4FMZA

Crystal structure of an internalin (inlf) from listeria monocytogenes str. 4b f2365 at 1.91 a resolution
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
340
structure length
340
Chain Sequence
TLATLPAPINQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNEDMEVIGGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an internalin (inlF) from Listeria monocytogenes str. 4b F2365 at 1.91 A resolution
rcsb
source organism Listeria monocytogenes serotype 4b
molecule tags Cell adhesion, cell invasion
molecule keywords Internalin
total genus 121
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fmzA00
3CVRA 2Q4GW 2Z82A 4RCAB 5LFNA 3ULAA 5A5CA 1P8TA 3JB9j 3CIGA 1DFJI 3KJ4A 3OGKB 3W3KA 3RW6A 1OTNA 1OZNA 4QBZA 1O6TA 4QC0A 1O6SA 4FS7A 2Z62A 3G3BA 4U06A 3VQ1A 3WPEA 4V2EA 4H09A 2OMTA 5GS0A 4LI2A 4LXSA 3TSRE 3G06A 1DCEA 1U0ND 3OGLB 5HZLB 2JQDA 1SQ0B 3RIZA 3UN9A 2P1OB 1P8VA 4CP6A 3G3AA 2P1QB 2UZXA 3OGMB 4P8SA 4V2CA 2ASTB 2ID5A 2Z66A 3A79B 2O6SA 4R6AA 4IM6A 4CC4C 5AWAA 4R09A 1A9NA 2A0ZA 5AWCA 3WPHA 4XOSA 3M19A 1XECA 3UL7A 4FMZA 4Q3IA 4TZHA 3WPFA 4LSCA 1WWLA 4BSRA 1P9AG 5B4PA 1XKUA 5IYXC 3C6PB 4RCWA 2O6QA 2WQVA 2WQUA 4HQ1A 1A4YA 5CMPA 3FXIA 4NKHA 3WPDA 2ASSB 2JE0A 3G04C 3P72A 3ZYJA 4CC4A 2XWTC 4KNGA 3WPIA 4LSXC 4CNCA 4BSUA 4R0AA 1LTXA 3ULUA 4FCGA 3C6OB 3ZYOA 4ECNA 4ARNA 1YRGA 1FT8A 2OMWA 1OGQA 2RA8A 4U09A 1M0ZA 4WP6A 5AWDA 3RFJA 1XEUA 5GMGA 3RFEA 4GT6A 4KT1A 1JL5A 5GMHA 1ZIWA 1GWBA 2P1PB 3OJAA 3WN4A 4C2AB 3BZ5A 3RGZA 3W3LA 2OMVA 5D3IA 4EZGA 4M7EA 3E4GA 2P1MB 4K17A 5B0NA 1FQVA 5B0TA 3WPCA 2Z65A 3E3ZA 3E6JA 4R6JA 3GOZA 4J4LA 4KXFB 4AW4A 3UL9A 3PMHG 4Q62A 1H6UA 4XGOA 2OMYA 4PQ8A 1OTOA 4FHOA 3ZYIA 3RGXA 3RW7A 3OJAB 4MN8B 4Z61C 4B8CD 1Z7XW 4I6JB 4R5DA 4ECOA 4L3AA 4R08A 1H6TA 2Y5QA 3RFSA 1DS9A 4XSQA 3W3MA 1K5GC 4R6GA 4J0MA 4PEQB 4Y61B 4U7LA 2Z64A 5IJBA 1XCDA 4GLPA 2V70A 4LSAA 4Z64C 4YEBB 4Z8GA 2O6RA 2Z7XB 3E2JA 3O53A 4LXRA 5HDHA 