4FNBA

Crystal structure of the mtb enoyl coa isomerase (rv0632c) in complex with hydroxybutyrl coa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
232
structure length
232
Chain Sequence
SMSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mechanism of the Prokaryotic Enoyl CoA Isomerase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase family protein
total genus 86
structure length 232
sequence length 232
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4fnbA00
3L3SA 1YG8A 1Q52A 4K2NA 1ON3A 3PGQA 5DU8A 5INIA 1UYVA 4EMPA 5CTBA 3WG5A 4KPKA 3M6MA 3BEZA 4FZWA 4U0GA 3NJDA 5DKPA 3PE8A 3T8AA 4FNDA 4WYOB 3N6RB 2A7KA 2W3PA 3HRXA 3P5MA 4QIJA 2UZFA 2GTRA 3QXIA 5DUCA 4ELSA 1JXZA 1HZDA 5DL1A 3TDCA 3ZW8A 3G64A 5FIFA 4FN7A 3M6NA 1DCIA 2F9IA 2VSUA 1HNOA 4IZDA 3ZWBA 4ZU2A 3TVWA 3OMEA 4IZCA 3IBBA 3Q0JA 3IAVA 4QFEA 3MFMA 3KTIA 3STAA 4JFCA 5KDRB 3NJBA 2PBPA 3TRRA 3K8XA 3QWDA 4Z0MA 3SWXA 1YG6A 4JWVA 3TVUA 3H0UA 1XNVA 3IB9A 1J7XA 4JCRA 4RYFH 1UYSA 3GF7A 2CBYA 5JBWA 3LKEA 1K39A 1EF9A 2F6QA 3TLFA 4JCTA 4L8KA 2VREA 2X24A 3GF3A 4U0GH 3V5EA 2DUBA 2ZL3A 3QYRA 3DJAA 4JSBA 3HP0A 4U1AA 1MJ3A 1N6DA 2J5IB 4ZDCA 4FB8A 4JYJA 4JOTA 4ZDBA 3P85A 4F47A 3T89A 1TG6A 3TT7A 1EY3A 1N6EA 3P2LA 2VSSF 1OD4A 3Q1TA 4IZBA 4JJTA 4B3IA 2DEOA 3Q0GA 1RJMA 1DUBA 2J5GA 3R6HA 4Q0GA 1FC9A 5DTPA 2PG8A 3TZ3A 3QXZA 4QIIA 3U9SB 2WTBA 5DTWA 3U9TB 5C90A 2HW5A 4B3HA 1FCFA 5KDRA 2NP9A 2ZL0A 3R9TA 3MT6A 4I52A 4I42A 3DORA 1UIYA 1N6FA 4NEKA 3ZWAA 4OMRA 4JYLA 1FC6A 3FDUA 5CTCA 3ZW9A 5G1RA 4B3JA 3RSIA 3HLN1 4OLQA 3K50A 4FN8A 4ZDFA 4HNKA 4U19A 3QKAA 1O8UA 2A81A 1FC7A 5DZKH 4MI2A 4U18A 3T88A 4ELWA 2PPYA 1VRGA 5MGBA 4ZDEA 4U0HA 3FF6A 4GHNA 1EF8A 1WDLA 3HINA 4MXIA 1WZ8A 5KJPA 1OD2A 2VSSA 2ZQRA 1SG4A 4FZWC 2J5IA 3HE2A 5E0SH 1X0UA 2IEXA 3H02A 3U9RB 4GM2A 4OG1A 1Q51A 5FUSA 2Q34A 3RSTA 3KTJA 2QQ3A 3KTKA 2A7SA 4FNBA 5E0NX 2J5SA 4LK5A 4KD6A 4KNPA 3PEAA 5G1SA 4JVTA 3GMAA 4DI1A 4MOUA 3SLLA 1PJHA 1PIXA 2BZRA 4ASIA 3H81A 2VSUF 3R9QA 2FZSA 3QMJA 3ZWCA 3R0OA 4K3WA 3BPPA 4Q1IA 3QREA 1XNWA 4JCQA 4G2RA 3GKBA 5C9GA 3LAOA 1SZOA 3H0SA 3H0JA 2J5II 5INGA 2ZQQA 4EMMA 3RRVA 4L6WA 1XO6A 2F9IB 