OR6C 2DWEC 2PYJA 1FFXA 1YHQV 5B1NA 2O1UA 1KUQA 1IVSA 3D36C 4TWKA 4R8CA 4NTYA 3KZIZ 2DYSC 3AK3A 2BU8A 2CUGA 5M4KA 5IY5C 2Q7EA 3B4SA 4RQEA 2HP8A 3IEDA 1P84F 3UO3A 4EM7A 2JJCA 2OYQA 1MSDA 3VQWA 1YJWV 3JD1A 3ABKB 2Q7HA 1K34A 4K35A 3A0XA 5J2TA 5JCOC 4JI1B 2R9AA 4UVCA 4DV7B 1Y74A 1AI4A 3ABUA 4QE9A 1K8AW 1JCHA 3FX7A 4GYCB 1QVGU 2UXCB 3ETDA 4LWIA 5LMUB 1YT1A 1UPGA 4XE2A 5JVDA 3R65A 2XCMA 1GRJA 4GGLA 2CCSA 5LHIA 3K97A 2LJ2A 3L71H 2EULA 1AH8A 1GK9A 4XCJA 3CYOA 4CWOA 4RUEA 1I94O 4X62B 3CWVA 4LH6A 1XQ8A 1IBMB 3SL2A 1KYOF 4FM1A 5JH7B 2CCUA 3G7BA 2P90A 2VCIA 3MDSA 5J2UB 2UU9O 5LA6A 2OIEA 2LW1A 1NVPD 1NI8A 3ZXOA 2B5UA 2VWKA 3AG2B 5DN6G 1T5EA 3BM9A 4R3AA 4X88A 2EX3A 2HKJA 4XIPA 3X2QB 4DR3O 2BYHA 1QY8A 3BEHA 1WPXA 3K5LA 4B3SO 4B3RB 1Y76A 3JAWB 2P22C 5FNCA 1MX0A 4PI0A 1YSRA 1ORQC 2QA4V 3Q4HB 2YEJA 4U3FH 2YEHA 3ZMUA 2VWCA 1NS1A 4XIQA 3ABKC 1AP5A 2JVDA 2BTQA 1B63A 1V9PA 3HZ1A 1Z5AA 4IIJA 2L35A 2IBZH 1ZL8A 5KHHA 4EGKA 1GKFA 5IJ0B 1M9NA 2R72A 5FNFA 3HYZA 5HFLA 3O2FA 4XBFA 2OTJV 1I5CA 1PNMA 3CGYA 1VIBA 1EFRG 1JMKC 5L3CA 2BSKA 2ILMA 4CZZA 2GUZA 4QJFB 1N34O 4TV8B 3WQ9A 2YEVB 3VHCA 2BU7A 1VQLV 5IDJA 4UV8A 2ZNJA 3FV5A 5BR8B 3T4ZA 4MBCA 5M4NA 4KFMA 3CCMV 4W4LA 3W7WA 4JI0B 5LMNB 1D5AA 1S5LZ 2AHYA 2EJRA 3E89A 1SQPH 1BL8A 3ABLC 4LF7B 3E22B 4DV2B 4QE7A 4CS4A 4XDJA 4LF6B 1JJOA 4ZBMA 3ZHUA 4K8XA 2KG7A 3UKMA 3TTZA 3I5DA 4O4HA 2HCHA 1F4NA 4TQFA 1Y4UA 4MVUA 1KKDA 2LFSA 2YE4A 3U2DA 4RWUA 4DR6B 5KUMA 4DR5O 1Q90D 4XC0A 2Q4PA 3L9DA 1YDXA 3HPLC 1IDSA 4DUYB 1UYGA 3VADA 3CYGA 5BMVB 2HVKC 4NYKA 4J42A 5JJEB 4MVZA 4DV5O 1R3IC 5M4MA 2PNRA 1F4MA 5E1AC 5D7CA 4GLXA 4LP0A 4JI4O 1N36B 4P9PA 4CC5A 2OT5A 1ZSPA 1K9MW 4P2ZA 3CCSV 2PI5A 5KMGB 2XD6A 2PY5A 3RBZA 3R4MA 3NR7A 4DO2A 4EFUA 5E79Z 2DYRB 2BU2A 3K03A 3IC9A 5CTYA 1QLNA 4JV5O 4H37A 2ZINA 1MG1A 4DR7O 1MZEA 1VEWA 2Q9LA 2DJVA 2CAZC 1NH2D 2D2CB 3JCUZ 1EZVH 1DF4A 1N0JA 5KHIA 4CWSA 5LYJB 4UUJC 4X64O 2A9HA 2CH7B 4FZ0A 5JJNB 3HEKA 4H44B 4YKXA 1YETA 2QG2A 3OTOO 4LNUA 5A2QN 2WI4A 4C7UA 1I5BA 1SKVA 4AWQA 3R66A 1AVMA 1FXKB 2D3OW 3HB3B 1G4YB 2W6JG 2W0FC 4I4TA 3SYQA 1VF7A 2OWOA 2CH4A 1VQ8V 4EEHA 3RYFB 2O1VA 2IWUA 3CCQV 3QNEA 4DV0O 1JQ0A 5ITZA 3E8FA 3K5NA 3GIGB 5KX5A 4DV4O 2ZKJA 2Y0PA 4BW9A 3VHAA 1K5QA 5CA1B 2EIMB 4GX2A 5D7DA 2CTRA 2Q0OC 4G28B 3SGIA 3CRAA 1M90W 1VF6A 1R3KC 3AK2A 3O0IA 4HYOA 1XNQO 5H5NA 1ROPA 1R3LC 2W6IG 1YIJV 1ZLZA 4NTWA 4EFEA 1F7YA 3F5TA 2WI5A 3CPWU 2IJKA 4FZ1A 2QKAA 3R92A 2DYRC 3C90A 5KHJA 1F23A 4IL6Z 4KSHA 3JCZA 4JI8B 1AB3A 2QFOA 1U0ZA 4DR2B 1SESA 3ZM7A 1TAEA 2YICA 5A9GA 2Q0AA 3H1LH 1L8DA 2XDUA 2AGAA 3N2KB 4CWRA 4XDLA 1GM9A 3K98A 5H6QA 5J6AA 1AH6A 4YKTA 4FFKA 4BWAA 1HNZO 1QBZA 5GTHZ 2P67A 1THZA 4MTFA 1N32O 2H55A 4OX9O 1FXKC 1VQKV 1AR4A 2E0AA 2Z3YA 4DR4O 4YKZA 2GHYA 3BCCH 2GFDA 1KD1W 4DR1B 3JSNA 3LSSA 3ABMB 3OR7C 3APOA 1PVGA 4XKKA 2JDIG 4PDVA 4MVRA 3FYEB 1YJNV 3U67A 2ZBKB 1TBWA 1KZNA 1KP3A 1WP8A 4LFBO 3CGZA 2YEBA 4ASGA 1EZJA 2EIMC 4D7TA 3L74H 4TQDA 3OFNG 2QTOA 1FPOA 5D6QA 2HHHO 4KHPO 4FLUA 4OXSA 2UXNA 5LOVB 1XBLA 1S5JA 1I5AA 3B2EE 4O05A 3K9AA 5D7RA 4LWEA 2YGAA 4CBCA 3ZS8C 2N04A 2XJJA 4I55B 3R4PA 3JAWA 2XX2A 1W59A 1XL4A 2YKJA 4R1FA 2ZXWC 3FB7C 4R7CA 4XTJA 2GTSA 3RYCB 2UUAO 1Y66A 1ZX3A 1XMQB 4GEEA 5J71A 4H0LB 4FMTA 2NNUA 5B3SB 1COWG 1H8HG 3TZ0A 2ZM6B 3CCUV 3R4OA 4JTDB 1SA0A 1B62A 2F43G 5IJ0A 1HW7A 2EILC 3C0EA 4BAYA 4JI1O 2P5OA 3ZRSA 4DV7O 2X7RB 5TISZ 1CEZA 4ABMA 1VQMV 3EHJA 1D2DA 1K3EA 5D5QA 2ZDIA 5HFMA 3LPSA 4TV8A 2RMKB 2YEVA 2F4VO 1MMMA 3K08A 1CP9A 4J80A 3ZBHA 4B7EA 4HYPA 2V4DA 1CXZB 1KB9F 5KHKA 1K92A 2F66C 3CCLV 3R91A 3ABMC 4GCZA 2YEGA 4AQYO 3G6EV 2UUBB 2CE4A 2DN9A 4X62O 4K8ZA 2PF4E 5BOCA 3B27A 1M93A 2BOCC 1IBMO 4P7AA 3E22A 5K1XA 4L93A 2FWZA 2RDCA 1M56C 1ENVA 1NKDA 3STLC 2YGFA 4K3AA 2BREA 5KHGA 4X1IA 3F7YC 5LHHA 4CC6A 4UCSA 3JD2A 2ZNIA 3WB2A 4WFHA 4LF8B 5C8YA 4DV1O 4J7JA 5LP6C 1UY9A 3L72H 2WLHA
chains in the Genus database with same CATH topology
3TZ4A 3FT5A 5L3JA 1UYEA 1PNKA 3INWA 3ZKDA 4JYBA 1AROP 5B3SC 2YJWA 2WI6A 1VQ9V 4MPCA 1K4DC 1ZXMA 4R3MA 1QR8A 3ZRWA 2WERA 4O09A 3CCJV 4DUHA 2FXSA 2YI0A 1I5XA 2IJIA 4WCEV 1TH8A 4UVBA 1YS3A 2Q69A 1M1KW 2M7WA 2WPDG 4PDRA 3CC7V 1UYMA 1P4RA 1VQNV 3FT8A 2IWXA 3OMAB 1TC6A 4O0BA 2X6BA 3K79A 2XAQA 1FXHA 4UXNA 3K99A 4XD8A 1DLBA 2XAHA 4ASBA 3UM7A 1JOYA 2XDKA 4CE1A 1YT0A 2GQPA 3NMQA 1YSCA 1OCCB 2XOKG 2WLLB 5FL7G 3GIGA 2OCCB 1VQ7V 1S5HC 5IDMA 1UYCA 1Y4MA 1VQ6V 2R9RB 1P7BA 1EA6A 1QYEA 1NHIA 2YI5A 4PU9A 2H94A 2Q67A 2LFRA 5L3FA 4CWFA 3RVYA 2IJJA 4YKUA 2EIKB 1J95A 1NQTA 3LUTB 4RAIA 1UY7A 4U7OA 2AKPA 1BGQA 2XHTA 4XIRA 1A4HA 3K60A 3BMYA 1K5SA 3MD0A 2WAMA 2XK2A 3STZC 2K1EA 3ZKBA 3SYCA 4J9ZB 1R6NA 3B28A 3PEHA 5CBGA 3A0YA 4F4LA 4XDMA 2HFEC 1VQPV 2EINB 4MB9A 1OCCC 4BQJA 3TZ2A 4NH9A 1YC4A 3G71V 1Z5CA 2OCCC 3FB5C 4BIUA 2FYPA 4CE3A 3K0GA 1AI6A 4WFGA 2EIKC 4KTNA 3MHSC 1R6KA 2YE5A 2BU6A 3ABLB 4K4OA 4BIZA 4ZKIA 5KA6A 3CCRV 1YTFB 3D2RA 3CP1A 3KG2A 2B1GA 2HKOA 4MW3A 2XAFA 2IWSA 4UV9A 3RLPA 3ZIAG 3M99B 4MVQA 4EKWA 1N8RW 4EMVA 2EINC 1OZ0A 4EFTA 1RPRA 1MOFA 3H4LA 1QLEC 2H8PC 5EBLC 1JPXA 3F7VC 1YI2V 4WFEA 3QO7A 4MT8A 1I5DA 1H7UA 4BXIA 4WUCA 4CWPA 1I59A 4L91A 4X8AA 3TCUA 4Q20A 2EZOA 1UYIA 2BT0A 1Y8PA 3E83A 3ZRXA 4QNHB 2JJ2G 1BYQA 4MPNA 1I5YA 2P7TC 2WSSG 3PEJA 2YE3A 2WLNA 2JEXA 2IH1C 1YJ9V 3E86A 2QM8A 2HJFC 1B3QA 2ZDXA 4FCQA 4CWTA 3D36A 4JTAB 4YKQA 3CRLA 3SPJA 3CC2V 2B1IA 2YEFA 2A79B 2YK2A 5LGNA 3KE6A 3I56V 4WFBV 2Q8IA 2JK5C 5LHGA 2JIZG 2WLIA 4KFGA 1K97A 2WLLA 4NH7A 2UWDA 1F51A 4YXWG 3INXA 1GM8A 1S0VA 1GO3F 3ASNB 2CCTA 2XNDG 3OWDA 4PELA 3Q5KA 3WHAA 5IYBO 1W0KG 4MW8A 4O07A 4FK5C 3W7TA 5EBMC 4PRVA 3MNRP 1DTOA 3OUFA 5J9PC 4FCPA 2CK3G 1Z5BA 4E01A 3LNMB 5CN0A 1AI7A 3GIFA 3Q5LA 2BSMA 1SERA 1QCEA 2JKIA 3BY6A 2YSUB 2YE9A 1NR1A 4MSWC 3E8HA 1RM1C 2ZXWB 3MHHC 3A0TA 1E1RG 4L94A 4PA4A 2IJHA 4CWNA 3RVZA 4AWPA 4PDMA 1S14A 2A0LA 2ZQMA 4XKOA 5GW7A 2EILB 1NR7A 3EHGA 2YI6A 4U7NA 1BMFG 5CBHA 3VOUA 3B8MA 4YKRA 2BYIA 1XL6A 3ASNC 1ID0A 3T10A 1TILA 2YKBA 2XDSA 1Q81W 3CD6V 5B1AC 2ITDC 3JD3A 4MOTA 2XJXA 2IW5A 5F3KA 1M56B 2BTZA 3W7UA 1YERA 4URMA 2ZDYA 4JQLA 2DW4A 3R4NA 1UYKA 1QVFU 4P8OA 3LDDA 1GKZA 1KP2A 1GMGA 1Z59A 1R3JC 2Y69B 1GTOA 1Q82W 3G4SV 3TZ5A 4I3HA 5L3GA 2K5BA 4MTGA 1QR9A 3D3IA 2QF6A 2BOBC 2X0LA 3B25A 3SJQC 3OE7G 5EC2C 3ASOC 3GIEA 1OHHG 4GX1A 2BU5A 1DF5A 3H80A 4E02A 4FPPA 3GB7C 5L3BA 1YESA 3ZRVA 3SPGA 4MVMA 2LP7A 1OCOB 1H2GA 1GM7A 1BHAA 5CTWA 3LSQA 4U93A 