4FNFA

Lt-iib-b5 s74d mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLDGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin IIB, B chain
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 22
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fnfA00
4FO2A 1QB5D 5G3LF 5G3LD 1TIID 1QCBD 4FNFA 4FP5D
chains in the Genus database with same CATH superfamily
3OPOA 5IT9E 1HNZQ 2UUAQ 4RGTA 1KL9A 1H9SA 2VUMH 3S2HH 3S1QH 3D6WA 1NR4A 3FEWX 5IGFA 4GN4B 5FOBB 1WI5A 1C7YA 4H0LC 3M3YH 2F0EA 2PNRC 4NXNQ 4XXEA 1XNQL 1BUVT 3J7ZC 1EIHA 4A3KH 3HOXH 2KQ3A 1K8OA 4BBRG 2KEDA 3N6RA 1VS0A 3AU7A 4NP5A 5ELBA 3KJOA 2RBMA 4IFDG 2X6LA 1SYGA 3A5ZB 3Q24A 2K33A 4WFN3 3S2DB 1H9MA 3RUZA 2F1MA 3TRZA 2JEAI 1DM0B 1KAAA 1XMOL 5LMUL 4A3DG 4RHRA 5IP7G 5M5XH 5EBCA 1HR0L 2JEBI 4C3HH 1JJ2A 1O78A 1EQTA 5IYBH 1K9MC 1RIPA 3GV3A 4BBRB 2A8VA 2PZTA 4H44C 1S5CD 2R7ZH 5M3MG 4X3KA 1NAPA 1VQGA 4H13C 1BBXC 5EGTA 2CW0C 5C3EG 2RHSB 1GUWA 1GOZA 4YWKA 2QILA 2AQ3B 2PZWA 1Y1VG 1V43A 2HCCA 3G4SA 1XYIA 4L5TA 5GQOA 4HIOA 4XDXA 1E24A 2WB1G 1BCPD 5LL6X 1ENAA 1KRSA 4JI5L 2R92G 1A3TA 4JI7L 1HPCA 1CKOA 3WOFA 1YNNC 5T1IA 2JA5H 4XIGS 5NUCA 1MBYA 1TVXA 4OGQC 3BDOA 4A3MH 2WAQG 3BYTB 3L7ZC 4C3IG 4B08A 3KFUA 3G71A 2CQOA 1IYVA 3OWFA 1HQRD 1PH3A 4K5WA 4ZUIA 1NJIC 2Y0SE 3D31A 1IL8A 2OWOA 2WB1B 5ELNA 1VQ7A 2L9HA 4RG1A 5FLMG 1ML0D 2KCNA 4CBVA 2R92B 4GNXB 3DHQA 4YCUA 4YWLA 1OXTA 5IYCG 4LF4L 1XNQQ 3FMCA 1LM0A 1VQCA 4KY5A 3MEFA 2A5HA 3CHBD 1Z47A 4LF5Q 1HQMC 2IT1A 1PXUA 1YJNA 4ZUJA 4LWCA 2NVTH 1JMCA 2WAQB 1TWCH 4FO2A 3TSSA 4DK1A 2MHVA 5IGDA 2EZVA 2H4OA 1D5ZC 4ULLA 2MGSA 4DK6C 1AN8A 1W6KA 3DLLA 1IBKL 2EVBA 4FXDA 3Q6SA 1YI2A 1VQ9A 3PO2H 2XWBB 3O13A 1JOOA 1SBBB 1K73C 1XMOQ 5LMUQ 2A6HC 1T5XD 4J1MA 1STYA 1OXVA 4KHZA 5FKAC 1RKNA 5EKKA 2MUYA 3F2CA 1ESRA 1HR0Q 1Y1WH 2EQSA 4DK0A 4B9XA 1WD0A 2B3GA 4BBSG 3J81L 1ENCA 1X65A 1Q3LA 3HOUG 1YNJC 3K8AA 2X6GA 3HGBA 4MHEA 4P73A 2DJFC 1PH9A 3BG3A 1G291 1PFNA 1EIYB 1STAA 1NBWA 2K5QA 3QOLA 3A7AB 3NTKA 5C0XH 3TP5A 3HOWG 2WKCA 4LMQD 2A6ED 3ERSX 4X6AH 1FL0A 1YHQA 1LUZA 5JPNC 1MKHA 4OWXB 4DUZL 2EJFC 2K1BA 3I3CA 4EQOA 2B2TA 4JI5Q 4F8MA 2CQAA 4OWTB 4R1JA 1PRTD 4JI7Q 1HHVA 2B2VC 3GTPB 3PUYA 1PFMA 2VQEQ 1S72A 1CHPD 2RDFA 4HSPA 3I55A 4DV1L 4BBSB 1KXLA 1M1KC 4DUYL 3EVQA 3HOUB 3K7AH 1RTOA 2YU9B 1F77A 4B3RQ 4DAVA 1SNCA 1K83B 2O5JC 4HJAA 3J7AV 4PZ8A 4OO1G 1L0WA 3HOWB 4LNQA 2EPBA 3S1NH 4A3LG 3AYHB 2JA9A 2NB0A 2E75C 2BE5C 1E1TA 4B3TL 3NUCA 3SXHA 3UDIA 2F0HA 1Q46A 1SLJA 1VQEA 1PH6A 1C8CA 4HJ8A 1P8LA 3HKZG 5EPLA 4EGVA 2ZJRA 3BZKA 2GVAA 3MXPA 1MJCA 1TWHB 2JA6H 2ZTEA 2JA8G 2OEOA 1F9SA 1BQQT 2NVXH 3PO3H 4F7XA 4GOPC 3S24A 3T1YQ 1JWUD 1IW7C 4G7ZC 3M85A 4IZ8A 3F2UA 2Z4HA 1G2SA 5E3FA 2E76C 1GXDC 5KNDA 4IO9A 1LT3D 1IBKQ 4IPHA 3S14H 3KUPA 3IFTA 3RLOA 4C3JG 2Z1CA 2EE1A 3MXNB 2B29A 3KF8A 4X66L 1WJJA 2AMCB 3S17B 1G8ZD 2WIIB 2D2CC 1KQSA 3GTLH 4DR6L 5ELCA 3HKZB 3H3VC 5D3IB 1EY9A 1D1KA 2GN5A 2EXDA 3MXNA 1IKLA 3I91A 5E7NA 3U9OA 4FNFA 3V96A 4PNYA 3CAMA 1B53A 4K6DA 5FLXL 4HAEA 1LTID 2L5TA 1Q1EA 3ITPA 1H9RA 3VA7A 4ILWA 2K5HA 3NTIA 4A3IG 1Z7TA 1SYCA 2I5LX 4A3CG 1UUPA 3KF6B 3CRKC 4DUZQ 1SRUA 2CWPA 4LUOA 4A3EG 5CV6A 1GUNA 4L8JA 1J5EL 2B2VA 1RDPD 2G9HD 2CCZA 2F0VA 4K5VA 4CDEC 1VQ4A 1CKMA 4CDFC 3S15H 1A3UA 5JEAG 4DV1Q 3WOEA 2ZXOA 3B6YA 3WWVA 4PZ7A 2UXDL 3GTJH 3E9HA 2QKIC 3S1MH 3TDQA 1A3VA 1N9WA 4FVMA 4LF9L 5C4JH 4FDBA 4JBWA 3T1HL 5EKIA 2PI2E 2D5DA 3CQZH 1QZHA 4TVAB 4XT1B 3STBD 3I56A 1YBYA 1II3A 5I2XA 3J81j 2CWAA 4J15A 4WORA 4B3TQ 1EQRA 4K8IA 2V4DA 4BA1I 4A3EB 4F88A 3HOYH 4RA8A 4TSSA 4BY1B 4LF6L 2PMZE 4LUVA 2E2JH 3J7A5 4YY3L 1EUJA 1N32L 4A93G 1LTTD 1K8MA 4O0AA 4KJOA 1SXTA 5ELFA 4Q5VA 3QO2A 4JVZA 2MO1A 1BCPF 3L2PA 3I90A 1EU3A 4KKUA 5LMNL 2VB3X 4HIKA 1WCMG 2L4NA 1TS2A 1EYAA 2FMMA 4X66Q 4OO1I 2B2YC 2BDOA 4XT3B 3PGZA 1D1IA 1I6HB 3M7GA 1EQVA 3A56A 1XPOA 5I6WA 4DR6Q 4DR7L 1JE4A 5JPMC 2Q2HA 4TQUS 4KHPQ 1HFNA 1DOMA 2L55A 3SK8A 2BA0A 2MJ8A 2EY6A 4HTHA 3AQQA 4BA2I 4A93B 1FYCA 1HZCA 3EFXD 2I5MX 5C3WA 1IBLQ 3TN2A 3J81c 3RMHA 3E9IA 2AWNA 5F2DA 5AJ3Q 2K32A 1VQAA 3J81E 2NBFA 4RHSA 1L1OC 3GO5A 1PH5A 1HH2P 2LMCB 2SNSA 1J5EQ 4JBJA 2C5CA 5CR3A 1I4PA 4NDXA 4ODGA 5E4XA 5ISRA 1LO5D 2K03A 3MVVA 1VQOA 2EJMA 2UXDQ 4B3MQ 3CCQA 2OTLA 2XSCA 1GM5A 1NTGA 1HA5A 3R93A 2K5WA 3A54A 2EDGA 3NBIA 4GKKQ 1IKMA 1LLRD 1PYSB 2C9OA 2K14A 2RCNA 4X62L 4Y7NB 1R4QB 3M4QA 4DFAA 5HURA 1SFOB 4DKAC 3KK7A 4CKCA 2KUMA 1TKWB 1Q7YC 1E7ZA 1FGBD 5CBEE 1VQBA 2K5DA 1D2BA 1QVGA 5KGUA 4LF6Q 3V05A 3HS0C 1MIUA 4JI4L 1CKNB 5DLQE 4K8JA 3CU7A 4YY3Q 1CSQA 1R4PB 1B9MA 3HP3A 4I65A 1ASYA 1N32Q 2AQ1B 3UE0A 3TREA 3CCUA 1F2ZA 1KABA 1Q81C 3PIPA 4BBRH 1CKNA 4CKBA 4KV6A 1O7YA 1PRTF 5EPJA 5JVG3 3OIQA 4WJ3M 4JBKA 3NWTA 4DR5L 5M5WB 1PTOB 3GV6A 4R4TA 3CCSA 3HEJA 1HR0W 2NVYB 3KDFA 4DXGA 4HSVA 4L5QA 4AYBB 2CH4W 4R8NA 4NKLA 5C44H 1WTXA 2MFIA 3RR5A 1ZYRD 4EVOA 2TSSA 1GJXA 1X3EA 3CCEA 1VQ5A 1B3AA 2R93B 1LTRD 2IPKD 1HCZA 1TWFH 4Q0FA 3U9SA 3A8JE 4UP7A 4LFCL 4ZRZA 3LNNA 2N88A 1B7YB 2B63B 4HIDA 4WJWA 4A3GB 4R9WA 3KLSA 2QF7A 1IBML 4C1NI 2RF4A 3ND8A 3MEHA 1BCPB 3URYA 5M3FG 4DV0L 2E5LQ 1DGSA 2Q2TA 3NSWA 3DEPA 2QCPX 2Z4IA 5IE8A 3OTOL 5FO7B 5FLXc 2F0IA 1VQMA 3PUVA 5C0XJ 1OXUA 4DK3C 4QB4A 4G57A 5C4XG 5FLXE 1L0XB 2R92H 5D14A 2HHHL 4UAIA 5JOBA 3E0JA 4N8X1 2K05A 3BZCA 3FPUB 1EY8A 3PUXA 4X62Q 2F3VA 1YITA 2KEEA 4DAYB 2AUKA 5IT9c 4KD3A 5M3FB 1SN8A 2OT2A 3PMFA 4KD4A 2KHJA 3DWPA 4NW2A 4JI2L 2ICIA 1TY2A 4DAYA 3CRLC 4X64L 5C4XB 5EJWA 3DWAA 3SK6A 5I2YA 3HOZB 2B2UC 3KLWA 1S5BD 1X3QA 4LF8Q 3ULPA 3DUZA 1W2BA 1N33Q 1HTLD 2EY2A 5EKLA 4DA2A 4XYQA 3KYHC 4BS9A 4K0KL 5BR8L 4JI0L 4DR5Q 1DCZA 4YHHQ 3DMUA 2AWOA 3J7YW 2BA1A 1E2WA 1UEBA 1LTAD 2A68D 2RVLA 1PH8A 5LHY1 1X54A 3U4VA 4ID6A 2F0TA 5GADC 1VF7A 2K7VA 2Q8IB 3GTPH 2Z6BA 4RKLA 3FRPB 4QUCA 1VQIA 1HNWL 4LFCQ 4XQJA 3DM1A 3R2IA 1D5MC 1S5FD 3G7LA 2YU9H 2EIFA 1U9RA 1K83H 3RNUA 5CV4A 3M4PA 4DV0Q 3HOWH 5FJ8H 4WRDA 1PRTB 2K52A 4DV2Q 4X3SA 3OTOQ 2IW3A 3P20A 1FNWA 5ELDA 3WDNA 4U673 1E22A 4JPBW 3T13A 1TWAB 2UXCL 5M5YB 5KYIA 4RFBA 4DR2L 1XPUA 4JG2A 3QB3A 3ICEA 1GKHA 2HHHQ 4A3DB 2YYZA 1PFBA 1TWHH 2F0NA 3D4RA 1I4GA 4IPDA 1CA6A 1CQFA 1ZEQX 4N9TA 1ASZA 1MHWC 2MP1A 2FMCA 4MN3A 4RWSC 4DR3Q 3FPPA 3KOJA 5L37A 2QDLA 2QDBA 5HY6A 2CH4A 3I4NG 2Z8LA 4TRDA 3Q22A 5M3MB 2A1AA 3GTOB 1WVLA 3MZ5A 3QOJA 4JOIC 3STBC 5C3EB 4JI2Q 5IIFA 2WKDA 3GTQB 2JXMB 1Y1VB 1U4MA 4X64Q 1FD7D 2B2UA 3PIOA 4KJNA 5J3BA 5JJLA 4KN7C 2RDGA 3I4MG 4MZ9A 1EQQA 5J39A 3U58A 1EFID 1K3BC 1KD1C 3UDGA 3M9BA 3CCVA 2D0PA 2VQFL 1A6XA 2EYHA 4K0KQ 2TMPA 2R61A 2XVSA 5BR8Q 4JI0Q 3ULJA 2QGQA 4NMZA 3PIP3 5C4ZA 1MJEA 5EPKA 1GD7A 4C3IB 2VUMG 2F0UA 4O42A 2F0KA 1PH4A 5D3DA 4QMGA 2H5XA 1EU4A 4POFA 3BVGA 1TS5A 3F2BA 4IPGA 4Y52H 3ULLA 4CGYB 1SROA 1LT5D 1JJGA 1SYEA 1STGA 2Z0SA 4A3KG 4L5RC 3MXUA 2AQ2B 1GVPA 3I7FA 3I4MB 1SDFA 1SE4A 2A69C 2PQAB 1DONA 3AB9A 2HDLA 4YCWA 4QCLA 2VS1A 1FNUA 3K57A 1CZGA 4JYAL 5CV7A 1AEXA 5KNCA 4RGNA 5CGKA 1A2UA 3K58A 3I8ZA 2N49A 2RSNA 2Q8RE 4ALPA 1Y8OB 1OO9B 2E8GA 2PQAA 4DAMA 1RCVD 1VDZA 1EFWA 4A3CH 2AKWB 3CCJA 3RZOB 2XRSD 3MFYA 2UXCQ 2K5NA 1EWIA 1D5XC 4IFDI 4DR2Q 4IUNA 5IP9G 4BY1H 4IQZA 1QB5D 2KECA 1NMFA 4C3HG 5C4HA 1Z9FA 4A3KB 3FVQA 5JEAH 2XRQD 5DM63 3CP0A 2DN8A 2J0TD 4OIKA 4R8IA 2F0PA 1Q8KA 2RCFA 4QJFA 4PV1C 