4RYFA 1NZYA 5JBXA 2F9YB 2FW2A 5INFA 3GLMA 2Q35A 2VSUC 3ISAA 4YLHA 3TT6A 4K29A 4HC8A 1WDMA 2VX2A 4I4ZA 1W2XA 2C8TA 4KWBA 5DU4A 2Q2XA 5DUFA 3ST9A 4WZ8B 4EMLA 1K32A 4FJWD 3V5IA 3OT6A 3T8BA 3JU1A 5E0SA 3PZKA 3H0QA 1Y7OA 5IKLB 2VSUE 1XX4A 2D3TA 2F6IA 5DU6A 2CE3A 5G1QA 4ELXA 2ZL4A 4ZDDA 3TV5A 3Q7HA 3KQFA 1ON9A 2FBMA 4JCSA 4RCNA 3VIVA 1XNYA 3KTHA 2F9YA 2EJ5A 3KTGA 2VSSE 3MOYA 2X58A 3BF0A 2ZL2A 1UYRA 3I47A 3OC7A 3R9SA 1NZYB 3T3WA 5DZKA 2J5GD 4WCZA 3MYBA 1TYFA 1HNUA 1WDKA 1RJNA 1UYTA 3QK8A 4NNQA
chains in the Genus database with same CATH superfamily
3L3SA 1YG8A 1Q52A 4K2NA 1ON3A 3PGQA 5DU8A 5INIA 1UYVA 4EMPA 5CTBA 3WG5A 4KPKA 3M6MA 3BEZA 4FZWA 4U0GA 3NJDA 5DKPA 3PE8A 3T8AA 4FNDA 4WYOB 3N6RB 2A7KA 2W3PA 3HRXA 3P5MA 4QIJA 2UZFA 2GTRA 3QXIA 5DUCA 4ELSA 1JXZA 1HZDA 5DL1A 3TDCA 3ZW8A 3G64A 5FIFA 4FN7A 3M6NA 1DCIA 2F9IA 2VSUA 1HNOA 4IZDA 3ZWBA 4ZU2A 3TVWA 3OMEA 4IZCA 3IBBA 3Q0JA 3IAVA 4QFEA 3MFMA 3KTIA 3STAA 4JFCA 5KDRB 3NJBA 2PBPA 3TRRA 3K8XA 3QWDA 4Z0MA 3SWXA 1YG6A 4JWVA 3TVUA 3H0UA 1XNVA 3IB9A 1J7XA 4JCRA 4RYFH 1UYSA 3GF7A 2CBYA 5JBWA 3LKEA 1K39A 1EF9A 2F6QA 3TLFA 4JCTA 4L8KA 2VREA 2X24A 3GF3A 4U0GH 3V5EA 2DUBA 2ZL3A 3QYRA 3DJAA 4JSBA 3HP0A 4U1AA 1MJ3A 1N6DA 2J5IB 4ZDCA 4FB8A 4JYJA 4JOTA 4ZDBA 3P85A 4F47A 3T89A 1TG6A 3TT7A 1EY3A 1N6EA 3P2LA 2VSSF 1OD4A 3Q1TA 4IZBA 4JJTA 4B3IA 2DEOA 3Q0GA 1RJMA 1DUBA 2J5GA 3R6HA 4Q0GA 1FC9A 5DTPA 2PG8A 3TZ3A 3QXZA 4QIIA 4NARA 3U9SB 2WTBA 5DTWA 3U9TB 5C90A 2HW5A 4B3HA 1FCFA 5KDRA 2NP9A 2ZL0A 3R9TA 3MT6A 4I52A 4I42A 3DORA 1UIYA 1N6FA 4NEKA 3ZWAA 4OMRA 4JYLA 1FC6A 3FDUA 5CTCA 3ZW9A 5G1RA 4B3JA 3RSIA 3HLN1 4OLQA 3K50A 4FN8A 4ZDFA 4HNKA 4U19A 3QKAA 1O8UA 2A81A 1FC7A 5DZKH 4MI2A 4U18A 3T88A 4ELWA 2PPYA 1VRGA 5MGBA 4ZDEA 4U0HA 3FF6A 4GHNA 1EF8A 1WDLA 3HINA 4MXIA 1WZ8A 5KJPA 1OD2A 2VSSA 2ZQRA 1SG4A 4FZWC 2J5IA 3HE2A 5E0SH 1X0UA 2IEXA 3H02A 3U9RB 4GM2A 4OG1A 1Q51A 5FUSA 2Q34A 3RSTA 3KTJA 2QQ3A 3KTKA 2A7SA 4FNBA 5E0NX 2J5SA 4LK5A 4KD6A 4KNPA 3PEAA 5G1SA 4JVTA 3GMAA 4DI1A 4MOUA 3SLLA 1PJHA 1PIXA 2BZRA 4ASIA 3H81A 2VSUF 3R9QA 2FZSA 3QMJA 3ZWCA 3R0OA 4K3WA 3BPPA 4Q1IA 3QREA 1XNWA 4JCQA 4G2RA 3GKBA 5C9GA 5HUQA 