1Y8NA 3T2MA 4MP2A 2ZR2A 2X6AA 2CGFA 4MP7A 2OTLV 3CMEV 1AJ6A 3SYPA 4XDKA 3JD0A 2Y69C 4KUMA 1NHJA 2VW5A 3QTFA 2DWDC 2ZD9A 4XKAA 1OCRC 4HY1A 1NJIW 2JJ1G 3ML0A 1THNA 2XASA 3OWBA 3OM3B 3OGCC 4GX0A 2IU3A 3D0BA 2WI3A 3B26A 5L3DA 1M57B 5GGZA 1R73A 3VBBA 1YITV 1W0JG 2QKSA 2H8MA 3G7EA 3B24A 1FXKA 3OPDA 1OCOC 3A0RA 1GJVA 2WWWA 4BW5A 1UYDA 5L3EA 2WEPA 3FB8C 3ZJZA 1UY8A 4HZ0A 4NH8A 1AJNA 4I9WA 4H33A 1YT2A 2WLJA 1V55B 1L1FA 5KUKA 1PL0A 3HYYA 4JPRA 1US7A 5CMUA 4AWOA 1I58A 4AS9A 1PNLA 1AR1B 2HG5C 3EKOA 2HVJC 4V26A 1M57C 2UXXA 2QG0A 3P30A 5H6RA 3AG1B 1V54B 4LPBA 4PA3A 3OEHG 2R9IA 3LNUA 5CF0A 2Q8GA 4QPKA 5KA5A 2EXLA 3RLRA 3ETEA 2ATKC 2XDXA 4RQFA 4X9LA 1AM1A 1Q86W 3AG4C 3ZMVA 1JJ2U 3H01A 1S3JA 3JYCA 3EHBB 4LWFA 1QLEB 5H9CA 1MABG 4FIPC 3A0WA 3I55V 1GKXA 1YSZA 1V55C 2EZPA 1UY6A 3A0ZA 4TSFG 3T1KA 2VCJA 1TUEB 2YEIA 4PA9A 4ASAA 2XAGA 3K06A 1FXVA 1YTFD 3CXCU 3EKRA 5LGUA 3T1CA 5LBQA 4EGHA 3NXSA 3TK1A 3G75A 4MVSA 2XDLA 3ZCCA 1S76D 3AG1C 1V54C 1YC1A 1G8MA 4G2KA 4HZ3A 3EHFA 3ZMSA 1U2OA 3RKZA 4ASFA 3QO8A 1Y8OA 2IOPA 4L8ZA 4FJCC 4JGSA 2KB1A 4PRXA 3ETGA 4PDLA 4RUFA 4X89A 1AI5A 1SETA 4H81A 1NVPB 2Q68A 4WFFA 3TETA 3FYIB 4KP4A 2YECA 3CRKA 1BKNA 4GFNA 3ZXQA 3PJSK 3CCEV 3E35A 1E79G 3QO5A 3OW6A 3IFXA 4KQVA 2YE7A 1MSWD 4B7PA 2CG9A 3T0ZA 1NHHA 2Q2EB 3FB6C 2NLJC 4MPEA 3E2EA 4HYMA 1ZWIC 4PA6A 2X6CA 4GQTA 1RPOA 4DXWA 4FCRA 1FS0G 2JEUA 2C2AA 5BZBA 5LGTA 3DGEA 4CE2A 2XJGA 2IORA 3B8NA 2EIJB 5M4PA 3AG2C 2WLKA 1HWYA 1BXDA 3X2QC 4MTXA 4HY6A 1UYLA 1AJQA 2FTKA 4DZYA 4MTOA 1RM1B 4H85A 1S16A 5IYCO 2MK3A 2Q6AA 3C11A 1NBMG 4E2LA 1PKXA 4XITA 2V1DA 3SPCA 5D6PA 3ZRWB 3F5WC 1JM6A 5CTUA 3ZN0A 4YKYA 2ZDIC 3QDDA 3E8BA 4GT8A 3OEEG 1ZW9A 1OCZB 3LDCA 3K3WA 1LNQA 2WLMA 5BODA 1R62A 1Y4SA 1B6QA 5B1BB 1NH2B 5B1AB 4LCUC 4ASUG 4QPJA 3OMNB 1SRYA 4HXWA 4RO2A 2EIJC 1PD3A 1CPYA 1ZXNA 2YKIA 1JX9A 2QE7G 3SYAA 2ZR3A 3JD4A 3U2KA 2IU0A 2HLDG 4EGIA 4WFAV 1KQSU 2YE8A 4E00A 2Q8HA 2XHRA 4XCLA 2EBOA 4P9OA 2P6JA 2QM7A 4P30A 3OUSA 3WFVA 4LWHA 5EC1C 5CBFA 4W7TA 3ASOB 5CA3A 5F5RA 1K7DA 2WI2A 1OCZC 3DTUB 5B1OA 2AHZA 4PA7A 4BAEA 1UYFA 1S77D 5M4HA 1W2BU 4JAUA 4ZVIA 5FWKA 5B1BC 4N21A 5DM6V 3W7SA 1Q7YW 1JVMA 4MS2A 4HZ5A 4PL9A 3P32A 4Z1MG 2Y48A 4O04A 2XHXA 1TC0A 1TIDA 2YJXA 5IYDO 1WLEA 1S72V 4CWQA 3WG7B 4I5SA 3T0HA 3T4DA 2GSMB 4J9YB 2HG1A 5EK0A 1EI1A 3EFFK 5CTXA 3T2SA 1OCRB 3HHUA 3GWOA 3OMIB 3SPIA 2XABA 1K4CC 2Q8FA 4R50A 2YE2A 1AJPA 2O1WA 1FFTB 1VQ4V 3EHHA 3B77A 5M4EA 3IGAC 4LWGA 4GT1A 1KIJA 4N23A 4UROA 2BRCA 4BQGA 2YEEA 2IOQA 4G27B 5IN9A 3CC4V 4LBEC 3AG3B 3OAAG 3ZN1A 2PI4A 3RLQA 4JF3A 3SYOA 4TT3G 2V7QG 3ABTA 1K33A 3WG7C 1KC8W 2XX5A 3OW2U 1AMWA 2FWYA 3SPHA 5FNDA 4HXZA 4V25A 2QEXV 1QZRA 1UJWB 4WF9V 4LC1A 2ESAA 4QIWF 3VHDA 3ZMTA 1H8EG 1SZTA 2HR3A 4HAMA 2YKCA 3OMUA 4B6CA 1YC3A 1H7SA 2YEAA 1VQ5V 1BHBA 5C93A 2Z5UA 1H38A 4JYCA 2XX4A 4URLA 1EBOA 3AEIA 3K04A 4JTCB 3RW0A 3AG3C 1IXMA 3LDEA 4L87A 4JAVA 4WUBA 3E8GA 3AG4B 3CCVV 2WEQA 4UVAA 1E1QG 5EBWC 3IC7A 2IH3C 2DYSB 4GX5A 1K73W 4KSGA 5IY5B 2WI7A 1MU5A 3W7XA 4WUDA 1L0OA 2BZ5A 2ITCC 3JZ3A 3HZ5A 3K0DA 2WLIB 2YEDA 4YKWA 1UYHA 4URNA 4LP8A 2YI7A 3ZMZA 4R6ZA 2YE6A 4H7QA 2YKEA 3Q5JA 2DQ0A 4MVOA 4L90A 3FKSG 1ZWHA 2XAJA 2DQ3A 1KECA 3CMAV 1OSFA 1VQOV 4JASA 3O6OA 2WI1A 2YK9A 2YGEA 5CPHA 3TUHA 3OR6C 2DWEC 1YHQV 5B1NA 2O1UA 4TWKA 4R8CA 2DYSC 2BU8A 5M4KA 5IY5C 4RQEA 3IEDA 4EM7A 2JJCA 1YJWV 3JD1A 3ABKB 1K34A 3A0XA 4UVCA 3ABUA 1AI4A 4QE9A 1K8AW 1JCHA 1QVGU 3ETDA 4LWIA 1YT1A 4XE2A 3R65A 2XCMA 4GGLA 2CCSA 5LHIA 3K97A 1AH8A 1GK9A 4XCJA 3CYOA 4CWOA 4RUEA 3CWVA 3SL2A 2CCUA 3G7BA 2P90A 2VCIA 1NVPD 3ZXOA 2B5UA 3AG2B 5DN6G 3BM9A 4R3AA 4X88A 2HKJA 4XIPA 3X2QB 2BYHA 1QY8A 3BEHA 1WPXA 5FNCA 1MX0A 1YSRA 1ORQC 2QA4V 2YEJA 2YEHA 3ZMUA 2VWCA 4XIQA 3ABKC 1B63A 3HZ1A 1Z5AA 4EGKA 1GKFA 1M9NA 5FNFA 3HYZA 5HFLA 3O2FA 4XBFA 2OTJV 1I5CA 1PNMA 3CGYA 1EFRG 5L3CA 4CZZA 4QJFB 3WQ9A 2YEVB 3VHCA 2BU7A 1VQLV 5IDJA 4UV8A 3FV5A 3T4ZA 4MBCA 5M4NA 4KFMA 3CCMV 3W7WA 2AHYA 2EJRA 3E89A 1BL8A 3ABLC 4QE7A 4XDJA 4ZBMA 3UKMA 3TTZA 2HCHA 1F4NA 1Y4UA 4MVUA 1KKDA 2LFSA 2YE4A 3U2DA 5KUMA 4XC0A 3HPLC 1UYGA 3VADA 2HVKC 4MVZA 1R3IC 5M4MA 2PNRA 1F4MA 5E1AC 5D7CA 4LP0A 4P9PA 2OT5A 1K9MW 4P2ZA 3CCSV 2PI5A 2XD6A 3RBZA 3R4MA 4DO2A 4EFUA 2DYRB 2BU2A 3K03A 5CTYA 1QLNA 4H37A 1MG1A 1NH2D 1DF4A 4CWSA 4UUJC 2A9HA 3HEKA 4YKXA 1YETA 2QG2A 2WI4A 1I5BA 4AWQA 1FXKB 2D3OW 3HB3B 1G4YB 2W6JG 2W0FC 3SYQA 2CH4A 1VQ8V 4EEHA 2O1VA 2IWUA 3CCQV 3QNEA 1JQ0A 3E8FA 3GIGB 2ZKJA 3VHAA 1K5QA 2EIMB 4GX2A 5D7DA 4G28B 1M90W 1R3KC 3O0IA 4HYOA 1ROPA 1R3LC 2W6IG 1YIJV 2WI5A 3CPWU 2IJKA 3R92A 2DYRC 1F23A 4KSHA 3JCZA 2QFOA 1U0ZA 1SESA 3ZM7A 2XDUA 4CWRA 4XDLA 1GM9A 3K98A 5H6QA 5J6AA 1AH6A 4YKTA 1QBZA 2P67A 1THZA 4MTFA 2H55A 1FXKC 1VQKV 2E0AA 2Z3YA 4YKZA 2GHYA 2GFDA 1KD1W 3LSSA 3ABMB 3OR7C 1PVGA 4XKKA 2JDIG 4PDVA 4MVRA 3FYEB 1YJNV 3U67A 2ZBKB 1TBWA 1KZNA 1KP3A 3CGZA 2YEBA 4ASGA 1EZJA 2EIMC 3OFNG 2QTOA 5D6QA 4OXSA 2UXNA 1I5AA 4O05A 3K9AA 5D7RA 4LWEA 2YGAA 4CBCA 2XJJA 3R4PA 2XX2A 1XL4A 2YKJA 4R1FA 2ZXWC 3FB7C 4R7CA 4XTJA 1Y66A 4GEEA 5J71A 4FMTA 2NNUA 5B3SB 1COWG 1H8HG 3TZ0A 3CCUV 3R4OA 4JTDB 1B62A 2F43G 2EILC 3C0EA 4BAYA 3ZRSA 2X7RB 1CEZA 1VQMV 3EHJA 1K3EA 2ZDIA 5HFMA 3LPSA 2YEVA 3K08A 1CP9A 4HYPA 1K92A 3CCLV 3R91A 3ABMC 4GCZA 2YEGA 3G6EV 5BOCA 3B27A 2BOCC 4P7AA 4L93A 2FWZA 1M56C 1ENVA 1NKDA 3STLC 2YGFA 2BREA 3F7YC 5LHHA 3JD2A 4WFHA 1UY9A 2WLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHG A;  5M4K A;  2YI6 A;  4U7N A;  3DGE A;  3TZ4 A;  3FT5 A;  5L3J A;  4CE2 A;  4YKR A;  1UYE A;  3IED A;  2BYI A;  4EM7 A;  3INW A;  2XJG A;  2JJC A;  2IOR A;  3ZKD A;  1ID0 A;  4JYB A;  5M4P A;  2YJW A;  2WI6 A;  3T10 A;  1TIL A;  2YKB A;  3A0X A;  4MPC A;  1BXD A;  2XDS A;  4MTX A;  1ZXM A;  4HY6 A;  1UYL A;  4R3M A;  3ZRW A;  2WER A;  4O09 A;  2FTK A;  4LWI A;  1YT1 A;  4DZY A;  4DUH A;  2FXS A;  2YI0 A;  4XE2 A;  4H85 A;  1TH8 A;  2XCM A;  4MOT A;  4GGL A;  1YS3 A;  2CCS A;  2XJX A;  5F3K A;  3K97 A;  2BTZ A;  1S16 A;  1YER A;  1AH8 A;  4XCJ A;  4CWO A;  3C11 A;  4URM A;  2ZDY A;  4JQL A;  4XIT A;  3R4N A;  1UYK A;  1UYM A;  3FT8 A;  5D6P A;  4P8O A;  2IWX A;  3ZRW B;  1GKZ A;  3CWV A;  1JM6 A;  1TC6 A;  3SL2 A;  5CTU A;  4O0B A;  2CCU A;  1Z59 A;  3G7B A;  4YKY A;  2VCI A;  3QDD A;  4GT8 A;  3TZ5 A;  3K99 A;  1ZW9 A;  4XD8 A;  4I3H A;  2K5B A;  4ASB A;  1JOY A;  2XDK A;  4CE1 A;  2QF6 A;  1YT0 A;  2GQP A;  3ZXO