3EJIA 1SNQA 3D0FA 5CBAE 3S1RB 2QEJC 3I70A 2NVQB 1OXSC 3FKIG 5CYUA 3KJPA 4IPCA 4JOIA 1B44D 1M90C 3NE5B 4G7HC 1CA5A 4P2CB 5JJZA 1VF5C 1XNRL 3RZDH 1I6HH 4JI6L 1WTPA 1PA6A 3DWQA 5M5XB 4ZKBB 1B70B 4A3BG 1NY4A 1STEA 4V190 2UU9L 3HFZB 4A3JH 5HGQA 3N52A 3H0GG 3RN2A 1G6PA 1EY4A 5E1FA 2BCOA 4LF4Q 1CI3M 5C5MA 5A2QL 4A93H 2UXBL 1E2VA 1GUTA 3K0YA 1BKBA 3GQBA 1PDQA 4QIWB 2IX0A 2VQFQ 1RD9D 3M4OB 1UAPA 3KF8B 2XIWA 5C3XA 3FKIB 1YVCA 1J8IA 1KHIA 1HTPA 5JJKA 2OXPA 4JV5L 1XWEA 2FHTA 1ONLA 1N36L 3DXJC 2HCIA 3L9AX 1XXGA 4PQXA 2ZT9C 4A3BB 1IL2A 4K5XA 4AQYL 4IUTA 2YTYA 3BVMA 2B2WC 4DV6L 1S5DD 4K2LA 1V9PA 4C1NK 4C2MB 3H0GB 4HCSA 1ZYRC 1SYDA 3C2PA 4KLKA 4JYAQ 2JA8B 2P5ZX 2BH8A 3A55A 1AE3A 3A8IE 4Y7NH 1C4QA 2NN6H 1SNOA 3PO2G 2Q8TA 3R3OA 4IOAA 3VR6A 1A0IA 1WOCA 5KIXA 1QVCA 2XN9C 3MTSA 3RLFA 2IHFA 4DNIA 1PYBA 5J22A 1HJPA 3UE1A 2VW9A 4C3JB 4C56C 2KENA 1Y1WG 3OOCA 3K81C 1S3OA 5IYDG 2RSOA 3CCMA 1PH7A 1T9HA 1JJCB 4IUPA 3EQLC 1JWMD 2I0QA 2DY7A 3FDTA 3CC2A 3E0EA 3D8GA 3NWSA 4Z9CB 5D65A 1VQFA 2GVBA 1PFSA 1J9OA 1NMGA 1N34L 4DUYQ 4RCNA 1TWCB 2BH2A 2J4XA 5C0XG 1TU2B 2MO0A 3QR8A 1F9PA 1CFMA 4KN4C 2ASBA 4RAUC 2B8GA 1EEFD 1EOTA 4PG3A 4GLXA 1S40A 1WYDA 1E1OA 1XNRQ 1PTOH 1F9RA 4GN5A 1VQKA 3MFGA 2FFKB 2NVYH 4A3IB 4UDUC 2YTXA 4GOPB 2UU9Q 1Y1WB 5IGBA 1VQDA 3CPWA 4BXXH 1JT8A 2QA4A 4GS3A 1VQHA 2K5VA 1FJGL 4G4KA 2R93H 2KHSA 4X65L 3G6EA 2UXBQ 3H6MA 4YIJA 5IOCA 3CPFA 5ELOA 1Q8IA 3PIO3 1R9TB 1BR9A 4HMIA 3CXCA 4GOPA 3IRBA 2B63H 4G7OC 3ZJYC 1G2TA 3BU2A 2IHEA 2WB1E 1GHJA 4A3GH 1KDBA 1YEZA 3JAMi 2IX1A 1SE2A 3NEMA 3A5UA 4LUZA 3BYYB 4DPGA 4LAAA 2F4IA 2PNHA 2M2LA 2L11A 4DNTB 4JV5Q 1HNXL 5IODA 3RD4A 1UE5A 3CMEA 2JP1A 1SEBD 1N36Q 1PVOA 4OHJA 2NTSA 3S9WA 4KKTA 2WAQE 3C46A 2E2IB 4M8AA 2B2WA 4UP9A 2F0FA 3OMCA 1U4RA 2B39A 1KNEA 1I94L 2UUBL 1T5EA 1AZQA 2JA6G 4DV6Q 2A68C 4E6IA 4OXPA 3AFQA 4JCVE 3K5OA 4DF7A 1B1ZA 4HIMA 4LK1C 2M00A 3PO3G 2A69D 4OEMB 2XWJB 3S16B 1H9JA 4B9WA 4A3FG 2NTTA 3CMAA 1ENFA 2B8FA 2WP8J 3LX0A 3GTKB 3K59A 2I07B 1QE6A 1SYFA 2N78A 5C6AA 1SNMA 2L1BA 4DR1L 3MHBA 2E2DC 3UDFA 2E2HB 4DV7L 3TP8A 1WCMB 5GAEC 1PH2A 2IX3A 2J7ZA 5GAGC 1JICA 2JA6B 1CUKA 5BN4A 1I4QA 3HOZH 1LTBD 2ES2A 4ZCKA 1SAPA 3CCRA 1N34Q 2JQOA 1FNVA 4R4IA 4A3FB 2Y0SG 4LF9Q 1JC7A 4UHVA 1PMRA 1UWVA 1JB7A 1ET6A 1EZ6A 3T1HQ 3VYSA 1TWGB 3GTGB 1OTCA 2NZ1D 4EX5A 1TR5A 4GZYC 4QQBX 3S2DH 1DOLA 5JVH3 4RCOA 2PW7A 1O7IA 3ND9A 2R7FA 3F2DA 3IAYA 1FJGQ 1QCBD 2HIXA 4X65Q 3K5LA 3I73A 1B2TA 1PZKD 1Z6HA 5G3LD 3W1BA 1FR3A 2AHOB 2GA4B 1ICWA 1AP0A 3P7JA 1TY0A 5DEHA 3Q8DA 2DUDA 1MD2D 1QUQA 4J6HA 3ERQA 2Y0SB 4S3SA 1JORA 2ZXPA 2KBNA 3HKSA 2HQLA 3I72A 4LJZC 5C0XI 3KDFB 3TEHB 1HNXQ 1HNZL 5LMNQ 1NCVA 5ELEA 4UY8C 2B2YA 1WTQA 3H3VI 4IFDH 3PCOB 4HJ7A 1TWAH 3EIVA 1I94Q 2FXQA 2UUBQ 4K6LA 2AUJD 3P75A 4P75A 3K5NA 2I46A 1NUCA 1TQOA 4DR7Q 4FXGC 1AW7A 3NELA 4A3DH 2L15A 3OW7A 3TP6A 2Q2IA 1U5KA 5IP7H 4NB3A 3LWEA 1X55A 1SE8A 1IHZA 1G51A 2WFWA 4IUUA 1BBUA 3CF5A 5CV9A 4JI1L 1L1OB 3VR4A 1YJ9A 1CM9A 1BVSA 3CQZB 3HKZE 1MSHA 3JC66 1HUNA 1LACA 4KY7A 2EYJA 4PMWA 1PV4A 1QOHA 2SOBA 4PZ6A 4KMUC 5IGEA 5M3MH 2OQ0A 3GTOH 4CJ1B 4DV7Q 5COYA 4CKEA 1L1OA 5C3EH 3OW2A 3GTQH 1EOVA 2E74C 3Q0AA 5BN3A 1Y1VH 2DNCA 3T51B 2F0SA 1TIID 4FF4A 5TSSA 2PW5A 3KBXA 2F0JA 1KDAA 1MSGA 2ICEC 3I4OA 4GN3B 3P1HA 2N3SA 1SNDA 1F9QA 1VMCA 2JE6I 4TKOB 2OCEA 3GD7A 1LABA 1I3QB 3OWEB 4OONA 3NENA 5JEAJ 1EYCA 2ZTDA 2MPMA 1RF2D 1EY6A 4HEDA 4C3IH 5FO8B 1ZKOA 2IJ0A 4N9PA 1VQPA 4ZKCB 3U4ZA 4DN4M 1BNZA 5CORA 4V0BA 2A19A 3E3XA 3TS2A 2CHBD 3SGIA 4JI4Q 5FO9B 1XTDA 5A35A 5BN5A 1F2MA 1D8LA 5FLMH 3I4MH 5IY0A 1HZ9A 2CVRA 5IYCH 2JA7G 1LTGD 3TZDA 3JAML 1LYLA 4X3TA 3EA6A 3HOVG 3A7LA 2EYPA 1X3FA 4L6TB 1OXXK 3LGJA 2FINB 5EBDA 1A2TA 1B50A 4PMCA 3RZOH 1A62A 2G9DA 1SMXA 2VL6A 2BOSA 2KVMA 1E3PA 1EY5A 2Z9HA 2DNEA 2K6AA 1X3GA 1K8AC 3H94A 3Q23A 5IGCA 4JI1Q 4LF5L 5EQ0A 1WTWA 3KLRA 2CFMA 4BBSH 2JA7B 5KRUA 1Q90A 4HCEA 2NWGA 3HOUH 3S1RH 3HOVB 1HUMA 4GNXC 1IBMQ 2NVQH 5DNFA 3NXWA 3UDXA 2ZM6L 1CK1A 4A75A 4FXKC 4RGOS 1SYBA 4AH6A 4U68A 2X69A 1JQYD 1CQVA 1FGUA 1Q12A 5C44G 5CV5A 2HIVA 1VQ8A 2QEXA 2Z6KC 5K36G 4CDCC 3VR3A 1PLFA 1PTOD 3J80i 2EYOA 5IP9H 2F0OA 5IWAL 1B8AA 1EY0A 2YV5A 2PQEA 1QILA 3BDLA 3GTMB 1DD2A 1I50B 2SDFA 3FHWA 3QIAA 3M4OH 3SDZA 2ZJQA 4FP5D 4ME3A 1PZID 3D4DA 3FKIH 2HT1A 1EZ8A 2LSSA 3SVMA 4BY7G 2LXKA 2PCFB 1AFPA 1BDOA 4OO1H 4JI3L 1N8RC 2IY5B 1YHAA 2N8NA 1O80A 5C44B 4KI0A 4ME5A 4A3LH 4FF2A 1DJRD 4A3BH 3S17H 2B2TC 1CTMA 2N55A 3A0JA 2PZUA 3AMUA 2YTVA 2VQEL 4HJ5A 1V1PB 2RDHA 1TWFB 4C2MH 1SSOA 4JI8L 4DV4L 3H0GH 2ENBA 1ILPA 1KAWA 3K7UC 2ALYB 4CJ2C 3I4LA 1D6EC 1GUOA 3HRZC 2F0LA 2KA7A 3TMEA 4IN3A 2JA8H 4O2DA 4B3RL 2FJ2A 1EY7A 1YHBA 5CV8A 3MA2B 5KYLA 1V1PA 4DGZA 2PI2A 1AZPA 1E0BA 2PMZB 5IGGA 1I4XA 3NTHA 4BY7B 1L0YB 1BF4A 1M4VA 3I4NB 3SEBA 1WTVA 4RGMA 4C3JH 3M7NA 4ZAIA 3T4AC 2PO4A 1K8GA 3KLSX 1SJED 3LWUA 3F8TA 3DM3A 1P16A 4MIUA 3T56B 1KNAA 3I2ZA 4I7AA 2UUCL 1HNWQ 3HOXG 1B9NA 4IALA 4YWMA 4AYBE 3T1YL 4KY6A 5GROA 4EQ5A 4LFBL 2EYLA 3BS1A 1LTLA 3C1EA 4GNXA 1Q1BA 2L12A 5EAYA 3PUWA 4L5SA 2ZM6Q 4XQQA 1ZXTA 1SMYD 1XTCD 1VMPA 1RL2A 2JN4A 2L0CA 1U4LA 4IUVA 1C0AA 2WV6D 4IOCA 4EQPA 4JW0A 3CC4A 1CT1D 2VNUD 3BZDB 5G3LF 2Z6KA 1S5ED 4A3IH 3M4YA 1MI2A 1UE7A 1QVFA 2VUMB 2LS01 2JK8A 2VZAA 3S2HB 1Y8NB 3W5OA 3S1QB 3V2TA 3CW2C 4A3EH 1F2YA 1STHA 5IYDH 1SJHD 3OSOA 2OQKA 5IWAQ 3M3YB 4BWGB 1SNPA 1YZ6A 3RN5A 3OYYA 2K01A 2C35B 4K14A 3HOXB 1R9TH 1AE2A 1MGSA 4IJLA 2LY7A 5IYBG 1NSNS 1QWYA 3A8KE 2O2LD 5E4WC 1IXRA 5FJ8G 2R7ZG 2CKZB 1JCKB 2F0GA 4ABNA 2K28A 4L63B 4FF3A 2I5HA 1VQNA 3H3VH 4JI3Q 2EY1A 3EROA 2G5DA 1IZ6A 2KJXA 2EOTA 2F52A 3W1GA 2E2IH 3NQIA 2R7DA 2RQXA 4H7BA 2F4VL 2XTIA 3H15A 1TS4A 3K0XA 4JI8Q 4DV4Q 1HXYD 4OIJA 1G91A 4YCVA 1LT6D 4C3HB 3S16H 4CDDC 5K5PA 2JA5G 1GHKA 5LMNW 4DR4L 4A3MG 1XMQL 1H95A 3GTKH 2DGYA 2XNAC 1RTNA 1RHPA 2HDMA 3G6JB 2R7ZB 3IFDA 3IL8A 3BVZA 4P71A 1EEID 3SR1A 1K0SA 3VR2A 3ZYYX 2VB2X 3JAMc 2PYKA 1C9OA 2RA4A 1QNUA 4RKBA 5FK9C 2E2HH 2SNMA 1WCMH 2R6GA 3AFPA 2ID0A 3UI2A 4MTNA 1UE6A 1Y14B 2VXWA 5CMDA 3JAME 2Q2UA 3CCLA 4WJ4A 2LXJA 2F0MA 1RODA 4K2KA 2ZXRA 4P72A 2UUCQ 4IFDJ 2DY8A 2H1EA 4RH6A 1ILQA 1W6JA 4DU9A 3E5SA 4LFBQ 2JA5B 1BO0A 4A3FH 1E2ZA 1LTSD 4CHTB 4A3MB 1Y69U 4FF1A 4DXFA 5KEEA 2QW7A 1V8QA 3NP8A 2ATWA 1TWGH 2JSOA 1QNKA 3GTGH 3HZXA 3W2DA 1SFOH 4NXML 2KCTA 3R8BA 1PYWD 3PF4A 1XPRA 3OMGA 1O7LA 2HQEA 1KLUD 1HA6A 3J80L 1HRJA 4DV5L 4KHPL 3QG1A 4LW1A 1C48A 2KHIA 2NUCA 4B3SL 1VQJA 1IYJB 5DM73 3NBHB 2OTJA 3MWYW 1NNXA 1B4OA 1X56A 1STNA 4DAPA 4KKSA 3QJYA 1IBLL 2EYMA 1JOKA 1RJTA 2KCCA 5I9PA 2NVTB 2CW0D 1EL0A 1WFQA 3VA5A 3K80C 3NBHA 4HJ9A 5AJ3L 5I4DA 3MC0B 3PQIA 3EN2A 3PO2B 2WINB 3ER0A 3HG9A 4BY1G 2K04A 3K6OA 2LFNA 4R4CA 4QF4A 5M5WH 3NQTA 4JI6Q 1F2LA 2F4VQ 1I6VC 4ZYSA 3KF6A 1K3RA 1A15A 1TXYA 1A8VA 1YNND 3C1FA 4B3ML 5IT9L 4N8FA 2RHQB 1KIXA 5JAVA 3TBIB 1XJVA 3GP7A 1JR0D 4DR4Q 1XMQQ 4GKKL 3ONAB 3SE0A 4IJHA 4DNRB 3MXGA 1UEAB 4LFAL 1PTOF 3H91A 5M9OA 4FYDA 4HR7B 4OX9L 3F1ZA 1TT2A 1ET9A 1BOSA 3AEVA 3L3OC 4F87A 2F0DA 4A3JG 3PV0A 5AFWA 2EJGC 4XTCS 1XX8A 1EIGA 4NPSA 4ZQ3A 2K75A 2NZHA 4UP8A 2KOLA 3VYRA 4AQYQ 1A63A 1G6ZA 1CZWA 4OWWB 3TP7A 1H9KA 1M8AA 3K7AB 2K4KA 4JC0A 1I3QH 4KTAA 1VCIA 3G48A 4PMBA 3DEOA 5J1ZA 5I9OA 4JK1C 3TZUA 4O1NA 3OHXC 3K5MA 3BJUA 