3VQ2A 1FO1A 2WQWA 4L3FA 1PGVA 4PERA 2FT3A 5AWBA 4PSJA 3UL8A 4ARRA 4QXEA 2P1NB 4R58A 3WPGA 3SB4A 2V9TB 1D0BA 4OQTA 2R9UA 5GS2B 5IJDA 3ZYNA 4LI1A 1QYYA 1O6VA 4G8AA 4WYKA 1G9UA 1K5DC 5AZ5A 2CA6A 2BNHA 2IFGA 2V9SA 3O6NA 3W3JA 4P91A 1OOKG 5IJCA 3DZEA 1IO0A 4V2DA 4M7EC 4MQWX 1M9SA 1OTMA 2ELLA 4R6FA 4RWTC 5FTTB 4CNMA 4FD0A 2Z63A 1FS2A 3C6NB 1XWDC 1KOOA 1KOHA 1W8AA 3W3NA 1M10B 3RJ0A 2JE1A 2BEXA 1M9LA 3WPBA 4BV4R 4Q3GA 2OMXA 2WFHA 5GMFA 4NKGA 2Z7XA 3W3GA 4U08A 2UZYA 2Z81A 4BSSA 2OMUA 4UFRA 3CIYA 2RR6A 4R07A 4LSXA 3ULVA 3M18A 4C2BB 2WQXA 4PKIG 5CMNA 4AY9X 4FDWA 3REZA 2XOTA 4Z79A 4Z94G 2OMZA 5GQRK 3G39A 4CILA 4R5CA
chains in the Genus database with same CATH superfamily
3CVRA 2Q4GW 2Z82A 4RCAB 5LFNA 3ULAA 5A5CA 1P8TA 3JB9j 3CIGA 1DFJI 3KJ4A 3OGKB 3W3KA 3RW6A 1OTNA 1OZNA 4QBZA 1O6TA 4QC0A 1O6SA 4FS7A 2Z62A 3G3BA 4U06A 3VQ1A 3WPEA 4V2EA 4H09A 2OMTA 5GS0A 4LI2A 4LXSA 3TSRE 3G06A 1DCEA 1U0ND 3OGLB 5HZLB 2JQDA 1SQ0B 3RIZA 3UN9A 2P1OB 1P8VA 4CP6A 3G3AA 2P1QB 2UZXA 3OGMB 4P8SA 4V2CA 2ASTB 2ID5A 2Z66A 3A79B 2O6SA 4R6AA 4IM6A 4CC4C 5AWAA 4R09A 1A9NA 2A0ZA 5AWCA 3WPHA 4XOSA 3M19A 1XECA 3UL7A 4FMZA 4Q3IA 4TZHA 3WPFA 4LSCA 1WWLA 4BSRA 1P9AG 5B4PA 1XKUA 5IYXC 3C6PB 4RCWA 2O6QA 2WQVA 2WQUA 4HQ1A 1A4YA 5CMPA 3FXIA 4NKHA 3WPDA 2ASSB 2JE0A 3G04C 3P72A 3ZYJA 4CC4A 2XWTC 4KNGA 3WPIA 4LSXC 4CNCA 4BSUA 4R0AA 1LTXA 3ULUA 4FCGA 3C6OB 3ZYOA 4ECNA 4ARNA 1YRGA 3RGZA 1FT8A 2OMWA 1OGQA 2RA8A 4U09A 1M0ZA 4WP6A 5AWDA 3RFJA 1XEUA 5GMGA 3RFEA 4GT6A 4KT1A 1JL5A 4NZTM 5GMHA 1GWBA 2P1PB 3OJAA 4NZRM 3WN4A 3BZ5A 4C2AB 1ZIWA 2OMVA 3W3LA 5D3IA 4EZGA 4M7EA 3E4GA 2P1MB 4K17A 5B0NA 1FQVA 5B0TA 3WPCA 2Z65A 3E3ZA 3E6JA 4R6JA 3GOZA 4J4LA 4KXFB 4AW4A 3UL9A 3PMHG 4Q62A 1H6UA 4XGOA 2OMYA 4PQ8A 1OTOA 4FHOA 3ZYIA 3RGXA 3RW7A 3OJAB 4MN8B 4Z61C 4B8CD 1Z7XW 4I6JB 4R5DA 4ECOA 4L3AA 4R08A 1H6TA 2Y5QA 3RFSA 1DS9A 4XSQA 3W3MA 1K5GC 4R6GA 4J0MA 4PEQB 4Y61B 4U7LA 2Z64A 5IJBA 1XCDA 4GLPA 