4FN3A

Crystal structure of an s52a mutant of the restriction-modification controller protein c.esp1396i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
77
structure length
77
Chain Sequence
SFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKALELIMKGLEVSDVVFFEMLIKEILKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Transcription
molecule keywords Regulatory protein
total genus 36
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4fn3A00
3QWGA 3O9XA 1UXCA 2EWTA 2KEJA 4GHJA 3HZIB 2L8NA 3FYAA 4PU7A 4MCXA 1B0NA 4Z5DA 1WIZA 4X4FA 1IC8A 2AW6A 2LYRA 4JCYA 1PRUA 2LYKA 3DNVB 1WH8A 2PUBA 3ZKCA 2OR1L 4X4DA 1QP7A 3OQOA 2XJ3A 4X4CA 2PUFA 2BNMA 1RZRA 2PUAA 3H5TA 1E3OC 2IV1A 1R69A 1UTXA 2CSFA 1Y9QA 3S8QA 5A7LA 2AXZA 2ICPA 4IVZA 4GQMA 3JXCL 1RZRD 3LISA 1PRAA 1AU7A 2EF8A 1NERA 3F52A 3MLFA 2CROA 2HSGA 1XWRA 1JFTA 1ZZ7A 4J1XA 3G7DA 3BS3A 3D1NI 2IVBA 1O4XA 1CQTA 3F6WA 3U3WA 1ADRA 1GT0C 2WUSR 2ICTA 3FYMA 1S7EA 2AWIA 4I6UA 2O4AA 2AXVA 1HF0A 3KXAA 1ZZ9A 4I6TA 4FBIA 1X57A 3TRBA 1ZVVA 3GN5B 4JQDA 2KEKA 1QP4A 1QQAA 4OB4A 3OQMA 4PU8A 2LYPA 1POUA 4IA8A 2IVQA 4J1WA 3LFPA 4PU3C 1ZZBA 3QYXA 1QQBA 2GRMA 2MEZA 2IU7A 3FMYA 4YARA 3BDNA 2PUDA 2D5VA 2KPJA 2EBYA 4Y42A 3VK0A 1PRVA 3ZHIA 1LMB3 2GZUA 2AUWA 1BDHA 1SQ8A 2JCGA 2MQKA 1YSEA 3SCGA 2IVGA 4YBAA 3G5GA 2HINA 2PIJA 1ZPQA 1WETA 3ZHMA 1RZSA 4O8BA 2PUEA 2WIUB 1JFSA 1LLIA 1LQCA 3GBFA 5K98B 2XSDC 4X4BA 4YG4A 2LYJA 1ZAYA 2KZ8A 3PXPA 2LYLA 4Z59A 4FN3A 2R1JL 3BD1A 1LCCA 3SCFA 2BNNA 4X4EA 1RIOA 4F8DA 1PERL 1QPZA 1R63A 1DWKA 2OFYA 3QQ6A 3CROL 4I8TA 1ZS4A 4IWRA 2PUCA 2O49A 3UFDA 3GN5A 2AXUA 2PUGA 3RZZA 1JWLA 3CLCA 1RPEL 1X2LA 1Y7YA 1ZUGA 2H8RA 1VPWA 2L49A 3SCHA 2PE5A 4I6RA 3B7HA 2GRLA 2LCVA 2O38A 1UXDA 4Z5CA 1PNRA 3OQNA 4NDWA 2A6CA 2B5AA 2LYQA 3F51A 1L1MA 1DW9A 1LCDA 4X4HA 2KEIA 3R1FA 1NEQA 3EUSA 3OMTA 3JXDL 2R63A 3KZ3A 2PPXA 4YG1A 3L1PA 2XCJA 4JCXA 2XIUA 3IVPA 2XI8A 1ZZ8A 3OP9A 3KJXA 2BJCA 4Z5HA 1CJGA 4YG7B 4Z58A 1ZZ6A 1OCTC 2LYSA 3QF3A 2FJRA 2IUOA 1OSLA 2JVLA 1QP0A 3CECA 4PU4C 2BNOA 4MCTA 4X4GA 1EFAA 4X4IA 1WH6A 1ZZCA 3JXBC 1BDIA 1JH9A
