4FMZA

Crystal structure of an internalin (inlf) from listeria monocytogenes str. 4b f2365 at 1.91 a resolution
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
340
structure length
340
Chain Sequence
TLATLPAPINQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNEDMEVIGGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin
publication title Crystal structure of an internalin (inlF) from Listeria monocytogenes str. 4b F2365 at 1.91 A resolution
rcsb
source organism Listeria monocytogenes serotype 4b
molecule tags Cell adhesion, cell invasion
total genus 121
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fmzA00
4QC0A 1H6UA 4XGOA 3KJ4A 3RW6A 4ARRA 3OGMB 5HZLB 1FQVA 2V70A 3BZ5A 1O6TA 1M0ZA 4H09A 4K17A 4GLPA 1QYYA 3W3NA 3E3ZA 2Z82A 4NKHA 4Z79A 4U08A 5CMPA 3OGLB 3WPHA 2CA6A 4R07A 1OGQA 2Z62A 4BSRA 2V9TB 3OJAA 4PEQB 2XWTC 2Z63A 2JE0A 1D0BA 2Z7XB 4CC4A 1XECA 1JL5A 3CIGA 4OQTA 2Z66A 4CP6A 4V2EA 4BSSA 3VQ2A 5GS0A 3VQ1A 3WN4A 1P8VA 1WWLA 3G04C 1OTOA 3G3BA 5GMHA 1XCDA 3WPBA 3ULVA 4ECNA 4RCAB 4QBZA 4P8SA 4Z8GA 1A9NA 4KT1A 3SB4A 1H6TA 2O6SA 2UZXA 3FXIA 4IM6A 2Z65A 3O53A 4MQWX 4LSAA 3M19A 3RIZA 4LSXA 4YEBB 3UN9A 1YRGA 4CC4C 4GT6A 2XOTA 1LTXA 2ID5A 1PGVA 3RJ0A 4WP6A 4FMZA 4J4LA 4CNCA 4V2CA 3E4GA 2OMWA 4Q62A 5GMFA 4PERA 4CILA 5A5CA 5IJBA 4TZHA 4BV4R 3WPCA 1KOOA 4C2AB 3WPIA 4Z64C 4I6JB 3CVRA 1FO1A 2OMXA 4WYKA 5D3IA 3ZYJA 2OMUA 5GS2B 2WQUA 2Y5QA 4EZGA 3G06A 4J0MA 3RFSA 2A0ZA 1DCEA 2IFGA 2JQDA 1U0ND 1M9LA 4RCWA 1O6SA 4LI2A 4M7EA 2RA8A 1IO0A 4LSXC 3WPGA 4QXEA 3C6PB 3ZYOA 1G9UA 4P91A 4R5DA 4R5CA 1GWBA 2WQWA 1OTMA 2ELLA 4PKIG 3WPFA 4R6AA 1A4YA 5HDHA 3W3JA 3G39A 5IYXC 5AWAA 2Z64A 4NKGA 4ECOA 1M9SA 2O6QA 5LFNA 2R9UA 4MN8B 1KOHA 3W3LA 2BEXA 4Z94G 3ZYNA 4ARNA 4R6JA 1P8TA 4U06A 3UL9A 4AW4A 4M7EC 5AWBA 5AZ5A 5AWCA 2OMTA 4LI1A 3RGXA 3WPDA 4FDWA 4Y61B 1XWDC 2P1OB 3DZEA 5IJDA 5B4PA 4FCGA 2OMYA 4Q3GA 2O6RA 1M10B 3O6NA 4R08A 5CMNA 3W3KA 3JB9j 