2V70A 4LSAA 4Z64C 4YEBB 4Z8GA 2O6RA 2Z7XB 3E2JA 3O53A 4LXRA 5HDHA 3VQ2A 1FO1A 2WQWA 4L3FA 1PGVA 4PERA 2FT3A 5AWBA 4PSJA 3UL8A 4ARRA 4QXEA 2P1NB 4R58A 3WPGA 3SB4A 2V9TB 1D0BA 4OQTA 2R9UA 5GS2B 5IJDA 3ZYNA 4LI1A 1QYYA 1O6VA 4G8AA 4WYKA 1G9UA 1K5DC 5AZ5A 2CA6A 2BNHA 2IFGA 2V9SA 3O6NA 3W3JA 4P91A 1OOKG 5IJCA 3DZEA 1IO0A 4V2DA 4M7EC 4MQWX 1M9SA 1OTMA 2ELLA 4R6FA 4RWTC 5FTTB 4CNMA 4FD0A 2Z63A 1FS2A 3C6NB 1XWDC 1KOOA 1KOHA 1W8AA 3W3NA 1M10B 3RJ0A 2JE1A 2BEXA 1M9LA 3WPBA 4BV4R 4Q3GA 2OMXA 2WFHA 5GMFA 4NKGA 2Z7XA 3W3GA 4U08A 2UZYA 2Z81A 4BSSA 2OMUA 4UFRA 3CIYA 2RR6A 4R07A 4LSXA 3ULVA 3M18A 4C2BB 2WQXA 4PKIG 5CMNA 4AY9X 4FDWA 3REZA 2XOTA 4Z79A 4Z94G 2OMZA 5GQRK 3G39A 4CILA 4R5CA
chains in the Genus database with same CATH topology
3CVRA 2Q4GW 2Z82A 4RCAB 5LFNA 3ULAA 5A5CA 1P8TA 3JB9j 3CIGA 1DFJI 3KJ4A 3OGKB 3W3KA 3RW6A 1OTNA 1OZNA 4QBZA 1O6TA 4QC0A 1O6SA 4FS7A 2Z62A 3G3BA 4U06A 3VQ1A 3WPEA 4V2EA 4H09A 2OMTA 5GS0A 4LI2A 4LXSA 3TSRE 3G06A 1DCEA 1U0ND 3OGLB 5HZLB 2JQDA 1SQ0B 3RIZA 3UN9A 2P1OB 1P8VA 4CP6A 3G3AA 2P1QB 2UZXA 3OGMB 4P8SA 4V2CA 2ASTB 2ID5A 2Z66A 3A79B 2O6SA 4R6AA 4IM6A 4CC4C 5AWAA 4R09A 1A9NA 2A0ZA 5AWCA 3WPHA 4XOSA 3M19A 1XECA 3UL7A 4FMZA 4Q3IA 4TZHA 3WPFA 4LSCA 1WWLA 4BSRA 1P9AG 5B4PA 1XKUA 5IYXC 3C6PB 4RCWA 2O6QA 2WQVA 2WQUA 4HQ1A 1A4YA 5CMPA 3FXIA 4NKHA 3WPDA 2ASSB 2JE0A 3G04C 3P72A 3ZYJA 4CC4A 2XWTC 4KNGA 3WPIA 4LSXC 4CNCA 4BSUA 4R0AA 1LTXA 3ULUA 4FCGA 3C6OB 3ZYOA 4ECNA 4ARNA 1YRGA 1FT8A 2OMWA 1OGQA 2RA8A 4U09A 1M0ZA 4WP6A 5AWDA 3RFJA 1XEUA 5GMGA 3RFEA 4GT6A 4KT1A 1JL5A 5GMHA 1ZIWA 1GWBA 2P1PB 3OJAA 3WN4A 4C2AB 3BZ5A 3RGZA 3W3LA 2OMVA 5D3IA 4EZGA 4M7EA 3E4GA 2P1MB 4K17A 5B0NA 1FQVA 5B0TA 3WPCA 2Z65A 3E3ZA 3E6JA 4R6JA 3GOZA 4J4LA 4KXFB 4AW4A 3UL9A 3PMHG 4Q62A 1H6UA 4XGOA 2OMYA 4PQ8A 1OTOA 4FHOA 3ZYIA 3RGXA 3RW7A 3OJAB 4MN8B 4Z61C 4B8CD 1Z7XW 4I6JB 4R5DA 4ECOA 4L3AA 4R08A 1H6TA 2Y5QA 3RFSA 1DS9A 4XSQA 3W3MA 1K5GC 4R6GA 