4FMZA

Crystal structure of an internalin (inlf) from listeria monocytogenes str. 4b f2365 at 1.91 a resolution
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
340
structure length
340
Chain Sequence
b'TLATLPAPINQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNEDMEVIGGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin
publication title Crystal structure of an internalin (inlF) from Listeria monocytogenes str. 4b F2365 at 1.91 A resolution
rcsb
source organism Listeria monocytogenes serotype 4b
molecule tags Cell adhesion, cell invasion
total genus 121
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fmzA00
4HQ1A 2OMXA 1KOHA 3DZEA 4AW4A 1OZNA 4XOSA 2O6SA 3OGMB 1K5GC 3W3JA 2P1QB 4BSRA 3W3NA 5IJDA 3JB9j 3GOZA 4ARRA 3RFJA 4KT1A 4R6GA 4R58A 3WPHA 3W3GA 2JE0A 4J4LA 5A5CA 1Z7XW 2WQWA 3VQ1A 4Z79A 4PEQB 1W8AA 1M0ZA 5AWBA 2O6QA 4PKIG 4QBZA 3A79B 3E4GA 4RWTC 2OMYA 4Z8GA 2OMVA 3WPFA 1SQ0B 3RFSA 3ULVA 2WQUA 5FTTB 3W3KA 2V9TB 3WPIA 5LFNA 2JQDA 3ZYNA 2ID5A 2V9SA 4BSSA 3PMHG 3G3AA 4G8AA 1G9UA 1OOKG 5CMPA 4FMZA 1OTMA 1XCDA 4P91A 3OGLB 1DCEA 4LSCA 3RFEA 4L3FA 5GQRK 4M7EA 1DFJI 5GMFA 4R5DA 1FO1A 1WWLA 2RR6A 2Z64A 4YEBB 2P1PB 3C6NB 1DS9A 5GS2B 2V70A 2Z63A 5CMNA 4L3AA 4LSAA 1FT8A 4UFRA 4PERA 4XGOA 4EZGA 2WQVA 2XOTA 2WFHA 1P8VA 3ULAA 4C2AB 4RCWA 4R6JA 4ARNA 4NKGA 1M9SA 2Z82A 3G39A 4BV4R 2R9UA 1A4YA 3UL8A 4ECNA 4BSUA 4GT6A 2P1MB 3ULUA 4GLPA 2ASTB 5B4PA 3WPCA 3UL7A 4XSQA 4KNGA 2Z7XB 2UZXA 4R08A 2XWTC 1ZIWA 1OTOA 3C6PB 4CILA 4R0AA 1XWDC 4H09A 4WYKA 5HDHA 3WPEA 4PSJA 4U08A 3RW7A 1GWBA 3G3BA 2OMUA 3SB4A 4I6JB 4K17A 3W3MA 4J0MA 4Z94G 4Q3IA 3WPDA 4CNMA 4KXFB 4NKHA 4LXRA 2O6RA 1H6UA 5HZLB 4CNCA 4LI1A 5B0TA 3W3LA 1PGVA 3TSRE 3WPGA 4LSXC 1XECA 3FXIA 5AZ5A 3O53A 3E6JA 5D3IA 1K5DC 4Q3GA 4U06A 4LXSA 1P9AG 3VQ2A 3CIGA 4B8CD 2Z66A 5AWCA 5GMHA 4QC0A 4WP6A 2P1OB 2WQXA 1FQVA 1FS2A 4R5CA 4RCAB 3G04C 1YRGA 2UZYA 5GS0A 4OQTA 4QXEA 3REZA 4AY9X 