4RWTC 1XKUA 4V2DA 1Z7XW 2P1NB 5GMGA 4BSUA 1W8AA 2BNHA 4LXSA 4B8CD 3ULAA 2UZYA 4KNGA 3M18A 1SQ0B 4CNMA 3C6OB 4Z61C 3W3GA 4PSJA 4XSQA 3E6JA 3RFEA 2ASSB 3UL8A 3PMHG 2Z7XA 2FT3A 3OJAB 2Z81A 1OZNA 2P1MB 3A79B 3W3MA 5B0TA 4U09A 2OMVA 5AWDA 4XOSA 2ASTB 3RW7A 4KXFB 3C6NB 4R0AA 1FT8A 4R58A 4LXRA 3G3AA 3P72A 1DFJI 2Q4GW 2RR6A 3RGZA 5B0NA 1K5DC 4HQ1A 1K5GC 3TSRE 4L3FA 1DS9A 4AY9X 3ULUA 4FD0A 5IJCA 1FS2A 4L3AA 2P1QB 5FTTB 1P9AG 3GOZA 3CIYA 1ZIWA 3WPEA 3E2JA 4R6FA 3ZYIA 2V9SA 2WFHA 3REZA 4R6GA 3RFJA 4UFRA 4FHOA 2WQXA 4LSCA 2WQVA 3OGKB 1OOKG 4G8AA 4U7LA 3UL7A 1O6VA 1OTNA 1XEUA 2P1PB 4PQ8A 2OMZA 5GQRK 4FS7A 2JE1A 4Q3IA 4C2BB 4R09A
chains in the Genus database with same CATH superfamily
4QC0A 1H6UA 4XGOA 3KJ4A 3RW6A 4ARRA 3OGMB 5HZLB 1FQVA 2V70A 3BZ5A 1O6TA 1M0ZA 4H09A 4K17A 4GLPA 1QYYA 3W3NA 3E3ZA 2Z82A 4NKHA 4Z79A 4U08A 5CMPA 3OGLB 3WPHA 2CA6A 4R07A 1OGQA 2Z62A 4BSRA 2V9TB 3OJAA 4PEQB 2XWTC 2Z63A 2JE0A 1D0BA 2Z7XB 4CC4A 1XECA 1JL5A 3CIGA 4OQTA 2Z66A 4CP6A 4V2EA 4BSSA 3VQ2A 5GS0A 3VQ1A 3WN4A 1P8VA 1WWLA 3G04C 1OTOA 3G3BA 5GMHA 1XCDA 3WPBA 3ULVA 4ECNA 4RCAB 4QBZA 4P8SA 4Z8GA 1A9NA 4KT1A 3SB4A 1H6TA 2O6SA 2UZXA 3FXIA 4IM6A 2Z65A 3O53A 4MQWX 4LSAA 3M19A 3RIZA 4LSXA 4YEBB 3UN9A 1YRGA 4CC4C 4GT6A 2XOTA 1LTXA 2ID5A 1PGVA 3RJ0A 4WP6A 4FMZA 4J4LA 4CNCA 4V2CA 3E4GA 2OMWA 4Q62A 5GMFA 4PERA 4CILA 5A5CA 5IJBA 4TZHA 4NZTM 4BV4R 3WPCA 1KOOA 4C2AB 3WPIA 4Z64C 4I6JB 3CVRA 1FO1A 2OMXA 4WYKA 5D3IA 3ZYJA 2OMUA 5GS2B 2WQUA 2Y5QA 4EZGA 3G06A 4J0MA 3RFSA 2A0ZA 1DCEA 2IFGA 2JQDA 1U0ND 1M9LA 4RCWA 1O6SA 4LI2A 4M7EA 2RA8A 1IO0A 4LSXC 3WPGA 4QXEA 3C6PB 3ZYOA 1G9UA 4P91A 4R5DA 4R5CA 1GWBA 2WQWA 1OTMA 2ELLA 4PKIG 3WPFA 4R6AA 1A4YA 5HDHA 3W3JA 3G39A 5IYXC 5AWAA 2Z64A 4NKGA 4ECOA 1M9SA 2O6QA 5LFNA 2R9UA 4MN8B 1KOHA 3W3LA 2BEXA 4Z94G 3ZYNA 4ARNA 4R6JA 1P8TA 4U06A 3UL9A 4AW4A 4M7EC 5AWBA 5AZ5A 5AWCA 2OMTA 4LI1A 3RGXA 3WPDA 4FDWA 4Y61B 1XWDC 2P1OB 3DZEA 5IJDA 5B4PA 4FCGA 