chains in the Genus database with same CATH superfamily
3QWGA 1UXCA 4GHJA 4EQZA 4Z5DA 3TFLA 4X4DA 3OQOA 2IV1A 3A9YA 2PXBA 4IVZA 2ICPA 1AU7A 2EF8A 1NERA 1ZZ7A 4J1XA 2XXQA 1O4XA 3ME5A 1S7EA 1HF0A 4FBIA 4ER0A 1QP4A 1QQAA 2YBDA 2LYPA 1NW3A 3NXHA 2GRMA 2PUDA 2D5VA 3VK0A 1QZXA 1SQ8A 1YSEA 2PXVA 2XXPA 4O8BA 2PUEA 3GUUA 1LQCA 1QB2A 2XSDC 3GBFA 4ER7A 4X4BA 4Z59A 2R1JL 3BD1A 3SCFA 1RIOA 4F8DA 1PERL 2PXLA 2OFYA 3QQ6A 1ZS4A 3NROA 3GN5A 1X2LA 1Y7YA 1ZUGA 2H8RA 1VPWA 1UXDA 2MXDA 1PNRA 2A6CA 2B5AA 1DW9A 3SX0A 3OMTA 3KZ3A 2PPXA 4DE9A 2XIUA 3KJXA 5DRYA 3OWQA 1OCTC 2V3CC 3NZLA 3QF3A 1QP0A 2PXQA 2BNOA 4X4GA 3JXBC 3O9XA 2PXPA 5DRTA 2L8NA 5JUWA 4PU7A 4MCXA 1WIZA 4X4FA 2PXKA 4JCYA 2LYKA 5DSXA 1WH8A 3ZKCA 3R09A 1HQ1A 2XJ3A 2PUFA 1RZRA 3H5TA 1R69A 1UTXA 2CSFA 1Y9QA 3S8QA 5A7LA 2AXZA 3JXCL 1RZRD 4EK9A 1PRAA 4EKGA 3F52A 2CROA 2HSGA 3G7DA 2IVBA 1CQTA 4ER3A 1GT0C 3FYMA 2PXEA 4I6TA 1X57A 5DTRA 1ZVVA 4WVLA 4IA8A 2IVQA 4PU3C 3LFPA 1QQBA 2MEZA 3FMYA 4YARA 3LQXA 4EZIA 3ZHIA 2JCGA 4YBAA 3DM5A 3ZHMA 2PIJA 4ER6A 3A9ZA 5DTQA 1MFQC 1R63A 3QOXA 2PUCA 3UFDA 1JWLA 4Q2JA 3SCHA 2O38A 3KL4A 3QOWA 1NEQA 3JXDL 4EKIA 4YG1A 2PXDA 3IVPA 2BJCA 4Z58A 1ZZ6A 2IUOA 3OKZA 3CECA 4PU4C 4MCTA 3M9LA 2LNMA 3SR4A 1JH9A 4I8TA 3GZDC 1B0NA 2LLWA 2LLVA 1PRUA 2PUBA 1QP7A 4X4CA 2PUAA 3GZDA 4GQMA 1DULA 3MLFA 1JFTA 5GAGi 3D1NI 3U3WA 2WUSR 2ICTA 2AWIA 4I6UA 2O4AA 3KXAA 1ZZ9A 3TRBA 3QFIA 4OB4A 3OQMA 1POUA 4J1WA 2HFZA 3QYXA 4DE8A 2VEOA 2KPJA 2EBYA 5DT2A 1PRVA 1LMB3 2IVGA 2HINA 1WETA 1ZPQA 1RZSA 3GZCA 2WIUB 3PE5A 3MEJA 3TELA 2FFHA 4YG4A 2KZ8A 1LCCA 2BNNA 4X4EA 3CROL 4IWRA 2PXFA 2ODRD 2O49A 5DTMA 4OBMA 2PXUA 2XXAA 1RPEL 2PE5A 4I6RA 4NDWA 2LYQA 1L1MA 3F51A 3EUSA 4JCXA 3OP9A 4Z5HA 2LYSA 2JVLA 1EFAA 4X4IA 2M4HA 2J7WA 1LCDA 2EWTA 2J7UA 2KEJA 3HZIB 1U2ZA 3FYAA 1IC8A 2AW6A 2LYRA 3DNVB 2JQEA 2OR1L 3ZPXA 2PXTA 2BNMA 1E3OC 3LISA 3NDBB 2L1PA 1XWRA 3BS3A 3F6WA 1ADRA 3TEPA 2AXVA 4ER5A 3GN5B 4JQDA 2KEKA 4PU8A 3A9XA 1ZZBA 2IU7A 3G0TA 3BDNA 2HCSA 4Y42A 2GZUA 2AUWA 1BDHA 3SCGA 2MQKA 3G5GA 1JFSA 1LLIA 5GAHi 5K98B 2LYJA 1ZAYA 3PXPA 2LYLA 4FN3A 1QPZA 1DWKA 2AXUA 2PUGA 3RZZA 2HCNA 3CLCA 2L49A 3UWPA 3B7HA 2GRLA 2LCVA 4Z5CA 3OQNA 3VWSA 4X4HA 2KEIA 3R1FA 2R63A 3L1PA 2XCJA 2XI8A 1ZZ8A 1CJGA 4YG7B 2FJRA 1OSLA 4HRAA 1WH6A 1ZZCA 1BDIA