A;  3NMQ A;  3B25 A;  5BOD A;  1R62 A;  3BM9 A;  4R3A A;  1Y4S A;  3GIG A;  2HKJ A;  3GIE A;  4XIP A;  2BYH A;  1QY8 A;  5IDM A;  1UYC A;  4QPJ A;  5FNC A;  1MX0 A;  1EA6 A;  1QYE A;  1YSR A;  1NHI A;  2BU5 A;  2YI5 A;  2YEJ A;  4PU9 A;  2YEH A;  3H80 A;  4HXW A;  2VWC A;  4E02 A;  4XIQ A;  1ZXN A;  4FPP A;  2YKI A;  1B63 A;  3HZ1 A;  1Z5A A;  2LFR A;  1YES A;  3U2K A;  4CWF A;  4YKU A;  4EGK A;  3ZRV A;  5FNF A;  3HYZ A;  4EGI A;  1UY7 A;  3O2F A;  4U7O A;  1I5C A;  3CGY A;  2YE8 A;  4E00 A;  2Q8H A;  2XHR A;  2AKP A;  4XCL A;  1BGQ A;  2QM7 A;  2XHT A;  4XIR A;  3WQ9 A;  3VHC A;  2BU7 A;  4LWH A;  5IDJ A;  5CTW A;  1A4H A;  3FV5 A;  3K60 A;  3BMY A;  4U93 A;  1Y8N A;  3MD0 A;  2XK2 A;  4MP2 A;  4MBC A;  4W7T A;  5M4N A;  2CGF A;  4MP7 A;  1AJ6 A;  3ZKB A;  1NHJ A;  5F5R A;  2WI2 A;  3B28 A;  3PEH A;  2VW5 A;  3QTF A;  3A0Y A;  5B1O A;  4XDM A;  4XKA A;  4BAE A;  1UYF A;  3TTZ A;  4MB9 A;  4HY1 A;  5M4H A;  2HCH A;  1Y4U A;  4BQJ A;  4JAU A;  4ZVI A;  2LFS A;  2YE4 A;  3TZ2 A;  3U2D A;  4NH9 A;  1YC4 A;  5FWK A;  1THN A;  4XC0 A;  1Z5C A;  3OWB A;  3D0B A;  1UYG A;  2WI3 A;  3VAD A;  3B26 A;  4HZ5 A;  5GGZ A;  4BIU A;  4PL9 A;  3P32 A;  2FYP A;  5M4M A;  4CE3 A;  2PNR A;  4O04 A;  2XHX A;  5D7C A;  4LP0 A;  1TC0 A;  1TID A;  2YJX A;  2H8M A;  3G7E A;  4KTN A;  3B24 A;  4CWQ A;  2XD6 A;  3R4M A;  2YE5 A;  4EFU A;  4I5S A;  2BU2 A;  2BU6 A;  3T0H A;  5CTY A;  3OPD A;  4K4O A;  3A0R A;  4BIZ A;  1GJV A;  2HG1 A;  2WWW A;  1EI1 A;  4ZKI A;  5CTX A;  1UYD A;  3T2S A;  3D2R A;  3HHU A;  2XAB A;  4CWS A;  2WEP A;  2Q8F A;  3HEK A;  4YKX A;  1YET A;  2IWS A;  1UY8 A;  2QG2 A;  2WI4 A;  4HZ0 A;  1I5B A;  3RLP A;  2YE2 A;  4NH8 A;  4AWQ A;  2CH4 A;  4EEH A;  2O1W A;  2O1V A;  1YT2 A;  2IWU A;  4EMV A;  3EHH A;  3HYY A;  5M4E A;  4LWG A;  4EFT A;  4GT1 A;  1KIJ A;  4URO A;  3GIG B;  1US7 A;  2BRC A;  4AWO A;  1I58 A;  4AS9 A;  2ZKJ A;  4BQG A;  3H4L A;  3VHA A;  2YEE A;  2IOQ A;  3EKO A;  5IN9 A;  4V26 A;  5D7D A;  2QG0 A;  4MT8 A;  1I5D A;  1H7U A;  4BXI A;  3O0I A;  4LPB A;  4WUC A;  4CWP A;  3RLQ A;  1I59 A;  4L91 A;  3LNU A;  5CF0 A;  2Q8G A;  4QPK A;  4Q20 A;  2WI5 A;  2EXL A;  1UYI A;  2BT0 A;  3RLR A;  3R92 A;  1Y8P A;  3ZRX A;  2XDX A;  4KSH A;  2XX5 A;  2QFO A;  4X9L A;  1U0Z A;  1AMW A;  1AM1 A;  2FWY A;  3ZM7 A;  1BYQ A;  5FND A;  4HXZ A;  4V25 A;  1QZR A;  4MPN A;  4LC1 A;  2XDU A;  2ESA A;  3PEJ A;  3VHD A;  4CWR A;  3K98 A;  5J6A A;  1AH6 A;  2YE3 A;  4LWF A;  4YKT A;  2P67 A;  2YKC A;  3OMU A;  4B6C A;  2H55 A;  1YC3 A;  1H7S A;  3A0W A;  2E0A A;  2YEA A;  2QM8 A;  1GKX A;  4YKZ A;  1B3Q A;  1YSZ A;  2ZDX A;  4FCQ A;  5C93 A;  2GFD A;  4JYC A;  1UY6 A;  4CWT A;  3A0Z A;  3D36 A;  3T1K A;  2VCJ A;  2XX4 A;  1PVG A;  4XKK A;  4YKQ A;  3CRL A;  2YEI A;  4URL A;  3U67 A;  2ZBK B;  4ASA A;  1TBW A;  1KZN A;  3CGZ A;  2YEB A;  2YEF A;  4ASG A;  2YK2 A;  3EKR A;  3KE6 A;  2Q8I A;  4EGH A;  1IXM A;  3NXS A;  3TK1 A;  5D6Q A;  2XDL A;  4JAV A;  3G75 A;  4WUB A;  3ZCC A;  4KFG A;  2WEQ A;  1YC1 A;  1I5A A;  3EHF A;  4NH7 A;  4O05 A;  5D7R A;  2UWD A;  4LWE A;  1U2O A;  2YGA A;  2XJJ A;  3RKZ A;  1F51 A;  3R4P A;  3INX A;  4KSG A;  4ASF A;  2WI7 A;  2XX2 A;  2YKJ A;  1MU5 A;  4R1F A;  1Y8O A;  2IOP A;  4L8Z A;  4WUD A;  4XTJ A;  1L0O A;  2BZ5 A;  3JZ3 A;  3HZ5 A;  2CCT A;  4PRX A;  4GEE A;  5J71 A;  3OWD A;  4FMT A;  3Q5K A;  2YED A;  4YKW A;  1UYH A;  3R4O A;  3TZ0 A;  3WHA A;  4URN A;  1B62 A;  2YI7 A;  4O07 A;  3C0E A;  4H81 A;  2YE6 A;  4H7Q A;  2YKE A;  3Q5J A;  4PRV A;  3EHJ A;  3MNR P;  4KP4 A;  2YEC A;  4FCP A;  3CRK A;  3LPS A;  4L90 A;  1Z5B A;  1BKN A;  4E01 A;  1ZWH A;  4HYP A;  4GFN A;  3GIF A;  3ZXQ A;  3Q5L A;  1OSF A;  2BSM A;  4JAS A;  3R91 A;  2YEG A;  4GCZ A;  3OW6 A;  3O6O A;  2JKI A;  2WI1 A;  4KQV A;  2YE7 A;  4B7P A;  2CG9 A;  2YK9 A;  2YGE A;  5CPH A;  2YE9 A;  3T0Z A;  1NHH A;  5BOC A;  2Q2E B;  3B27 A;  4P7A A;  4L93 A;  3TUH A;  3A0T A;  4L94 A;  2FWZ A;  4MPE A;  4CWN A;  2YGF A;  2BRE A;  4AWP A;  5B1N A;  4HYM A;  2O1U A;  4GQT A;  1S14 A;  4XKO A;  4FCR A;  2BU8 A;  1UY9 A;  2C2A A; 
#chains in the Genus database with same CATH topology
 4I50 B;  4J7Z A;  3TZ4 A;  3FT5 A;  2CTP A;  4D7S A;  5L3J A;  3DC5 A;  4B3R O;  1UYE A;  1PNK A;  4O4J B;  2YS8 A;  3INW A;  2E76 B;  3HKC B;  4NXM B;  3APQ A;  3ZHR A;  3ZKD A;  4JYB A;  2VQE B;  4TOI A;  2O57 A;  1ARO P;  5B3S C;  2YJW A;  2WI6 A;  4ZHQ A;  5AG2 A;  1VQ9 V;  4MPC A;  3IAY A;  1K4D C;  1ZXM A;  2N05 A;  1XNR B;  1WA8 B;  4R3M A;  1QR8 A;  5KAI Z;  3ZRW A;  2WER A;  4O09 A;  2FB5 A;  3CCJ V;  4DUH A;  2FXS A;  2YI0 A;  3UO2 A;  1I5X A;  1ZTE A;  2IJI A;  5EIB D;  4X65 B;  4WCE V;  4UVB A;  1TH8 A;  1YS3 A;  2A06 H;  2Q69 A;  4WBN A;  1M1K W;  4IGG A;  2M7W A;  2WPD G;  4PDR A;  5LYJ A;  5BR8 O;  3CC7 V;  2YI8 A;  1UYM A;  1P4R A;  1VF5 B;  1VQN V;  3FT8 A;  5DEC A;  2IWX A;  3OMA B;  1TVK A;  4JI0 O;  5LMN O;  5GTI Z;  1TC6 A;  4O0B A;  2X6B A;  3K79 A;  2XAQ A;  3JAR A;  1FXH A;  4B3T O;  4UXN A;  3K5M A;  2GBO A;  3ICX A;  3K99 A;  4XD8 A;  1M4U A;  3RYF A;  1DLB A;  2XAH A;  4ASB A;  3UM7 A;  1JOY A;  1GAX A;  2XDK A;  4CE1 A;  4FFB A;  1YT0 A;  2GQP A;  1TUB B;  3NMQ A;  1YSC A;  1OCC B;  2XOK G;  2WLL B;  4TUY A;  5FL7 G;  3GIG A;  1DGS A;  3CSX A;  1XHX A;  2OCC B;  1VQ7 V;  1S5H C;  5IDM A;  1UYC A;  1Y4M A;  1VQ6 V;  1AIL A;  4LFA O;  2R9R B;  1P7B A;  4O4L A;  5CA1 A;  1EA6 A;  3ZHQ A;  1QYE A;  5IWA B;  1NHI A;  2YI5 A;  3ZX6 A;  4PU9 A;  4DUY O;  2H94 A;  5IJ9 A;  2Q67 A;  2LFR A;  4O4I B;  5L3F A;  4CWF A;  3RVY A;  1HNW B;  2IJJ A;  4YKU A;  2EIK B;  1J95 A;  1NQT A;  3LUT B;  2LGQ A;  1NTK H;  4RAI A;  1UY7 A;  3RYI B;  5FNV B;  4U7O A;  1SQX H;  5B66 Z;  3ZHS A;  2AKP A;  3RT3 C;  1BGQ A;  2XHT A;  4XIR A;  1AP6 A;  4BR6 A;  4CH4 A;  2YDE A;  1A4H A;  3K60 A;  3BMY A;  1K5S A;  3MD0 A;  2WAM A;  2XK2 A;  1H2K A;  2OCH A;  3STZ C;  2E5L B;  2K1E A;  3ZKB A;  3SYC A;  1GN4 A;  3MAQ A;  1Q6I A;  4J9Z B;  2P06 A;  1R6N A;  3B28 A;  3ZHV A;  3PEH A;  4YIO A;  3BVO A;  5CBG A;  3C3S A;  1US6 A;  4ZOL B;  3A0Y A;  4F4L A;  4J7K A;  4XDM A;  2HFE C;  1VQP V;  2EIN B;  4MB9 A;  1WP7 A;  1OCC C;  4UCU A;  4L8J A;  4BQJ A;  2CGN A;  3TZ2 A;  4NH9 A;  1YC4 A;  3G71 