2OMYA 4Q3GA 2O6RA 1M10B 3O6NA 4R08A 5CMNA 3W3KA 3JB9j 4RWTC 1XKUA 4V2DA 1Z7XW 2P1NB 4NZRM 5GMGA 4BSUA 1W8AA 2BNHA 4LXSA 4B8CD 3ULAA 2UZYA 4KNGA 3M18A 1SQ0B 4CNMA 3C6OB 4Z61C 3W3GA 4PSJA 4XSQA 3E6JA 3RFEA 2ASSB 3UL8A 3PMHG 2Z7XA 2FT3A 3OJAB 2Z81A 1OZNA 2P1MB 3A79B 3W3MA 5B0TA 4U09A 2OMVA 5AWDA 4XOSA 2ASTB 3RW7A 4KXFB 3C6NB 4R0AA 1FT8A 4R58A 4LXRA 3G3AA 3P72A 1DFJI 2Q4GW 2RR6A 3RGZA 5B0NA 1K5DC 4HQ1A 1K5GC 3TSRE 4L3FA 1DS9A 4AY9X 3ULUA 4FD0A 5IJCA 1FS2A 4L3AA 2P1QB 5FTTB 1P9AG 3GOZA 3CIYA 1ZIWA 3WPEA 3E2JA 4R6FA 3ZYIA 2V9SA 2WFHA 3REZA 4R6GA 3RFJA 4UFRA 4FHOA 2WQXA 4LSCA 2WQVA 3OGKB 1OOKG 4G8AA 4U7LA 3UL7A 1O6VA 1OTNA 1XEUA 2P1PB 4PQ8A 2OMZA 5GQRK 4FS7A 2JE1A 4Q3IA 4C2BB 4R09A
chains in the Genus database with same CATH topology
4QC0A 1H6UA 4XGOA 3KJ4A 3RW6A 4ARRA 3OGMB 5HZLB 1FQVA 2V70A 3BZ5A 1O6TA 1M0ZA 4H09A 4K17A 4GLPA 1QYYA 3W3NA 3E3ZA 2Z82A 4NKHA 4Z79A 4U08A 5CMPA 3OGLB 3WPHA 2CA6A 4R07A 1OGQA 2Z62A 4BSRA 2V9TB 3OJAA 4PEQB 2XWTC 2Z63A 2JE0A 1D0BA 2Z7XB 4CC4A 1XECA 1JL5A 3CIGA 4OQTA 2Z66A 4CP6A 4V2EA 4BSSA 3VQ2A 5GS0A 3VQ1A 3WN4A 1P8VA 1WWLA 3G04C 1OTOA 3G3BA 5GMHA 1XCDA 3WPBA 3ULVA 4ECNA 4RCAB 4QBZA 4P8SA 4Z8GA 1A9NA 4KT1A 3SB4A 1H6TA 2O6SA 2UZXA 3FXIA 4IM6A 2Z65A 3O53A 4MQWX 4LSAA 3M19A 3RIZA 4LSXA 4YEBB 3UN9A 1YRGA 4CC4C 4GT6A 2XOTA 1LTXA 2ID5A 1PGVA 3RJ0A 4WP6A 4FMZA 4J4LA 4CNCA 4V2CA 3E4GA 2OMWA 4Q62A 5GMFA 4PERA 4CILA 5A5CA 5IJBA 4TZHA 4BV4R 3WPCA 1KOOA 4C2AB 3WPIA 4Z64C 4I6JB 3CVRA 1FO1A 2OMXA 4WYKA 5D3IA 3ZYJA 2OMUA 5GS2B 2WQUA 2Y5QA 4EZGA 3G06A 4J0MA 3RFSA 2A0ZA 1DCEA 2IFGA 2JQDA 1U0ND 1M9LA 4RCWA 1O6SA 4LI2A 4M7EA 2RA8A 1IO0A 4LSXC 3WPGA 4QXEA 3C6PB 3ZYOA 1G9UA 4P91A 4R5DA 4R5CA 1GWBA 2WQWA 1OTMA 2ELLA 4PKIG 3WPFA 4R6AA 1A4YA 5HDHA 3W3JA 3G39A 5IYXC 5AWAA 2Z64A 4NKGA 4ECOA 1M9SA 2O6QA 5LFNA 2R9UA 4MN8B 1KOHA 3W3LA 2BEXA 4Z94G 3ZYNA 4ARNA 4R6JA 1P8TA 4U06A 3UL9A 4AW4A 4M7EC 5AWBA 5AZ5A 5AWCA 2OMTA 4LI1A 3RGXA 