3M18A 1OGQA 3OGKB 2CA6A 3WPBA 4CC4C 3O6NA 4MN8B 3ZYJA 1IO0A 4FDWA 2RA8A 3E3ZA 3RGXA 2Z7XA 2P1NB 2OMTA 3ZYIA 2BNHA 2Y5QA 3ZYOA 2JE1A 4R09A 3RW6A 4V2EA 3OJAB 3OJAA 3RIZA 5IJCA 1LTXA 4CP6A 1D0BA 4ECOA 4R6FA 3RJ0A 3UN9A 4R6AA 3BZ5A 3P72A 4LSXA 4P8SA 1O6SA 2ASSB 1KOOA 1P8TA 4R07A 4FD0A 4U7LA 4V2DA 5IYXC 3CIYA 1O6VA 1A9NA 5AWDA 2Z81A 3C6OB 5AWAA 3WN4A 5GMGA 2FT3A 1JL5A 4Z64C 4Y61B 4IM6A 4U09A 1QYYA 2A0ZA 2Z62A 4C2BB 2IFGA 4FS7A 4Q62A 4FHOA 4FCGA 2ELLA 2BEXA 3G06A 1XEUA 4V2CA 2Q4GW 1H6TA 4LI2A 1U0ND 2OMWA 3KJ4A 4M7EC 4Z61C 3E2JA 1XKUA 3CVRA 3RGZA 4CC4A 3UL9A 1O6TA 1OTNA 3M19A 4TZHA 2OMZA 1M9LA 4PQ8A 1M10B 2Z65A 4MQWX 5B0NA 5IJBA
chains in the Genus database with same CATH superfamily
4HQ1A 2OMXA 1KOHA 3DZEA 4AW4A 1OZNA 4XOSA 2O6SA 3OGMB 1K5GC 3W3JA 2P1QB 4BSRA 3W3NA 5IJDA 3JB9j 3GOZA 4ARRA 3RFJA 4KT1A 4NZRM 4R6GA 4R58A 3WPHA 3W3GA 2JE0A 4J4LA 5A5CA 1Z7XW 2WQWA 3VQ1A 4Z79A 4PEQB 1W8AA 1M0ZA 5AWBA 2O6QA 4PKIG 4QBZA 3A79B 3E4GA 4RWTC 2OMYA 4Z8GA 2OMVA 3WPFA 1SQ0B 3RFSA 3ULVA 2WQUA 5FTTB 3W3KA 2V9TB 3WPIA 5LFNA 2JQDA 3ZYNA 2ID5A 2V9SA 4BSSA 3PMHG 3G3AA 4G8AA 1G9UA 1OOKG 5CMPA 4FMZA 1OTMA 1XCDA 4P91A 3OGLB 1DCEA 4LSCA 3RFEA 4L3FA 5GQRK 4M7EA 1DFJI 5GMFA 4R5DA 1FO1A 1WWLA 2RR6A 2Z64A 4YEBB 2P1PB 3C6NB 1DS9A 5GS2B 2V70A 2Z63A 5CMNA 4L3AA 4LSAA 1FT8A 4UFRA 4PERA 4XGOA 4EZGA 2WQVA 2XOTA 2WFHA 1P8VA 3ULAA 4C2AB 4RCWA 4R6JA 4ARNA 4NKGA 1M9SA 2Z82A 3G39A 4BV4R 2R9UA 1A4YA 3UL8A 4ECNA 4BSUA 4GT6A 2P1MB 3ULUA 4GLPA 2ASTB 5B4PA 3WPCA 3UL7A 4XSQA 4KNGA 2Z7XB 2UZXA 4R08A 2XWTC 1ZIWA 1OTOA 3C6PB 4CILA 4R0AA 1XWDC 4H09A 4WYKA 5HDHA 3WPEA 4PSJA 4U08A 3RW7A 1GWBA 3G3BA 2OMUA 3SB4A 4I6JB 4K17A 3W3MA 4J0MA 4Z94G 4Q3IA 3WPDA 4CNMA 4KXFB 4NKHA 4LXRA 2O6RA 1H6UA 5HZLB 4CNCA 4LI1A 5B0TA 3W3LA 1PGVA 4NZTM 3TSRE 3WPGA 4LSXC 1XECA 3FXIA 5AZ5A 3O53A 3E6JA 5D3IA 1K5DC 4Q3GA 4U06A 4LXSA 1P9AG 3VQ2A 3CIGA 4B8CD 2Z66A 5AWCA 5GMHA 4QC0A 4WP6A 2P1OB 2WQXA 1FQVA 1FS2A 