V;  1Z5C A;  2OCC C;  3FB5 C;  2QWO B;  3PN1 A;  3QG5 A;  1BZK A;  2WA3 A;  2QSA A;  3BA8 A;  2YC0 A;  4FLT A;  4IHJ B;  4BIU A;  4NKG B;  3TXQ A;  2FYP A;  4CE3 A;  1IXB A;  3K0G A;  2VQF B;  1AI6 A;  1EN6 A;  4WFG A;  1BQZ A;  2EIK C;  4KTN A;  3MHS C;  4I55 A;  3WB0 A;  1R6K A;  2YE5 A;  5JJJ B;  3S5T A;  1WAZ A;  4LWS B;  5D5P A;  4YHH B;  2BU6 A;  2A7W A;  3ABL B;  1L0L H;  5CB4 B;  4K4O A;  4BIZ A;  3C3T A;  4ZKI A;  5KA6 A;  4DR2 O;  4OPA A;  4DW1 A;  3CCR V;  1YTF B;  3D2R A;  3CP1 A;  3KG2 A;  2B1G A;  2HKO A;  4MW3 A;  2LW7 A;  2XAF A;  2IWS A;  2XT9 A;  4JYY A;  4UV9 A;  2L6L A;  3RLP A;  2VWJ A;  4UCV A;  3ZIA G;  3M99 B;  4MVQ A;  4EKW A;  5IT9 N;  1PPJ H;  2Y4U A;  2XHB A;  3N27 A;  1PV0 A;  1N8R W;  2QWP B;  4EMV A;  2EIN C;  1OZ0 A;  4KL1 A;  2PUS A;  5KAF Z;  4EFT A;  2FL4 A;  1PL4 A;  3AK1 A;  5BXZ A;  1RPR A;  1MOF A;  3H4L A;  1QLE C;  2H8P C;  5EBL C;  3CRC A;  4LF9 B;  1JPX A;  3QTC A;  3F7V C;  1YI2 V;  2DMX A;  4WFE A;  1TGO A;  3QO7 A;  4MT8 A;  1I5D A;  1H7U A;  4BXI A;  4DRX B;  4WUC A;  4CWP A;  1I59 A;  4L91 A;  4X8A A;  3U10 A;  3TCU A;  1IBK O;  4Q20 A;  2EZO A;  1UYI A;  2BT0 A;  4GZR B;  1Y8P A;  3E83 A;  3ZRX A;  4QNH B;  5IYZ B;  2UXB B;  4O4J A;  2JJ2 G;  3HKC A;  4JZG A;  1Y67 A;  3CRQ A;  1BYQ A;  4YY3 B;  1SQF A;  4MPN A;  1I5Y A;  2P7T C;  2WSS G;  1FAF A;  3PEJ A;  2ZM6 O;  1FJG B;  3M8A A;  5LL6 Y;  1WA8 A;  2YE3 A;  2WLN A;  2JEX A;  2IH1 C;  1YJ9 V;  4EB6 B;  4JI3 B;  4AI8 A;  1BS3 A;  3E86 A;  2QM8 A;  1B3Q A;  2HJF C;  2ZDX A;  4FCQ A;  4EEQ A;  5F2V O;  1M5I A;  1U96 A;  4CWT A;  3D36 A;  4JTA B;  4LF4 B;  4B7K A;  4YKQ A;  3CRL A;  3SPJ A;  5EYP A;  5GON B;  4JI5 B;  3CC2 V;  1URF A;  1SF9 A;  2B1I A;  1H2S B;  1RFY A;  2ZCE A;  2YEF A;  2A79 B;  2YK2 A;  5LGN A;  1NT2 B;  1SQV H;  3KE6 A;  3I56 V;  4WFB V;  2Q8I A;  1YEW A;  5KLV H;  4GKK B;  2JK5 C;  3O65 A;  4LH7 A;  5LHG A;  2JIZ G;  2WLI A;  3L75 H;  5JQG A;  4KFG A;  3BAA A;  1K97 A;  3K9S A;  2WLL A;  2A3Q A;  1NTM H;  3T1Y B;  4NH7 A;  2UWD A;  4UCR A;  2PZS A;  5JCO A;  2IM9 A;  4LF5 B;  4O2B B;  4JYA B;  3KCY A;  1F51 A;  4YXW G;  3INX A;  1GM8 A;  1S0V A;  1GO3 F;  4PHZ A;  3ZED A;  1NU1 H;  3ASN B;  2CCT A;  2XND G;  1MA1 A;  1MZF A;  2RN9 A;  3OWD A;  4NXM O;  3UT5 B;  4PEL A;  3Q5K A;  4O4I A;  3A8T A;  4X1K B;  3WHA A;  5IYB O;  1W0K G;  3GVM A;  4MW8 A;  4NB5 A;  3H1K H;  4O07 A;  4FK5 C;  3RYI A;  3W7T A;  1XNR O;  4W4K A;  5EBM C;  4PRV A;  4TV9 A;  2C1G A;  3BHP A;  3MNR P;  1DTO A;  3OUF A;  5J9P C;  4FCP A;  1Q43 A;  2CK3 G;  2RCV A;  4X65 O;  1Z5B A;  2NN4 A;  4E01 A;  1XMO B;  3LNM B;  3FD9 A;  5CN0 A;  1J5E O;  1AI7 A;  3GIF A;  4DUZ B;  5CA0 B;  3Q5L A;  2BSM A;  1SER A;  1QCE A;  2JKI A;  3BY6 A;  1XDC A;  4J41 A;  4ZI7 B;  2YSU B;  2YE9 A;  1NR1 A;  3ETQ A;  4MSW C;  3E8H A;  5JWP A;  1RM1 C;  2ZXW B;  3MHH C;  3A0T A;  1E1R G;  4L94 A;  4PA4 A;  2IJH A;  4CWN A;  4FLZ A;  4ZOL A;  3RVZ A;  2LQT A;  4DW0 A;  4AWP A;  4ICG A;  2YXH A;  4PDM A;  1I94 B;  1S14 A;  2A0L A;  2ZQM A;  4XKO A;  4DV6 B;  3FAV B;  5GW7 A;  5IE9 A;  2EIL B;  1NR7 A;  3EHG A;  1EN4 A;  2YI6 A;  3D3Q A;  4U7N A;  4Z1V A;  2UU9 B;  1BMF G;  5CBH A;  3VOU A;  3B8M A;  4YKR A;  2BYI A;  2KKW A;  4IHJ A;  1XL6 A;  3ASN C;  1MNG A;  1ID0 A;  1YCI A;  3T10 A;  1TIL A;  2YKB A;  4DR3 B;  2XDS A;  1Q81 W;  1HNW O;  3WB1 A;  2RQ6 A;  3CD6 V;  5B1A C;  1IX9 A;  4LWS A;  1UFI A;  5JH7 A;  2ZIM A;  1B04 A;  2ITD C;  5J2U A;  5CB4 A;  2Q8V A;  3JD3 A;  4MOT A;  2XJX A;  2IW5 A;  3BFR A;  5F3K A;  1M56 B;  2BTZ A;  2DE0 X;  3W7U A;  1YER A;  5EZY B;  4URM A;  1WB8 A;  2ZDY A;  4JQL A;  2DW4 A;  3SDL A;  3R4N A;  1QHT A;  1UYK A;  5LP6 B;  5FPO A;  1QVF U;  3LDD A;  4UCO A;  1D5N A;  4P8O A;  1GKZ A;  1KP2 A;  2P4K A;  1GMG A;  2PGG A;  1N34 B;  1Z59 A;  1R3J C;  4UB8 Z;  2Y69 B;  5JVD B;  1GTO A;  4PD4 F;  3G4S V;  3Q4H A;  1Q82 W;  3TZ5 A;  4I3H A;  5L3G A;  2K5B A;  1WB7 A;  4MTG A;  1QR9 A;  3DXR B;  3D3I A;  2QF6 A;  3H9V A;  4Z2W A;  2BOB C;  2JGD B;  2X0L A;  3B25 A;  3SJQ C;  3K5O A;  1BGY H;  1ZAU A;  3OE7 G;  5BY1 A;  5EC2 C;  1GN2 A;  1EN5 A;  2VS0 A;  3ASO C;  4B3M B;  3GIE A;  1AR5 A;  1OHH G;  3S3W A;  4GX1 A;  1IBL B;  2UXC O;  4X1Y B;  2BU5 A;  3J7A U;  1DF5 A;  2JRI A;  5LMU O;  3H80 A;  4E02 A;  1HNX B;  2YID A;  4U3J B;  4FPP A;  4DRX A;  3GB7 C;  4I0X B;  5L3B A;  1YES A;  4DR5 B;  3M7M X;  4J11 A;  3ZRV A;  1Z5V A;  1SQQ H;  2ARH A;  4OGQ B;  1Y76 B;  5IYZ A;  3K58 A;  1JFF B;  2HEP A;  2MW2 B;  4NVP A;  1GN6 A;  4UB6 Z;  3SPG A;  4MVM A;  2LP7 A;  4DV5 B;  1SS3 A;  1OCO B;  3K59 A;  1H2G A;  2P4V A;  2JS5 A;  3HKD B;  1GM7 A;  4JI4 B;  3L73 H;  1BHA A;  5CTW A;  2QKC A;  3LSQ A;  4U93 A;  1Y8N A;  1WNS A;  3T2M A;  4MP2 A;  2ZR2 A;  2X6A A;  3A2F A;  2CGF A;  4MP7 A;  2OTL V;  3CME V;  1AJ6 A;  3SYP A;  4XDK A;  3CE2 A;  4JV5 B;  3JD0 A;  4EB6 A;  2Y69 C;  4KUM A;  1GN3 A;  2PYL A;  2BSK B;  1NHJ A;  5BMV A;  4DR7 B;  2GUZ B;  3D8C A;  3VQX A;  2VW5 A;  3QTF A;  3L70 H;  4F6R B;  2DWD C;  2BE3 A;  2ZD9 A;  2BTO A;  4JI2 B;  4XKA A;  1OCR C;  4HY1 A;  1NJI W;  1PP9 H;  4GKJ B;  2JJ1 G;  1BE3 H;  3ML0 A;  2QR4 A;  2XTA A;  5GON A;  1THN A;  2XAS A;  5KMG A;  3OWB A;  3H1I H;  3OM3 B;  3OGC C;  4GX0 A;  2IU3 A;  3D0B A;  2WI3 A;  3OD4 A;  3B26 A;  5L3D A;  1M57 B;  2F93 B;  5GGZ A;  3B40 A;  4LF9 O;  3J80 N;  1R73 A;  3VBB A;  1YIT V;  2QWR B;  2YUA A;  2KG7 B;  1G1X B;  1W0J G;  2QKS A;  4HNA B;  2CDY A;  3TXS A;  1IZ3 A;  2H8M A;  2CH7 A;  3G7E A;  3B24 A;  2JS3 A;  1OV9 A;  1Z5W A;  5LXT B;  1FXK A;  1HP8 A;  3OPD A;  3BRC A;  1OCO C;  3A0R A;  1GJV A;  4LF7 O;  4DV2 O;  2WWW A;  3HKE B;  4LF6 O;  4BW5 A;  4A5U B;  3JAL B;  1UYD A;  4JI6 B;  4YY3 O;  2JGU A;  5L3E A;  2WEP A;  3FB8 C;  3ZJZ A;  1UY8 A;  2ZE7 A;  3VQY A;  4HZ0 A;  4DR6 O;  2G38 A;  4CH5 A;  4NH8 A;  2ZE8 A;  2H3O A;  1AJN A;  4I9W A;  4H33 A;  1YT2 A;  1O9G A;  4LR3 A;  3QF7 A;  2WLJ A;  4JZ2 A;  1V55 B;  1L1F A;  5KUK A;  1PL0 A;  5CA0 A;  3HYY A;  4AIL C;  2Y0I A;  2LGW A;  1Q8I A;  4Q6G A;  4QGP A;  3P3P A;  4JPR A;  4LF4 O;  4J10 A;  1HNZ B;  1XEQ A;  2UUC B;  1US7 A;  5CMU A;  1EM1 A;  4ZI7 A;  1N36 O;  1I58 A;  4AS9 A;  4AWO A;  2W0X A;  1B06 A;  1PNL A;  4LNU B;  1AR1 