3WPDA 4FDWA 4Y61B 1XWDC 2P1OB 3DZEA 5IJDA 5B4PA 4FCGA 2OMYA 4Q3GA 2O6RA 1M10B 3O6NA 4R08A 5CMNA 3W3KA 3JB9j 4RWTC 1XKUA 4V2DA 1Z7XW 2P1NB 5GMGA 4BSUA 1W8AA 2BNHA 4LXSA 4B8CD 3ULAA 2UZYA 4KNGA 3M18A 1SQ0B 4CNMA 3C6OB 4Z61C 3W3GA 4PSJA 4XSQA 3E6JA 3RFEA 2ASSB 3UL8A 3PMHG 2Z7XA 2FT3A 3OJAB 2Z81A 1OZNA 2P1MB 3A79B 3W3MA 5B0TA 4U09A 2OMVA 5AWDA 4XOSA 2ASTB 3RW7A 4KXFB 3C6NB 4R0AA 1FT8A 4R58A 4LXRA 3G3AA 3P72A 1DFJI 2Q4GW 2RR6A 3RGZA 5B0NA 1K5DC 4HQ1A 1K5GC 3TSRE 4L3FA 1DS9A 4AY9X 3ULUA 4FD0A 5IJCA 1FS2A 4L3AA 2P1QB 5FTTB 1P9AG 3GOZA 3CIYA 1ZIWA 3WPEA 3E2JA 4R6FA 3ZYIA 2V9SA 2WFHA 3REZA 4R6GA 3RFJA 4UFRA 4FHOA 2WQXA 4LSCA 2WQVA 3OGKB 1OOKG 4G8AA 4U7LA 3UL7A 1O6VA 1OTNA 1XEUA 2P1PB 4PQ8A 2OMZA 5GQRK 4FS7A 2JE1A 4Q3IA 4C2BB 4R09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QC0 A;  1H6U A;  4XGO A;  3KJ4 A;  3RW6 A;  4ARR A;  3OGM B;  5HZL B;  1FQV A;  2V70 A;  3BZ5 A;  1O6T A;  1M0Z A;  4H09 A;  4K17 A;  4GLP A;  1QYY A;  3W3N A;  3E3Z A;  2Z82 A;  4NKH A;  4Z79 A;  4U08 A;  5CMP A;  3OGL B;  3WPH A;  2CA6 A;  4R07 A;  1OGQ A;  2Z62 A;  4BSR A;  2V9T B;  3OJA A;  4PEQ B;  2XWT C;  2Z63 A;  2JE0 A;  1D0B A;  2Z7X B;  4CC4 A;  1XEC A;  1JL5 A;  3CIG A;  4OQT A;  2Z66 A;  4CP6 A;  4V2E A;  4BSS A;  3VQ2 A;  5GS0 A;  3VQ1 A;  3WN4 A;  1P8V A;  1WWL A;  3G04 C;  1OTO A;  3G3B A;  5GMH A;  1XCD A;  3WPB A;  3ULV A;  4ECN A;  4RCA B;  4QBZ A;  4P8S A;  4Z8G A;  1A9N A;  4KT1 A;  3SB4 A;  1H6T A;  2O6S A;  2UZX A;  3FXI A;  4IM6 A;  2Z65 A;  3O53 A;  4MQW X;  4LSA A;  3M19 A;  3RIZ A;  4LSX A;  4YEB B;  3UN9 A;  1YRG A;  4CC4 C;  4GT6 A;  2XOT A;  1LTX A;  2ID5 A;  1PGV A;  3RJ0 A;  4WP6 A;  4FMZ A;  4J4L A;  4CNC A;  4V2C A;  3E4G A;  2OMW A;  4Q62 A;  5GMF A;  4PER A;  4CIL A;  5A5C A;  5IJB A;  4TZH A;  4BV4 R;  3WPC A;  1KOO A;  4C2A B;  3WPI A;  4Z64 C;  4I6J B;  3CVR A;  1FO1 A;  2OMX A;  4WYK A;  5D3I A;  3ZYJ A;  2OMU A;  