4R5CA 4RCAB 3G04C 1YRGA 2UZYA 5GS0A 4OQTA 4QXEA 3REZA 4AY9X 3M18A 1OGQA 3OGKB 2CA6A 3WPBA 4CC4C 3O6NA 4MN8B 3ZYJA 1IO0A 4FDWA 2RA8A 3E3ZA 3RGXA 2Z7XA 2P1NB 2OMTA 3ZYIA 2BNHA 2Y5QA 3ZYOA 2JE1A 4R09A 3RW6A 4V2EA 3OJAB 3OJAA 3RIZA 5IJCA 1LTXA 4CP6A 1D0BA 4ECOA 4R6FA 3RJ0A 3UN9A 4R6AA 3BZ5A 3P72A 4LSXA 4P8SA 1O6SA 2ASSB 1KOOA 1P8TA 4R07A 4FD0A 4U7LA 4V2DA 5IYXC 3CIYA 1O6VA 1A9NA 5AWDA 2Z81A 3C6OB 5AWAA 3WN4A 5GMGA 2FT3A 1JL5A 4Z64C 4Y61B 4IM6A 4U09A 1QYYA 2A0ZA 2Z62A 4C2BB 2IFGA 4FS7A 4Q62A 4FHOA 4FCGA 2ELLA 2BEXA 3G06A 1XEUA 4V2CA 2Q4GW 1H6TA 4LI2A 1U0ND 2OMWA 3KJ4A 4M7EC 4Z61C 3E2JA 1XKUA 3CVRA 3RGZA 4CC4A 3UL9A 1O6TA 1OTNA 3M19A 4TZHA 2OMZA 1M9LA 4PQ8A 1M10B 2Z65A 4MQWX 5B0NA 5IJBA
chains in the Genus database with same CATH topology
4HQ1A 2OMXA 1KOHA 3DZEA 4AW4A 1OZNA 4XOSA 2O6SA 3OGMB 1K5GC 3W3JA 2P1QB 4BSRA 3W3NA 5IJDA 3JB9j 3GOZA 4ARRA 3RFJA 4KT1A 4R6GA 4R58A 3WPHA 3W3GA 2JE0A 4J4LA 5A5CA 1Z7XW 2WQWA 3VQ1A 4Z79A 4PEQB 1W8AA 1M0ZA 5AWBA 2O6QA 4PKIG 4QBZA 3A79B 3E4GA 4RWTC 2OMYA 4Z8GA 2OMVA 3WPFA 1SQ0B 3RFSA 3ULVA 2WQUA 5FTTB 3W3KA 2V9TB 3WPIA 5LFNA 2JQDA 3ZYNA 2ID5A 2V9SA 4BSSA 3PMHG 3G3AA 4G8AA 1G9UA 1OOKG 5CMPA 4FMZA 1OTMA 1XCDA 4P91A 3OGLB 1DCEA 4LSCA 3RFEA 4L3FA 5GQRK 4M7EA 1DFJI 5GMFA 4R5DA 1FO1A 1WWLA 2RR6A 2Z64A 4YEBB 2P1PB 3C6NB 1DS9A 5GS2B 2V70A 2Z63A 5CMNA 4L3AA 4LSAA 1FT8A 4UFRA 4PERA 4XGOA 4EZGA 2WQVA 2XOTA 2WFHA 1P8VA 3ULAA 4C2AB 4RCWA 4R6JA 4ARNA 4NKGA 1M9SA 2Z82A 3G39A 4BV4R 2R9UA 1A4YA 3UL8A 4ECNA 4BSUA 4GT6A 2P1MB 3ULUA 4GLPA 2ASTB 5B4PA 3WPCA 3UL7A 4XSQA 4KNGA 2Z7XB 2UZXA 4R08A 2XWTC 1ZIWA 1OTOA 3C6PB 4CILA 4R0AA 1XWDC 4H09A 4WYKA 5HDHA 3WPEA 4PSJA 4U08A 3RW7A 1GWBA 3G3BA 2OMUA 3SB4A 4I6JB 4K17A 3W3MA 4J0MA 4Z94G 4Q3IA 3WPDA 4CNMA 4KXFB 4NKHA 4LXRA 2O6RA 1H6UA 5HZLB 4CNCA 4LI1A 5B0TA 3W3LA 1PGVA 3TSRE 3WPGA 4LSXC 1XECA 3FXIA 5AZ5A 3O53A 3E6JA 5D3IA 1K5DC 4Q3GA 4U06A 4LXSA 1P9AG 3VQ2A 3CIGA 4B8CD 2Z66A 5AWCA 