3TQYA 3RZDB 3S1NB 4NXMQ 2A6HD 1YJWA 5M3FH 3R2TA 5CC4A 2EXZA 2HUGA 1Q86C 1QJOA 4DV5Q 4A3JB 3EBEA 4B3SQ 3C3LA 1JB3A 4DV3L 4KK7A 2ZTCA 1DZ1A 1YNJD 1PTOC 4AIMA 5C4XH 4QUFA 3TS0A 1GO3E 4GLAC 1I4RA 2OF1A 1B3QA 2NVXB 3PO3B 4M1UB 2D62A 1S4ZA 2PPBC 3NPPA 1U4PA 2NN6G 1GUGA 1GUSA 1BXTA 2F03A 1X9NA 1Q82C 3X3NA 4ZLTF 2E5LL 4CJ0B 3S14B 3FP9A 1ESFA 4QGUA 4ZK9B 2NYZD 1ICFB 4LF7L 4OL7A 3CD6A 4XYOA 4JBMA 1UNSA 1BBWA 4GKJL 1BCPC 2JJQA 3GTLB 2KCMA 1CHQD 2NZOA 4UPAA 2A74C 1QUQB 4H02A 1YIJA 1WTOA 4MTKA 2IL8A 1EWHA 3NK9A 2MQHA 4J8QA 2JA7H 1KLGD 1WTHA 1CSPA 1DOKA 1KDCA 2F0WA 2LKVA 2SEBD 3OIPA 5GAHC 1JOQA 4R4OA 4LFAQ 1VQLA 1SR3A 1X32A 4IURA 4APVA 2MNAA 3PF5A 1X3PA 3VYUA 2IWHA 3HOVH 2O4XA 4OX9Q 1K0RA 1I4HA 4QL5A 2BE5D 4A4IA 4AYBG 4POGA 1EYDA 2V1CC 4I7ZC 3VYTA 2O5IC 2UUAL 1VQ6A 4QIWE 3PSIA 1TS3A 2WACA 4BXXG 5A2QE 5I6YA 3HOYG 1PZJD 2D9UA 3SK4A 2R93G 4XQNA 3VDYA 5T1GA 5KNBA 5M5YH 3CKIB 1STBA 3S15B 1EIFA 4NXNL 4LF8L 1L2FA 2B63G 5JJIA 3D4WA 2F0QA 1O7ZA 3GTJB 4A3GG 2RKSA 1HZBA 2HD3A 3S1MB 1K28A 1N33L 3GTMH 1IW7D 1J6QA 5C4JB 1I50H 5DAUA 1SE3A 3KBGA 2F3WA 4RMFA 2VY3A 3IKJA 3X3MA 1W3SA 4YHHL 1HFGA 1PHJA 1U0LA 4MNOA 3SHLA 1D7QA 1EYGA 1SMYC 4DR1Q 1V1OA 1Y8PB 2D0OA 2EY5A 1FVIA 4HMJA 1YNXA 1V1QA 3HOYB 5K36H 3CC7A 1LV9A 3W3AA 4DV3Q 5C5LA 1PH1A 2E2JB 4OELB 2XGTA 4KHVA 1I5FA 4X3UA 3E6ZX 3J80c 3J81i 3RLNA 2ZJPA 1JE5A 4HN7A 1JWSD 1HZAA 3L0OA 1X6OA 4GLVB 1WD1A 3J80E 3QWNA 4EQNA 1QG7A 3A74A 1KRTA 1AH9A 3T16A 4A76A 4DV2L 1EWCA 3H09A 1NE3A 2A6EC 3VR5A 1KC8C 4BY7H 2JYOA 4LF7Q 1WTRA 1KTKA 1IYUA 3I4NH 1DYQA 5HGTA 2K50A 3PUZA 5H1SE 2R3ZA 3NHHA 2F3IA 3BDCA 4GKJQ 3GDEA 4IUQA 3HOZG 2EYFA 4QY7A 1PRTC 3T53B 4R4QA 5LL6S 3U50C 3SK5A 1LT4D 2M9VA 3J7AF 4DR3L 1H9SB 3D3RA 2BDNA 1UE1A 3D6CA 1NR2A 2DJGC 1QZGA 2A73B 3MAQA 1DXMA 2NN6I 4P74A
chains in the Genus database with same CATH topology
3OPOA 5IT9E 4RGTA 1H9SA 3D6WA 1NR4A 3FEWX 5IGFA 5FOBB 4H0LC 2F0EA 2PNRC 4XXEA 1BUVT 1EIHA 2KQ3A 1K8OA 2KEDA 3N6RA 3AU7A 4NP5A 5ELBA 2RBMA 4IFDG 2X6LA 1SYGA 3Q24A 2K33A 4WFN3 3S2DB 1H9MA 3RUZA 2F1MA 2JEAI 1DM0B 1KAAA 4RHRA 5EBCA 2JEBI 1O78A 1EQTA 3GV3A 4BBRB 2PZTA 4H44C 1S5CD 4X3KA 1NAPA 1BBXC 4H13C 5EGTA 2CW0C 1GUWA 1GOZA 2QILA 2AQ3B 2PZWA 1V43A 2HCCA 1XYIA 4XDXA 1BCPD 5LL6X 1ENAA 1A3TA 1HPCA 3WOFA 1YNNC 5T1IA 4XIGS 5NUCA 1MBYA 1TVXA 4OGQC 3BDOA 3BYTB 3L7ZC 4C3IG 4B08A 1IYVA 3OWFA 1HQRD 4K5WA 4ZUIA 3D31A 1IL8A 2WB1B 2L9HA 1ML0D 2KCNA 4CBVA 2R92B 3DHQA 1OXTA 3FMCA 4KY5A 2A5HA 3CHBD 1Z47A 1HQMC 2IT1A 1PXUA 4ZUJA 2WAQB 4FO2A 2EZVA 3TSSA 4DK1A 2MHVA 5IGDA 2H4OA 1D5ZC 4ULLA 2MGSA 1AN8A 1W6KA 2EVBA 4FXDA 3Q6SA 2XWBB 3O13A 1JOOA 1SBBB 2A6HC 4J1MA 4KHZA 5FKAC 1T5XD 1OXVA 1STYA 1RKNA 5EKKA 2MUYA 1ESRA 4DK0A 4B9XA 1WD0A 3J81L 1ENCA 1Q3LA 1YNJC 2X6GA 3HGBA 4MHEA 3BG3A 1G291 1PFNA 1STAA 2K5QA 3QOLA 3A7AB 3NTKA 5C0XH 3TP5A 2WKCA 4LMQD 2A6ED 5JPNC 2EJFC 2K1BA 3I3CA 4EQOA 2B2TA 4F8MA 2CQAA 1PRTD 1HHVA 2B2VC 3GTPB 3PUYA 1PFMA 1CHPD 2RDFA 4HSPA 4BBSB 3EVQA 3HOUB 1RTOA 2YU9B 1F77A 4DAVA 1SNCA 1K83B 2O5JC 3J7AV 4OO1G 3HOWB 2EPBA 2NB0A 2E75C 2BE5C 3NUCA 3SXHA 2F0HA 1C8CA 5EPLA 4EGVA 3MXPA 1TWHB 2OEOA 1F9SA 1BQQT 4F7XA 1JWUD 1IW7C 4G7ZC 3M85A 4IZ8A 3F2UA 2Z4HA 1G2SA 5E3FA 2E76C 1GXDC 5KNDA 1LT3D 3KUPA 3IFTA 4C3JG 2Z1CA 2EE1A 3KF8A 3S17B 1G8ZD 2WIIB 2D2CC 5ELCA 3HKZB 3H3VC 5D3IB 1EY9A 1D1KA 3MXNA 1IKLA 3I91A 3U9OA 4FNFA 3V96A 4PNYA 1B53A 4K6DA 5FLXL 4HAEA 1LTID 2L5TA 1Q1EA 3ITPA 1H9RA 3VA7A 4ILWA 3NTIA 1Z7TA 1SYCA 1UUPA 3CRKC 5CV6A 1GUNA 4L8JA 2B2VA 1RDPD 2G9HD 2F0VA 4K5VA 1A3UA 5JEAG 3WOEA 2ZXOA 2QKIC 3TDQA 1A3VA 4FVMA 4JBWA 5EKIA 2D5DA 4XT1B 1II3A 5I2XA 4WORA 4K8IA 2V4DA 4BA1I 4A3EB 4F88A 4RA8A 4TSSA 4BY1B 1LTTD 1K8MA 4KJOA 1SXTA 5ELFA 4Q5VA 3QO2A 1BCPF 3I90A 1EU3A 4KKUA 2VB3X 2L4NA 1TS2A 1EYAA 2FMMA 4OO1I 2B2YC 2BDOA 4XT3B 1D1IA 1I6HB 3M7GA 1EQVA 3A56A 5I6WA 1JE4A 5JPMC 4TQUS 1HFNA 1DOMA 2L55A 3SK8A 2BA0A 2MJ8A 2EY6A 4HTHA 4BA2I 4A93B 1FYCA 3EFXD 5C3WA 3TN2A 3RMHA 2AWNA 5F2DA 2K32A 3J81E 2NBFA 4RHSA 3GO5A 2LMCB 2SNSA 2C5CA 5CR3A 1I4PA 4NDXA 4ODGA 5E4XA 5ISRA 1LO5D 2K03A 3MVVA 2EJMA 2XSCA 1HA5A 3R93A 2K5WA 3A54A 2EDGA 3NBIA 1IKMA 1LLRD 2C9OA 4Y7NB 1R4QB 4DFAA 5HURA 1SFOB 3KK7A 4CKCA 2KUMA 1TKWB 1FGBD 5CBEE 2K5DA 1D2BA 5KGUA 3V05A 3HS0C 4K8JA 3CU7A 1R4PB 1B9MA 3HP3A 4I65A 2AQ1B 1F2ZA 1KABA 4CKBA 4KV6A 1O7YA 1PRTF 5EPJA 5JVG3 3OIQA 3NWTA 5M5WB 1PTOB 3GV6A 3HEJA 2NVYB 4DXGA 4HSVA 4AYBB 4R8NA 4NKLA 1WTXA 1ZYRD 4EVOA 2TSSA 1GJXA 2R93B 1B3AA 1LTRD 2IPKD 1HCZA 4Q0FA 3U9SA 3A8JE 4ZRZA 3LNNA 2N88A 2B63B 4WJWA 4A3GB 4R9WA 3KLSA 2QF7A 4C1NI 3ND8A 3MEHA 1BCPB 3URYA 3NSWA 3DEPA 2QCPX 2Z4IA 5FO7B 2F0IA 3PUVA 5C0XJ 1OXUA 4QB4A 4G57A 5FLXE 1L0XB 5D14A 4UAIA 5JOBA 3E0JA 2K05A 3FPUB 1EY8A 3PUXA 2F3VA 2KEEA 2AUKA 4KD3A 5M3FB 2OT2A 3PMFA 4KD4A 3DWPA 4NW2A 2ICIA 1TY2A 4DAYA 3CRLC 5C4XB 5EJWA 3DWAA 3SK6A 5I2YA 3HOZB 2B2UC 1S5BD 1X3QA 3DUZA 1HTLD 2EY2A 5EKLA 4DA2A 4XYQA 4BS9A 1DCZA 3DMUA 2AWOA 3J7YW 2BA1A 1E2WA 1LTAD 2A68D 2RVLA 5LHY1 4ID6A 2F0TA 1VF7A 2K7VA 2Q8IB 4RKLA 3FRPB 4QUCA 4XQJA 3DM1A 3R2IA 1D5MC 1S5FD 3G7LA 1U9RA 5CV4A 4WRDA 1PRTB 4X3SA 2IW3A 3P20A 1FNWA 5ELDA 3WDNA 4U673 3T13A 1TWAB 5M5YB 5KYIA 4RFBA 3QB3A 4A3DB 2YYZA 1PFBA 2F0NA 3D4RA 1I4GA 1CA6A 1CQFA 1ZEQX 4N9TA 2MP1A 2FMCA 4MN3A 4RWSC 3FPPA 2QDBA 2Z8LA 4TRDA 3Q22A 5M3MB 3GTOB 1WVLA 3MZ5A 3QOJA 5C3EB 5IIFA 2WKDA 3GTQB 2JXMB 1Y1VB 1U4MA 1FD7D 2B2UA 4KJNA 4KN7C 2RDGA 5J39A 1EFID 1A6XA 2EYHA 2TMPA 2R61A 2XVSA 4NMZA 3PIP3 5C4ZA 5EPKA 4C3IB 2F0UA 4O42A 2F0KA 5D3DA 4QMGA 1EU4A 3BVGA 1TS5A 4CGYB 1LT5D 1SYEA 1STGA 3MXUA 2AQ2B 3I4MB 1SDFA 1SE4A 2A69C 1DONA 3AB9A 2HDLA 4QCLA 1FNUA 3K57A 1CZGA 5CV7A 1AEXA 5KNCA 4RGNA 5CGKA 1A2UA 3K58A 3I8ZA 2RSNA 2Q8RE 1Y8OB 1OO9B 1RCVD 1VDZA 3RZOB 2XRSD 3MFYA 1D5XC 4IFDI 4IUNA 4IQZA 1QB5D 2KECA 4C3HG 5C4HA 4A3KB 3FVQA 5JEAH 2XRQD 5DM63 2DN8A 2J0TD 4OIKA 4R8IA 2F0PA 4PV1C 3EJIA 1SNQA 5CBAE 3S1RB 2QEJC 3I70A 2NVQB 1OXSC 5CYUA 1B44D 3NE5B 4G7HC 1CA5A 4P2CB 5JJZA 1VF5C 1WTPA 3DWQA 5M5XB 4ZKBB 1STEA 4V190 3N52A 1EY4A 5E1FA 2BCOA 1CI3M 5C5MA 5A2QL 1E2VA 1GUTA 3K0YA 3GQBA 1PDQA 4QIWB 2IX0A 1RD9D 3M4OB 1UAPA 2XIWA 5C3XA 3FKIB 1J8IA 1HTPA 2OXPA 1XWEA 2FHTA 1ONLA 3DXJC 2HCIA 3L9AX 1XXGA 4PQXA 2ZT9C 4A3BB 4K5XA 4IUTA 3BVMA 2B2WC 1S5DD 4K2LA 4C1NK 4C2MB 3H0GB 4HCSA 1ZYRC 1SYDA 3C2PA 2JA8B 3A55A 3A8IE 1C4QA 2NN6H 1SNOA 2Q8TA 3R3OA 3VR6A 5KIXA 2XN9C 3MTSA 3RLFA 5J22A 4C3JB 4C56C 3OOCA 2RSOA 4IUPA 3EQLC 1JWMD 2DY7A 3FDTA 3D8GA 3NWSA 4Z9CB 5D65A 1J9OA 4RCNA 1TWCB 2J4XA 5C0XG 1TU2B 1F9PA 1CFMA 4KN4C 4RAUC 2B8GA 1EEFD 1EOTA 1PTOH 1F9RA 3MFGA 2FFKB 4A3IB 4UDUC 1Y1WB 5IGBA 4G4KA 2KHSA 3H6MA 4YIJA 5IOCA 1Q8IA 3PIO3 1R9TB 1BR9A 4HMIA 4G7OC 1G2TA 1GHJA 1KDBA 2IX1A 1SE2A 3BYYB 4LAAA 2F4IA 2M2LA 2L11A 4DNTB 5IODA 3RD4A 2JP1A 1SEBD 4OHJA 2NTSA 3S9WA 4KKTA 3C46A 2E2IB 4M8AA 2B2WA 2F0FA 3OMCA 1U4RA 2B39A 1KNEA 1T5EA 1AZQA 2A68C 4E6IA 4DF7A 3K5OA 1B1ZA 4LK1C 2M00A 2A69D 2XWJB 3S16B 1H9JA 4B9WA 2NTTA 1ENFA 2B8FA 2WP8J 3LX0A 3GTKB 3K59A 2I07B 1QE6A 1SYFA 5C6AA 1SNMA 2L1BA 3MHBA 2E2DC 2E2HB 3TP8A 1WCMB 2IX3A 2J7ZA 1JICA 2JA6B 5BN4A 1I4QA 1LTBD 1SAPA 1FNVA 4A3FB 1JC7A 1PMRA 1ET6A 1EZ6A 3VYSA 1TWGB 3GTGB 2NZ1D 1TR5A 4GZYC 1DOLA 5JVH3 4RCOA 2PW7A 3ND9A 3IAYA 1QCBD 3K5LA 