B;  1VMG A;  2GDS A;  2HG5 C;  3A0H Z;  1Y6X A;  4HBN A;  3VQV A;  4O2A B;  3EKO A;  2HVJ C;  4V26 A;  1M57 C;  4I4T B;  2FYU H;  2UXX A;  2QG0 A;  3P30 A;  4YJ3 B;  5H6R A;  2YXL A;  3AG1 B;  1V54 B;  4LPB A;  4PA3 A;  3OEH G;  2R9I A;  3N2K A;  1H2N A;  3T1Y O;  3LNU A;  5CF0 A;  2QWN B;  3RYH B;  1KMI Z;  2Q8G A;  4QPK A;  5KA5 A;  5KX5 B;  2EXL A;  4JYA O;  4LF5 O;  3RLR A;  3ETE A;  2CGO A;  2ATK C;  2XDX A;  4RQF A;  2ZE6 A;  2HHH B;  4KHP B;  4X9L A;  3BA9 A;  4DV3 B;  1AM1 A;  1Q86 W;  1WN7 A;  2YI9 A;  4IT5 A;  3AG4 C;  5FPR A;  3ZMV A;  4IYH A;  1JJ2 U;  3HR0 A;  3H01 A;  1S3J A;  5EIB C;  3JYC A;  3EHB B;  2AZ0 A;  1X59 A;  4LWF A;  1OJH A;  2RJZ A;  1QLE B;  5H9C A;  2F95 B;  1MAB G;  3GWK C;  4FIP C;  1HDJ A;  2UUA B;  2UXD B;  3A0W A;  3WU2 Z;  3JAK B;  3I55 V;  1GKX A;  1YSZ A;  3JSL A;  5EZY A;  1XMO O;  1V55 C;  2EZP A;  5LOV A;  1UY6 A;  2ZIO A;  3A0Z A;  4TSF G;  4DUZ O;  4CH3 A;  3T1K A;  2VCJ A;  5LP6 A;  1TUE B;  3G6B A;  1Q6H A;  2YEI A;  2VRZ A;  4PA9 A;  4ASA A;  2XAG A;  3K06 A;  1FXV A;  4D6T H;  3J81 N;  1YTF D;  2ZKO A;  3CXC U;  2F4V B;  3EKR A;  5LGU A;  3T1C A;  5LBQ A;  4EGH A;  3RYC A;  1XIL A;  3NXS A;  4JI8 O;  3TK1 A;  3DXR A;  4KXR A;  4MVS A;  2XDL A;  3G75 A;  3ZCC A;  1S76 D;  3AG1 C;  1V54 C;  2JGD A;  1YC1 A;  1G8M A;  4G2K A;  4HZ3 A;  4AQY B;  3EHF A;  4NTX A;  2YIB A;  3ZMS A;  1N33 B;  2WA4 A;  4DV6 O;  1U2O A;  3G67 A;  1YVW A;  4AHC A;  3RKZ A;  2ZT9 B;  4ASF A;  3B09 A;  3QO8 A;  3OT7 A;  2LO1 A;  4X1Y A;  5K1P A;  4YJ2 B;  1Y8O A;  2IOP A;  4L8Z A;  4FJC C;  4JGS A;  4X20 B;  4NXN B;  2KB1 A;  4PRX A;  3ETG A;  4U3J A;  4PDL A;  4RUF A;  1VF6 C;  4I0X A;  4X89 A;  1QNM A;  3UCS C;  1AI5 A;  3SJC C;  1XI1 A;  4DV1 B;  4DR1 O;  1SET A;  4H81 A;  3LMM A;  1Q5O A;  3RN4 A;  3TGU H;  1NVP B;  1NZ6 A;  2Q68 A;  1Z2G A;  4WFF A;  1JFF A;  3N2G B;  3TET A;  2KSD A;  3FYI B;  4KP4 A;  2K9P A;  2YEC A;  3CRK A;  1BKN A;  3HKD A;  4GFN A;  4PI2 A;  3ZXQ A;  3PJS K;  4H13 B;  1SA0 B;  3CCE V;  3E35 A;  1E79 G;  3QO5 A;  3OW6 A;  3IFX A;  4KQV A;  2YE7 A;  1MSW D;  4I50 A;  4B7P A;  2CG9 A;  3T0Z A;  3T1H B;  1NHH A;  2Q2E B;  1N0N A;  3FB6 C;  2QGN A;  1HR0 B;  2NLJ C;  4MPE A;  1H2M A;  3E2E A;  4F6R A;  3DSQ A;  4HYM A;  1ZWI C;  4PA6 A;  1XMQ O;  4K0K B;  1KBH A;  2X6C A;  3EVK A;  4GQT A;  1RPO A;  4DXW A;  4FCR A;  1FS0 G;  2JEU A;  1WJZ A;  3QVN A;  2F1M A;  2C2A A;  4JAA A;  1JR9 A;  5BZB A;  4B3M O;  3CXH F;  5LGT A;  3LNN A;  1H2L A;  3DGE A;  4B3T B;  1XUQ A;  1YXB A;  4DK0 A;  4FM0 A;  4CE2 A;  1IBL O;  2XJG A;  2IOR A;  3B8N A;  2EIJ B;  4JI7 B;  4X1I B;  5M4P A;  3AG2 C;  1HNX O;  2QTS A;  2WLK A;  4HNA A;  1P7G A;  3U11 A;  1HWY A;  5C8Y B;  1BXD A;  4X66 B;  1ZUQ A;  3X2Q C;  4MTX A;  4HY6 A;  4LFA B;  1UYL A;  2R70 A;  1AJQ A;  2UUB O;  4EFB A;  5LXT A;  2GTA A;  2FTK A;  1A32 A;  2RNB A;  4DZY A;  4GUN A;  4MTO A;  1RM1 B;  4H85 A;  4FLV A;  1R6T A;  3CJH B;  4UFZ A;  3HKB B;  3HKE A;  1S16 A;  3JAL A;  5IYC O;  1TUB A;  2MK3 A;  2Q6A A;  3C11 A;  4ZHQ B;  1NBM G;  4E2L A;  1PKX A;  2GV9 A;  4XIT A;  4LFC B;  4I7Z B;  2V1D A;  3SPC A;  4LF8 O;  5D6P A;  3ZRW B;  3F5W C;  3KCX A;  1JM6 A;  5CTU A;  3CX5 F;  3ZN0 A;  4YKY A;  2ZDI C;  3QDD A;  3E8B A;  4GT8 A;  3OEE G;  3BPZ A;  1ZW9 A;  1OCZ B;  3LDC A;  1RSO B;  3K3W A;  4PV1 B;  1LNQ A;  4WBN B;  2QM4 A;  2WLM A;  4JI2 O;  5BOD A;  2VQE O;  1R62 A;  5FLX N;  1Y4S A;  2AW9 A;  4GKJ O;  1B6Q A;  5B1B B;  1NH2 B;  1XRE A;  3EXA A;  3UQ8 A;  1TVK B;  5FNV A;  4LCU C;  5B1A B;  4ASU G;  4QPJ A;  4O2A A;  1U97 A;  3JAR B;  2NR5 A;  4UCT A;  3OMN B;  2BCC H;  1SQG A;  3P3N A;  4YJ3 A;  1SRY A;  4HXW A;  4RO2 A;  3JAS B;  2EIJ C;  3KKY A;  1PD3 A;  1CPY A;  1ZXN A;  2YKI A;  4FFB B;  1JX9 A;  1FD9 A;  2QE7 G;  3SYA A;  2ZR3 A;  2AXT Z;  4TUY B;  3JD4 A;  3U2K A;  2IU0 A;  1QQC A;  2HLD G;  3RYH A;  1FKA O;  1YF2 A;  4FVM A;  4EGI A;  4WFA V;  3JAT B;  4O4L B;  1KQS U;  2YE8 A;  4E00 A;  2EJ7 A;  2Q8H A;  2E75 B;  2XHR A;  4XCL A;  2EBO A;  4P9O A;  2P6J A;  2YXY A;  2QM7 A;  1KU9 A;  4P30 A;  3OUS A;  1O9H A;  1XHZ A;  3WFV A;  4LWH A;  5IJ9 B;  5EC1 C;  4JI6 O;  4FLY A;  5CBF A;  1N4C A;  3CWB H;  1KKC A;  3TJT A;  1G6U A;  4W7T A;  5DED A;  3ASO B;  4E4E A;  1P49 A;  1DK1 A;  2C1I A;  5CA3 A;  3CEI A;  5F5R A;  2HJD A;  1K7D A;  2WI2 A;  1BSM A;  3JAK A;  1OCZ C;  3DTU B;  5IWA O;  5B1O A;  2AHZ A;  1FFX B;  4PA7 A;  4BAE A;  3LSU A;  1UYF A;  1S77 D;  5M4H A;  2HHI A;  1W2B U;  4JAU A;  4ZVI A;  5FWK A;  5B1B C;  4B3S B;  2QJ1 A;  2UUC O;  4N21 A;  5DM6 V;  3W7S A;  1Q7Y W;  3OTF A;  2DOS A;  2F23 A;  3CB2 A;  1JVM A;  1Q3E A;  3AG7 A;  4MS2 A;  2E3C A;  1PM9 A;  2CTQ A;  4DYL A;  4HZ5 A;  4PL9 A;  3P32 A;  3SR2 C;  2QWQ B;  4Z1M G;  2Y48 A;  3CHX A;  4O04 A;  2XHX A;  1TC0 A;  4F6E A;  2CTW A;  1TID A;  2YJX A;  5IYD O;  1WLE A;  3H1H H;  1S72 V;  3ZHT A;  5J2T B;  4CWQ A;  1Y74 B;  1IUR A;  2E5L O;  3WG7 B;  1Q6U A;  4ZIB A;  3IJ4 A;  4I5S A;  4YJ2 A;  1GH6 A;  3T0H A;  3K57 A;  2ODM A;  4X20 A;  3T4D A;  2GSM B;  2YIB D;  4J9Y B;  2HG1 A;  4DV3 O;  5EK0 A;  1EI1 A;  3EFF K;  5CTX A;  1RP3 B;  3T2S A;  1OCR B;  1YZB A;  3HHU A;  3GWO A;  3OMI B;  3SPI A;  2XAB A;  1IBK B;  1K4C C;  4NR1 A;  1I0H A;  2Q8F A;  4R50 A;  3JAM N;  3N2G A;  2YE2 A;  3RFR A;  3CRM A;  3A0B Z;  1AJP A;  2UXD O;  5LA6 B;  2O1W A;  4I9Q A;  1FFT B;  4BIO A;  1VQ4 V;  3EHH A;  3B77 A;  1BT8 A;  1VAR A;  5M4E A;  3IGA C;  4LWG A;  4GT1 A;  2VQF O;  1KIJ A;  4N23 A;  3S3X A;  2M6Y A;  4URO A;  2BRC A;  4FLW A;  1BQ0 A;  4BQG A;  2Q73 A;  2YEE A;  1LUW A;  2IOQ A;  4G27 B;  1TA8 A;  5IN9 A;  2ADP A;  3CC4 V;  4LBE C;  5H2F Z;  3CRR A;  3AG3 B;  4YHH O;  3OAA G;  1JA8 A;  3ZN1 A;  3CS5 A;  2PI4 A;  2BTQ B;  3RLQ A;  4IIJ B;  4JF3 A;  2E74 B;  1ZL8 B;  3O9O A;  3SYO A;  2ADQ B;  4TT3 G;  2V7Q G;  3ABT A;  1N33 O;  5JEN A;  1K33 A;  3WG7 C;  3FFQ A;  2XUM A;  1KC8 W;  2XX5 A;  4CS2 A;  4CH6 A;  4CS3 A;  3OW2 U;  1AMW A;  1SZX A;  3SPH A;  4NXN O;  2FWY A;  1R1B A;  5FND A;  4HXZ A;  4V25 A;  2N74 A;  2QEX V;  1QZR A;  1UJW B;  4WF9 V;  4LC1 A;  4X64 B;  1XOU A;  2ETN A;  2ESA A;  4QIW F;  3VHD A;  1BCC H;  3ZMT A;  1H8E G;  3OTO B;  1SZT A;  4B08 A;  5B5E Z;  3H1J H;  3SJA C;  