4J0MA 4PEQB 4Y61B 4U7LA 2Z64A 5IJBA 1XCDA 4GLPA 2V70A 4LSAA 4Z64C 4YEBB 4Z8GA 2O6RA 2Z7XB 3E2JA 3O53A 4LXRA 5HDHA 3VQ2A 1FO1A 2WQWA 4L3FA 1PGVA 4PERA 2FT3A 5AWBA 4PSJA 3UL8A 4ARRA 4QXEA 2P1NB 4R58A 3WPGA 3SB4A 2V9TB 1D0BA 4OQTA 2R9UA 5GS2B 5IJDA 3ZYNA 4LI1A 1QYYA 1O6VA 4G8AA 4WYKA 1G9UA 1K5DC 5AZ5A 2CA6A 2BNHA 2IFGA 2V9SA 3O6NA 3W3JA 4P91A 1OOKG 5IJCA 3DZEA 1IO0A 4V2DA 4M7EC 4MQWX 1M9SA 1OTMA 2ELLA 4R6FA 4RWTC 5FTTB 4CNMA 4FD0A 2Z63A 1FS2A 3C6NB 1XWDC 1KOOA 1KOHA 1W8AA 3W3NA 1M10B 3RJ0A 2JE1A 2BEXA 1M9LA 3WPBA 4BV4R 4Q3GA 2OMXA 2WFHA 5GMFA 4NKGA 2Z7XA 3W3GA 4U08A 2UZYA 2Z81A 4BSSA 2OMUA 4UFRA 3CIYA 2RR6A 4R07A 4LSXA 3ULVA 3M18A 4C2BB 2WQXA 4PKIG 5CMNA 4AY9X 4FDWA 3REZA 2XOTA 4Z79A 4Z94G 2OMZA 5GQRK 3G39A 4CILA 4R5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVR A;  2Q4G W;  2Z82 A;  4RCA B;  5LFN A;  3ULA A;  5A5C A;  1P8T A;  3JB9 j;  3CIG A;  1DFJ I;  3KJ4 A;  3OGK B;  3W3K A;  3RW6 A;  1OTN A;  1OZN A;  4QBZ A;  1O6T A;  4QC0 A;  1O6S A;  4FS7 A;  2Z62 A;  3G3B A;  4U06 A;  3VQ1 A;  3WPE A;  4V2E A;  4H09 A;  2OMT A;  5GS0 A;  4LI2 A;  4LXS A;  3TSR E;  3G06 A;  1DCE A;  1U0N D;  3OGL B;  5HZL B;  2JQD A;  1SQ0 B;  3RIZ A;  3UN9 A;  2P1O B;  1P8V A;  4CP6 A;  3G3A A;  2P1Q B;  2UZX A;  3OGM B;  4P8S A;  4V2C A;  2AST B;  2ID5 A;  2Z66 A;  3A79 B;  2O6S A;  4R6A A;  4IM6 A;  4CC4 C;  5AWA A;  4R09 A;  1A9N A;  2A0Z A;  5AWC A;  3WPH A;  4XOS A;  3M19 A;  1XEC A;  3UL7 A;  4FMZ A;  4Q3I A;  4TZH A;  3WPF A;  4LSC A;  1WWL A;  4BSR A;  1P9A G;  5B4P A;  1XKU A;  5IYX C;  3C6P B;  4RCW A;  2O6Q A;  2WQV A;  2WQU A;  4HQ1 A;  1A4Y A;  5CMP A;  3FXI A;  4NKH A;  3WPD A;  2ASS B;  2JE0 A;  3G04 C;  3P72 A;  3ZYJ A;  4CC4 A;  2XWT C;  4KNG A;  3WPI A;  4LSX C;  4CNC A;  4BSU A;  4R0A A;  1LTX A;  3ULU A;  4FCG A;  3C6O B;  3ZYO A;  4ECN A;  4ARN A;  1YRG A;  1FT8 A;  2OMW A;  1OGQ A;  2RA8 A;  4U09 A;  1M0Z A;  4WP6 A;  