3I73A 1B2TA 1PZKD 1Z6HA 5G3LD 1FR3A 2GA4B 1ICWA 1AP0A 3P7JA 1TY0A 5DEHA 1MD2D 4J6HA 3ERQA 2Y0SB 4S3SA 1JORA 2ZXPA 3I72A 4LJZC 5C0XI 1NCVA 5ELEA 2B2YA 1WTQA 4IFDH 4K6LA 2AUJD 3P75A 3K5NA 2I46A 1NUCA 1TQOA 4FXGC 1AW7A 3OW7A 3TP6A 3LWEA 4IUUA 1IHZA 5CV9A 3VR4A 1CM9A 3CQZB 1MSHA 1HUNA 1LACA 4KY7A 2EYJA 4PMWA 1QOHA 2SOBA 4KMUC 5IGEA 4CJ1B 5COYA 4CKEA 2E74C 3Q0AA 5BN3A 2DNCA 3T51B 2F0SA 1TIID 4FF4A 5TSSA 2PW5A 3KBXA 2F0JA 1KDAA 1MSGA 2ICEC 3P1HA 1SNDA 1F9QA 1VMCA 2JE6I 4TKOB 3GD7A 1LABA 1I3QB 3OWEB 5JEAJ 1EYCA 2MPMA 1RF2D 1EY6A 4HEDA 5FO8B 1ZKOA 2IJ0A 4N9PA 4ZKCB 4DN4M 1BNZA 5CORA 4V0BA 2CHBD 5FO9B 5A35A 5BN5A 1F2MA 2CVRA 1LTGD 3TZDA 3JAML 4X3TA 3EA6A 3A7LA 2EYPA 4L6TB 1OXXK 2FINB 5EBDA 1A2TA 1B50A 4PMCA 2G9DA 2BOSA 2KVMA 1EY5A 2DNEA 2K6AA 3H94A 3Q23A 5IGCA 5EQ0A 1WTWA 3KLRA 2JA7B 5KRUA 1Q90A 4HCEA 2NWGA 3HOVB 1HUMA 5DNFA 3NXWA 1CK1A 4FXKC 4RGOS 1SYBA 4U68A 2X69A 1JQYD 1CQVA 1Q12A 5CV5A 5K36G 3VR3A 1PLFA 1PTOD 2EYOA 2F0OA 1EY0A 2PQEA 1QILA 3BDLA 3GTMB 1DD2A 1I50B 2SDFA 3QIAA 3SDZA 4FP5D 1PZID 3D4DA 1EZ8A 3SVMA 2PCFB 1AFPA 1BDOA 4OO1H 1O80A 5C44B 4KI0A 4ME5A 4FF2A 1DJRD 2B2TC 1CTMA 2N55A 2PZUA 3AMUA 1V1PB 2RDHA 1TWFB 1SSOA 2ENBA 1ILPA 4CJ2C 3I4LA 1D6EC 1GUOA 3HRZC 2F0LA 2KA7A 3TMEA 4IN3A 2FJ2A 1EY7A 5CV8A 3MA2B 5KYLA 1V1PA 4DGZA 1AZPA 1E0BA 2PMZB 5IGGA 1I4XA 3NTHA 4BY7B 1L0YB 1BF4A 1M4VA 3I4NB 3SEBA 1WTVA 4RGMA 3M7NA 4ZAIA 3T4AC 2PO4A 3KLSX 1SJED 3LWUA 4MIUA 3T56B 1KNAA 1B9NA 4IALA 4KY6A 2EYLA 3BS1A 3C1EA 1Q1BA 2L12A 3PUWA 4XQQA 1ZXTA 1SMYD 1XTCD 1VMPA 2L0CA 1U4LA 4IUVA 2WV6D 4EQPA 2VNUD 1CT1D 3BZDB 5G3LF 1S5ED 3M4YA 1MI2A 2VUMB 2LS01 3S2HB 1Y8NB 3S1QB 3V2TA 1F2YA 1STHA 1SJHD 3OSOA 3M3YB 4BWGB 1SNPA 2K01A 4K14A 3HOXB 1MGSA 2LY7A 1NSNS 1QWYA 3A8KE 2O2LD 5E4WC 1JCKB 2F0GA 4ABNA 2K28A 4L63B 4FF3A 2EY1A 3EROA 2KJXA 2EOTA 3NQIA 2RQXA 4H7BA 1TS4A 1HXYD 4OIJA 1G91A 1LT6D 4C3HB 5K5PA 1GHKA 2XNAC 1RTNA 1RHPA 2HDMA 3G6JB 2R7ZB 3IFDA 3IL8A 3BVZA 1EEID 3SR1A 3VR2A 3ZYYX 2VB2X 2PYKA 2RA4A 1QNUA 4RKBA 5FK9C 2SNMA 2R6GA 2ID0A 3UI2A 2VXWA 5CMDA 3JAME 2F0MA 1RODA 4K2KA 2ZXRA 4IFDJ 2DY8A 2H1EA 4RH6A 1ILQA 1W6JA 4DU9A 3E5SA 2JA5B 1BO0A 1E2ZA 1LTSD 4CHTB 4A3MB 1Y69U 4FF1A 4DXFA 5KEEA 1V8QA 3NP8A 2JSOA 1QNKA 3HZXA 3W2DA 3R8BA 1PYWD 3OMGA 1O7LA 2HQEA 1KLUD 1HA6A 3J80L 1HRJA 3QG1A 1C48A 2NUCA 5DM73 3MWYW 1B4OA 1STNA 4DAPA 4KKSA 3QJYA 2EYMA 5I9PA 1JOKA 1RJTA 2KCCA 2NVTB 2CW0D 1EL0A 3VA5A 3NBHA 5I4DA 3MC0B 3PO2B 2WINB 3HG9A 2K04A 3K6OA 2LFNA 4QF4A 3NQTA 1F2LA 1I6VC 4ZYSA 1A15A 1YNND 3C1FA 5IT9L 5JAVA 3TBIB 3GP7A 1JR0D 3ONAB 3SE0A 4DNRB 3MXGA 1UEAB 1PTOF 3H91A 5M9OA 4FYDA 4HR7B 1TT2A 1ET9A 1BOSA 3L3OC 4F87A 2F0DA 3PV0A 5AFWA 2EJGC 4XTCS 1XX8A 1EIGA 4ZQ3A 2KOLA 3VYRA 1G6ZA 1CZWA 3TP7A 1H9KA 1M8AA 3K7AB 4KTAA 1VCIA 4PMBA 3DEOA 5J1ZA 5I9OA 4JK1C 3TZUA 4O1NA 3OHXC 3K5MA 3RZDB 3S1NB 2A6HD 3R2TA 5CC4A 2EXZA 2HUGA 1QJOA 4A3JB 3C3LA 1JB3A 4KK7A 1DZ1A 1YNJD 1PTOC 4QUFA 1I4RA 2OF1A 2NVXB 3PO3B 4M1UB 2D62A 1S4ZA 2PPBC 3NPPA 1U4PA 2NN6G 1GUGA 1GUSA 1BXTA 2F03A 3X3NA 4ZLTF 4CJ0B 3S14B 1ESFA 4ZK9B 2NYZD 4OL7A 4XYOA 1UNSA 1BCPC 3GTLB 1CHQD 2A74C 1WTOA 2IL8A 1EWHA 3NK9A 4J8QA 1KLGD 1KDCA 1DOKA 2F0WA 2LKVA 2SEBD 3OIPA 1JOQA 1X32A 4IURA 1X3PA 3VYUA 2IWHA 2O4XA 1I4HA 2BE5D 1EYDA 4I7ZC 3VYTA 2O5IC 1TS3A 2WACA 5A2QE 5I6YA 1PZJD 2D9UA 3SK4A 4XQNA 5T1GA 5KNBA 3CKIB 1STBA 3S15B 3D4WA 2F0QA 1O7ZA 3GTJB 2RKSA 3S1MB 1IW7D 5C4JB 5DAUA 1SE3A 3KBGA 2F3WA 3IKJA 3X3MA 1HFGA 3SHLA 1SMYC 1V1OA 1Y8PB 2EY5A 4HMJA 3HOYB 5K36H 1LV9A 3W3AA 5C5LA 2E2JB 4KHVA 4X3UA 3E6ZX 4HN7A 1JWSD 1WD1A 3J80E 3QWNA 4EQNA 1QG7A 3T16A 1EWCA 3H09A 2A6EC 3VR5A 2JYOA 1WTRA 1KTKA 1IYUA 1DYQA 5HGTA 3PUZA 2R3ZA 3NHHA 3BDCA 4IUQA 2EYFA 1PRTC 3T53B 5LL6S 3SK5A 1LT4D 2M9VA 3J7AF 1H9SB 3D3RA 2BDNA 3D6CA 1NR2A 2A73B 3MAQA 1DXMA 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO2 A;  1QB5 D;  5G3L F;  5G3L D;  1TII D;  1QCB D;  4FNF A;  4FP5 D; 
#chains in the Genus database with same CATH topology
 3OPO A;  5IT9 E;  1HNZ Q;  2UUA Q;  4RGT A;  1KL9 A;  1H9S A;  2VUM H;  3S2H H;  3S1Q H;  3D6W A;  1NR4 A;  3FEW X;  5IGF A;  4GN4 B;  5FOB B;  1WI5 A;  1C7Y A;  4H0L C;  3M3Y H;  2F0E A;  2PNR C;  4NXN Q;  4XXE A;  1XNQ L;  1BUV T;  3J7Z C;  1EIH A;  4A3K H;  3HOX H;  2KQ3 A;  1K8O A;  4BBR G;  2KED A;  3N6R A;  1VS0 A;  3AU7 A;  4NP5 A;  5ELB A;  3KJO A;  2RBM A;  4IFD G;  2X6L A;  1SYG A;  3A5Z B;  3Q24 A;  2K33 A;  4WFN 3;  3S2D B;  1H9M A;  3RUZ A;  2F1M A;  3TRZ A;  2JEA I;  1DM0 B;  1KAA A;  1XMO L;  5LMU L;  4A3D G;  4RHR A;  5IP7 G;  5M5X H;  5EBC A;  1HR0 L;  2JEB I;  4C3H H;  1JJ2 A;  1O78 A;  1EQT A;  5IYB H;  1K9M C;  1RIP A;  3GV3 A;  4BBR B;  2A8V A;  2PZT A;  4H44 C;  1S5C D;  2R7Z H;  5M3M G;  4X3K A;  1NAP A;  1VQG A;  4H13 C;  1BBX C;  5EGT A;  2CW0 C;  5C3E G;  2RHS B;  1GUW A;  1GOZ A;  4YWK A;  2QIL A;  2AQ3 B;  2PZW A;  1Y1V G;  1V43 A;  2HCC A;  3G4S A;  1XYI A;  4L5T A;  5GQO A;  4HIO A;  4XDX A;  1E24 A;  2WB1 G;  1BCP D;  5LL6 X;  1ENA A;  1KRS A;  4JI5 L;  2R92 G;  1A3T A;  4JI7 L;  1HPC A;  1CKO A;  3WOF A;  1YNN C;  5T1I A;  2JA5 H;  4XIG S;  5NUC A;  1MBY A;  1TVX A;  4OGQ C;  3BDO A;  4A3M H;  2WAQ G;  3BYT B;  3L7Z C;  4C3I G;  4B08 A;  3KFU A;  3G71 A;  2CQO A;  1IYV A;  3OWF A;  1HQR D;  1PH3 A;  4K5W A;  4ZUI A;  1NJI C;  2Y0S E;  3D31 A;  1IL8 A;  2OWO A;  2WB1 B;  5ELN A;  1VQ7 A;  2L9H A;  4RG1 A;  5FLM G;  1ML0 D;  2KCN A;  4CBV A;  2R92 B;  4GNX B;  3DHQ A;  4YCU A;  4YWL A;  1OXT A;  5IYC G;  4LF4 L;  1XNQ Q;  3FMC A;  1LM0 A;  1VQC A;  4KY5 A;  3MEF A;  2A5H A;  3CHB D;  1Z47 A;  4LF5 Q;  1HQM C;  2IT1 A;  1PXU A;  1YJN A;  4ZUJ A;  4LWC A;  2NVT H;  1JMC A;  2WAQ B;  1TWC H;  4FO2 A;  3TSS A;  4DK1 A;  2MHV A;  5IGD A;  2EZV A;  2H4O A;  1D5Z C;  4ULL A;  2MGS A;  4DK6 C;  1AN8 A;  1W6K A;  3DLL A;  1IBK L;  2EVB A;  4FXD A;  3Q6S A;  1YI2 A;  1VQ9 A;  3PO2 H;  2XWB B;  3O13 A;  1JOO A;  1SBB B;  1K73 C;  1XMO Q;  5LMU Q;  2A6H C;  1T5X D;  4J1M A;  1STY A;  1OXV A;  4KHZ A;  5FKA C;  1RKN A;  5EKK A;  2MUY A;  3F2C A;  1ESR A;  1HR0 Q;  1Y1W H;  2EQS A;  4DK0 A;  4B9X A;  1WD0 A;  2B3G A;  4BBS G;  3J81 L;  1ENC A;  1X65 A;  1Q3L A;  3HOU G;  1YNJ C;  3K8A A;  2X6G A;  3HGB A;  4MHE A;  4P73 A;  2DJF C;  1PH9 A;  3BG3 A;  1G29 1;  1PFN A;  1EIY B;  1STA A;  1NBW A;  2K5Q A;  3QOL A;  3A7A B;  3NTK A;  5C0X H;  3TP5 A;  3HOW G;  2WKC A;  4LMQ D;  2A6E D;  3ERS X;  4X6A H;  1FL0 A;  1YHQ A;  1LUZ A;  5JPN C;  1MKH A;  4OWX B;  4DUZ L;  2EJF C;  2K1B A;  3I3C A;  4EQO A;  2B2T A;  4JI5 Q;  4F8M A;  2CQA A;  4OWT B;  4R1J A;  1PRT D;  4JI7 Q;  1HHV A;  2B2V C;  3GTP B;  3PUY A;  1PFM A;  2VQE Q;  1S72 A;  1CHP D;  2RDF A;  4HSP A;  3I55 A;  4DV1 L;  4BBS B;  1KXL A;  1M1K C;  4DUY L;  3EVQ A;  3HOU B;  3K7A H;  1RTO A;  2YU9 B;  1F77 A;  4B3R Q;  4DAV A;  1SNC A;  1K83 B;  2O5J C;  4HJA A;  3J7A V;  4PZ8 A;  4OO1 G;  1L0W A;  3HOW B;  4LNQ A;  2EPB A;  3S1N H;  4A3L G;  3AYH B;  2JA9 A;  2NB0 A;  2E75 C;  2BE5 C;  1E1T A;  4B3T L;  3NUC A;  3SXH A;  3UDI A;  2F0H A;  1Q46 A;  1SLJ A;  1VQE A;  1PH6 A;  1C8C A;  4HJ8 A;  1P8L A;  3HKZ G;  5EPL A;  4EGV A;  2ZJR A;  