2AZ2 A;  2Z0A A;  1SQB H;  2HR3 A;  4HAM A;  2YKC A;  3OMU A;  4B6C A;  3DC6 A;  1WPB A;  1YC3 A;  3BAB A;  1H7S A;  1NTZ H;  2YEA A;  3CJH A;  1VQ5 V;  3HKB A;  1BHB A;  4IYI A;  5C93 A;  2Z5U A;  4DV0 B;  1H38 A;  4JYC A;  4O4H B;  3OGI B;  2XX4 A;  4OPH A;  4DV4 B;  4O2B A;  3G80 A;  4URL A;  4FLX A;  2Q7G A;  1EBO A;  3AEI A;  3T1H O;  3K04 A;  4JTC B;  3RW0 A;  1FYJ A;  2UXB O;  2ZE5 A;  3AG3 C;  1IXM A;  1RSO A;  3RGB A;  1J5E B;  2YIA A;  1HR0 O;  2B9Z A;  3LDE A;  4L87 A;  4JAV A;  1I7F A;  4WUB A;  3E8G A;  3AG4 B;  3UT5 A;  1VP7 A;  4UVA A;  3CCV V;  1SC5 B;  1XNQ B;  1E1Q G;  2WEQ A;  5EBW C;  3IC7 A;  4X1K A;  1LR1 A;  4K0K O;  2IH3 C;  1X4T A;  2DYS B;  2PTM A;  2FML A;  5EYP B;  4YIP A;  4GX5 A;  1FJG O;  1K73 W;  4KSG A;  1QU7 A;  2OIG A;  5IY5 B;  2WI7 A;  2Y4T A;  1MU5 A;  1L0N H;  3W7X A;  4WUD A;  1L0O A;  2BZ5 A;  2ITC C;  3JZ3 A;  3HZ5 A;  4JI3 O;  3JAS A;  2KQX A;  3K0D A;  2WLI B;  5JQG B;  3SJB C;  4PJ0 Z;  4JI7 O;  2YED A;  4YKW A;  1UYH A;  4URN A;  3RWR D;  4LP8 A;  2YI7 A;  3ZMZ A;  4R6Z A;  2YE6 A;  4X66 O;  3JAT A;  4H7Q A;  4DK1 A;  2YKE A;  1N32 B;  3Q5J A;  4OX9 B;  4JI5 O;  1LUV A;  2DQ0 A;  4X9Q A;  4MVO A;  4FM2 A;  4L90 A;  4DR4 B;  3THO A;  3FKS G;  1ZWH A;  1I08 A;  4GKK O;  2FKX A;  2XAJ A;  2DQ3 A;  1KEC A;  2QDO A;  3CMA V;  1OSF A;  1VQO V;  4JAS A;  5ITZ B;  3FAV A;  4LFC O;  3O6O A;  2WI1 A;  3U0Z A;  4LFB B;  2YK9 A;  2Q5Z A;  2YGE A;  5CPH A;  4E72 A;  4TV9 B;  3TUH A;  3OR6 C;  2DWE C;  2PYJ A;  1FFX A;  1YHQ V;  5B1N A;  2O1U A;  1KUQ A;  1IVS A;  3D36 C;  4TWK A;  4R8C A;  4NTY A;  3KZI Z;  2DYS C;  3AK3 A;  2BU8 A;  2CUG A;  5M4K A;  5IY5 C;  2Q7E A;  3B4S A;  4RQE A;  2HP8 A;  3IED A;  1P84 F;  3UO3 A;  4EM7 A;  2JJC A;  2OYQ A;  1MSD A;  3VQW A;  1YJW V;  3JD1 A;  3ABK B;  2Q7H A;  1K34 A;  4K35 A;  3A0X A;  5J2T A;  5JCO C;  4JI1 B;  2R9A A;  4UVC A;  4DV7 B;  1Y74 A;  1AI4 A;  3ABU A;  4QE9 A;  1K8A W;  1JCH A;  3FX7 A;  4GYC B;  1QVG U;  2UXC B;  3ETD A;  4LWI A;  5LMU B;  1YT1 A;  1UPG A;  4XE2 A;  5JVD A;  3R65 A;  2XCM A;  1GRJ A;  4GGL A;  2CCS A;  5LHI A;  3K97 A;  2LJ2 A;  3L71 H;  2EUL A;  1AH8 A;  1GK9 A;  4XCJ A;  3CYO A;  4CWO A;  4RUE A;  1I94 O;  4X62 B;  3CWV A;  4LH6 A;  1XQ8 A;  1IBM B;  3SL2 A;  1KYO F;  4FM1 A;  5JH7 B;  2CCU A;  3G7B A;  2P90 A;  2VCI A;  3MDS A;  5J2U B;  2UU9 O;  5LA6 A;  2OIE A;  2LW1 A;  1NVP D;  1NI8 A;  3ZXO A;  2B5U A;  2VWK A;  3AG2 B;  5DN6 G;  1T5E A;  3BM9 A;  4R3A A;  4X88 A;  2EX3 A;  2HKJ A;  4XIP A;  3X2Q B;  4DR3 O;  2BYH A;  1QY8 A;  3BEH A;  1WPX A;  3K5L A;  4B3S O;  4B3R B;  1Y76 A;  3JAW B;  2P22 C;  5FNC A;  1MX0 A;  4PI0 A;  1YSR A;  1ORQ C;  2QA4 V;  3Q4H B;  2YEJ A;  4U3F H;  2YEH A;  3ZMU A;  2VWC A;  1NS1 A;  4XIQ A;  3ABK C;  1AP5 A;  2JVD A;  2BTQ A;  1B63 A;  1V9P A;  3HZ1 A;  1Z5A A;  4IIJ A;  2L35 A;  2IBZ H;  1ZL8 A;  5KHH A;  4EGK A;  1GKF A;  5IJ0 B;  1M9N A;  2R72 A;  5FNF A;  3HYZ A;  5HFL A;  3O2F A;  4XBF A;  2OTJ V;  1I5C A;  1PNM A;  3CGY A;  1VIB A;  1EFR G;  1JMK C;  5L3C A;  2BSK A;  2ILM A;  4CZZ A;  2GUZ A;  4QJF B;  1N34 O;  4TV8 B;  3WQ9 A;  2YEV B;  3VHC A;  2BU7 A;  1VQL V;  5IDJ A;  4UV8 A;  2ZNJ A;  3FV5 A;  5BR8 B;  3T4Z A;  4MBC A;  5M4N A;  4KFM A;  3CCM V;  4W4L A;  3W7W A;  4JI0 B;  5LMN B;  1D5A A;  1S5L Z;  2AHY A;  2EJR A;  3E89 A;  1SQP H;  1BL8 A;  3ABL C;  4LF7 B;  3E22 B;  4DV2 B;  4QE7 A;  4CS4 A;  4XDJ A;  4LF6 B;  1JJO A;  4ZBM A;  3ZHU A;  4K8X A;  2KG7 A;  3UKM A;  3TTZ A;  3I5D A;  4O4H A;  2HCH A;  1F4N A;  4TQF A;  1Y4U A;  4MVU A;  1KKD A;  2LFS A;  2YE4 A;  3U2D A;  4RWU A;  4DR6 B;  5KUM A;  4DR5 O;  1Q90 D;  4XC0 A;  2Q4P A;  3L9D A;  1YDX A;  3HPL C;  1IDS A;  4DUY B;  1UYG A;  3VAD A;  3CYG A;  5BMV B;  2HVK C;  4NYK A;  4J42 A;  5JJE B;  4MVZ A;  4DV5 O;  1R3I C;  5M4M A;  2PNR A;  1F4M A;  5E1A C;  5D7C A;  4GLX A;  4LP0 A;  4JI4 O;  1N36 B;  4P9P A;  4CC5 A;  2OT5 A;  1ZSP A;  1K9M W;  4P2Z A;  3CCS V;  2PI5 A;  5KMG B;  2XD6 A;  2PY5 A;  3RBZ A;  3R4M A;  3NR7 A;  4DO2 A;  4EFU A;  5E79 Z;  2DYR B;  2BU2 A;  3K03 A;  3IC9 A;  5CTY A;  1QLN A;  4JV5 O;  4H37 A;  2ZIN A;  1MG1 A;  4DR7 O;  1MZE A;  1VEW A;  2Q9L A;  2DJV A;  2CAZ C;  1NH2 D;  2D2C B;  3JCU Z;  1EZV H;  1DF4 A;  1N0J A;  5KHI A;  4CWS A;  5LYJ B;  4UUJ C;  4X64 O;  2A9H A;  2CH7 B;  4FZ0 A;  5JJN B;  3HEK A;  4H44 B;  4YKX A;  1YET A;  2QG2 A;  3OTO O;  4LNU A;  5A2Q N;  2WI4 A;  4C7U A;  1I5B A;  1SKV A;  4AWQ A;  3R66 A;  1AVM A;  1FXK B;  2D3O W;  3HB3 B;  1G4Y B;  2W6J G;  2W0F C;  4I4T A;  3SYQ A;  1VF7 A;  2OWO A;  2CH4 A;  1VQ8 V;  4EEH A;  3RYF B;  2O1V A;  2IWU A;  3CCQ V;  3QNE A;  4DV0 O;  1JQ0 A;  5ITZ A;  3E8F A;  3K5N A;  3GIG B;  5KX5 A;  4DV4 O;  2ZKJ A;  2Y0P A;  4BW9 A;  3VHA A;  1K5Q A;  5CA1 B;  2EIM B;  4GX2 A;  5D7D A;  2CTR A;  2Q0O C;  4G28 B;  3SGI A;  3CRA A;  1M90 W;  1VF6 A;  1R3K C;  3AK2 A;  3O0I A;  4HYO A;  1XNQ O;  5H5N A;  1ROP A;  1R3L C;  2W6I G;  1YIJ V;  1ZLZ A;  4NTW A;  4EFE A;  1F7Y A;  3F5T A;  2WI5 A;  3CPW U;  2IJK A;  4FZ1 A;  2QKA A;  3R92 A;  2DYR C;  3C90 A;  5KHJ A;  1F23 A;  4IL6 Z;  4KSH A;  3JCZ A;  4JI8 B;  1AB3 A;  2QFO A;  1U0Z A;  4DR2 B;  1SES A;  3ZM7 A;  1TAE A;  2YIC A;  5A9G A;  2Q0A A;  3H1L H;  1L8D A;  2XDU A;  2AGA A;  3N2K B;  4CWR A;  4XDL A;  1GM9 A;  3K98 A;  5H6Q A;  5J6A A;  1AH6 A;  4YKT A;  4FFK A;  4BWA A;  1HNZ O;  1QBZ A;  5GTH Z;  2P67 A;  1THZ A;  4MTF A;  1N32 O;  2H55 A;  4OX9 O;  1FXK C;  1VQK V;  1AR4 A;  2E0A A;  2Z3Y A;  4DR4 O;  4YKZ A;  2GHY A;  3BCC H;  2GFD A;  1KD1 W;  4DR1 B;  3JSN A;  3LSS A;  3ABM B;  3OR7 C;  3APO A;  1PVG A;  4XKK A;  2JDI G;  4PDV A;  4MVR A;  3FYE B;  1YJN V;  3U67 A;  2ZBK B;  1TBW A;  1KZN A;  1KP3 A;  1WP8 A;  4LFB O;  3CGZ A;  2YEB A;  4ASG A;  1EZJ A;  2EIM C;  4D7T A;  3L74 H;  4TQD A;  3OFN G;  2QTO A;  1FPO A;  5D6Q A;  2HHH O;  4KHP O;  4FLU A;  4OXS A;  2UXN A;  5LOV B;  1XBL A;  1S5J A;  1I5A A;  3B2E E;  4O05 A;  3K9A A;  5D7R A;  4LWE A;  2YGA A;  4CBC A;  3ZS8 C;  2N04 A;  2XJJ A;  4I55 B;  3R4P A;  3JAW A;  2XX2 A;  1W59 A;  1XL4 A;  2YKJ A;  4R1F A;  2ZXW C;  3FB7 C;  4R7C A;  4XTJ A;  2GTS A;  3RYC B;  2UUA O;  1Y66 A;  1ZX3 A;  1XMQ B;  4GEE A;  5J71 A;  4H0L B;  4FMT A;  2NNU A;  5B3S B;  1COW G;  1H8H G;  3TZ0 A;  2ZM6 B;  3CCU V;  3R4O A;  4JTD B;  1SA0 A;  1B62 A;  2F43 G;  5IJ0 A;  1HW7 A;  2EIL C;  3C0E A;  4BAY A;  4JI1 O;  2P5O A;  3ZRS A;  4DV7 O;  2X7R B;  5TIS Z;  1CEZ A;  4ABM A;  1VQM V;  3EHJ A;  1D2D A;  1K3E A;  5D5Q A;  2ZDI A;  5HFM A;  3LPS A;  4TV8 A;  2RMK B;  2YEV A;  2F4V O;  1MMM A;  3K08 A;  1CP9 A;  4J80 A;  3ZBH A;  4B7E A;  4HYP A;  2V4D A;  1CXZ B;  1KB9 F;  5KHK A;  1K92 A;  2F66 C;  3CCL V;  3R91 A;  3ABM C;  4GCZ A;  2YEG A;  4AQY O;  3G6E V;  2UUB B;  2CE4 A;  2DN9 A;  4X62 O;  4K8Z A;  2PF4 E;  5BOC A;  3B27 A;  1M93 A;  2BOC C;  1IBM O;  4P7A A;  3E22 A;  5K1X A;  4L93 A;  2FWZ A;  2RDC A;  1M56 C;  1ENV A;  1NKD A;  3STL C;  2YGF A;  4K3A A;  2BRE A;  5KHG A;  4X1I A;  3F7Y C;  5LHH A;  4CC6 A;  4UCS A;  3JD2 A;  2ZNI A;  3WB2 A;  4WFH A;  4LF8 B;  5C8Y A;  4DV1 O;  4J7J A;  5LP6 C;  1UY9 A;  3L72 H;  2WLH A; 