3LAOA 1SZOA 3H0SA 3H0JA 2J5II 5INGA 2ZQQA 4EMMA 3RRVA 4L6WA 1XO6A 2F9IB 4RYFA 1NZYA 5JBXA 2F9YB 2FW2A 5INFA 3GLMA 2Q35A 2VSUC 3ISAA 4YLHA 3TT6A 4K29A 4HC8A 1WDMA 2VX2A 4I4ZA 1W2XA 2C8TA 3BPTA 4KWBA 5DU4A 2Q2XA 5DUFA 3ST9A 4WZ8B 4EMLA 1K32A 4FJWD 3V5IA 3OT6A 3T8BA 3JU1A 2YJGA 5E0SA 3PZKA 3H0QA 1Y7OA 5IKLB 2VSUE 1XX4A 2D3TA 2F6IA 5DU6A 2CE3A 5G1QA 4ELXA 4HDTA 2ZL4A 4ZDDA 3TV5A 3Q7HA 3KQFA 1ON9A 2FBMA 4JCSA 4RCNA 3VIVA 1XNYA 3KTHA 2F9YA 2EJ5A 3KTGA 2VSSE 3MOYA 2X58A 3BF0A 2ZL2A 1UYRA 3I47A 3OC7A 3R9SA 1NZYB 3T3WA 5DZKA 2J5GD 4WCZA 3MYBA 1TYFA 4J2UA 1HNUA 1WDKA 1RJNA 1UYTA 3QK8A 4NNQA
chains in the Genus database with same CATH topology
3L3SA 1YG8A 1Q52A 4K2NA 1ON3A 3PGQA 5DU8A 5INIA 1UYVA 4EMPA 5CTBA 3WG5A 4KPKA 3M6MA 3BEZA 4FZWA 4U0GA 3NJDA 5DKPA 3PE8A 3T8AA 4FNDA 4WYOB 3N6RB 2A7KA 2W3PA 3HRXA 3P5MA 4QIJA 2UZFA 2GTRA 3QXIA 5DUCA 4ELSA 1JXZA 1HZDA 5DL1A 3TDCA 3ZW8A 3G64A 5FIFA 4FN7A 3M6NA 1DCIA 2F9IA 2VSUA 1HNOA 4IZDA 3ZWBA 4ZU2A 3TVWA 3OMEA 4IZCA 3IBBA 3Q0JA 3IAVA 4QFEA 3MFMA 3KTIA 3STAA 4JFCA 5KDRB 3NJBA 2PBPA 3TRRA 3K8XA 3QWDA 4Z0MA 3SWXA 1YG6A 4JWVA 3TVUA 3H0UA 1XNVA 3IB9A 1J7XA 4JCRA 4RYFH 1UYSA 3GF7A 2CBYA 5JBWA 3LKEA 1K39A 1EF9A 2F6QA 3TLFA 4JCTA 4L8KA 2VREA 2X24A 3GF3A 4U0GH 3V5EA 2DUBA 2ZL3A 3QYRA 3DJAA 4JSBA 3HP0A 4U1AA 1MJ3A 1N6DA 2J5IB 4ZDCA 4FB8A 4JYJA 4JOTA 4ZDBA 3P85A 4F47A 3T89A 1TG6A 3TT7A 1EY3A 1N6EA 3P2LA 2VSSF 1OD4A 3Q1TA 4IZBA 4JJTA 4B3IA 2DEOA 3Q0GA 1RJMA 1DUBA 2J5GA 3R6HA 4Q0GA 1FC9A 5DTPA 2PG8A 3TZ3A 3QXZA 4QIIA 4NARA 3U9SB 2WTBA 5DTWA 3U9TB 5C90A 2HW5A 4B3HA 1FCFA 5KDRA 2NP9A 2ZL0A 3R9TA 3MT6A 4I52A 4I42A 3DORA 1UIYA 1N6FA 4NEKA 3ZWAA 4OMRA 4JYLA 1FC6A 3FDUA 5CTCA 3ZW9A 5G1RA 4B3JA 3RSIA 3HLN1 4OLQA 3K50A 4FN8A 4ZDFA 4HNKA 4U19A 3QKAA 1O8UA 2A81A 1FC7A 5DZKH 4MI2A 4U18A 3T88A 4ELWA 2PPYA 1VRGA 5MGBA 4ZDEA 4U0HA 3FF6A 4GHNA 1EF8A 1WDLA 3HINA 4MXIA 1WZ8A 5KJPA 1OD2A 2VSSA 2ZQRA 1SG4A 4FZWC 2J5IA 3HE2A 5E0SH 1X0UA 2IEXA 3H02A 3U9RB 4GM2A 4OG1A 1Q51A 5FUSA 2Q34A 3RSTA 3KTJA 2QQ3A 3KTKA 2A7SA 4FNBA 5E0NX 2J5SA 4LK5A 4KD6A 4KNPA 3PEAA 5G1SA 4JVTA 3GMAA 4DI1A 4MOUA 3SLLA 1PJHA 1PIXA 2BZRA 4ASIA 3H81A 