3BZK A;  2GVA A;  3MXP A;  1MJC A;  1TWH B;  2JA6 H;  2ZTE A;  2JA8 G;  2OEO A;  1F9S A;  1BQQ T;  2NVX H;  3PO3 H;  4F7X A;  4GOP C;  3S24 A;  3T1Y Q;  1JWU D;  1IW7 C;  4G7Z C;  3M85 A;  4IZ8 A;  3F2U A;  2Z4H A;  1G2S A;  5E3F A;  2E76 C;  1GXD C;  5KND A;  4IO9 A;  1LT3 D;  1IBK Q;  4IPH A;  3S14 H;  3KUP A;  3IFT A;  3RLO A;  4C3J G;  2Z1C A;  2EE1 A;  3MXN B;  2B29 A;  3KF8 A;  4X66 L;  1WJJ A;  2AMC B;  3S17 B;  1G8Z D;  2WII B;  2D2C C;  1KQS A;  3GTL H;  4DR6 L;  5ELC A;  3HKZ B;  3H3V C;  5D3I B;  1EY9 A;  1D1K A;  2GN5 A;  2EXD A;  3MXN A;  1IKL A;  3I91 A;  5E7N A;  3U9O A;  4FNF A;  3V96 A;  4PNY A;  3CAM A;  1B53 A;  4K6D A;  5FLX L;  4HAE A;  1LTI D;  2L5T A;  1Q1E A;  3ITP A;  1H9R A;  3VA7 A;  4ILW A;  2K5H A;  3NTI A;  4A3I G;  1Z7T A;  1SYC A;  2I5L X;  4A3C G;  1UUP A;  3KF6 B;  3CRK C;  4DUZ Q;  1SRU A;  2CWP A;  4LUO A;  4A3E G;  5CV6 A;  1GUN A;  4L8J A;  1J5E L;  2B2V A;  1RDP D;  2G9H D;  2CCZ A;  2F0V A;  4K5V A;  4CDE C;  1VQ4 A;  1CKM A;  4CDF C;  3S15 H;  1A3U A;  5JEA G;  4DV1 Q;  3WOE A;  2ZXO A;  3B6Y A;  3WWV A;  4PZ7 A;  2UXD L;  3GTJ H;  3E9H A;  2QKI C;  3S1M H;  3TDQ A;  1A3V A;  1N9W A;  4FVM A;  4LF9 L;  5C4J H;  4FDB A;  4JBW A;  3T1H L;  5EKI A;  2PI2 E;  2D5D A;  3CQZ H;  1QZH A;  4TVA B;  4XT1 B;  3STB D;  3I56 A;  1YBY A;  1II3 A;  5I2X A;  3J81 j;  2CWA A;  4J15 A;  4WOR A;  4B3T Q;  1EQR A;  4K8I A;  2V4D A;  4BA1 I;  4A3E B;  4F88 A;  3HOY H;  4RA8 A;  4TSS A;  4BY1 B;  4LF6 L;  2PMZ E;  4LUV A;  2E2J H;  3J7A 5;  4YY3 L;  1EUJ A;  1N32 L;  4A93 G;  1LTT D;  1K8M A;  4O0A A;  4KJO A;  1SXT A;  5ELF A;  4Q5V A;  3QO2 A;  4JVZ A;  2MO1 A;  1BCP F;  3L2P A;  3I90 A;  1EU3 A;  4KKU A;  5LMN L;  2VB3 X;  4HIK A;  1WCM G;  2L4N A;  1TS2 A;  1EYA A;  2FMM A;  4X66 Q;  4OO1 I;  2B2Y C;  2BDO A;  4XT3 B;  3PGZ A;  1D1I A;  1I6H B;  3M7G A;  1EQV A;  3A56 A;  1XPO A;  5I6W A;  4DR6 Q;  4DR7 L;  1JE4 A;  5JPM C;  2Q2H A;  4TQU S;  4KHP Q;  1HFN A;  1DOM A;  2L55 A;  3SK8 A;  2BA0 A;  2MJ8 A;  2EY6 A;  4HTH A;  3AQQ A;  4BA2 I;  4A93 B;  1FYC A;  1HZC A;  3EFX D;  2I5M X;  5C3W A;  1IBL Q;  3TN2 A;  3J81 c;  3RMH A;  3E9I A;  2AWN A;  5F2D A;  5AJ3 Q;  2K32 A;  1VQA A;  3J81 E;  2NBF A;  4RHS A;  1L1O C;  3GO5 A;  1PH5 A;  1HH2 P;  2LMC B;  2SNS A;  1J5E Q;  4JBJ A;  2C5C A;  5CR3 A;  1I4P A;  4NDX A;  4ODG A;  5E4X A;  5ISR A;  1LO5 D;  2K03 A;  3MVV A;  1VQO A;  2EJM A;  2UXD Q;  4B3M Q;  3CCQ A;  2OTL A;  2XSC A;  1GM5 A;  1NTG A;  1HA5 A;  3R93 A;  2K5W A;  3A54 A;  2EDG A;  3NBI A;  4GKK Q;  1IKM A;  1LLR D;  1PYS B;  2C9O A;  2K14 A;  2RCN A;  4X62 L;  4Y7N B;  1R4Q B;  3M4Q A;  4DFA A;  5HUR A;  1SFO B;  4DKA C;  3KK7 A;  4CKC A;  2KUM A;  1TKW B;  1Q7Y C;  1E7Z A;  1FGB D;  5CBE E;  1VQB A;  2K5D A;  1D2B A;  1QVG A;  5KGU A;  4LF6 Q;  3V05 A;  3HS0 C;  1MIU A;  4JI4 L;  1CKN B;  5DLQ E;  4K8J A;  3CU7 A;  4YY3 Q;  1CSQ A;  1R4P B;  1B9M A;  3HP3 A;  4I65 A;  1ASY A;  1N32 Q;  2AQ1 B;  3UE0 A;  3TRE A;  3CCU A;  1F2Z A;  1KAB A;  1Q81 C;  3PIP A;  4BBR H;  1CKN A;  4CKB A;  4KV6 A;  1O7Y A;  1PRT F;  5EPJ A;  5JVG 3;  3OIQ A;  4WJ3 M;  4JBK A;  3NWT A;  4DR5 L;  5M5W B;  1PTO B;  3GV6 A;  4R4T A;  3CCS A;  3HEJ A;  1HR0 W;  2NVY B;  3KDF A;  4DXG A;  4HSV A;  4L5Q A;  4AYB B;  2CH4 W;  4R8N A;  4NKL A;  5C44 H;  1WTX A;  2MFI A;  3RR5 A;  1ZYR D;  4EVO A;  2TSS A;  1GJX A;  1X3E A;  3CCE A;  1VQ5 A;  1B3A A;  2R93 B;  1LTR D;  2IPK D;  1HCZ A;  1TWF H;  4Q0F A;  3U9S A;  3A8J E;  4UP7 A;  4LFC L;  4ZRZ A;  3LNN A;  2N88 A;  1B7Y B;  2B63 B;  4HID A;  4WJW A;  4A3G B;  4R9W A;  3KLS A;  2QF7 A;  1IBM L;  4C1N I;  2RF4 A;  3ND8 A;  3MEH A;  1BCP B;  3URY A;  5M3F G;  4DV0 L;  2E5L Q;  1DGS A;  2Q2T A;  3NSW A;  3DEP A;  2QCP X;  2Z4I A;  5IE8 A;  3OTO L;  5FO7 B;  5FLX c;  2F0I A;  1VQM A;  3PUV A;  5C0X J;  1OXU A;  4DK3 C;  4QB4 A;  4G57 A;  5C4X G;  5FLX E;  1L0X B;  2R92 H;  5D14 A;  2HHH L;  4UAI A;  5JOB A;  3E0J A;  4N8X 1;  2K05 A;  3BZC A;  3FPU B;  1EY8 A;  3PUX A;  4X62 Q;  2F3V A;  1YIT A;  2KEE A;  4DAY B;  2AUK A;  5IT9 c;  4KD3 A;  5M3F B;  1SN8 A;  2OT2 A;  3PMF A;  4KD4 A;  2KHJ A;  3DWP A;  4NW2 A;  4JI2 L;  2ICI A;  1TY2 A;  4DAY A;  3CRL C;  4X64 L;  5C4X B;  5EJW A;  3DWA A;  3SK6 A;  5I2Y A;  3HOZ B;  2B2U C;  3KLW A;  1S5B D;  1X3Q A;  4LF8 Q;  3ULP A;  3DUZ A;  1W2B A;  1N33 Q;  1HTL D;  2EY2 A;  5EKL A;  4DA2 A;  4XYQ A;  3KYH C;  4BS9 A;  4K0K L;  5BR8 L;  4JI0 L;  4DR5 Q;  1DCZ A;  4YHH Q;  3DMU A;  2AWO A;  3J7Y W;  2BA1 A;  1E2W A;  1UEB A;  1LTA D;  2A68 D;  2RVL A;  1PH8 A;  5LHY 1;  1X54 A;  3U4V A;  4ID6 A;  2F0T A;  5GAD C;  1VF7 A;  2K7V A;  2Q8I B;  3GTP H;  2Z6B A;  4RKL A;  3FRP B;  4QUC A;  1VQI A;  1HNW L;  4LFC Q;  4XQJ A;  3DM1 A;  3R2I A;  1D5M C;  1S5F D;  3G7L A;  2YU9 H;  2EIF A;  1U9R A;  1K83 H;  3RNU A;  5CV4 A;  3M4P A;  4DV0 Q;  3HOW H;  5FJ8 H;  4WRD A;  1PRT B;  2K52 A;  4DV2 Q;  4X3S A;  3OTO Q;  2IW3 A;  3P20 A;  1FNW A;  5ELD A;  3WDN A;  4U67 3;  1E22 A;  4JPB W;  3T13 A;  1TWA B;  2UXC L;  5M5Y B;  5KYI A;  4RFB A;  4DR2 L;  1XPU A;  4JG2 A;  3QB3 A;  3ICE A;  1GKH A;  2HHH Q;  4A3D B;  2YYZ A;  1PFB A;  1TWH H;  2F0N A;  3D4R A;  1I4G A;  4IPD A;  1CA6 A;  1CQF A;  1ZEQ X;  4N9T A;  1ASZ A;  1MHW C;  2MP1 A;  2FMC A;  4MN3 A;  4RWS C;  4DR3 Q;  3FPP A;  3KOJ A;  5L37 A;  2QDL A;  2QDB A;  5HY6 A;  2CH4 A;  3I4N G;  2Z8L A;  4TRD A;  3Q22 A;  5M3M B;  2A1A A;  3GTO B;  1WVL A;  3MZ5 A;  3QOJ A;  4JOI C;  3STB C;  5C3E B;  4JI2 Q;  5IIF A;  2WKD A;  3GTQ B;  2JXM B;  1Y1V B;  1U4M A;  4X64 Q;  1FD7 D;  2B2U A;  3PIO A;  4KJN A;  5J3B A;  5JJL A;  4KN7 C;  2RDG A;  3I4M G;  4MZ9 A;  1EQQ A;  5J39 A;  3U58 A;  1EFI D;  1K3B C;  1KD1 C;  3UDG A;  3M9B A;  3CCV A;  2D0P A;  2VQF L;  1A6X A;  2EYH A;  4K0K Q;  2TMP A;  2R61 A;  2XVS A;  5BR8 Q;  4JI0 Q;  3ULJ A;  2QGQ A;  4NMZ A;  3PIP 3;  5C4Z A;  1MJE A;  5EPK A;  1GD7 A;  4C3I B;  2VUM G;  2F0U A;  4O42 A;  2F0K A;  1PH4 A;  5D3D A;  4QMG A;  2H5X A;  1EU4 A;  4POF A;  3BVG A;  1TS5 A;  3F2B A;  4IPG A;  4Y52 H;  3ULL A;  4CGY B;  1SRO A;  1LT5 D;  1JJG A;  1SYE A;  1STG A;  2Z0S A;  4A3K G;  4L5R C;  3MXU A;  2AQ2 B;  1GVP A;  3I7F A;  3I4M B;  1SDF A;  1SE4 A;  2A69 C;  2PQA B;  1DON A;  3AB9 A;  2HDL A;  4YCW A;  4QCL A;  2VS1 A;  1FNU A;  3K57 A;  1CZG A;  4JYA L;  5CV7 A;  1AEX A;  5KNC A;  4RGN A;  5CGK A;  1A2U A;  3K58 A;  3I8Z A;  2N49 A;  2RSN A;  2Q8R E;  4ALP A;  1Y8O B;  1OO9 B;  2E8G A;  2PQA A;  4DAM A;  1RCV D;  1VDZ A;  1EFW A;  4A3C H;  2AKW B;  3CCJ A;  3RZO B;  2XRS D;  3MFY A;  2UXC Q;  2K5N A;  1EWI A;  1D5X C;  4IFD I;  4DR2 Q;  4IUN A;  5IP9 G;  4BY1 H;  4IQZ A;  1QB5 D;  2KEC A;  1NMF A;  4C3H G;  5C4H A;  1Z9F A;  4A3K B;  3FVQ A;  5JEA H;  2XRQ D;  5DM6 3;  3CP0 A;  2DN8 A;  2J0T D;  4OIK A;  4R8I A;  2F0P A;  1Q8K A;  2RCF A;  4QJF A;  4PV1 C;  3EJI A;  1SNQ A;  3D0F A;  5CBA E;  3S1R B;  2QEJ C;  3I70 A;  2NVQ B;  1OXS C;  3FKI G;  5CYU A;  3KJP A;  4IPC A;  4JOI A;  1B44 D;  1M90 C;  3NE5 B;  4G7H C;  1CA5 A;  4P2C B;  5JJZ A;  1VF5 