#chains in the Genus database with same CATH homology
 3TZ4 A;  3FT5 A;  5L3J A;  1UYE A;  1PNK A;  3INW A;  3ZKD A;  4JYB A;  1ARO P;  5B3S C;  2YJW A;  2WI6 A;  1VQ9 V;  4MPC A;  1K4D C;  1ZXM A;  4R3M A;  1QR8 A;  3ZRW A;  2WER A;  4O09 A;  3CCJ V;  4DUH A;  2FXS A;  2YI0 A;  1I5X A;  2IJI A;  4WCE V;  1TH8 A;  4UVB A;  1YS3 A;  2Q69 A;  1M1K W;  2M7W A;  2WPD G;  4PDR A;  3CC7 V;  1UYM A;  1P4R A;  1VQN V;  3FT8 A;  2IWX A;  3OMA B;  1TC6 A;  4O0B A;  2X6B A;  3K79 A;  2XAQ A;  1FXH A;  4UXN A;  3K99 A;  4XD8 A;  1DLB A;  2XAH A;  4ASB A;  3UM7 A;  1JOY A;  2XDK A;  4CE1 A;  1YT0 A;  2GQP A;  3NMQ A;  1YSC A;  1OCC B;  2XOK G;  2WLL B;  5FL7 G;  3GIG A;  2OCC B;  1VQ7 V;  1S5H C;  5IDM A;  1UYC A;  1Y4M A;  1VQ6 V;  2R9R B;  1P7B A;  1EA6 A;  1QYE A;  1NHI A;  2YI5 A;  4PU9 A;  2H94 A;  2Q67 A;  2LFR A;  5L3F A;  4CWF A;  3RVY A;  2IJJ A;  4YKU A;  2EIK B;  1J95 A;  1NQT A;  3LUT B;  4RAI A;  1UY7 A;  4U7O A;  2AKP A;  1BGQ A;  2XHT A;  4XIR A;  1A4H A;  3K60 A;  3BMY A;  1K5S A;  3MD0 A;  2WAM A;  2XK2 A;  3STZ C;  2K1E A;  3ZKB A;  3SYC A;  4J9Z B;  1R6N A;  3B28 A;  3PEH A;  5CBG A;  3A0Y A;  4F4L A;  4XDM A;  2HFE C;  1VQP V;  2EIN B;  4MB9 A;  1OCC C;  4BQJ A;  3TZ2 A;  4NH9 A;  1YC4 A;  3G71 V;  1Z5C A;  2OCC C;  3FB5 C;  4BIU A;  2FYP A;  4CE3 A;  3K0G A;  1AI6 A;  4WFG A;  2EIK C;  4KTN A;  3MHS C;  1R6K A;  2YE5 A;  2BU6 A;  3ABL B;  4K4O A;  4BIZ A;  4ZKI A;  5KA6 A;  3CCR V;  1YTF B;  3D2R A;  3CP1 A;  3KG2 A;  2B1G A;  2HKO A;  4MW3 A;  2XAF A;  2IWS A;  4UV9 A;  3RLP A;  3ZIA G;  3M99 B;  4MVQ A;  4EKW A;  1N8R W;  4EMV A;  2EIN C;  1OZ0 A;  4EFT A;  1RPR A;  1MOF A;  3H4L A;  1QLE C;  2H8P C;  5EBL C;  1JPX A;  3F7V C;  1YI2 V;  4WFE A;  3QO7 A;  4MT8 A;  1I5D A;  1H7U A;  4BXI A;  4WUC A;  4CWP A;  1I59 A;  4L91 A;  4X8A A;  3TCU A;  4Q20 A;  2EZO A;  1UYI A;  2BT0 A;  1Y8P A;  3E83 A;  3ZRX A;  4QNH B;  2JJ2 G;  1BYQ A;  4MPN A;  1I5Y A;  2P7T C;  2WSS G;  3PEJ A;  2YE3 A;  2WLN A;  2JEX A;  2IH1 C;  1YJ9 V;  3E86 A;  2QM8 A;  2HJF C;  1B3Q A;  2ZDX A;  4FCQ A;  4CWT A;  3D36 A;  4JTA B;  4YKQ A;  3CRL A;  3SPJ A;  3CC2 V;  2B1I A;  2YEF A;  2A79 B;  2YK2 A;  5LGN A;  3KE6 A;  3I56 V;  4WFB V;  2Q8I A;  2JK5 C;  5LHG A;  2JIZ G;  2WLI A;  4KFG A;  1K97 A;  2WLL A;  4NH7 A;  2UWD A;  1F51 A;  4YXW G;  3INX A;  1GM8 A;  1S0V A;  1GO3 F;  3ASN B;  2CCT A;  2XND G;  3OWD A;  4PEL A;  3Q5K A;  3WHA A;  5IYB O;  1W0K G;  4MW8 A;  4O07 A;  4FK5 C;  3W7T A;  5EBM C;  4PRV A;  3MNR P;  1DTO A;  3OUF A;  5J9P C;  4FCP A;  2CK3 G;  1Z5B A;  4E01 A;  3LNM B;  5CN0 A;  1AI7 A;  3GIF A;  3Q5L A;  2BSM A;  1SER A;  1QCE A;  2JKI A;  3BY6 A;  2YSU B;  2YE9 A;  1NR1 A;  4MSW C;  3E8H A;  1RM1 C;  2ZXW B;  3MHH C;  3A0T A;  1E1R G;  4L94 A;  4PA4 A;  2IJH A;  4CWN A;  3RVZ A;  4AWP A;  4PDM A;  1S14 A;  2A0L A;  2ZQM A;  4XKO A;  5GW7 A;  2EIL B;  1NR7 A;  3EHG A;  2YI6 A;  4U7N A;  1BMF G;  5CBH A;  3VOU A;  3B8M A;  4YKR A;  2BYI A;  1XL6 A;  3ASN C;  1ID0 A;  3T10 A;  1TIL A;  2YKB A;  2XDS A;  1Q81 W;  3CD6 V;  5B1A C;  2ITD C;  3JD3 A;  4MOT A;  2XJX A;  2IW5 A;  5F3K A;  1M56 B;  2BTZ A;  3W7U A;  1YER A;  4URM A;  2ZDY A;  4JQL A;  2DW4 A;  3R4N A;  1UYK A;  1QVF U;  4P8O A;  3LDD A;  1GKZ A;  1KP2 A;  1GMG A;  1Z59 A;  1R3J C;  2Y69 B;  1GTO A;  1Q82 W;  3G4S V;  3TZ5 A;  4I3H A;  5L3G A;  2K5B A;  4MTG A;  1QR9 A;  3D3I A;  2QF6 A;  2BOB C;  2X0L A;  3B25 A;  3SJQ C;  3OE7 G;  5EC2 C;  3ASO C;  3GIE A;  1OHH G;  4GX1 A;  2BU5 A;  1DF5 A;  3H80 A;  4E02 A;  4FPP A;  3GB7 C;  5L3B A;  1YES A;  3ZRV A;  3SPG A;  4MVM A;  2LP7 A;  1OCO B;  1H2G A;  1GM7 A;  1BHA A;  5CTW A;  3LSQ A;  4U93 A;  1Y8N A;  3T2M A;  4MP2 A;  2ZR2 A;  2X6A A;  2CGF A;  4MP7 A;  2OTL V;  3CME V;  1AJ6 A;  3SYP A;  4XDK A;  3JD0 A;  2Y69 C;  4KUM A;  1NHJ A;  2VW5 A;  3QTF A;  2DWD C;  2ZD9 A;  4XKA A;  1OCR C;  4HY1 A;  1NJI W;  2JJ1 G;  3ML0 A;  1THN A;  2XAS A;  3OWB A;  3OM3 B;  3OGC C;  4GX0 A;  2IU3 A;  3D0B A;  2WI3 A;  3B26 A;  5L3D A;  1M57 B;  5GGZ A;  1R73 A;  3VBB A;  1YIT V;  1W0J G;  2QKS A;  2H8M A;  3G7E A;  3B24 A;  1FXK A;  3OPD A;  1OCO C;  3A0R A;  1GJV A;  2WWW A;  4BW5 A;  1UYD A;  5L3E A;  2WEP A;  3FB8 C;  3ZJZ A;  1UY8 A;  4HZ0 A;  4NH8 A;  1AJN A;  4I9W A;  4H33 A;  1YT2 A;  2WLJ A;  1V55 B;  1L1F A;  5KUK A;  1PL0 A;  3HYY A;  4JPR A;  1US7 A;  5CMU A;  4AWO A;  1I58 A;  4AS9 A;  1PNL A;  1AR1 B;  2HG5 C;  3EKO A;  2HVJ C;  4V26 A;  1M57 C;  2UXX A;  2QG0 A;  3P30 A;  5H6R A;  3AG1 B;  1V54 B;  4LPB A;  4PA3 A;  3OEH G;  2R9I A;  3LNU A;  5CF0 A;  2Q8G A;  4QPK A;  5KA5 A;  2EXL A;  3RLR A;  3ETE A;  2ATK C;  2XDX A;  4RQF A;  4X9L A;  1AM1 A;  1Q86 W;  3AG4 C;  3ZMV A;  1JJ2 U;  3H01 A;  1S3J A;  3JYC A;  3EHB B;  4LWF A;  1QLE B;  5H9C A;  1MAB G;  4FIP C;  3A0W A;  3I55 V;  1GKX A;  1YSZ A;  1V55 C;  2EZP A;  1UY6 A;  3A0Z A;  4TSF G;  3T1K A;  2VCJ A;  1TUE B;  2YEI A;  4PA9 A;  4ASA A;  2XAG A;  3K06 A;  1FXV A;  1YTF D;  3CXC U;  3EKR A;  5LGU A;  3T1C A;  5LBQ A;  4EGH A;  3NXS A;  3TK1 A;  3G75 A;  4MVS A;  2XDL A;  3ZCC A;  1S76 D;  3AG1 C;  1V54 C;  1YC1 A;  1G8M A;  4G2K A;  4HZ3 A;  3EHF A;  3ZMS A;  1U2O A;  3RKZ A;  4ASF A;  3QO8 A;  1Y8O A;  2IOP A;  4L8Z A;  4FJC C;  4JGS A;  2KB1 A;  4PRX A;  3ETG A;  4PDL A;  4RUF A;  4X89 A;  1AI5 A;  1SET A;  4H81 A;  1NVP