2VSUF 3R9QA 2FZSA 3QMJA 3ZWCA 3R0OA 4K3WA 3BPPA 4Q1IA 3QREA 1XNWA 4JCQA 4G2RA 3GKBA 5C9GA 5HUQA 3LAOA 1SZOA 3H0SA 3H0JA 2J5II 5INGA 2ZQQA 4EMMA 3RRVA 4L6WA 1XO6A 2F9IB 4RYFA 1NZYA 5JBXA 2F9YB 2FW2A 5INFA 3GLMA 2Q35A 2VSUC 3ISAA 4YLHA 3TT6A 4K29A 4HC8A 1WDMA 2VX2A 4I4ZA 1W2XA 2C8TA 3BPTA 4KWBA 5DU4A 2Q2XA 5DUFA 3ST9A 4WZ8B 4EMLA 1K32A 4FJWD 3V5IA 3OT6A 3T8BA 3JU1A 2YJGA 5E0SA 3PZKA 3H0QA 1Y7OA 5IKLB 2VSUE 1XX4A 2D3TA 2F6IA 5DU6A 2CE3A 5G1QA 4ELXA 4HDTA 2ZL4A 4ZDDA 3TV5A 3Q7HA 3KQFA 1ON9A 2FBMA 4JCSA 4RCNA 3VIVA 1XNYA 3KTHA 2F9YA 2EJ5A 3KTGA 2VSSE 3MOYA 2X58A 3BF0A 2ZL2A 1UYRA 3I47A 3OC7A 3R9SA 1NZYB 3T3WA 5DZKA 2J5GD 4WCZA 3MYBA 1TYFA 4J2UA 1HNUA 1WDKA 1RJNA 1UYTA 3QK8A 4NNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3S A;  1YG8 A;  1Q52 A;  4K2N A;  1ON3 A;  3PGQ A;  5DU8 A;  5INI A;  1UYV A;  4EMP A;  5CTB A;  3WG5 A;  4KPK A;  3M6M A;  3BEZ A;  4FZW A;  4U0G A;  3NJD A;  5DKP A;  3PE8 A;  3T8A A;  4FND A;  4WYO B;  3N6R B;  2A7K A;  2W3P A;  3HRX A;  3P5M A;  4QIJ A;  2UZF A;  2GTR A;  3QXI A;  5DUC A;  4ELS A;  1JXZ A;  1HZD A;  5DL1 A;  3TDC A;  3ZW8 A;  3G64 A;  5FIF A;  4FN7 A;  3M6N A;  1DCI A;  2F9I A;  2VSU A;  1HNO A;  4IZD A;  3ZWB A;  4ZU2 A;  3TVW A;  3OME A;  4IZC A;  3IBB A;  3Q0J A;  3IAV A;  4QFE A;  3MFM A;  3KTI A;  3STA A;  4JFC A;  5KDR B;  3NJB A;  2PBP A;  3TRR A;  3K8X A;  3QWD A;  4Z0M A;  3SWX A;  1YG6 A;  4JWV A;  3TVU A;  3H0U A;  1XNV A;  3IB9 A;  1J7X A;  4JCR A;  4RYF H;  1UYS A;  3GF7 A;  2CBY A;  5JBW A;  3LKE A;  1K39 A;  1EF9 A;  2F6Q A;  3TLF A;  4JCT A;  4L8K A;  2VRE A;  2X24 A;  3GF3 A;  4U0G H;  3V5E A;  2DUB A;  2ZL3 A;  3QYR A;  3DJA A;  4JSB A;  3HP0 A;  4U1A A;  1MJ3 A;  1N6D A;  2J5I B;  4ZDC A;  4FB8 A;  4JYJ A;  4JOT A;  4ZDB A;  3P85 A;  4F47 A;  3T89 A;  1TG6 A;  3TT7 A;  1EY3 A;  1N6E A;  3P2L A;  2VSS F;  1OD4 A;  3Q1T A;  4IZB A;  4JJT A;  4B3I A;  2DEO A;  3Q0G A;  1RJM A;  1DUB A;  2J5G A;  3R6H A;  4Q0G A;  1FC9 A;  5DTP A;  2PG8 A;  3TZ3 A;  3QXZ A;  4QII A;  3U9S B;  2WTB A;  5DTW A;  3U9T B;  5C90 A;  2HW5 A;  4B3H A;  1FCF A;  5KDR A;  2NP9 A;  2ZL0 