C;  1XNR L;  3RZD H;  1I6H H;  4JI6 L;  1WTP A;  1PA6 A;  3DWQ A;  5M5X B;  4ZKB B;  1B70 B;  4A3B G;  1NY4 A;  1STE A;  4V19 0;  2UU9 L;  3HFZ B;  4A3J H;  5HGQ A;  3N52 A;  3H0G G;  3RN2 A;  1G6P A;  1EY4 A;  5E1F A;  2BCO A;  4LF4 Q;  1CI3 M;  5C5M A;  5A2Q L;  4A93 H;  2UXB L;  1E2V A;  1GUT A;  3K0Y A;  1BKB A;  3GQB A;  1PDQ A;  4QIW B;  2IX0 A;  2VQF Q;  1RD9 D;  3M4O B;  1UAP A;  3KF8 B;  2XIW A;  5C3X A;  3FKI B;  1YVC A;  1J8I A;  1KHI A;  1HTP A;  5JJK A;  2OXP A;  4JV5 L;  1XWE A;  2FHT A;  1ONL A;  1N36 L;  3DXJ C;  2HCI A;  3L9A X;  1XXG A;  4PQX A;  2ZT9 C;  4A3B B;  1IL2 A;  4K5X A;  4AQY L;  4IUT A;  2YTY A;  3BVM A;  2B2W C;  4DV6 L;  1S5D D;  4K2L A;  1V9P A;  4C1N K;  4C2M B;  3H0G B;  4HCS A;  1ZYR C;  1SYD A;  3C2P A;  4KLK A;  4JYA Q;  2JA8 B;  2P5Z X;  2BH8 A;  3A55 A;  1AE3 A;  3A8I E;  4Y7N H;  1C4Q A;  2NN6 H;  1SNO A;  3PO2 G;  2Q8T A;  3R3O A;  4IOA A;  3VR6 A;  1A0I A;  1WOC A;  5KIX A;  1QVC A;  2XN9 C;  3MTS A;  3RLF A;  2IHF A;  4DNI A;  1PYB A;  5J22 A;  1HJP A;  3UE1 A;  2VW9 A;  4C3J B;  4C56 C;  2KEN A;  1Y1W G;  3OOC A;  3K81 C;  1S3O A;  5IYD G;  2RSO A;  3CCM A;  1PH7 A;  1T9H A;  1JJC B;  4IUP A;  3EQL C;  1JWM D;  2I0Q A;  2DY7 A;  3FDT A;  3CC2 A;  3E0E A;  3D8G A;  3NWS A;  4Z9C B;  5D65 A;  1VQF A;  2GVB A;  1PFS A;  1J9O A;  1NMG A;  1N34 L;  4DUY Q;  4RCN A;  1TWC B;  2BH2 A;  2J4X A;  5C0X G;  1TU2 B;  2MO0 A;  3QR8 A;  1F9P A;  1CFM A;  4KN4 C;  2ASB A;  4RAU C;  2B8G A;  1EEF D;  1EOT A;  4PG3 A;  4GLX A;  1S40 A;  1WYD A;  1E1O A;  1XNR Q;  1PTO H;  1F9R A;  4GN5 A;  1VQK A;  3MFG A;  2FFK B;  2NVY H;  4A3I B;  4UDU C;  2YTX A;  4GOP B;  2UU9 Q;  1Y1W B;  5IGB A;  1VQD A;  3CPW A;  4BXX H;  1JT8 A;  2QA4 A;  4GS3 A;  1VQH A;  2K5V A;  1FJG L;  4G4K A;  2R93 H;  2KHS A;  4X65 L;  3G6E A;  2UXB Q;  3H6M A;  4YIJ A;  5IOC A;  3CPF A;  5ELO A;  1Q8I A;  3PIO 3;  1R9T B;  1BR9 A;  4HMI A;  3CXC A;  4GOP A;  3IRB A;  2B63 H;  4G7O C;  3ZJY C;  1G2T A;  3BU2 A;  2IHE A;  2WB1 E;  1GHJ A;  4A3G H;  1KDB A;  1YEZ A;  3JAM i;  2IX1 A;  1SE2 A;  3NEM A;  3A5U A;  4LUZ A;  3BYY B;  4DPG A;  4LAA A;  2F4I A;  2PNH A;  2M2L A;  2L11 A;  4DNT B;  4JV5 Q;  1HNX L;  5IOD A;  3RD4 A;  1UE5 A;  3CME A;  2JP1 A;  1SEB D;  1N36 Q;  1PVO A;  4OHJ A;  2NTS A;  3S9W A;  4KKT A;  2WAQ E;  3C46 A;  2E2I B;  4M8A A;  2B2W A;  4UP9 A;  2F0F A;  3OMC A;  1U4R A;  2B39 A;  1KNE A;  1I94 L;  2UUB L;  1T5E A;  1AZQ A;  2JA6 G;  4DV6 Q;  2A68 C;  4E6I A;  4OXP A;  3AFQ A;  4JCV E;  3K5O A;  4DF7 A;  1B1Z A;  4HIM A;  4LK1 C;  2M00 A;  3PO3 G;  2A69 D;  4OEM B;  2XWJ B;  3S16 B;  1H9J A;  4B9W A;  4A3F G;  2NTT A;  3CMA A;  1ENF A;  2B8F A;  2WP8 J;  3LX0 A;  3GTK B;  3K59 A;  2I07 B;  1QE6 A;  1SYF A;  2N78 A;  5C6A A;  1SNM A;  2L1B A;  4DR1 L;  3MHB A;  2E2D C;  3UDF A;  2E2H B;  4DV7 L;  3TP8 A;  1WCM B;  5GAE C;  1PH2 A;  2IX3 A;  2J7Z A;  5GAG C;  1JIC A;  2JA6 B;  1CUK A;  5BN4 A;  1I4Q A;  3HOZ H;  1LTB D;  2ES2 A;  4ZCK A;  1SAP A;  3CCR A;  1N34 Q;  2JQO A;  1FNV A;  4R4I A;  4A3F B;  2Y0S G;  4LF9 Q;  1JC7 A;  4UHV A;  1PMR A;  1UWV A;  1JB7 A;  1ET6 A;  1EZ6 A;  3T1H Q;  3VYS A;  1TWG B;  3GTG B;  1OTC A;  2NZ1 D;  4EX5 A;  1TR5 A;  4GZY C;  4QQB X;  3S2D H;  1DOL A;  5JVH 3;  4RCO A;  2PW7 A;  1O7I A;  3ND9 A;  2R7F A;  3F2D A;  3IAY A;  1FJG Q;  1QCB D;  2HIX A;  4X65 Q;  3K5L A;  3I73 A;  1B2T A;  1PZK D;  1Z6H A;  5G3L D;  3W1B A;  1FR3 A;  2AHO B;  2GA4 B;  1ICW A;  1AP0 A;  3P7J A;  1TY0 A;  5DEH A;  3Q8D A;  2DUD A;  1MD2 D;  1QUQ A;  4J6H A;  3ERQ A;  2Y0S B;  4S3S A;  1JOR A;  2ZXP A;  2KBN A;  3HKS A;  2HQL A;  3I72 A;  4LJZ C;  5C0X I;  3KDF B;  3TEH B;  1HNX Q;  1HNZ L;  5LMN Q;  1NCV A;  5ELE A;  4UY8 C;  2B2Y A;  1WTQ A;  3H3V I;  4IFD H;  3PCO B;  4HJ7 A;  1TWA H;  3EIV A;  1I94 Q;  2FXQ A;  2UUB Q;  4K6L A;  2AUJ D;  3P75 A;  4P75 A;  3K5N A;  2I46 A;  1NUC A;  1TQO A;  4DR7 Q;  4FXG C;  1AW7 A;  3NEL A;  4A3D H;  2L15 A;  3OW7 A;  3TP6 A;  2Q2I A;  1U5K A;  5IP7 H;  4NB3 A;  3LWE A;  1X55 A;  1SE8 A;  1IHZ A;  1G51 A;  2WFW A;  4IUU A;  1BBU A;  3CF5 A;  5CV9 A;  4JI1 L;  1L1O B;  3VR4 A;  1YJ9 A;  1CM9 A;  1BVS A;  3CQZ B;  3HKZ E;  1MSH A;  3JC6 6;  1HUN A;  1LAC A;  4KY7 A;  2EYJ A;  4PMW A;  1PV4 A;  1QOH A;  2SOB A;  4PZ6 A;  4KMU C;  5IGE A;  5M3M H;  2OQ0 A;  3GTO H;  4CJ1 B;  4DV7 Q;  5COY A;  4CKE A;  1L1O A;  5C3E H;  3OW2 A;  3GTQ H;  1EOV A;  2E74 C;  3Q0A A;  5BN3 A;  1Y1V H;  2DNC A;  3T51 B;  2F0S A;  1TII D;  4FF4 A;  5TSS A;  2PW5 A;  3KBX A;  2F0J A;  1KDA A;  1MSG A;  2ICE C;  3I4O A;  4GN3 B;  3P1H A;  2N3S A;  1SND A;  1F9Q A;  1VMC A;  2JE6 I;  4TKO B;  2OCE A;  3GD7 A;  1LAB A;  1I3Q B;  3OWE B;  4OON A;  3NEN A;  5JEA J;  1EYC A;  2ZTD A;  2MPM A;  1RF2 D;  1EY6 A;  4HED A;  4C3I H;  5FO8 B;  1ZKO A;  2IJ0 A;  4N9P A;  1VQP A;  4ZKC B;  3U4Z A;  4DN4 M;  1BNZ A;  5COR A;  4V0B A;  2A19 A;  3E3X A;  3TS2 A;  2CHB D;  3SGI A;  4JI4 Q;  5FO9 B;  1XTD A;  5A35 A;  5BN5 A;  1F2M A;  1D8L A;  5FLM H;  3I4M H;  5IY0 A;  1HZ9 A;  2CVR A;  5IYC H;  2JA7 G;  1LTG D;  3TZD A;  3JAM L;  1LYL A;  4X3T A;  3EA6 A;  3HOV G;  3A7L A;  2EYP A;  1X3F A;  4L6T B;  1OXX K;  3LGJ A;  2FIN B;  5EBD A;  1A2T A;  1B50 A;  4PMC A;  3RZO H;  1A62 A;  2G9D A;  1SMX A;  2VL6 A;  2BOS A;  2KVM A;  1E3P A;  1EY5 A;  2Z9H A;  2DNE A;  2K6A A;  1X3G A;  1K8A C;  3H94 A;  3Q23 A;  5IGC A;  4JI1 Q;  4LF5 L;  5EQ0 A;  1WTW A;  3KLR A;  2CFM A;  4BBS H;  2JA7 B;  5KRU A;  1Q90 A;  4HCE A;  2NWG A;  3HOU H;  3S1R H;  3HOV B;  1HUM A;  4GNX C;  1IBM Q;  2NVQ H;  5DNF A;  3NXW A;  3UDX A;  2ZM6 L;  1CK1 A;  4A75 A;  4FXK C;  4RGO S;  1SYB A;  4AH6 A;  4U68 A;  2X69 A;  1JQY D;  1CQV A;  1FGU A;  1Q12 A;  5C44 G;  5CV5 A;  2HIV A;  1VQ8 A;  2QEX A;  2Z6K C;  5K36 G;  4CDC C;  3VR3 A;  1PLF A;  1PTO D;  3J80 i;  2EYO A;  5IP9 H;  2F0O A;  5IWA L;  1B8A A;  1EY0 A;  2YV5 A;  2PQE A;  1QIL A;  3BDL A;  3GTM B;  1DD2 A;  1I50 B;  2SDF A;  3FHW A;  3QIA A;  3M4O H;  3SDZ A;  2ZJQ A;  4FP5 D;  4ME3 A;  1PZI D;  3D4D A;  3FKI H;  2HT1 A;  1EZ8 A;  2LSS A;  3SVM A;  4BY7 G;  2LXK A;  2PCF B;  1AFP A;  1BDO A;  4OO1 H;  4JI3 L;  1N8R C;  2IY5 B;  1YHA A;  2N8N A;  1O80 A;  5C44 B;  4KI0 A;  4ME5 A;  4A3L H;  4FF2 A;  1DJR D;  4A3B H;  3S17 H;  2B2T C;  1CTM A;  2N55 A;  3A0J A;  2PZU A;  3AMU A;  2YTV A;  2VQE L;  4HJ5 A;  1V1P B;  2RDH A;  1TWF B;  4C2M H;  1SSO A;  4JI8 L;  4DV4 L;  3H0G H;  2ENB A;  1ILP A;  1KAW A;  3K7U C;  2ALY B;  4CJ2 C;  3I4L A;  1D6E C;  1GUO A;  3HRZ C;  2F0L A;  2KA7 A;  3TME A;  4IN3 A;  2JA8 H;  4O2D A;  4B3R L;  2FJ2 A;  1EY7 A;  1YHB A;  5CV8 A;  3MA2 B;  5KYL A;  1V1P A;  4DGZ A;  2PI2 A;  1AZP A;  1E0B A;  2PMZ B;  5IGG A;  1I4X A;  3NTH A;  4BY7 B;  1L0Y B;  1BF4 A;  1M4V A;  3I4N B;  3SEB A;  1WTV A;  4RGM A;  4C3J H;  3M7N A;  4ZAI A;  3T4A C;  2PO4 A;  1K8G A;  3KLS X;  1SJE D;  3LWU A;  3F8T A;  3DM3 A;  1P16 A;  4MIU A;  3T56 B;  1KNA A;  3I2Z A;  4I7A A;  2UUC L;  1HNW Q;  3HOX G;  1B9N A;  4IAL A;  4YWM A;  4AYB E;  3T1Y L;  4KY6 A;  5GRO A;  