chains in the Genus database with same CATH topology
3QWGA 3O9XA 1UXCA 2EWTA 2KEJA 4GHJA 3HZIB 2L8NA 3FYAA 4PU7A 4MCXA 1B0NA 4Z5DA 1WIZA 4X4FA 1IC8A 2AW6A 2LYRA 4JCYA 1PRUA 2LYKA 3DNVB 1WH8A 2PUBA 3ZKCA 2OR1L 4X4DA 1QP7A 3OQOA 2XJ3A 4X4CA 2PUFA 2BNMA 1RZRA 2PUAA 3H5TA 1E3OC 2IV1A 1R69A 1UTXA 2CSFA 1Y9QA 3S8QA 5A7LA 2AXZA 2ICPA 4IVZA 4GQMA 3JXCL 1RZRD 3LISA 1PRAA 1AU7A 2EF8A 1NERA 3F52A 3MLFA 2CROA 2HSGA 1XWRA 1JFTA 1ZZ7A 4J1XA 3G7DA 3BS3A 3D1NI 2IVBA 1O4XA 1CQTA 3F6WA 3U3WA 1ADRA 1GT0C 2WUSR 2ICTA 3FYMA 1S7EA 2AWIA 4I6UA 2O4AA 2AXVA 1HF0A 3KXAA 1ZZ9A 4I6TA 4FBIA 1X57A 3TRBA 1ZVVA 3GN5B 4JQDA 2KEKA 1QP4A 1QQAA 4OB4A 3OQMA 4PU8A 2LYPA 1POUA 4IA8A 2IVQA 4J1WA 3LFPA 4PU3C 1ZZBA 3QYXA 1QQBA 2GRMA 2MEZA 2IU7A 3FMYA 4YARA 3BDNA 2PUDA 2D5VA 2KPJA 2EBYA 4Y42A 3VK0A 1PRVA 3ZHIA 1LMB3 2GZUA 2AUWA 1BDHA 1SQ8A 2JCGA 2MQKA 1YSEA 3SCGA 2IVGA 4YBAA 3G5GA 2HINA 2PIJA 1ZPQA 1WETA 3ZHMA 1RZSA 4O8BA 2PUEA 2WIUB 1JFSA 1LLIA 1LQCA 3GBFA 5K98B 2XSDC 4X4BA 4YG4A 2LYJA 1ZAYA 2KZ8A 3PXPA 2LYLA 4Z59A 4FN3A 2R1JL 3BD1A 1LCCA 3SCFA 2BNNA 4X4EA 1RIOA 4F8DA 1PERL 1QPZA 1R63A 1DWKA 2OFYA 3QQ6A 3CROL 4I8TA 1ZS4A 4IWRA 2PUCA 2O49A 3UFDA 3GN5A 2AXUA 2PUGA 3RZZA 1JWLA 3CLCA 1RPEL 1X2LA 1Y7YA 1ZUGA 2H8RA 1VPWA 2L49A 3SCHA 2PE5A 4I6RA 3B7HA 2GRLA 2LCVA 2O38A 1UXDA 4Z5CA 1PNRA 3OQNA 4NDWA 2A6CA 2B5AA 2LYQA 3F51A 1L1MA 1DW9A 1LCDA 4X4HA 2KEIA 3R1FA 1NEQA 3EUSA 3OMTA 3JXDL 2R63A 3KZ3A 2PPXA 4YG1A 3L1PA 2XCJA 4JCXA 2XIUA 3IVPA 2XI8A 1ZZ8A 3OP9A 3KJXA 2BJCA 4Z5HA 1CJGA 4YG7B 4Z58A 1ZZ6A 1OCTC 2LYSA 3QF3A 2FJRA 2IUOA 1OSLA 2JVLA 1QP0A 3CECA 4PU4C 2BNOA 4MCTA 4X4GA 1EFAA 4X4IA 1WH6A 1ZZCA 3JXBC 1BDIA 1JH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWG A;  3O9X A;  1UXC A;  2EWT A;  2KEJ A;  4GHJ A;  3HZI B;  2L8N A;  3FYA A;  4PU7 