5GS2 B;  2WQU A;  2Y5Q A;  4EZG A;  3G06 A;  4J0M A;  3RFS A;  2A0Z A;  1DCE A;  2IFG A;  2JQD A;  1U0N D;  1M9L A;  4RCW A;  1O6S A;  4LI2 A;  4M7E A;  2RA8 A;  1IO0 A;  4LSX C;  3WPG A;  4QXE A;  3C6P B;  3ZYO A;  1G9U A;  4P91 A;  4R5D A;  4R5C A;  1GWB A;  2WQW A;  1OTM A;  2ELL A;  4PKI G;  3WPF A;  4R6A A;  1A4Y A;  5HDH A;  3W3J A;  3G39 A;  5IYX C;  5AWA A;  2Z64 A;  4NKG A;  4ECO A;  1M9S A;  2O6Q A;  5LFN A;  2R9U A;  4MN8 B;  1KOH A;  3W3L A;  2BEX A;  4Z94 G;  3ZYN A;  4ARN A;  4R6J A;  1P8T A;  4U06 A;  3UL9 A;  4AW4 A;  4M7E C;  5AWB A;  5AZ5 A;  5AWC A;  2OMT A;  4LI1 A;  3RGX A;  3WPD A;  4FDW A;  4Y61 B;  1XWD C;  2P1O B;  3DZE A;  5IJD A;  5B4P A;  4FCG A;  2OMY A;  4Q3G A;  2O6R A;  1M10 B;  3O6N A;  4R08 A;  5CMN A;  3W3K A;  3JB9 j;  4RWT C;  1XKU A;  4V2D A;  1Z7X W;  2P1N B;  5GMG A;  4BSU A;  1W8A A;  2BNH A;  4LXS A;  4B8C D;  3ULA A;  2UZY A;  4KNG A;  3M18 A;  1SQ0 B;  4CNM A;  3C6O B;  4Z61 C;  3W3G A;  4PSJ A;  4XSQ A;  3E6J A;  3RFE A;  2ASS B;  3UL8 A;  3PMH G;  2Z7X A;  2FT3 A;  3OJA B;  2Z81 A;  1OZN A;  2P1M B;  3A79 B;  3W3M A;  5B0T A;  4U09 A;  2OMV A;  5AWD A;  4XOS A;  2AST B;  3RW7 A;  4KXF B;  3C6N B;  4R0A A;  1FT8 A;  4R58 A;  4LXR A;  3G3A A;  3P72 A;  1DFJ I;  2Q4G W;  2RR6 A;  3RGZ A;  5B0N A;  1K5D C;  4HQ1 A;  1K5G C;  3TSR E;  4L3F A;  1DS9 A;  4AY9 X;  3ULU A;  4FD0 A;  5IJC A;  1FS2 A;  4L3A A;  2P1Q B;  5FTT B;  1P9A G;  3GOZ A;  3CIY A;  1ZIW A;  3WPE A;  3E2J A;  4R6F A;  3ZYI A;  2V9S A;  2WFH A;  3REZ A;  4R6G A;  3RFJ A;  4UFR A;  4FHO A;  2WQX A;  4LSC A;  2WQV A;  3OGK B;  1OOK G;  4G8A A;  4U7L A;  3UL7 A;  1O6V A;  1OTN A;  1XEU A;  2P1P B;  4PQ8 A;  2OMZ A;  5GQR K;  4FS7 A;  2JE1 A;  4Q3I A;  4C2B B;  4R09 A; 
#chains in the Genus database with same CATH topology