4EQ5 A;  4LFB L;  2EYL A;  3BS1 A;  1LTL A;  3C1E A;  4GNX A;  1Q1B A;  2L12 A;  5EAY A;  3PUW A;  4L5S A;  2ZM6 Q;  4XQQ A;  1ZXT A;  1SMY D;  1XTC D;  1VMP A;  1RL2 A;  2JN4 A;  2L0C A;  1U4L A;  4IUV A;  1C0A A;  2WV6 D;  4IOC A;  4EQP A;  4JW0 A;  3CC4 A;  1CT1 D;  2VNU D;  3BZD B;  5G3L F;  2Z6K A;  1S5E D;  4A3I H;  3M4Y A;  1MI2 A;  1UE7 A;  1QVF A;  2VUM B;  2LS0 1;  2JK8 A;  2VZA A;  3S2H B;  1Y8N B;  3W5O A;  3S1Q B;  3V2T A;  3CW2 C;  4A3E H;  1F2Y A;  1STH A;  5IYD H;  1SJH D;  3OSO A;  2OQK A;  5IWA Q;  3M3Y B;  4BWG B;  1SNP A;  1YZ6 A;  3RN5 A;  3OYY A;  2K01 A;  2C35 B;  4K14 A;  3HOX B;  1R9T H;  1AE2 A;  1MGS A;  4IJL A;  2LY7 A;  5IYB G;  1NSN S;  1QWY A;  3A8K E;  2O2L D;  5E4W C;  1IXR A;  5FJ8 G;  2R7Z G;  2CKZ B;  1JCK B;  2F0G A;  4ABN A;  2K28 A;  4L63 B;  4FF3 A;  2I5H A;  1VQN A;  3H3V H;  4JI3 Q;  2EY1 A;  3ERO A;  2G5D A;  1IZ6 A;  2KJX A;  2EOT A;  2F52 A;  3W1G A;  2E2I H;  3NQI A;  2R7D A;  2RQX A;  4H7B A;  2F4V L;  2XTI A;  3H15 A;  1TS4 A;  3K0X A;  4JI8 Q;  4DV4 Q;  1HXY D;  4OIJ A;  1G91 A;  4YCV A;  1LT6 D;  4C3H B;  3S16 H;  4CDD C;  5K5P A;  2JA5 G;  1GHK A;  5LMN W;  4DR4 L;  4A3M G;  1XMQ L;  1H95 A;  3GTK H;  2DGY A;  2XNA C;  1RTN A;  1RHP A;  2HDM A;  3G6J B;  2R7Z B;  3IFD A;  3IL8 A;  3BVZ A;  4P71 A;  1EEI D;  3SR1 A;  1K0S A;  3VR2 A;  3ZYY X;  2VB2 X;  3JAM c;  2PYK A;  1C9O A;  2RA4 A;  1QNU A;  4RKB A;  5FK9 C;  2E2H H;  2SNM A;  1WCM H;  2R6G A;  3AFP A;  2ID0 A;  3UI2 A;  4MTN A;  1UE6 A;  1Y14 B;  2VXW A;  5CMD A;  3JAM E;  2Q2U A;  3CCL A;  4WJ4 A;  2LXJ A;  2F0M A;  1ROD A;  4K2K A;  2ZXR A;  4P72 A;  2UUC Q;  4IFD J;  2DY8 A;  2H1E A;  4RH6 A;  1ILQ A;  1W6J A;  4DU9 A;  3E5S A;  4LFB Q;  2JA5 B;  1BO0 A;  4A3F H;  1E2Z A;  1LTS D;  4CHT B;  4A3M B;  1Y69 U;  4FF1 A;  4DXF A;  5KEE A;  2QW7 A;  1V8Q A;  3NP8 A;  2ATW A;  1TWG H;  2JSO A;  1QNK A;  3GTG H;  3HZX A;  3W2D A;  1SFO H;  4NXM L;  2KCT A;  3R8B A;  1PYW D;  3PF4 A;  1XPR A;  3OMG A;  1O7L A;  2HQE A;  1KLU D;  1HA6 A;  3J80 L;  1HRJ A;  4DV5 L;  4KHP L;  3QG1 A;  4LW1 A;  1C48 A;  2KHI A;  2NUC A;  4B3S L;  1VQJ A;  1IYJ B;  5DM7 3;  3NBH B;  2OTJ A;  3MWY W;  1NNX A;  1B4O A;  1X56 A;  1STN A;  4DAP A;  4KKS A;  3QJY A;  1IBL L;  2EYM A;  1JOK A;  1RJT A;  2KCC A;  5I9P A;  2NVT B;  2CW0 D;  1EL0 A;  1WFQ A;  3VA5 A;  3K80 C;  3NBH A;  4HJ9 A;  5AJ3 L;  5I4D A;  3MC0 B;  3PQI A;  3EN2 A;  3PO2 B;  2WIN B;  3ER0 A;  3HG9 A;  4BY1 G;  2K04 A;  3K6O A;  2LFN A;  4R4C A;  4QF4 A;  5M5W H;  3NQT A;  4JI6 Q;  1F2L A;  2F4V Q;  1I6V C;  4ZYS A;  3KF6 A;  1K3R A;  1A15 A;  1TXY A;  1A8V A;  1YNN D;  3C1F A;  4B3M L;  5IT9 L;  4N8F A;  2RHQ B;  1KIX A;  5JAV A;  3TBI B;  1XJV A;  3GP7 A;  1JR0 D;  4DR4 Q;  1XMQ Q;  4GKK L;  3ONA B;  3SE0 A;  4IJH A;  4DNR B;  3MXG A;  1UEA B;  4LFA L;  1PTO F;  3H91 A;  5M9O A;  4FYD A;  4HR7 B;  4OX9 L;  3F1Z A;  1TT2 A;  1ET9 A;  1BOS A;  3AEV A;  3L3O C;  4F87 A;  2F0D A;  4A3J G;  3PV0 A;  5AFW A;  2EJG C;  4XTC S;  1XX8 A;  1EIG A;  4NPS A;  4ZQ3 A;  2K75 A;  2NZH A;  4UP8 A;  2KOL A;  3VYR A;  4AQY Q;  1A63 A;  1G6Z A;  1CZW A;  4OWW B;  3TP7 A;  1H9K A;  1M8A A;  3K7A B;  2K4K A;  4JC0 A;  1I3Q H;  4KTA A;  1VCI A;  3G48 A;  4PMB A;  3DEO A;  5J1Z A;  5I9O A;  4JK1 C;  3TZU A;  4O1N A;  3OHX C;  3K5M A;  3BJU A;  3TQY A;  3RZD B;  3S1N B;  4NXM Q;  2A6H D;  1YJW A;  5M3F H;  3R2T A;  5CC4 A;  2EXZ A;  2HUG A;  1Q86 C;  1QJO A;  4DV5 Q;  4A3J B;  3EBE A;  4B3S Q;  3C3L A;  1JB3 A;  4DV3 L;  4KK7 A;  2ZTC A;  1DZ1 A;  1YNJ D;  1PTO C;  4AIM A;  5C4X H;  4QUF A;  3TS0 A;  1GO3 E;  4GLA C;  1I4R A;  2OF1 A;  1B3Q A;  2NVX B;  3PO3 B;  4M1U B;  2D62 A;  1S4Z A;  2PPB C;  3NPP A;  1U4P A;  2NN6 G;  1GUG A;  1GUS A;  1BXT A;  2F03 A;  1X9N A;  1Q82 C;  3X3N A;  4ZLT F;  2E5L L;  4CJ0 B;  3S14 B;  3FP9 A;  1ESF A;  4QGU A;  4ZK9 B;  2NYZ D;  1ICF B;  4LF7 L;  4OL7 A;  3CD6 A;  4XYO A;  4JBM A;  1UNS A;  1BBW A;  4GKJ L;  1BCP C;  2JJQ A;  3GTL B;  2KCM A;  1CHQ D;  2NZO A;  4UPA A;  2A74 C;  1QUQ B;  4H02 A;  1YIJ A;  1WTO A;  4MTK A;  2IL8 A;  1EWH A;  3NK9 A;  2MQH A;  4J8Q A;  2JA7 H;  1KLG D;  1WTH A;  1CSP A;  1DOK A;  1KDC A;  2F0W A;  2LKV A;  2SEB D;  3OIP A;  5GAH C;  1JOQ A;  4R4O A;  4LFA Q;  1VQL A;  1SR3 A;  1X32 A;  4IUR A;  4APV A;  2MNA A;  3PF5 A;  1X3P A;  3VYU A;  2IWH A;  3HOV H;  2O4X A;  4OX9 Q;  1K0R A;  1I4H A;  4QL5 A;  2BE5 D;  4A4I A;  4AYB G;  4POG A;  1EYD A;  2V1C C;  4I7Z C;  3VYT A;  2O5I C;  2UUA L;  1VQ6 A;  4QIW E;  3PSI A;  1TS3 A;  2WAC A;  4BXX G;  5A2Q E;  5I6Y A;  3HOY G;  1PZJ D;  2D9U A;  3SK4 A;  2R93 G;  4XQN A;  3VDY A;  5T1G A;  5KNB A;  5M5Y H;  3CKI B;  1STB A;  3S15 B;  1EIF A;  4NXN L;  4LF8 L;  1L2F A;  2B63 G;  5JJI A;  3D4W A;  2F0Q A;  1O7Z A;  3GTJ B;  4A3G G;  2RKS A;  1HZB A;  2HD3 A;  3S1M B;  1K28 A;  1N33 L;  3GTM H;  1IW7 D;  1J6Q A;  5C4J B;  1I50 H;  5DAU A;  1SE3 A;  3KBG A;  2F3W A;  4RMF A;  2VY3 A;  3IKJ A;  3X3M A;  1W3S A;  4YHH L;  1HFG A;  1PHJ A;  1U0L A;  4MNO A;  3SHL A;  1D7Q A;  1EYG A;  1SMY C;  4DR1 Q;  1V1O A;  1Y8P B;  2D0O A;  2EY5 A;  1FVI A;  4HMJ A;  1YNX A;  1V1Q A;  3HOY B;  5K36 H;  3CC7 A;  1LV9 A;  3W3A A;  4DV3 Q;  5C5L A;  1PH1 A;  2E2J B;  4OEL B;  2XGT A;  4KHV A;  1I5F A;  4X3U A;  3E6Z X;  3J80 c;  3J81 i;  3RLN A;  2ZJP A;  1JE5 A;  4HN7 A;  1JWS D;  1HZA A;  3L0O A;  1X6O A;  4GLV B;  1WD1 A;  3J80 E;  3QWN A;  4EQN A;  1QG7 A;  3A74 A;  1KRT A;  1AH9 A;  3T16 A;  4A76 A;  4DV2 L;  1EWC A;  3H09 A;  1NE3 A;  2A6E C;  3VR5 A;  1KC8 C;  4BY7 H;  2JYO A;  4LF7 Q;  1WTR A;  1KTK A;  1IYU A;  3I4N H;  1DYQ A;  5HGT A;  2K50 A;  3PUZ A;  5H1S E;  2R3Z A;  3NHH A;  2F3I A;  3BDC A;  4GKJ Q;  3GDE A;  4IUQ A;  3HOZ G;  2EYF A;  4QY7 A;  1PRT C;  3T53 B;  4R4Q A;  5LL6 S;  3U50 C;  3SK5 A;  1LT4 D;  2M9V A;  3J7A F;  4DR3 L;  1H9S B;  3D3R A;  2BDN A;  1UE1 A;  3D6C A;  1NR2 A;  2DJG C;  1QZG A;  2A73 B;  3MAQ A;  1DXM A;  2NN6 I;  4P74 A; 
#chains in the Genus database with same CATH homology