A;  4MCX A;  1B0N A;  4Z5D A;  1WIZ A;  4X4F A;  1IC8 A;  2AW6 A;  2LYR A;  4JCY A;  1PRU A;  2LYK A;  3DNV B;  1WH8 A;  2PUB A;  3ZKC A;  2OR1 L;  4X4D A;  1QP7 A;  3OQO A;  2XJ3 A;  4X4C A;  2PUF A;  2BNM A;  1RZR A;  2PUA A;  3H5T A;  1E3O C;  2IV1 A;  1R69 A;  1UTX A;  2CSF A;  1Y9Q A;  3S8Q A;  5A7L A;  2AXZ A;  2ICP A;  4IVZ A;  4GQM A;  3JXC L;  1RZR D;  3LIS A;  1PRA A;  1AU7 A;  2EF8 A;  1NER A;  3F52 A;  3MLF A;  2CRO A;  2HSG A;  1XWR A;  1JFT A;  1ZZ7 A;  4J1X A;  3G7D A;  3BS3 A;  3D1N I;  2IVB A;  1O4X A;  1CQT A;  3F6W A;  3U3W A;  1ADR A;  1GT0 C;  2WUS R;  2ICT A;  3FYM A;  1S7E A;  2AWI A;  4I6U A;  2O4A A;  2AXV A;  1HF0 A;  3KXA A;  1ZZ9 A;  4I6T A;  4FBI A;  1X57 A;  3TRB A;  1ZVV A;  3GN5 B;  4JQD A;  2KEK A;  1QP4 A;  1QQA A;  4OB4 A;  3OQM A;  4PU8 A;  2LYP A;  1POU A;  4IA8 A;  2IVQ A;  4J1W A;  3LFP A;  4PU3 C;  1ZZB A;  3QYX A;  1QQB A;  2GRM A;  2MEZ A;  2IU7 A;  3FMY A;  4YAR A;  3BDN A;  2PUD A;  2D5V A;  2KPJ A;  2EBY A;  4Y42 A;  3VK0 A;  1PRV A;  3ZHI A;  1LMB 3;  2GZU A;  2AUW A;  1BDH A;  1SQ8 A;  2JCG A;  2MQK A;  1YSE A;  3SCG A;  2IVG A;  4YBA A;  3G5G A;  2HIN A;  2PIJ A;  1ZPQ A;  1WET A;  3ZHM A;  1RZS A;  4O8B A;  2PUE A;  2WIU B;  1JFS A;  1LLI A;  1LQC A;  3GBF A;  5K98 B;  2XSD C;  4X4B A;  4YG4 A;  2LYJ A;  1ZAY A;  2KZ8 A;  3PXP A;  2LYL A;  4Z59 A;  4FN3 A;  2R1J L;  3BD1 A;  1LCC A;  3SCF A;  2BNN A;  4X4E A;  1RIO A;  4F8D A;  1PER L;  1QPZ A;  1R63 A;  1DWK A;  2OFY A;  3QQ6 A;  3CRO L;  4I8T A;  1ZS4 A;  4IWR A;  2PUC A;  2O49 A;  3UFD A;  3GN5 A;  2AXU A;  2PUG A;  3RZZ A;  1JWL A;  3CLC A;  1RPE L;  1X2L A;  1Y7Y A;  1ZUG A;  2H8R A;  1VPW A;  2L49 A;  3SCH A;  2PE5 A;  4I6R A;  3B7H A;  2GRL A;  2LCV A;  2O38 A;  1UXD A;  4Z5C A;  1PNR A;  3OQN A;  4NDW A;  2A6C A;  2B5A A;  2LYQ A;  3F51 A;  1L1M A;  1DW9 A;  1LCD A;  4X4H A;  2KEI A;  3R1F A;  1NEQ A;  3EUS A;  3OMT A;  3JXD L;  2R63 A;  3KZ3 A;  2PPX A;  4YG1 A;  3L1P A;  2XCJ A;  4JCX A;  2XIU A;  3IVP A;  2XI8 A;  1ZZ8 A;  3OP9 A;  3KJX A;  2BJC A;  4Z5H A;  1CJG A;  4YG7 B;  4Z58 A;  1ZZ6 A;  1OCT C;  2LYS A;  3QF3 A;  2FJR A;  2IUO A;  1OSL A;  2JVL A;  1QP0 A;  3CEC A;  4PU4 C;  2BNO A;  4MCT A;  4X4G A;  1EFA A;  4X4I A;  1WH6 A;  1ZZC A;  3JXB C;  1BDI A;  1JH9 A; 