B;  2Q68 A;  4WFF A;  3TET A;  3FYI B;  4KP4 A;  2YEC A;  3CRK A;  1BKN A;  4GFN A;  3ZXQ A;  3PJS K;  3CCE V;  3E35 A;  1E79 G;  3QO5 A;  3OW6 A;  3IFX A;  4KQV A;  2YE7 A;  1MSW D;  4B7P A;  2CG9 A;  3T0Z A;  1NHH A;  2Q2E B;  3FB6 C;  2NLJ C;  4MPE A;  3E2E A;  4HYM A;  1ZWI C;  4PA6 A;  2X6C A;  4GQT A;  1RPO A;  4DXW A;  4FCR A;  1FS0 G;  2JEU A;  2C2A A;  5BZB A;  5LGT A;  3DGE A;  4CE2 A;  2XJG A;  2IOR A;  3B8N A;  2EIJ B;  5M4P A;  3AG2 C;  2WLK A;  1HWY A;  1BXD A;  3X2Q C;  4MTX A;  4HY6 A;  1UYL A;  1AJQ A;  2FTK A;  4DZY A;  4MTO A;  1RM1 B;  4H85 A;  1S16 A;  5IYC O;  2MK3 A;  2Q6A A;  3C11 A;  1NBM G;  4E2L A;  1PKX A;  4XIT A;  2V1D A;  3SPC A;  5D6P A;  3ZRW B;  3F5W C;  1JM6 A;  5CTU A;  3ZN0 A;  4YKY A;  2ZDI C;  3QDD A;  3E8B A;  4GT8 A;  3OEE G;  1ZW9 A;  1OCZ B;  3LDC A;  3K3W A;  1LNQ A;  2WLM A;  5BOD A;  1R62 A;  1Y4S A;  1B6Q A;  5B1B B;  1NH2 B;  5B1A B;  4LCU C;  4ASU G;  4QPJ A;  3OMN B;  1SRY A;  4HXW A;  4RO2 A;  2EIJ C;  1PD3 A;  1CPY A;  1ZXN A;  2YKI A;  1JX9 A;  2QE7 G;  3SYA A;  2ZR3 A;  3JD4 A;  3U2K A;  2IU0 A;  2HLD G;  4EGI A;  4WFA V;  1KQS U;  2YE8 A;  4E00 A;  2Q8H A;  2XHR A;  4XCL A;  2EBO A;  4P9O A;  2P6J A;  2QM7 A;  4P30 A;  3OUS A;  3WFV A;  4LWH A;  5EC1 C;  5CBF A;  4W7T A;  3ASO B;  5CA3 A;  5F5R A;  1K7D A;  2WI2 A;  1OCZ C;  3DTU B;  5B1O A;  2AHZ A;  4PA7 A;  4BAE A;  1UYF A;  1S77 D;  5M4H A;  1W2B U;  4JAU A;  4ZVI A;  5FWK A;  5B1B C;  4N21 A;  5DM6 V;  3W7S A;  1Q7Y W;  1JVM A;  4MS2 A;  4HZ5 A;  4PL9 A;  3P32 A;  4Z1M G;  2Y48 A;  4O04 A;  2XHX A;  1TC0 A;  1TID A;  2YJX A;  5IYD O;  1WLE A;  1S72 V;  4CWQ A;  3WG7 B;  4I5S A;  3T0H A;  3T4D A;  2GSM B;  4J9Y B;  2HG1 A;  5EK0 A;  1EI1 A;  3EFF K;  5CTX A;  3T2S A;  1OCR B;  3HHU A;  3GWO A;  3OMI B;  3SPI A;  2XAB A;  1K4C C;  2Q8F A;  4R50 A;  2YE2 A;  1AJP A;  2O1W A;  1FFT B;  1VQ4 V;  3EHH A;  3B77 A;  5M4E A;  3IGA C;  4LWG A;  4GT1 A;  1KIJ A;  4N23 A;  4URO A;  2BRC A;  4BQG A;  2YEE A;  2IOQ A;  4G27 B;  5IN9 A;  3CC4 V;  4LBE C;  3AG3 B;  3OAA G;  3ZN1 A;  2PI4 A;  3RLQ A;  4JF3 A;  3SYO A;  4TT3 G;  2V7Q G;  3ABT A;  1K33 A;  3WG7 C;  1KC8 W;  2XX5 A;  3OW2 U;  1AMW A;  2FWY A;  3SPH A;  5FND A;  4HXZ A;  4V25 A;  2QEX V;  1QZR A;  1UJW B;  4WF9 V;  4LC1 A;  2ESA A;  4QIW F;  3VHD A;  3ZMT A;  1H8E G;  1SZT A;  2HR3 A;  4HAM A;  2YKC A;  3OMU A;  4B6C A;  1YC3 A;  1H7S A;  2YEA A;  1VQ5 V;  1BHB A;  5C93 A;  2Z5U A;  1H38 A;  4JYC A;  2XX4 A;  4URL A;  1EBO A;  3AEI A;  3K04 A;  4JTC B;  3RW0 A;  3AG3 C;  1IXM A;  3LDE A;  4L87 A;  4JAV A;  4WUB A;  3E8G A;  3AG4 B;  3CCV V;  2WEQ A;  4UVA A;  1E1Q G;  5EBW C;  3IC7 A;  2IH3 C;  2DYS B;  4GX5 A;  1K73 W;  4KSG A;  5IY5 B;  2WI7 A;  1MU5 A;  3W7X A;  4WUD A;  1L0O A;  2BZ5 A;  2ITC C;  3JZ3 A;  3HZ5 A;  3K0D A;  2WLI B;  2YED A;  4YKW A;  1UYH A;  4URN A;  4LP8 A;  2YI7 A;  3ZMZ A;  4R6Z A;  2YE6 A;  4H7Q A;  2YKE A;  3Q5J A;  2DQ0 A;  4MVO A;  4L90 A;  3FKS G;  1ZWH A;  2XAJ A;  2DQ3 A;  1KEC A;  3CMA V;  1OSF A;  1VQO V;  4JAS A;  3O6O A;  2WI1 A;  2YK9 A;  2YGE A;  5CPH A;  3TUH A;  3OR6 C;  2DWE C;  1YHQ V;  5B1N A;  2O1U A;  4TWK A;  4R8C A;  2DYS C;  2BU8 A;  5M4K A;  5IY5 C;  4RQE A;  3IED A;  4EM7 A;  2JJC A;  1YJW V;  3JD1 A;  3ABK B;  1K34 A;  3A0X A;  4UVC A;  3ABU A;  1AI4 A;  4QE9 A;  1K8A W;  1JCH A;  1QVG U;  3ETD A;  4LWI A;  1YT1 A;  4XE2 A;  3R65 A;  2XCM A;  4GGL A;  2CCS A;  5LHI A;  3K97 A;  1AH8 A;  1GK9 A;  4XCJ A;  3CYO A;  4CWO A;  4RUE A;  3CWV A;  3SL2 A;  2CCU A;  3G7B A;  2P90 A;  2VCI A;  1NVP D;  3ZXO A;  2B5U A;  3AG2 B;  5DN6 G;  3BM9 A;  4R3A A;  4X88 A;  2HKJ A;  4XIP A;  3X2Q B;  2BYH A;  1QY8 A;  3BEH A;  1WPX A;  5FNC A;  1MX0 A;  1YSR A;  1ORQ C;  2QA4 V;  2YEJ A;  2YEH A;  3ZMU A;  2VWC A;  4XIQ A;  3ABK C;  1B63 A;  3HZ1 A;  1Z5A A;  4EGK A;  1GKF A;  1M9N A;  5FNF A;  3HYZ A;  5HFL A;  3O2F A;  4XBF A;  2OTJ V;  1I5C A;  1PNM A;  3CGY A;  1EFR G;  5L3C A;  4CZZ A;  4QJF B;  3WQ9 A;  2YEV B;  3VHC A;  2BU7 A;  1VQL V;  5IDJ A;  4UV8 A;  3FV5 A;  3T4Z A;  4MBC A;  5M4N A;  4KFM A;  3CCM V;  3W7W A;  2AHY A;  2EJR A;  3E89 A;  1BL8 A;  3ABL C;  4QE7 A;  4XDJ A;  4ZBM A;  3UKM A;  3TTZ A;  2HCH A;  1F4N A;  1Y4U A;  4MVU A;  1KKD A;  2LFS A;  2YE4 A;  3U2D A;  5KUM A;  4XC0 A;  3HPL C;  1UYG A;  3VAD A;  2HVK C;  4MVZ A;  1R3I C;  5M4M A;  2PNR A;  1F4M A;  5E1A C;  5D7C A;  4LP0 A;  4P9P A;  2OT5 A;  1K9M W;  4P2Z A;  3CCS V;  2PI5 A;  2XD6 A;  3RBZ A;  3R4M A;  4DO2 A;  4EFU A;  2DYR B;  2BU2 A;  3K03 A;  5CTY A;  1QLN A;  4H37 A;  1MG1 A;  1NH2 D;  1DF4 A;  4CWS A;  4UUJ C;  2A9H A;  3HEK A;  4YKX A;  1YET A;  2QG2 A;  2WI4 A;  1I5B A;  4AWQ A;  1FXK B;  2D3O W;  3HB3 B;  1G4Y B;  2W6J G;  2W0F C;  3SYQ A;  2CH4 A;  1VQ8 V;  4EEH A;  2O1V A;  2IWU A;  3CCQ V;  3QNE A;  1JQ0 A;  3E8F A;  3GIG B;  2ZKJ A;  3VHA A;  1K5Q A;  2EIM B;  4GX2 A;  5D7D A;  4G28 B;  1M90 W;  1R3K C;  3O0I A;  4HYO A;  1ROP A;  1R3L C;  2W6I G;  1YIJ V;  2WI5 A;  3CPW U;  2IJK A;  3R92 A;  2DYR C;  1F23 A;  4KSH A;  3JCZ A;  2QFO A;  1U0Z A;  1SES A;  3ZM7 A;  2XDU A;  4CWR A;  4XDL A;  1GM9 A;  3K98 A;  5H6Q A;  5J6A A;  1AH6 A;  4YKT A;  1QBZ A;  2P67 A;  1THZ A;  4MTF A;  2H55 A;  1FXK C;  1VQK V;  2E0A A;  2Z3Y A;  4YKZ A;  2GHY A;  2GFD A;  1KD1 W;  3LSS A;  3ABM B;  3OR7 C;  1PVG A;  4XKK A;  2JDI G;  4PDV A;  4MVR A;  3FYE B;  1YJN V;  3U67 A;  2ZBK B;  1TBW A;  1KZN A;  1KP3 A;  3CGZ A;  2YEB A;  4ASG A;  1EZJ A;  2EIM C;  3OFN G;  2QTO A;  5D6Q A;  4OXS A;  2UXN A;  1I5A A;  4O05 A;  3K9A A;  5D7R A;  4LWE A;  2YGA A;  4CBC A;  2XJJ A;  3R4P A;  2XX2 A;  1XL4 A;  2YKJ A;  4R1F A;  2ZXW C;  3FB7 C;  4R7C A;  4XTJ A;  1Y66 A;  4GEE A;  5J71 A;  4FMT A;  2NNU A;  5B3S B;  1COW G;  1H8H G;  3TZ0 A;  3CCU V;  3R4O A;  4JTD B;  1B62 A;  2F43 G;  2EIL C;  3C0E A;  4BAY A;  3ZRS A;  2X7R B;  1CEZ A;  1VQM V;  3EHJ A;  1K3E A;  2ZDI A;  5HFM A;  3LPS A;  2YEV A;  3K08 A;  1CP9 A;  4HYP A;  1K92 A;  3CCL V;  3R91 A;  3ABM C;  4GCZ A;  2YEG A;  3G6E V;  5BOC A;  3B27 A;  2BOC C;  4P7A A;  4L93 A;  2FWZ A;  1M56 C;  1ENV A;  1NKD A;  3STL C;  2YGF A;  2BRE A;  3F7Y C;  5LHH A;  3JD2 A;  4WFH A;  1UY9 A;  2WLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...