5AWD A;  3RFJ A;  1XEU A;  5GMG A;  3RFE A;  4GT6 A;  4KT1 A;  1JL5 A;  5GMH A;  1ZIW A;  1GWB A;  2P1P B;  3OJA A;  3WN4 A;  4C2A B;  3BZ5 A;  3RGZ A;  3W3L A;  2OMV A;  5D3I A;  4EZG A;  4M7E A;  3E4G A;  2P1M B;  4K17 A;  5B0N A;  1FQV A;  5B0T A;  3WPC A;  2Z65 A;  3E3Z A;  3E6J A;  4R6J A;  3GOZ A;  4J4L A;  4KXF B;  4AW4 A;  3UL9 A;  3PMH G;  4Q62 A;  1H6U A;  4XGO A;  2OMY A;  4PQ8 A;  1OTO A;  4FHO A;  3ZYI A;  3RGX A;  3RW7 A;  3OJA B;  4MN8 B;  4Z61 C;  4B8C D;  1Z7X W;  4I6J B;  4R5D A;  4ECO A;  4L3A A;  4R08 A;  1H6T A;  2Y5Q A;  3RFS A;  1DS9 A;  4XSQ A;  3W3M A;  1K5G C;  4R6G A;  4J0M A;  4PEQ B;  4Y61 B;  4U7L A;  2Z64 A;  5IJB A;  1XCD A;  4GLP A;  2V70 A;  4LSA A;  4Z64 C;  4YEB B;  4Z8G A;  2O6R A;  2Z7X B;  3E2J A;  3O53 A;  4LXR A;  5HDH A;  3VQ2 A;  1FO1 A;  2WQW A;  4L3F A;  1PGV A;  4PER A;  2FT3 A;  5AWB A;  4PSJ A;  3UL8 A;  4ARR A;  4QXE A;  2P1N B;  4R58 A;  3WPG A;  3SB4 A;  2V9T B;  1D0B A;  4OQT A;  2R9U A;  5GS2 B;  5IJD A;  3ZYN A;  4LI1 A;  1QYY A;  1O6V A;  4G8A A;  4WYK A;  1G9U A;  1K5D C;  5AZ5 A;  2CA6 A;  2BNH A;  2IFG A;  2V9S A;  3O6N A;  3W3J A;  4P91 A;  1OOK G;  5IJC A;  3DZE A;  1IO0 A;  4V2D A;  4M7E C;  4MQW X;  1M9S A;  1OTM A;  2ELL A;  4R6F A;  4RWT C;  5FTT B;  4CNM A;  4FD0 A;  2Z63 A;  1FS2 A;  3C6N B;  1XWD C;  1KOO A;  1KOH A;  1W8A A;  3W3N A;  1M10 B;  3RJ0 A;  2JE1 A;  2BEX A;  1M9L A;  3WPB A;  4BV4 R;  4Q3G A;  2OMX A;  2WFH A;  5GMF A;  4NKG A;  2Z7X A;  3W3G A;  4U08 A;  2UZY A;  2Z81 A;  4BSS A;  2OMU A;  4UFR A;  3CIY A;  2RR6 A;  4R07 A;  4LSX A;  3ULV A;  3M18 A;  4C2B B;  2WQX A;  4PKI G;  5CMN A;  4AY9 X;  4FDW A;  3REZ A;  2XOT A;  4Z79 A;  4Z94 G;  2OMZ A;  5GQR K;  3G39 A;  4CIL A;  4R5C A; 
#chains in the Genus database with same CATH topology