#chains in the Genus database with same CATH topology
 3QWG A;  1UXC A;  4GHJ A;  4EQZ A;  4Z5D A;  3TFL A;  4X4D A;  3OQO A;  2IV1 A;  3A9Y A;  2PXB A;  4IVZ A;  2ICP A;  1AU7 A;  2EF8 A;  1NER A;  1ZZ7 A;  4J1X A;  2XXQ A;  1O4X A;  3ME5 A;  1S7E A;  1HF0 A;  4FBI A;  4ER0 A;  1QP4 A;  1QQA A;  2YBD A;  2LYP A;  1NW3 A;  3NXH A;  2GRM A;  2PUD A;  2D5V A;  3VK0 A;  1QZX A;  1SQ8 A;  1YSE A;  2PXV A;  2XXP A;  4O8B A;  2PUE A;  3GUU A;  1LQC A;  1QB2 A;  2XSD C;  3GBF A;  4ER7 A;  4X4B A;  4Z59 A;  2R1J L;  3BD1 A;  3SCF A;  1RIO A;  4F8D A;  1PER L;  2PXL A;  2OFY A;  3QQ6 A;  1ZS4 A;  3NRO A;  3GN5 A;  1X2L A;  1Y7Y A;  1ZUG A;  2H8R A;  1VPW A;  1UXD A;  2MXD A;  1PNR A;  2A6C A;  2B5A A;  1DW9 A;  3SX0 A;  3OMT A;  3KZ3 A;  2PPX A;  4DE9 A;  2XIU A;  3KJX A;  5DRY A;  3OWQ A;  1OCT C;  2V3C C;  3NZL A;  3QF3 A;  1QP0 A;  2PXQ A;  2BNO A;  4X4G A;  3JXB C;  3O9X A;  2PXP A;  5DRT A;  2L8N A;  5JUW A;  4PU7 A;  4MCX A;  1WIZ A;  4X4F A;  2PXK A;  4JCY A;  2LYK A;  5DSX A;  1WH8 A;  3ZKC A;  3R09 A;  1HQ1 A;  2XJ3 A;  2PUF A;  1RZR A;  3H5T A;  1R69 A;  1UTX A;  2CSF A;  1Y9Q A;  3S8Q A;  5A7L A;  2AXZ A;  3JXC L;  1RZR D;  4EK9 A;  1PRA A;  4EKG A;  3F52 A;  2CRO A;  2HSG A;  3G7D A;  2IVB A;  1CQT A;  4ER3 A;  1GT0 C;  3FYM A;  2PXE A;  4I6T A;  1X57 A;  5DTR A;  1ZVV A;  4WVL A;  4IA8 A;  2IVQ A;  4PU3 C;  3LFP A;  1QQB A;  2MEZ A;  3FMY A;  4YAR A;  3LQX A;  4EZI A;  3ZHI A;  2JCG A;  4YBA A;  3DM5 A;  3ZHM A;  2PIJ A;  4ER6 A;  3A9Z A;  5DTQ A;  1MFQ C;  1R63 A;  3QOX A;  2PUC A;  3UFD A;  1JWL A;  4Q2J A;  3SCH A;  2O38 A;  3KL4 A;  3QOW A;  1NEQ A;  3JXD L;  4EKI A;  4YG1 A;  2PXD A;  3IVP A;  2BJC A;  4Z58 A;  1ZZ6 A;  2IUO A;  3OKZ A;  3CEC A;  4PU4 C;  4MCT A;  3M9L A;  