A;  3R9T A;  3MT6 A;  4I52 A;  4I42 A;  3DOR A;  1UIY A;  1N6F A;  4NEK A;  3ZWA A;  4OMR A;  4JYL A;  1FC6 A;  3FDU A;  5CTC A;  3ZW9 A;  5G1R A;  4B3J A;  3RSI A;  3HLN 1;  4OLQ A;  3K50 A;  4FN8 A;  4ZDF A;  4HNK A;  4U19 A;  3QKA A;  1O8U A;  2A81 A;  1FC7 A;  5DZK H;  4MI2 A;  4U18 A;  3T88 A;  4ELW A;  2PPY A;  1VRG A;  5MGB A;  4ZDE A;  4U0H A;  3FF6 A;  4GHN A;  1EF8 A;  1WDL A;  3HIN A;  4MXI A;  1WZ8 A;  5KJP A;  1OD2 A;  2VSS A;  2ZQR A;  1SG4 A;  4FZW C;  2J5I A;  3HE2 A;  5E0S H;  1X0U A;  2IEX A;  3H02 A;  3U9R B;  4GM2 A;  4OG1 A;  1Q51 A;  5FUS A;  2Q34 A;  3RST A;  3KTJ A;  2QQ3 A;  3KTK A;  2A7S A;  4FNB A;  5E0N X;  2J5S A;  4LK5 A;  4KD6 A;  4KNP A;  3PEA A;  5G1S A;  4JVT A;  3GMA A;  4DI1 A;  4MOU A;  3SLL A;  1PJH A;  1PIX A;  2BZR A;  4ASI A;  3H81 A;  2VSU F;  3R9Q A;  2FZS A;  3QMJ A;  3ZWC A;  3R0O A;  4K3W A;  3BPP A;  4Q1I A;  3QRE A;  1XNW A;  4JCQ A;  4G2R A;  3GKB A;  5C9G A;  3LAO A;  1SZO A;  3H0S A;  3H0J A;  2J5I I;  5ING A;  2ZQQ A;  4EMM A;  3RRV A;  4L6W A;  1XO6 A;  2F9I B;  4RYF A;  1NZY A;  5JBX A;  2F9Y B;  2FW2 A;  5INF A;  3GLM A;  2Q35 A;  2VSU C;  3ISA A;  4YLH A;  3TT6 A;  4K29 A;  4HC8 A;  1WDM A;  2VX2 A;  4I4Z A;  1W2X A;  2C8T A;  4KWB A;  5DU4 A;  2Q2X A;  5DUF A;  3ST9 A;  4WZ8 B;  4EML A;  1K32 A;  4FJW D;  3V5I A;  3OT6 A;  3T8B A;  3JU1 A;  5E0S A;  3PZK A;  3H0Q A;  1Y7O A;  5IKL B;  2VSU E;  1XX4 A;  2D3T A;  2F6I A;  5DU6 A;  2CE3 A;  5G1Q A;  4ELX A;  2ZL4 A;  4ZDD A;  3TV5 A;  3Q7H A;  3KQF A;  1ON9 A;  2FBM A;  4JCS A;  4RCN A;  3VIV A;  1XNY A;  3KTH A;  2F9Y A;  2EJ5 A;  3KTG A;  2VSS E;  3MOY A;  2X58 A;  3BF0 A;  2ZL2 A;  1UYR A;  3I47 A;  3OC7 A;  3R9S A;  1NZY B;  3T3W A;  5DZK A;  2J5G D;  4WCZ A;  3MYB A;  1TYF A;  1HNU A;  1WDK A;  1RJN A;  1UYT A;  3QK8 A;  4NNQ A; 
#chains in the Genus database with same CATH topology