 4QC0 A;  1H6U A;  4XGO A;  3KJ4 A;  3RW6 A;  4ARR A;  3OGM B;  5HZL B;  1FQV A;  2V70 A;  3BZ5 A;  1O6T A;  1M0Z A;  4H09 A;  4K17 A;  4GLP A;  1QYY A;  3W3N A;  3E3Z A;  2Z82 A;  4NKH A;  4Z79 A;  4U08 A;  5CMP A;  3OGL B;  3WPH A;  2CA6 A;  4R07 A;  1OGQ A;  2Z62 A;  4BSR A;  2V9T B;  3OJA A;  4PEQ B;  2XWT C;  2Z63 A;  2JE0 A;  1D0B A;  2Z7X B;  4CC4 A;  1XEC A;  1JL5 A;  3CIG A;  4OQT A;  2Z66 A;  4CP6 A;  4V2E A;  4BSS A;  3VQ2 A;  5GS0 A;  3VQ1 A;  3WN4 A;  1P8V A;  1WWL A;  3G04 C;  1OTO A;  3G3B A;  5GMH A;  1XCD A;  3WPB A;  3ULV A;  4ECN A;  4RCA B;  4QBZ A;  4P8S A;  4Z8G A;  1A9N A;  4KT1 A;  3SB4 A;  1H6T A;  2O6S A;  2UZX A;  3FXI A;  4IM6 A;  2Z65 A;  3O53 A;  4MQW X;  4LSA A;  3M19 A;  3RIZ A;  4LSX A;  4YEB B;  3UN9 A;  1YRG A;  4CC4 C;  4GT6 A;  2XOT A;  1LTX A;  2ID5 A;  1PGV A;  3RJ0 A;  4WP6 A;  4FMZ A;  4J4L A;  4CNC A;  4V2C A;  3E4G A;  2OMW A;  4Q62 A;  5GMF A;  4PER A;  4CIL A;  5A5C A;  5IJB A;  4TZH A;  4NZT M;  4BV4 R;  3WPC A;  1KOO A;  4C2A B;  3WPI A;  4Z64 C;  4I6J B;  3CVR A;  1FO1 A;  2OMX A;  4WYK A;  5D3I A;  3ZYJ A;  2OMU A;  5GS2 B;  2WQU A;  2Y5Q A;  4EZG A;  3G06 A;  4J0M A;  3RFS A;  2A0Z A;  1DCE A;  2IFG A;  2JQD A;  1U0N D;  1M9L A;  4RCW A;  1O6S A;  4LI2 A;  4M7E A;  2RA8 A;  1IO0 A;  4LSX C;  3WPG A;  4QXE A;  3C6P B;  3ZYO A;  1G9U A;  4P91 A;  4R5D A;  4R5C A;  1GWB A;  2WQW A;  1OTM A;  2ELL A;  4PKI G;  3WPF A;  4R6A A;  1A4Y A;  5HDH A;  3W3J A;  3G39 A;  5IYX C;  5AWA A;  2Z64 A;  4NKG A;  4ECO A;  1M9S A;  2O6Q A;  5LFN A;  2R9U A;  4MN8 B;  1KOH A;  3W3L A;  2BEX A;  4Z94 G;  3ZYN A;  4ARN A;  4R6J A;  1P8T A;  4U06 A;  3UL9 A;  4AW4 A;  4M7E C;  5AWB A;  5AZ5 A;  5AWC A;  2OMT A;  4LI1 A;  3RGX A;  3WPD A;  4FDW A;  4Y61 B;  1XWD C;  2P1O B;  3DZE A;  5IJD A;  5B4P A;  4FCG A;  2OMY A;  4Q3G A;  2O6R A;  1M10 B;  3O6N A;  4R08 A;  5CMN A;  3W3K A;  3JB9 j;  4RWT C;  1XKU A;  4V2D A;  1Z7X W;  2P1N B;  4NZR M;  5GMG A;  4BSU A;  1W8A A;  2BNH A;  4LXS A;  4B8C D;  3ULA