5GMHA 4QC0A 4WP6A 2P1OB 2WQXA 1FQVA 1FS2A 4R5CA 4RCAB 3G04C 1YRGA 2UZYA 5GS0A 4OQTA 4QXEA 3REZA 4AY9X 3M18A 1OGQA 3OGKB 2CA6A 3WPBA 4CC4C 3O6NA 4MN8B 3ZYJA 1IO0A 4FDWA 2RA8A 3E3ZA 3RGXA 2Z7XA 2P1NB 2OMTA 3ZYIA 2BNHA 2Y5QA 3ZYOA 2JE1A 4R09A 3RW6A 4V2EA 3OJAB 3OJAA 3RIZA 5IJCA 1LTXA 4CP6A 1D0BA 4ECOA 4R6FA 3RJ0A 3UN9A 4R6AA 3BZ5A 3P72A 4LSXA 4P8SA 1O6SA 2ASSB 1KOOA 1P8TA 4R07A 4FD0A 4U7LA 4V2DA 5IYXC 3CIYA 1O6VA 1A9NA 5AWDA 2Z81A 3C6OB 5AWAA 3WN4A 5GMGA 2FT3A 1JL5A 4Z64C 4Y61B 4IM6A 4U09A 1QYYA 2A0ZA 2Z62A 4C2BB 2IFGA 4FS7A 4Q62A 4FHOA 4FCGA 2ELLA 2BEXA 3G06A 1XEUA 4V2CA 2Q4GW 1H6TA 4LI2A 1U0ND 2OMWA 3KJ4A 4M7EC 4Z61C 3E2JA 1XKUA 3CVRA 3RGZA 4CC4A 3UL9A 1O6TA 1OTNA 3M19A 4TZHA 2OMZA 1M9LA 4PQ8A 1M10B 2Z65A 4MQWX 5B0NA 5IJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQ1 A;  2OMX A;  1KOH A;  3DZE A;  4AW4 A;  1OZN A;  4XOS A;  2O6S A;  3OGM B;  1K5G C;  3W3J A;  2P1Q B;  4BSR A;  3W3N A;  5IJD A;  3JB9 j;  3GOZ A;  4ARR A;  3RFJ A;  4KT1 A;  4R6G A;  4R58 A;  3WPH A;  3W3G A;  2JE0 A;  4J4L A;  5A5C A;  1Z7X W;  2WQW A;  3VQ1 A;  4Z79 A;  4PEQ B;  1W8A A;  1M0Z A;  5AWB A;  2O6Q A;  4PKI G;  4QBZ A;  3A79 B;  3E4G A;  4RWT C;  2OMY A;  4Z8G A;  2OMV A;  3WPF A;  1SQ0 B;  3RFS A;  3ULV A;  2WQU A;  5FTT B;  3W3K A;  2V9T B;  3WPI A;  5LFN A;  2JQD A;  3ZYN A;  2ID5 A;  2V9S A;  4BSS A;  3PMH G;  3G3A A;  4G8A A;  1G9U A;  1OOK G;  5CMP A;  4FMZ A;  1OTM A;  1XCD A;  4P91 A;  3OGL B;  1DCE A;  4LSC A;  3RFE A;  4L3F A;  5GQR K;  4M7E A;  1DFJ I;  5GMF A;  4R5D A;  1FO1 A;  1WWL A;  2RR6 A;  2Z64 A;  4YEB B;  2P1P B;  3C6N B;  1DS9 A;  5GS2 B;  2V70 A;  2Z63 A;  5CMN A;  4L3A A;  4LSA A;  1FT8 A;  4UFR A;  4PER A;  4XGO A;  4EZG A;  2WQV A;  2XOT A;  2WFH A;  1P8V A;  3ULA A;  4C2A B;  4RCW A;  4R6J A;  4ARN A;  4NKG A;  1M9S A;  2Z82 A;  3G39 A;  4BV4 R;  2R9U A;  1A4Y A;  3UL8 A;  4ECN A;  4BSU A;  4GT6 A;  2P1M B;  