2LNM A;  3SR4 A;  1JH9 A;  4I8T A;  3GZD C;  1B0N A;  2LLW A;  2LLV A;  1PRU A;  2PUB A;  1QP7 A;  4X4C A;  2PUA A;  3GZD A;  4GQM A;  1DUL A;  3MLF A;  1JFT A;  5GAG i;  3D1N I;  3U3W A;  2WUS R;  2ICT A;  2AWI A;  4I6U A;  2O4A A;  3KXA A;  1ZZ9 A;  3TRB A;  3QFI A;  4OB4 A;  3OQM A;  1POU A;  4J1W A;  2HFZ A;  3QYX A;  4DE8 A;  2VEO A;  2KPJ A;  2EBY A;  5DT2 A;  1PRV A;  1LMB 3;  2IVG A;  2HIN A;  1WET A;  1ZPQ A;  1RZS A;  3GZC A;  2WIU B;  3PE5 A;  3MEJ A;  3TEL A;  2FFH A;  4YG4 A;  2KZ8 A;  1LCC A;  2BNN A;  4X4E A;  3CRO L;  4IWR A;  2PXF A;  2ODR D;  2O49 A;  5DTM A;  4OBM A;  2PXU A;  2XXA A;  1RPE L;  2PE5 A;  4I6R A;  4NDW A;  2LYQ A;  1L1M A;  3F51 A;  3EUS A;  4JCX A;  3OP9 A;  4Z5H A;  2LYS A;  2JVL A;  1EFA A;  4X4I A;  2M4H A;  2J7W A;  1LCD A;  2EWT A;  2J7U A;  2KEJ A;  3HZI B;  1U2Z A;  3FYA A;  1IC8 A;  2AW6 A;  2LYR A;  3DNV B;  2JQE A;  2OR1 L;  3ZPX A;  2PXT A;  2BNM A;  1E3O C;  3LIS A;  3NDB B;  2L1P A;  1XWR A;  3BS3 A;  3F6W A;  1ADR A;  3TEP A;  2AXV A;  4ER5 A;  3GN5 B;  4JQD A;  2KEK A;  4PU8 A;  3A9X A;  1ZZB A;  2IU7 A;  3G0T A;  3BDN A;  2HCS A;  4Y42 A;  2GZU A;  2AUW A;  1BDH A;  3SCG A;  2MQK A;  3G5G A;  1JFS A;  1LLI A;  5GAH i;  5K98 B;  2LYJ A;  1ZAY A;  3PXP A;  2LYL A;  4FN3 A;  1QPZ A;  1DWK A;  2AXU A;  2PUG A;  3RZZ A;  2HCN A;  3CLC A;  2L49 A;  3UWP A;  3B7H A;  2GRL A;  2LCV A;  4Z5C A;  3OQN A;  3VWS A;  4X4H A;  2KEI A;  3R1F A;  2R63 A;  3L1P A;  2XCJ A;  2XI8 A;  1ZZ8 A;  1CJG A;  4YG7 B;  2FJR A;  1OSL A;  4HRA A;  1WH6 A;  1ZZC A;  1BDI A; 
#chains in the Genus database with same CATH homology
 3QWG A;  3O9X A;  1UXC A;  2EWT A;  2KEJ A;  4GHJ A;  3HZI B;  2L8N A;  3FYA A;  4PU7 A;  4MCX A;  1B0N A;  4Z5D A;  1WIZ A;  4X4F A;  1IC8 A;  2AW6 A;  2LYR A;  4JCY A;  1PRU A;  2LYK A;  3DNV B;  1WH8 A;  2PUB A;  3ZKC A;  2OR1 L;  4X4D A;  1QP7 A;  3OQO A;  2XJ3 A;  4X4C A;  2PUF A;  2BNM A;  1RZR A;  2PUA A;  3H5T A;  1E3O C;  2IV1 A;  1R69 A;  1UTX A;  2CSF A;  1Y9Q A;  3S8Q A;  5A7L