A;  2UZY A;  4KNG A;  3M18 A;  1SQ0 B;  4CNM A;  3C6O B;  4Z61 C;  3W3G A;  4PSJ A;  4XSQ A;  3E6J A;  3RFE A;  2ASS B;  3UL8 A;  3PMH G;  2Z7X A;  2FT3 A;  3OJA B;  2Z81 A;  1OZN A;  2P1M B;  3A79 B;  3W3M A;  5B0T A;  4U09 A;  2OMV A;  5AWD A;  4XOS A;  2AST B;  3RW7 A;  4KXF B;  3C6N B;  4R0A A;  1FT8 A;  4R58 A;  4LXR A;  3G3A A;  3P72 A;  1DFJ I;  2Q4G W;  2RR6 A;  3RGZ A;  5B0N A;  1K5D C;  4HQ1 A;  1K5G C;  3TSR E;  4L3F A;  1DS9 A;  4AY9 X;  3ULU A;  4FD0 A;  5IJC A;  1FS2 A;  4L3A A;  2P1Q B;  5FTT B;  1P9A G;  3GOZ A;  3CIY A;  1ZIW A;  3WPE A;  3E2J A;  4R6F A;  3ZYI A;  2V9S A;  2WFH A;  3REZ A;  4R6G A;  3RFJ A;  4UFR A;  4FHO A;  2WQX A;  4LSC A;  2WQV A;  3OGK B;  1OOK G;  4G8A A;  4U7L A;  3UL7 A;  1O6V A;  1OTN A;  1XEU A;  2P1P B;  4PQ8 A;  2OMZ A;  5GQR K;  4FS7 A;  2JE1 A;  4Q3I A;  4C2B B;  4R09 A; 
#chains in the Genus database with same CATH homology
 4QC0 A;  1H6U A;  4XGO A;  3KJ4 A;  3RW6 A;  4ARR A;  3OGM B;  5HZL B;  1FQV A;  2V70 A;  3BZ5 A;  1O6T A;  1M0Z A;  4H09 A;  4K17 A;  4GLP A;  1QYY A;  3W3N A;  3E3Z A;  2Z82 A;  4NKH A;  4Z79 A;  4U08 A;  5CMP A;  3OGL B;  3WPH A;  2CA6 A;  4R07 A;  1OGQ A;  2Z62 A;  4BSR A;  2V9T B;  3OJA A;  4PEQ B;  2XWT C;  2Z63 A;  2JE0 A;  1D0B A;  2Z7X B;  4CC4 A;  1XEC A;  1JL5 A;  3CIG A;  4OQT A;  2Z66 A;  4CP6 A;  4V2E A;  4BSS A;  3VQ2 A;  5GS0 A;  3VQ1 A;  3WN4 A;  1P8V A;  1WWL A;  3G04 C;  1OTO A;  3G3B A;  5GMH A;  1XCD A;  3WPB A;  3ULV A;  4ECN A;  4RCA B;  4QBZ A;  4P8S A;  4Z8G A;  1A9N A;  4KT1 A;  3SB4 A;  1H6T A;  2O6S A;  2UZX A;  3FXI A;  4IM6 A;  2Z65 A;  3O53 A;  4MQW X;  4LSA A;  3M19 A;  3RIZ A;  4LSX A;  4YEB B;  3UN9 A;  1YRG A;  4CC4 C;  4GT6 A;  2XOT A;  1LTX A;  2ID5 A;  1PGV A;  3RJ0 A;  4WP6 A;  4FMZ A;  4J4L A;  4CNC A;  4V2C A;  3E4G A;  2OMW A;  4Q62 A;  5GMF A;  4PER A;  4CIL A;  5A5C A;  5IJB A;  4TZH A;  4BV4 R;  3WPC A;  1KOO