3ULU A;  4GLP A;  2AST B;  5B4P A;  3WPC A;  3UL7 A;  4XSQ A;  4KNG A;  2Z7X B;  2UZX A;  4R08 A;  2XWT C;  1ZIW A;  1OTO A;  3C6P B;  4CIL A;  4R0A A;  1XWD C;  4H09 A;  4WYK A;  5HDH A;  3WPE A;  4PSJ A;  4U08 A;  3RW7 A;  1GWB A;  3G3B A;  2OMU A;  3SB4 A;  4I6J B;  4K17 A;  3W3M A;  4J0M A;  4Z94 G;  4Q3I A;  3WPD A;  4CNM A;  4KXF B;  4NKH A;  4LXR A;  2O6R A;  1H6U A;  5HZL B;  4CNC A;  4LI1 A;  5B0T A;  3W3L A;  1PGV A;  3TSR E;  3WPG A;  4LSX C;  1XEC A;  3FXI A;  5AZ5 A;  3O53 A;  3E6J A;  5D3I A;  1K5D C;  4Q3G A;  4U06 A;  4LXS A;  1P9A G;  3VQ2 A;  3CIG A;  4B8C D;  2Z66 A;  5AWC A;  5GMH A;  4QC0 A;  4WP6 A;  2P1O B;  2WQX A;  1FQV A;  1FS2 A;  4R5C A;  4RCA B;  3G04 C;  1YRG A;  2UZY A;  5GS0 A;  4OQT A;  4QXE A;  3REZ A;  4AY9 X;  3M18 A;  1OGQ A;  3OGK B;  2CA6 A;  3WPB A;  4CC4 C;  3O6N A;  4MN8 B;  3ZYJ A;  1IO0 A;  4FDW A;  2RA8 A;  3E3Z A;  3RGX A;  2Z7X A;  2P1N B;  2OMT A;  3ZYI A;  2BNH A;  2Y5Q A;  3ZYO A;  2JE1 A;  4R09 A;  3RW6 A;  4V2E A;  3OJA B;  3OJA A;  3RIZ A;  5IJC A;  1LTX A;  4CP6 A;  1D0B A;  4ECO A;  4R6F A;  3RJ0 A;  3UN9 A;  4R6A A;  3BZ5 A;  3P72 A;  4LSX A;  4P8S A;  1O6S A;  2ASS B;  1KOO A;  1P8T A;  4R07 A;  4FD0 A;  4U7L A;  4V2D A;  5IYX C;  3CIY A;  1O6V A;  1A9N A;  5AWD A;  2Z81 A;  3C6O B;  5AWA A;  3WN4 A;  5GMG A;  2FT3 A;  1JL5 A;  4Z64 C;  4Y61 B;  4IM6 A;  4U09 A;  1QYY A;  2A0Z A;  2Z62 A;  4C2B B;  2IFG A;  4FS7 A;  4Q62 A;  4FHO A;  4FCG A;  2ELL A;  2BEX A;  3G06 A;  1XEU A;  4V2C A;  2Q4G W;  1H6T A;  4LI2 A;  1U0N D;  2OMW A;  3KJ4 A;  4M7E C;  4Z61 C;  3E2J A;  1XKU A;  3CVR A;  3RGZ A;  4CC4 A;  3UL9 A;  1O6T A;  1OTN A;  3M19 A;  4TZH A;  2OMZ A;  1M9L A;  4PQ8 A;  1M10 B;  2Z65 A;  4MQW X;  5B0N A;  5IJB A; 
#chains in the Genus database with same CATH topology