 3L3S A;  1YG8 A;  1Q52 A;  4K2N A;  1ON3 A;  3PGQ A;  5DU8 A;  5INI A;  1UYV A;  4EMP A;  5CTB A;  3WG5 A;  4KPK A;  3M6M A;  3BEZ A;  4FZW A;  4U0G A;  3NJD A;  5DKP A;  3PE8 A;  3T8A A;  4FND A;  4WYO B;  3N6R B;  2A7K A;  2W3P A;  3HRX A;  3P5M A;  4QIJ A;  2UZF A;  2GTR A;  3QXI A;  5DUC A;  4ELS A;  1JXZ A;  1HZD A;  5DL1 A;  3TDC A;  3ZW8 A;  3G64 A;  5FIF A;  4FN7 A;  3M6N A;  1DCI A;  2F9I A;  2VSU A;  1HNO A;  4IZD A;  3ZWB A;  4ZU2 A;  3TVW A;  3OME A;  4IZC A;  3IBB A;  3Q0J A;  3IAV A;  4QFE A;  3MFM A;  3KTI A;  3STA A;  4JFC A;  5KDR B;  3NJB A;  2PBP A;  3TRR A;  3K8X A;  3QWD A;  4Z0M A;  3SWX A;  1YG6 A;  4JWV A;  3TVU A;  3H0U A;  1XNV A;  3IB9 A;  1J7X A;  4JCR A;  4RYF H;  1UYS A;  3GF7 A;  2CBY A;  5JBW A;  3LKE A;  1K39 A;  1EF9 A;  2F6Q A;  3TLF A;  4JCT A;  4L8K A;  2VRE A;  2X24 A;  3GF3 A;  4U0G H;  3V5E A;  2DUB A;  2ZL3 A;  3QYR A;  3DJA A;  4JSB A;  3HP0 A;  4U1A A;  1MJ3 A;  1N6D A;  2J5I B;  4ZDC A;  4FB8 A;  4JYJ A;  4JOT A;  4ZDB A;  3P85 A;  4F47 A;  3T89 A;  1TG6 A;  3TT7 A;  1EY3 A;  1N6E A;  3P2L A;  2VSS F;  1OD4 A;  3Q1T A;  4IZB A;  4JJT A;  4B3I A;  2DEO A;  3Q0G A;  1RJM A;  1DUB A;  2J5G A;  3R6H A;  4Q0G A;  1FC9 A;  5DTP A;  2PG8 A;  3TZ3 A;  3QXZ A;  4QII A;  4NAR A;  3U9S B;  2WTB A;  5DTW A;  3U9T B;  5C90 A;  2HW5 A;  4B3H A;  1FCF A;  5KDR A;  2NP9 A;  2ZL0 A;  3R9T A;  3MT6 A;  4I52 A;  4I42 A;  3DOR A;  1UIY A;  1N6F A;  4NEK A;  3ZWA A;  4OMR A;  4JYL A;  1FC6 A;  3FDU A;  5CTC A;  3ZW9 A;  5G1R A;  4B3J A;  3RSI A;  3HLN 1;  4OLQ A;  3K50 A;  4FN8 A;  4ZDF A;  4HNK A;  4U19 A;  3QKA A;  1O8U A;  2A81 A;  1FC7 A;  5DZK H;  4MI2 A;  4U18 A;  3T88 A;  4ELW A;  2PPY A;  1VRG A;  5MGB A;  4ZDE A;  4U0H A;  3FF6 A;  4GHN A;  1EF8 A;  1WDL A;  3HIN A;  4MXI A;  1WZ8 A;  5KJP A;  1OD2 A;  2VSS A;  2ZQR A;  1SG4 A;  4FZW C;  2J5I A;  3HE2 A;  5E0S H;  1X0U A;  2IEX A;  3H02 A;  3U9R B;  4GM2 A;  4OG1 A;  1Q51 A;  5FUS A;  2Q34 A;  3RST A;  3KTJ A;  2QQ3 A;  3KTK A;  2A7S A;  4FNB A;  5E0N X;  2J5S A;  4LK5 A;  4KD6 A;  4KNP A;  3PEA A;  5G1S A;  4JVT A;  3GMA A;  4DI1 A;  4MOU A;  3SLL A;  1PJH A;  1PIX A;  2BZR A;  4ASI A;  3H81 A;  2VSU F;  3R9Q A;  2FZS A;  3QMJ A;  3ZWC A;  3R0O A;  4K3W A;  3BPP A;  4Q1I A;  3QRE A;  1XNW A;  4JCQ A;  4G2R A;  3GKB A;  5C9G A;  5HUQ A;  3LAO A;  1SZO A;  3H0S