 3CVR A;  2Q4G W;  2Z82 A;  4RCA B;  5LFN A;  3ULA A;  5A5C A;  1P8T A;  3JB9 j;  3CIG A;  1DFJ I;  3KJ4 A;  3OGK B;  3W3K A;  3RW6 A;  1OTN A;  1OZN A;  4QBZ A;  1O6T A;  4QC0 A;  1O6S A;  4FS7 A;  2Z62 A;  3G3B A;  4U06 A;  3VQ1 A;  3WPE A;  4V2E A;  4H09 A;  2OMT A;  5GS0 A;  4LI2 A;  4LXS A;  3TSR E;  3G06 A;  1DCE A;  1U0N D;  3OGL B;  5HZL B;  2JQD A;  1SQ0 B;  3RIZ A;  3UN9 A;  2P1O B;  1P8V A;  4CP6 A;  3G3A A;  2P1Q B;  2UZX A;  3OGM B;  4P8S A;  4V2C A;  2AST B;  2ID5 A;  2Z66 A;  3A79 B;  2O6S A;  4R6A A;  4IM6 A;  4CC4 C;  5AWA A;  4R09 A;  1A9N A;  2A0Z A;  5AWC A;  3WPH A;  4XOS A;  3M19 A;  1XEC A;  3UL7 A;  4FMZ A;  4Q3I A;  4TZH A;  3WPF A;  4LSC A;  1WWL A;  4BSR A;  1P9A G;  5B4P A;  1XKU A;  5IYX C;  3C6P B;  4RCW A;  2O6Q A;  2WQV A;  2WQU A;  4HQ1 A;  1A4Y A;  5CMP A;  3FXI A;  4NKH A;  3WPD A;  2ASS B;  2JE0 A;  3G04 C;  3P72 A;  3ZYJ A;  4CC4 A;  2XWT C;  4KNG A;  3WPI A;  4LSX C;  4CNC A;  4BSU A;  4R0A A;  1LTX A;  3ULU A;  4FCG A;  3C6O B;  3ZYO A;  4ECN A;  4ARN A;  1YRG A;  3RGZ A;  1FT8 A;  2OMW A;  1OGQ A;  2RA8 A;  4U09 A;  1M0Z A;  4WP6 A;  5AWD A;  3RFJ A;  1XEU A;  5GMG A;  3RFE A;  4GT6 A;  4KT1 A;  1JL5 A;  4NZT M;  5GMH A;  1GWB A;  2P1P B;  3OJA A;  4NZR M;  3WN4 A;  3BZ5 A;  4C2A B;  1ZIW A;  2OMV A;  3W3L A;  5D3I A;  4EZG A;  4M7E A;  3E4G A;  2P1M B;  4K17 A;  5B0N A;  1FQV A;  5B0T A;  3WPC A;  2Z65 A;  3E3Z A;  3E6J A;  4R6J A;  3GOZ A;  4J4L A;  4KXF B;  4AW4 A;  3UL9 A;  3PMH G;  4Q62 A;  1H6U A;  4XGO A;  2OMY A;  4PQ8 A;  1OTO A;  4FHO A;  3ZYI A;  3RGX A;  3RW7 A;  3OJA B;  4MN8 B;  4Z61 C;  4B8C D;  1Z7X W;  4I6J B;  4R5D A;  4ECO A;  4L3A A;  4R08 A;  1H6T A;  2Y5Q A;  3RFS A;  1DS9 A;  4XSQ A;  3W3M A;  1K5G C;  4R6G A;  4J0M A;  4PEQ B;  4Y61 B;  4U7L A;  2Z64 A;  5IJB A;  1XCD A;  4GLP A;  2V70 A;  4LSA A;  4Z64 C;  4YEB B;  4Z8G A;  2O6R A;  2Z7X B;  3E2J A;  3O53 A;  4LXR A;  5HDH A;  3VQ2 A;  1FO1 A;  2WQW A;  4L3F A;  1PGV A;  4PER A;  2FT3 A;  5AWB A;  4PSJ A;  3UL8 A;  