 4HQ1 A;  2OMX A;  1KOH A;  3DZE A;  4AW4 A;  1OZN A;  4XOS A;  2O6S A;  3OGM B;  1K5G C;  3W3J A;  2P1Q B;  4BSR A;  3W3N A;  5IJD A;  3JB9 j;  3GOZ A;  4ARR A;  3RFJ A;  4KT1 A;  4NZR M;  4R6G A;  4R58 A;  3WPH A;  3W3G A;  2JE0 A;  4J4L A;  5A5C A;  1Z7X W;  2WQW A;  3VQ1 A;  4Z79 A;  4PEQ B;  1W8A A;  1M0Z A;  5AWB A;  2O6Q A;  4PKI G;  4QBZ A;  3A79 B;  3E4G A;  4RWT C;  2OMY A;  4Z8G A;  2OMV A;  3WPF A;  1SQ0 B;  3RFS A;  3ULV A;  2WQU A;  5FTT B;  3W3K A;  2V9T B;  3WPI A;  5LFN A;  2JQD A;  3ZYN A;  2ID5 A;  2V9S A;  4BSS A;  3PMH G;  3G3A A;  4G8A A;  1G9U A;  1OOK G;  5CMP A;  4FMZ A;  1OTM A;  1XCD A;  4P91 A;  3OGL B;  1DCE A;  4LSC A;  3RFE A;  4L3F A;  5GQR K;  4M7E A;  1DFJ I;  5GMF A;  4R5D A;  1FO1 A;  1WWL A;  2RR6 A;  2Z64 A;  4YEB B;  2P1P B;  3C6N B;  1DS9 A;  5GS2 B;  2V70 A;  2Z63 A;  5CMN A;  4L3A A;  4LSA A;  1FT8 A;  4UFR A;  4PER A;  4XGO A;  4EZG A;  2WQV A;  2XOT A;  2WFH A;  1P8V A;  3ULA A;  4C2A B;  4RCW A;  4R6J A;  4ARN A;  4NKG A;  1M9S A;  2Z82 A;  3G39 A;  4BV4 R;  2R9U A;  1A4Y A;  3UL8 A;  4ECN A;  4BSU A;  4GT6 A;  2P1M B;  3ULU A;  4GLP A;  2AST B;  5B4P A;  3WPC A;  3UL7 A;  4XSQ A;  4KNG A;  2Z7X B;  2UZX A;  4R08 A;  2XWT C;  1ZIW A;  1OTO A;  3C6P B;  4CIL A;  4R0A A;  1XWD C;  4H09 A;  4WYK A;  5HDH A;  3WPE A;  4PSJ A;  4U08 A;  3RW7 A;  1GWB A;  3G3B A;  2OMU A;  3SB4 A;  4I6J B;  4K17 A;  3W3M A;  4J0M A;  4Z94 G;  4Q3I A;  3WPD A;  4CNM A;  4KXF B;  4NKH A;  4LXR A;  2O6R A;  1H6U A;  5HZL B;  4CNC A;  4LI1 A;  5B0T A;  3W3L A;  1PGV A;  4NZT M;  3TSR E;  3WPG A;  4LSX C;  1XEC A;  3FXI A;  5AZ5 A;  3O53 A;  3E6J A;  5D3I A;  1K5D C;  4Q3G A;  4U06 A;  4LXS A;  1P9A G;  3VQ2 A;  3CIG A;  4B8C D;  2Z66 A;  5AWC A;  5GMH A;  4QC0 A;  4WP6 A;  2P1O B;  2WQX A;  1FQV A;  1FS2 A;  4R5C A;  4RCA B;  3G04 C;  1YRG A;  2UZY A;  5GS0 A;  4OQT A;  4QXE A;  3REZ A;  4AY9 X;  3M18 A;  1OGQ A;  3OGK B;  2CA6 A;  3WPB A;  4CC4 C;  3O6N A;  4MN8 B;  3ZYJ A;  1IO0 A;  4FDW A;  2RA8 A;  3E3Z