A;  3H0J A;  2J5I I;  5ING A;  2ZQQ A;  4EMM A;  3RRV A;  4L6W A;  1XO6 A;  2F9I B;  4RYF A;  1NZY A;  5JBX A;  2F9Y B;  2FW2 A;  5INF A;  3GLM A;  2Q35 A;  2VSU C;  3ISA A;  4YLH A;  3TT6 A;  4K29 A;  4HC8 A;  1WDM A;  2VX2 A;  4I4Z A;  1W2X A;  2C8T A;  3BPT A;  4KWB A;  5DU4 A;  2Q2X A;  5DUF A;  3ST9 A;  4WZ8 B;  4EML A;  1K32 A;  4FJW D;  3V5I A;  3OT6 A;  3T8B A;  3JU1 A;  2YJG A;  5E0S A;  3PZK A;  3H0Q A;  1Y7O A;  5IKL B;  2VSU E;  1XX4 A;  2D3T A;  2F6I A;  5DU6 A;  2CE3 A;  5G1Q A;  4ELX A;  4HDT A;  2ZL4 A;  4ZDD A;  3TV5 A;  3Q7H A;  3KQF A;  1ON9 A;  2FBM A;  4JCS A;  4RCN A;  3VIV A;  1XNY A;  3KTH A;  2F9Y A;  2EJ5 A;  3KTG A;  2VSS E;  3MOY A;  2X58 A;  3BF0 A;  2ZL2 A;  1UYR A;  3I47 A;  3OC7 A;  3R9S A;  1NZY B;  3T3W A;  5DZK A;  2J5G D;  4WCZ A;  3MYB A;  1TYF A;  4J2U A;  1HNU A;  1WDK A;  1RJN A;  1UYT A;  3QK8 A;  4NNQ A; 
#chains in the Genus database with same CATH homology
 3L3S A;  1YG8 A;  1Q52 A;  4K2N A;  1ON3 A;  3PGQ A;  5DU8 A;  5INI A;  1UYV A;  4EMP A;  5CTB A;  3WG5 A;  4KPK A;  3M6M A;  3BEZ A;  4FZW A;  4U0G A;  3NJD A;  5DKP A;  3PE8 A;  3T8A A;  4FND A;  4WYO B;  3N6R B;  2A7K A;  2W3P A;  3HRX A;  3P5M A;  4QIJ A;  2UZF A;  2GTR A;  3QXI A;  5DUC A;  4ELS A;  1JXZ A;  1HZD A;  5DL1 A;  3TDC A;  3ZW8 A;  3G64 A;  5FIF A;  4FN7 A;  3M6N A;  1DCI A;  2F9I A;  2VSU A;  1HNO A;  4IZD A;  3ZWB A;  4ZU2 A;  3TVW A;  3OME A;  4IZC A;  3IBB A;  3Q0J A;  3IAV A;  4QFE A;  3MFM A;  3KTI A;  3STA A;  4JFC A;  5KDR B;  3NJB A;  2PBP A;  3TRR A;  3K8X A;  3QWD A;  4Z0M A;  3SWX A;  1YG6 A;  4JWV A;  3TVU A;  3H0U A;  1XNV A;  3IB9 A;  1J7X A;  4JCR A;  4RYF H;  1UYS A;  3GF7 A;  2CBY A;  5JBW A;  3LKE A;  1K39 A;  1EF9 A;  2F6Q A;  3TLF A;  4JCT A;  4L8K A;  2VRE A;  2X24 A;  3GF3 A;  4U0G H;  3V5E A;  2DUB A;  2ZL3 A;  3QYR A;  3DJA A;  4JSB A;  3HP0 A;  4U1A A;  1MJ3 A;  1N6D A;  2J5I B;  4ZDC A;  4FB8 A;  4JYJ A;  4JOT A;  4ZDB A;  3P85 A;  4F47 A;  3T89 A;  1TG6 A;  3TT7 A;  1EY3 A;  1N6E A;  3P2L A;  2VSS F;  1OD4 A;  3Q1T A;  4IZB A;  4JJT A;  4B3I A;  2DEO A;  3Q0G A;  1RJM A;  1DUB