4ARR A;  4QXE A;  2P1N B;  4R58 A;  3WPG A;  3SB4 A;  2V9T B;  1D0B A;  4OQT A;  2R9U A;  5GS2 B;  5IJD A;  3ZYN A;  4LI1 A;  1QYY A;  1O6V A;  4G8A A;  4WYK A;  1G9U A;  1K5D C;  5AZ5 A;  2CA6 A;  2BNH A;  2IFG A;  2V9S A;  3O6N A;  3W3J A;  4P91 A;  1OOK G;  5IJC A;  3DZE A;  1IO0 A;  4V2D A;  4M7E C;  4MQW X;  1M9S A;  1OTM A;  2ELL A;  4R6F A;  4RWT C;  5FTT B;  4CNM A;  4FD0 A;  2Z63 A;  1FS2 A;  3C6N B;  1XWD C;  1KOO A;  1KOH A;  1W8A A;  3W3N A;  1M10 B;  3RJ0 A;  2JE1 A;  2BEX A;  1M9L A;  3WPB A;  4BV4 R;  4Q3G A;  2OMX A;  2WFH A;  5GMF A;  4NKG A;  2Z7X A;  3W3G A;  4U08 A;  2UZY A;  2Z81 A;  4BSS A;  2OMU A;  4UFR A;  3CIY A;  2RR6 A;  4R07 A;  4LSX A;  3ULV A;  3M18 A;  4C2B B;  2WQX A;  4PKI G;  5CMN A;  4AY9 X;  4FDW A;  3REZ A;  2XOT A;  4Z79 A;  4Z94 G;  2OMZ A;  5GQR K;  3G39 A;  4CIL A;  4R5C A; 
#chains in the Genus database with same CATH homology
 3CVR A;  2Q4G W;  2Z82 A;  4RCA B;  5LFN A;  3ULA A;  5A5C A;  1P8T A;  3JB9 j;  3CIG A;  1DFJ I;  3KJ4 A;  3OGK B;  3W3K A;  3RW6 A;  1OTN A;  1OZN A;  4QBZ A;  1O6T A;  4QC0 A;  1O6S A;  4FS7 A;  2Z62 A;  3G3B A;  4U06 A;  3VQ1 A;  3WPE A;  4V2E A;  4H09 A;  2OMT A;  5GS0 A;  4LI2 A;  4LXS A;  3TSR E;  3G06 A;  1DCE A;  1U0N D;  3OGL B;  5HZL B;  2JQD A;  1SQ0 B;  3RIZ A;  3UN9 A;  2P1O B;  1P8V A;  4CP6 A;  3G3A A;  2P1Q B;  2UZX A;  3OGM B;  4P8S A;  4V2C A;  2AST B;  2ID5 A;  2Z66 A;  3A79 B;  2O6S A;  4R6A A;  4IM6 A;  4CC4 C;  5AWA A;  4R09 A;  1A9N A;  2A0Z A;  5AWC A;  3WPH A;  4XOS A;  3M19 A;  1XEC A;  3UL7 A;  4FMZ A;  4Q3I A;  4TZH A;  3WPF A;  4LSC A;  1WWL A;  4BSR A;  1P9A G;  5B4P A;  1XKU A;  5IYX C;  3C6P B;  4RCW A;  2O6Q A;  2WQV A;  2WQU A;  4HQ1 A;  1A4Y A;  5CMP A;  3FXI A;  4NKH A;  3WPD A;  2ASS B;  2JE0 A;  3G04 C;  3P72 A;  3ZYJ A;  4CC4 A;  2XWT C;  4KNG A;  3WPI A;  4LSX C;  4CNC A;  4BSU A;  4R0A A;  1LTX A;  3ULU A;  4FCG