A;  3RGX A;  2Z7X A;  2P1N B;  2OMT A;  3ZYI A;  2BNH A;  2Y5Q A;  3ZYO A;  2JE1 A;  4R09 A;  3RW6 A;  4V2E A;  3OJA B;  3OJA A;  3RIZ A;  5IJC A;  1LTX A;  4CP6 A;  1D0B A;  4ECO A;  4R6F A;  3RJ0 A;  3UN9 A;  4R6A A;  3BZ5 A;  3P72 A;  4LSX A;  4P8S A;  1O6S A;  2ASS B;  1KOO A;  1P8T A;  4R07 A;  4FD0 A;  4U7L A;  4V2D A;  5IYX C;  3CIY A;  1O6V A;  1A9N A;  5AWD A;  2Z81 A;  3C6O B;  5AWA A;  3WN4 A;  5GMG A;  2FT3 A;  1JL5 A;  4Z64 C;  4Y61 B;  4IM6 A;  4U09 A;  1QYY A;  2A0Z A;  2Z62 A;  4C2B B;  2IFG A;  4FS7 A;  4Q62 A;  4FHO A;  4FCG A;  2ELL A;  2BEX A;  3G06 A;  1XEU A;  4V2C A;  2Q4G W;  1H6T A;  4LI2 A;  1U0N D;  2OMW A;  3KJ4 A;  4M7E C;  4Z61 C;  3E2J A;  1XKU A;  3CVR A;  3RGZ A;  4CC4 A;  3UL9 A;  1O6T A;  1OTN A;  3M19 A;  4TZH A;  2OMZ A;  1M9L A;  4PQ8 A;  1M10 B;  2Z65 A;  4MQW X;  5B0N A;  5IJB A; 
#chains in the Genus database with same CATH homology
 4HQ1 A;  2OMX A;  1KOH A;  3DZE A;  4AW4 A;  1OZN A;  4XOS A;  2O6S A;  3OGM B;  1K5G C;  3W3J A;  2P1Q B;  4BSR A;  3W3N A;  5IJD A;  3JB9 j;  3GOZ A;  4ARR A;  3RFJ A;  4KT1 A;  4R6G A;  4R58 A;  3WPH A;  3W3G A;  2JE0 A;  4J4L A;  5A5C A;  1Z7X W;  2WQW A;  3VQ1 A;  4Z79 A;  4PEQ B;  1W8A A;  1M0Z A;  5AWB A;  2O6Q A;  4PKI G;  4QBZ A;  3A79 B;  3E4G A;  4RWT C;  2OMY A;  4Z8G A;  2OMV A;  3WPF A;  1SQ0 B;  3RFS A;  3ULV A;  2WQU A;  5FTT B;  3W3K A;  2V9T B;  3WPI A;  5LFN A;  2JQD A;  3ZYN A;  2ID5 A;  2V9S A;  4BSS A;  3PMH G;  3G3A A;  4G8A A;  1G9U A;  1OOK G;  5CMP A;  4FMZ A;  1OTM A;  1XCD A;  4P91 A;  3OGL B;  1DCE A;  4LSC A;  3RFE A;  4L3F A;  5GQR K;  4M7E A;  1DFJ I;  5GMF A;  4R5D A;  1FO1 A;  1WWL A;  2RR6 A;  2Z64 A;  4YEB B;  2P1P B;  3C6N B;  1DS9 A;  5GS2 B;  2V70 A;  2Z63 A;  5CMN A;  4L3A A;  4LSA A;  1FT8 A;  4UFR A;  4PER A;  4XGO A;  4EZG A;  2WQV A;  2XOT A;  2WFH A;  1P8V A;  3ULA A;  4C2A B;  4RCW A;  4R6J A;  4ARN A;  4NKG