A;  2J5G A;  3R6H A;  4Q0G A;  1FC9 A;  5DTP A;  2PG8 A;  3TZ3 A;  3QXZ A;  4QII A;  4NAR A;  3U9S B;  2WTB A;  5DTW A;  3U9T B;  5C90 A;  2HW5 A;  4B3H A;  1FCF A;  5KDR A;  2NP9 A;  2ZL0 A;  3R9T A;  3MT6 A;  4I52 A;  4I42 A;  3DOR A;  1UIY A;  1N6F A;  4NEK A;  3ZWA A;  4OMR A;  4JYL A;  1FC6 A;  3FDU A;  5CTC A;  3ZW9 A;  5G1R A;  4B3J A;  3RSI A;  3HLN 1;  4OLQ A;  3K50 A;  4FN8 A;  4ZDF A;  4HNK A;  4U19 A;  3QKA A;  1O8U A;  2A81 A;  1FC7 A;  5DZK H;  4MI2 A;  4U18 A;  3T88 A;  4ELW A;  2PPY A;  1VRG A;  5MGB A;  4ZDE A;  4U0H A;  3FF6 A;  4GHN A;  1EF8 A;  1WDL A;  3HIN A;  4MXI A;  1WZ8 A;  5KJP A;  1OD2 A;  2VSS A;  2ZQR A;  1SG4 A;  4FZW C;  2J5I A;  3HE2 A;  5E0S H;  1X0U A;  2IEX A;  3H02 A;  3U9R B;  4GM2 A;  4OG1 A;  1Q51 A;  5FUS A;  2Q34 A;  3RST A;  3KTJ A;  2QQ3 A;  3KTK A;  2A7S A;  4FNB A;  5E0N X;  2J5S A;  4LK5 A;  4KD6 A;  4KNP A;  3PEA A;  5G1S A;  4JVT A;  3GMA A;  4DI1 A;  4MOU A;  3SLL A;  1PJH A;  1PIX A;  2BZR A;  4ASI A;  3H81 A;  2VSU F;  3R9Q A;  2FZS A;  3QMJ A;  3ZWC A;  3R0O A;  4K3W A;  3BPP A;  4Q1I A;  3QRE A;  1XNW A;  4JCQ A;  4G2R A;  3GKB A;  5C9G A;  5HUQ A;  3LAO A;  1SZO A;  3H0S A;  3H0J A;  2J5I I;  5ING A;  2ZQQ A;  4EMM A;  3RRV A;  4L6W A;  1XO6 A;  2F9I B;  4RYF A;  1NZY A;  5JBX A;  2F9Y B;  2FW2 A;  5INF A;  3GLM A;  2Q35 A;  2VSU C;  3ISA A;  4YLH A;  3TT6 A;  4K29 A;  4HC8 A;  1WDM A;  2VX2 A;  4I4Z A;  1W2X A;  2C8T A;  3BPT A;  4KWB A;  5DU4 A;  2Q2X A;  5DUF A;  3ST9 A;  4WZ8 B;  4EML A;  1K32 A;  4FJW D;  3V5I A;  3OT6 A;  3T8B A;  3JU1 A;  2YJG A;  5E0S A;  3PZK A;  3H0Q A;  1Y7O A;  5IKL B;  2VSU E;  1XX4 A;  2D3T A;  2F6I A;  5DU6 A;  2CE3 A;  5G1Q A;  4ELX A;  4HDT A;  2ZL4 A;  4ZDD A;  3TV5 A;  3Q7H A;  3KQF A;  1ON9 A;  2FBM A;  4JCS A;  4RCN A;  3VIV A;  1XNY A;  3KTH A;  2F9Y A;  2EJ5 A;  3KTG A;  2VSS E;  3MOY A;  2X58 A;  3BF0 A;  2ZL2 A;  1UYR A;  3I47 A;  3OC7 A;  3R9S A;  1NZY B;  3T3W A;  5DZK A;  2J5G D;  4WCZ A;  3MYB A;  1TYF A;  4J2U A;  1HNU A;  1WDK A;  1RJN A;  1UYT A;  3QK8 A;  4NNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...