A;  3C6O B;  3ZYO A;  4ECN A;  4ARN A;  1YRG A;  1FT8 A;  2OMW A;  1OGQ A;  2RA8 A;  4U09 A;  1M0Z A;  4WP6 A;  5AWD A;  3RFJ A;  1XEU A;  5GMG A;  3RFE A;  4GT6 A;  4KT1 A;  1JL5 A;  5GMH A;  1ZIW A;  1GWB A;  2P1P B;  3OJA A;  3WN4 A;  4C2A B;  3BZ5 A;  3RGZ A;  3W3L A;  2OMV A;  5D3I A;  4EZG A;  4M7E A;  3E4G A;  2P1M B;  4K17 A;  5B0N A;  1FQV A;  5B0T A;  3WPC A;  2Z65 A;  3E3Z A;  3E6J A;  4R6J A;  3GOZ A;  4J4L A;  4KXF B;  4AW4 A;  3UL9 A;  3PMH G;  4Q62 A;  1H6U A;  4XGO A;  2OMY A;  4PQ8 A;  1OTO A;  4FHO A;  3ZYI A;  3RGX A;  3RW7 A;  3OJA B;  4MN8 B;  4Z61 C;  4B8C D;  1Z7X W;  4I6J B;  4R5D A;  4ECO A;  4L3A A;  4R08 A;  1H6T A;  2Y5Q A;  3RFS A;  1DS9 A;  4XSQ A;  3W3M A;  1K5G C;  4R6G A;  4J0M A;  4PEQ B;  4Y61 B;  4U7L A;  2Z64 A;  5IJB A;  1XCD A;  4GLP A;  2V70 A;  4LSA A;  4Z64 C;  4YEB B;  4Z8G A;  2O6R A;  2Z7X B;  3E2J A;  3O53 A;  4LXR A;  5HDH A;  3VQ2 A;  1FO1 A;  2WQW A;  4L3F A;  1PGV A;  4PER A;  2FT3 A;  5AWB A;  4PSJ A;  3UL8 A;  4ARR A;  4QXE A;  2P1N B;  4R58 A;  3WPG A;  3SB4 A;  2V9T B;  1D0B A;  4OQT A;  2R9U A;  5GS2 B;  5IJD A;  3ZYN A;  4LI1 A;  1QYY A;  1O6V A;  4G8A A;  4WYK A;  1G9U A;  1K5D C;  5AZ5 A;  2CA6 A;  2BNH A;  2IFG A;  2V9S A;  3O6N A;  3W3J A;  4P91 A;  1OOK G;  5IJC A;  3DZE A;  1IO0 A;  4V2D A;  4M7E C;  4MQW X;  1M9S A;  1OTM A;  2ELL A;  4R6F A;  4RWT C;  5FTT B;  4CNM A;  4FD0 A;  2Z63 A;  1FS2 A;  3C6N B;  1XWD C;  1KOO A;  1KOH A;  1W8A A;  3W3N A;  1M10 B;  3RJ0 A;  2JE1 A;  2BEX A;  1M9L A;  3WPB A;  4BV4 R;  4Q3G A;  2OMX A;  2WFH A;  5GMF A;  4NKG A;  2Z7X A;  3W3G A;  4U08 A;  2UZY A;  2Z81 A;  4BSS A;  2OMU A;  4UFR A;  3CIY A;  2RR6 A;  4R07 A;  4LSX A;  3ULV A;  3M18 A;  4C2B B;  2WQX A;  4PKI G;  5CMN A;  4AY9 X;  4FDW A;  3REZ A;  2XOT A;  4Z79 A;  4Z94 G;  2OMZ A;  5GQR K;  3G39 A;  4CIL A;  4R5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...