A;  1M9S A;  2Z82 A;  3G39 A;  4BV4 R;  2R9U A;  1A4Y A;  3UL8 A;  4ECN A;  4BSU A;  4GT6 A;  2P1M B;  3ULU A;  4GLP A;  2AST B;  5B4P A;  3WPC A;  3UL7 A;  4XSQ A;  4KNG A;  2Z7X B;  2UZX A;  4R08 A;  2XWT C;  1ZIW A;  1OTO A;  3C6P B;  4CIL A;  4R0A A;  1XWD C;  4H09 A;  4WYK A;  5HDH A;  3WPE A;  4PSJ A;  4U08 A;  3RW7 A;  1GWB A;  3G3B A;  2OMU A;  3SB4 A;  4I6J B;  4K17 A;  3W3M A;  4J0M A;  4Z94 G;  4Q3I A;  3WPD A;  4CNM A;  4KXF B;  4NKH A;  4LXR A;  2O6R A;  1H6U A;  5HZL B;  4CNC A;  4LI1 A;  5B0T A;  3W3L A;  1PGV A;  3TSR E;  3WPG A;  4LSX C;  1XEC A;  3FXI A;  5AZ5 A;  3O53 A;  3E6J A;  5D3I A;  1K5D C;  4Q3G A;  4U06 A;  4LXS A;  1P9A G;  3VQ2 A;  3CIG A;  4B8C D;  2Z66 A;  5AWC A;  5GMH A;  4QC0 A;  4WP6 A;  2P1O B;  2WQX A;  1FQV A;  1FS2 A;  4R5C A;  4RCA B;  3G04 C;  1YRG A;  2UZY A;  5GS0 A;  4OQT A;  4QXE A;  3REZ A;  4AY9 X;  3M18 A;  1OGQ A;  3OGK B;  2CA6 A;  3WPB A;  4CC4 C;  3O6N A;  4MN8 B;  3ZYJ A;  1IO0 A;  4FDW A;  2RA8 A;  3E3Z A;  3RGX A;  2Z7X A;  2P1N B;  2OMT A;  3ZYI A;  2BNH A;  2Y5Q A;  3ZYO A;  2JE1 A;  4R09 A;  3RW6 A;  4V2E A;  3OJA B;  3OJA A;  3RIZ A;  5IJC A;  1LTX A;  4CP6 A;  1D0B A;  4ECO A;  4R6F A;  3RJ0 A;  3UN9 A;  4R6A A;  3BZ5 A;  3P72 A;  4LSX A;  4P8S A;  1O6S A;  2ASS B;  1KOO A;  1P8T A;  4R07 A;  4FD0 A;  4U7L A;  4V2D A;  5IYX C;  3CIY A;  1O6V A;  1A9N A;  5AWD A;  2Z81 A;  3C6O B;  5AWA A;  3WN4 A;  5GMG A;  2FT3 A;  1JL5 A;  4Z64 C;  4Y61 B;  4IM6 A;  4U09 A;  1QYY A;  2A0Z A;  2Z62 A;  4C2B B;  2IFG A;  4FS7 A;  4Q62 A;  4FHO A;  4FCG A;  2ELL A;  2BEX A;  3G06 A;  1XEU A;  4V2C A;  2Q4G W;  1H6T A;  4LI2 A;  1U0N D;  2OMW A;  3KJ4 A;  4M7E C;  4Z61 C;  3E2J A;  1XKU A;  3CVR A;  3RGZ A;  4CC4 A;  3UL9 A;  1O6T A;  1OTN A;  3M19 A;  4TZH A;  2OMZ A;  1M9L A;  4PQ8 A;  1M10 B;  2Z65 A;  4MQW X;  5B0N A;  5IJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...