A;  4C2A B;  3WPI A;  4Z64 C;  4I6J B;  3CVR A;  1FO1 A;  2OMX A;  4WYK A;  5D3I A;  3ZYJ A;  2OMU A;  5GS2 B;  2WQU A;  2Y5Q A;  4EZG A;  3G06 A;  4J0M A;  3RFS A;  2A0Z A;  1DCE A;  2IFG A;  2JQD A;  1U0N D;  1M9L A;  4RCW A;  1O6S A;  4LI2 A;  4M7E A;  2RA8 A;  1IO0 A;  4LSX C;  3WPG A;  4QXE A;  3C6P B;  3ZYO A;  1G9U A;  4P91 A;  4R5D A;  4R5C A;  1GWB A;  2WQW A;  1OTM A;  2ELL A;  4PKI G;  3WPF A;  4R6A A;  1A4Y A;  5HDH A;  3W3J A;  3G39 A;  5IYX C;  5AWA A;  2Z64 A;  4NKG A;  4ECO A;  1M9S A;  2O6Q A;  5LFN A;  2R9U A;  4MN8 B;  1KOH A;  3W3L A;  2BEX A;  4Z94 G;  3ZYN A;  4ARN A;  4R6J A;  1P8T A;  4U06 A;  3UL9 A;  4AW4 A;  4M7E C;  5AWB A;  5AZ5 A;  5AWC A;  2OMT A;  4LI1 A;  3RGX A;  3WPD A;  4FDW A;  4Y61 B;  1XWD C;  2P1O B;  3DZE A;  5IJD A;  5B4P A;  4FCG A;  2OMY A;  4Q3G A;  2O6R A;  1M10 B;  3O6N A;  4R08 A;  5CMN A;  3W3K A;  3JB9 j;  4RWT C;  1XKU A;  4V2D A;  1Z7X W;  2P1N B;  5GMG A;  4BSU A;  1W8A A;  2BNH A;  4LXS A;  4B8C D;  3ULA A;  2UZY A;  4KNG A;  3M18 A;  1SQ0 B;  4CNM A;  3C6O B;  4Z61 C;  3W3G A;  4PSJ A;  4XSQ A;  3E6J A;  3RFE A;  2ASS B;  3UL8 A;  3PMH G;  2Z7X A;  2FT3 A;  3OJA B;  2Z81 A;  1OZN A;  2P1M B;  3A79 B;  3W3M A;  5B0T A;  4U09 A;  2OMV A;  5AWD A;  4XOS A;  2AST B;  3RW7 A;  4KXF B;  3C6N B;  4R0A A;  1FT8 A;  4R58 A;  4LXR A;  3G3A A;  3P72 A;  1DFJ I;  2Q4G W;  2RR6 A;  3RGZ A;  5B0N A;  1K5D C;  4HQ1 A;  1K5G C;  3TSR E;  4L3F A;  1DS9 A;  4AY9 X;  3ULU A;  4FD0 A;  5IJC A;  1FS2 A;  4L3A A;  2P1Q B;  5FTT B;  1P9A G;  3GOZ A;  3CIY A;  1ZIW A;  3WPE A;  3E2J A;  4R6F A;  3ZYI A;  2V9S A;  2WFH A;  3REZ A;  4R6G A;  3RFJ A;  4UFR A;  4FHO A;  2WQX A;  4LSC A;  2WQV A;  3OGK B;  1OOK G;  4G8A A;  4U7L A;  3UL7 A;  1O6V A;  1OTN A;  1XEU A;  2P1P B;  4PQ8 A;  2OMZ A;  5GQR K;  4FS7 A;  2JE1 A;  4Q3I A;  4C2B B;  4R09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...