A;  2AXZ A;  2ICP A;  4IVZ A;  4GQM A;  3JXC L;  1RZR D;  3LIS A;  1PRA A;  1AU7 A;  2EF8 A;  1NER A;  3F52 A;  3MLF A;  2CRO A;  2HSG A;  1XWR A;  1JFT A;  1ZZ7 A;  4J1X A;  3G7D A;  3BS3 A;  3D1N I;  2IVB A;  1O4X A;  1CQT A;  3F6W A;  3U3W A;  1ADR A;  1GT0 C;  2WUS R;  2ICT A;  3FYM A;  1S7E A;  2AWI A;  4I6U A;  2O4A A;  2AXV A;  1HF0 A;  3KXA A;  1ZZ9 A;  4I6T A;  4FBI A;  1X57 A;  3TRB A;  1ZVV A;  3GN5 B;  4JQD A;  2KEK A;  1QP4 A;  1QQA A;  4OB4 A;  3OQM A;  4PU8 A;  2LYP A;  1POU A;  4IA8 A;  2IVQ A;  4J1W A;  3LFP A;  4PU3 C;  1ZZB A;  3QYX A;  1QQB A;  2GRM A;  2MEZ A;  2IU7 A;  3FMY A;  4YAR A;  3BDN A;  2PUD A;  2D5V A;  2KPJ A;  2EBY A;  4Y42 A;  3VK0 A;  1PRV A;  3ZHI A;  1LMB 3;  2GZU A;  2AUW A;  1BDH A;  1SQ8 A;  2JCG A;  2MQK A;  1YSE A;  3SCG A;  2IVG A;  4YBA A;  3G5G A;  2HIN A;  2PIJ A;  1ZPQ A;  1WET A;  3ZHM A;  1RZS A;  4O8B A;  2PUE A;  2WIU B;  1JFS A;  1LLI A;  1LQC A;  3GBF A;  5K98 B;  2XSD C;  4X4B A;  4YG4 A;  2LYJ A;  1ZAY A;  2KZ8 A;  3PXP A;  2LYL A;  4Z59 A;  4FN3 A;  2R1J L;  3BD1 A;  1LCC A;  3SCF A;  2BNN A;  4X4E A;  1RIO A;  4F8D A;  1PER L;  1QPZ A;  1R63 A;  1DWK A;  2OFY A;  3QQ6 A;  3CRO L;  4I8T A;  1ZS4 A;  4IWR A;  2PUC A;  2O49 A;  3UFD A;  3GN5 A;  2AXU A;  2PUG A;  3RZZ A;  1JWL A;  3CLC A;  1RPE L;  1X2L A;  1Y7Y A;  1ZUG A;  2H8R A;  1VPW A;  2L49 A;  3SCH A;  2PE5 A;  4I6R A;  3B7H A;  2GRL A;  2LCV A;  2O38 A;  1UXD A;  4Z5C A;  1PNR A;  3OQN A;  4NDW A;  2A6C A;  2B5A A;  2LYQ A;  3F51 A;  1L1M A;  1DW9 A;  1LCD A;  4X4H A;  2KEI A;  3R1F A;  1NEQ A;  3EUS A;  3OMT A;  3JXD L;  2R63 A;  3KZ3 A;  2PPX A;  4YG1 A;  3L1P A;  2XCJ A;  4JCX A;  2XIU A;  3IVP A;  2XI8 A;  1ZZ8 A;  3OP9 A;  3KJX A;  2BJC A;  4Z5H A;  1CJG A;  4YG7 B;  4Z58 A;  1ZZ6 A;  1OCT C;  2LYS A;  3QF3 A;  2FJR A;  2IUO A;  1OSL A;  2JVL A;  1QP0 A;  3CEC A;  4PU4 C;  2BNO A;  4MCT A;  4X4G A;  1EFA A;  4X4I A;  1WH6 A;  1ZZC A;  3JXB C;  1BDI A;  1JH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...