 3OPO A;  5IT9 E;  4RGT A;  1H9S A;  3D6W A;  1NR4 A;  3FEW X;  5IGF A;  5FOB B;  4H0L C;  2F0E A;  2PNR C;  4XXE A;  1BUV T;  1EIH A;  2KQ3 A;  1K8O A;  2KED A;  3N6R A;  3AU7 A;  4NP5 A;  5ELB A;  2RBM A;  4IFD G;  2X6L A;  1SYG A;  3Q24 A;  2K33 A;  4WFN 3;  3S2D B;  1H9M A;  3RUZ A;  2F1M A;  2JEA I;  1DM0 B;  1KAA A;  4RHR A;  5EBC A;  2JEB I;  1O78 A;  1EQT A;  3GV3 A;  4BBR B;  2PZT A;  4H44 C;  1S5C D;  4X3K A;  1NAP A;  1BBX C;  4H13 C;  5EGT A;  2CW0 C;  1GUW A;  1GOZ A;  2QIL A;  2AQ3 B;  2PZW A;  1V43 A;  2HCC A;  1XYI A;  4XDX A;  1BCP D;  5LL6 X;  1ENA A;  1A3T A;  1HPC A;  3WOF A;  1YNN C;  5T1I A;  4XIG S;  5NUC A;  1MBY A;  1TVX A;  4OGQ C;  3BDO A;  3BYT B;  3L7Z C;  4C3I G;  4B08 A;  1IYV A;  3OWF A;  1HQR D;  4K5W A;  4ZUI A;  3D31 A;  1IL8 A;  2WB1 B;  2L9H A;  1ML0 D;  2KCN A;  4CBV A;  2R92 B;  3DHQ A;  1OXT A;  3FMC A;  4KY5 A;  2A5H A;  3CHB D;  1Z47 A;  1HQM C;  2IT1 A;  1PXU A;  4ZUJ A;  2WAQ B;  4FO2 A;  2EZV A;  3TSS A;  4DK1 A;  2MHV A;  5IGD A;  2H4O A;  1D5Z C;  4ULL A;  2MGS A;  1AN8 A;  1W6K A;  2EVB A;  4FXD A;  3Q6S A;  2XWB B;  3O13 A;  1JOO A;  1SBB B;  2A6H C;  4J1M A;  4KHZ A;  5FKA C;  1T5X D;  1OXV A;  1STY A;  1RKN A;  5EKK A;  2MUY A;  1ESR A;  4DK0 A;  4B9X A;  1WD0 A;  3J81 L;  1ENC A;  1Q3L A;  1YNJ C;  2X6G A;  3HGB A;  4MHE A;  3BG3 A;  1G29 1;  1PFN A;  1STA A;  2K5Q A;  3QOL A;  3A7A B;  3NTK A;  5C0X H;  3TP5 A;  2WKC A;  4LMQ D;  2A6E D;  5JPN C;  2EJF C;  2K1B A;  3I3C A;  4EQO A;  2B2T A;  4F8M A;  2CQA A;  1PRT D;  1HHV A;  2B2V C;  3GTP B;  3PUY A;  1PFM A;  1CHP D;  2RDF A;  4HSP A;  4BBS B;  3EVQ A;  3HOU B;  1RTO A;  2YU9 B;  1F77 A;  4DAV A;  1SNC A;  1K83 B;  2O5J C;  3J7A V;  4OO1 G;  3HOW B;  2EPB A;  2NB0 A;  2E75 C;  2BE5 C;  3NUC A;  3SXH A;  2F0H A;  1C8C A;  5EPL A;  4EGV A;  3MXP A;  1TWH B;  2OEO A;  1F9S A;  1BQQ T;  4F7X A;  1JWU D;  1IW7 C;  4G7Z C;  3M85 A;  4IZ8 A;  3F2U A;  2Z4H A;  1G2S A;  5E3F A;  2E76 C;  1GXD C;  5KND A;  1LT3 D;  3KUP A;  3IFT A;  4C3J G;  2Z1C A;  2EE1 A;  3KF8 A;  3S17 B;  1G8Z D;  2WII B;  2D2C C;  5ELC A;  3HKZ B;  3H3V C;  5D3I B;  1EY9 A;  1D1K A;  3MXN A;  1IKL A;  3I91 A;  3U9O A;  4FNF A;  3V96 A;  4PNY A;  1B53 A;  4K6D A;  5FLX L;  4HAE A;  1LTI D;  2L5T A;  1Q1E A;  3ITP A;  1H9R A;  3VA7 A;  4ILW A;  3NTI A;  1Z7T A;  1SYC A;  1UUP A;  3CRK C;  5CV6 A;  1GUN A;  4L8J A;  2B2V A;  1RDP D;  2G9H D;  2F0V A;  4K5V A;  1A3U A;  5JEA G;  3WOE A;  2ZXO A;  2QKI C;  3TDQ A;  1A3V A;  4FVM A;  4JBW A;  5EKI A;  2D5D A;  4XT1 B;  1II3 A;  5I2X A;  4WOR A;  4K8I A;  2V4D A;  4BA1 I;  4A3E B;  4F88 A;  4RA8 A;  4TSS A;  4BY1 B;  1LTT D;  1K8M A;  4KJO A;  1SXT A;  5ELF A;  4Q5V A;  3QO2 A;  1BCP F;  3I90 A;  1EU3 A;  4KKU A;  2VB3 X;  2L4N A;  1TS2 A;  1EYA A;  2FMM A;  4OO1 I;  2B2Y C;  2BDO A;  4XT3 B;  1D1I A;  1I6H B;  3M7G A;  1EQV A;  3A56 A;  5I6W A;  1JE4 A;  5JPM C;  4TQU S;  1HFN A;  1DOM A;  2L55 A;  3SK8 A;  2BA0 A;  2MJ8 A;  2EY6 A;  4HTH A;  4BA2 I;  4A93 B;  1FYC A;  3EFX D;  5C3W A;  3TN2 A;  3RMH A;  2AWN A;  5F2D A;  2K32 A;  3J81 E;  2NBF A;  4RHS A;  3GO5 A;  2LMC B;  2SNS A;  2C5C A;  5CR3 A;  1I4P A;  4NDX A;  4ODG A;  5E4X A;  5ISR A;  1LO5 D;  2K03 A;  3MVV A;  2EJM A;  2XSC A;  1HA5 A;  3R93 A;  2K5W A;  3A54 A;  2EDG A;  3NBI A;  1IKM A;  1LLR D;  2C9O A;  4Y7N B;  1R4Q B;  4DFA A;  5HUR A;  1SFO B;  3KK7 A;  4CKC A;  2KUM A;  1TKW B;  1FGB D;  5CBE E;  2K5D A;  1D2B A;  5KGU A;  3V05 A;  3HS0 C;  4K8J A;  3CU7 A;  1R4P B;  1B9M A;  3HP3 A;  4I65 A;  2AQ1 B;  1F2Z A;  1KAB A;  4CKB A;  4KV6 A;  1O7Y A;  1PRT F;  5EPJ A;  5JVG 3;  3OIQ A;  3NWT A;  5M5W B;  1PTO B;  3GV6 A;  3HEJ A;  2NVY B;  4DXG A;  4HSV A;  4AYB B;  4R8N A;  4NKL A;  1WTX A;  1ZYR D;  4EVO A;  2TSS A;  1GJX A;  2R93 B;  1B3A A;  1LTR D;  2IPK D;  1HCZ A;  4Q0F A;  3U9S A;  3A8J E;  4ZRZ A;  3LNN A;  2N88 A;  2B63 B;  4WJW A;  4A3G B;  4R9W A;  3KLS A;  2QF7 A;  4C1N I;  3ND8 A;  3MEH A;  1BCP B;  3URY A;  3NSW A;  3DEP A;  2QCP X;  2Z4I A;  5FO7 B;  2F0I A;  3PUV A;  5C0X J;  1OXU A;  4QB4 A;  4G57 A;  5FLX E;  1L0X B;  5D14 A;  4UAI A;  5JOB A;  3E0J A;  2K05 A;  3FPU B;  1EY8 A;  3PUX A;  2F3V A;  2KEE A;  2AUK A;  4KD3 A;  5M3F B;  2OT2 A;  3PMF A;  4KD4 A;  3DWP A;  4NW2 A;  2ICI A;  1TY2 A;  4DAY A;  3CRL C;  5C4X B;  5EJW A;  3DWA A;  3SK6 A;  5I2Y A;  3HOZ B;  2B2U C;  1S5B D;  1X3Q A;  3DUZ A;  1HTL D;  2EY2 A;  5EKL A;  4DA2 A;  4XYQ A;  4BS9 A;  1DCZ A;  3DMU A;  2AWO A;  3J7Y W;  2BA1 A;  1E2W A;  1LTA D;  2A68 D;  2RVL A;  5LHY 1;  4ID6 A;  2F0T A;  1VF7 A;  2K7V A;  2Q8I B;  4RKL A;  3FRP B;  4QUC A;  4XQJ A;  3DM1 A;  3R2I A;  1D5M C;  1S5F D;  3G7L A;  1U9R A;  5CV4 A;  4WRD A;  1PRT B;  4X3S A;  2IW3 A;  3P20 A;  1FNW A;  5ELD A;  3WDN A;  4U67 3;  3T13 A;  1TWA B;  5M5Y B;  5KYI A;  4RFB A;  3QB3 A;  4A3D B;  2YYZ A;  1PFB A;  2F0N A;  3D4R A;  1I4G A;  1CA6 A;  1CQF A;  1ZEQ X;  4N9T A;  2MP1 A;  2FMC A;  4MN3 A;  4RWS C;  3FPP A;  2QDB A;  2Z8L A;  4TRD A;  3Q22 A;  5M3M B;  3GTO B;  1WVL A;  3MZ5 A;  3QOJ A;  5C3E B;  5IIF A;  2WKD A;  3GTQ B;  2JXM B;  1Y1V B;  1U4M A;  1FD7 D;  2B2U A;  4KJN A;  4KN7 C;  2RDG A;  5J39 A;  1EFI D;  1A6X A;  2EYH A;  2TMP A;  2R61 A;  2XVS A;  4NMZ A;  3PIP 3;  5C4Z A;  5EPK A;  4C3I B;  2F0U A;  4O42 A;  2F0K A;  5D3D A;  4QMG A;  1EU4 A;  3BVG A;  1TS5 A;  4CGY B;  1LT5 D;  1SYE A;  1STG A;  3MXU A;  2AQ2 B;  3I4M B;  1SDF A;  1SE4 A;  2A69 C;  1DON A;  3AB9 A;  2HDL A;  4QCL A;  1FNU A;  3K57 A;  1CZG A;  5CV7 A;  1AEX A;  5KNC A;  4RGN A;  5CGK A;  1A2U A;  3K58 A;  3I8Z A;  2RSN A;  2Q8R E;  1Y8O B;  1OO9 B;  1RCV D;  1VDZ A;  3RZO B;  2XRS D;  3MFY A;  1D5X C;  4IFD I;  4IUN A;  4IQZ A;  1QB5 D;  2KEC A;  4C3H G;  5C4H A;  4A3K B;  3FVQ A;  5JEA H;  2XRQ D;  5DM6 3;  2DN8 A;  2J0T D;  4OIK A;  4R8I A;  2F0P A;  4PV1 C;  3EJI A;  1SNQ A;  5CBA E;  3S1R B;  2QEJ C;  3I70 A;  2NVQ B;  1OXS C;  5CYU A;  1B44 D;  3NE5 B;  4G7H C;  1CA5 A;  4P2C B;  5JJZ A;  1VF5 C;  1WTP A;  3DWQ A;  5M5X B;  4ZKB B;  1STE A;  4V19 0;  3N52 A;  1EY4 A;  5E1F A;  2BCO A;  1CI3 M;  5C5M A;  5A2Q L;  1E2V A;  1GUT A;  3K0Y A;  3GQB A;  1PDQ A;  4QIW B;  2IX0 A;  1RD9 D;  3M4O B;  1UAP A;  2XIW A;  5C3X A;  3FKI B;  1J8I A;  1HTP A;  2OXP A;  1XWE A;  2FHT A;  1ONL A;  3DXJ C;  2HCI A;  3L9A X;  1XXG A;  4PQX A;  2ZT9 C;  4A3B B;  4K5X A;  4IUT A;  3BVM A;  2B2W C;  1S5D D;  4K2L A;  4C1N K;  4C2M B;  3H0G B;  4HCS A;  1ZYR C;  1SYD A;  3C2P A;  2JA8 B;  3A55 A;  3A8I E;  1C4Q A;  2NN6 H;  1SNO A;  2Q8T A;  3R3O A;  3VR6 A;  5KIX A;  2XN9 C;  3MTS A;  3RLF A;  5J22 A;  4C3J B;  4C56 C;  3OOC A;  2RSO A;  4IUP A;  3EQL C;  1JWM D;  2DY7 A;  3FDT A;  3D8G A;  3NWS A;  4Z9C B;  5D65 A;  1J9O A;  4RCN A;  1TWC B;  2J4X A;  5C0X G;  1TU2 B;  1F9P A;  1CFM A;  4KN4 C;  4RAU C;  2B8G A;  1EEF D;  1EOT A;  1PTO H;  1F9R A;  3MFG A;  2FFK B;  4A3I B;  4UDU C;  1Y1W B;  5IGB A;  4G4K A;  2KHS A;  3H6M A;  4YIJ A;  5IOC A;  1Q8I A;  3PIO 3;  1R9T B;  1BR9 A;  4HMI A;  4G7O C;  1G2T A;  1GHJ A;  1KDB A;  2IX1 A;  1SE2 A;  3BYY B;  4LAA A;  2F4I A;  2M2L A;  2L11 A;  4DNT B;  5IOD A;  3RD4 A;  2JP1 A;  1SEB D;  4OHJ A;  2NTS A;  3S9W A;  4KKT A;  3C46 A;  2E2I B;  4M8A A;  2B2W A;  2F0F A;  3OMC A;  1U4R A;  2B39 A;  1KNE A;  1T5E A;  1AZQ A;  2A68 C;  4E6I A;  4DF7 A;  3K5O A;  1B1Z A;  4LK1 C;  2M00 A;  2A69 D;  2XWJ B;  3S16 B;  1H9J A;  4B9W A;  2NTT A;  1ENF A;  2B8F A;  2WP8 J;  3LX0 A;  3GTK B;  3K59 A;  2I07 B;  1QE6 A;  1SYF A;  5C6A A;  1SNM A;  2L1B A;  3MHB A;  2E2D C;  2E2H B;  3TP8 A;  1WCM B;  2IX3 A;  2J7Z A;  1JIC A;  2JA6 B;  5BN4 A;  1I4Q A;  1LTB D;  1SAP A;  1FNV A;  4A3F B;  1JC7 A;  1PMR A;  1ET6 A;  1EZ6 A;  3VYS A;  1TWG B;  3GTG B;  2NZ1 D;  1TR5 A;  4GZY C;  1DOL A;  5JVH 3;  4RCO A;  2PW7 A;  3ND9 A;  3IAY A;  1QCB D;  3K5L A;  3I73 A;  1B2T A;  1PZK D;  1Z6H A;  5G3L D;  1FR3 A;  2GA4 B;  1ICW A;  1AP0 A;  3P7J A;  1TY0 A;  5DEH A;  1MD2 D;  4J6H A;  3ERQ A;  2Y0S B;  4S3S A;  1JOR A;  2ZXP A;  3I72 A;  4LJZ C;  5C0X I;  1NCV A;  5ELE A;  2B2Y A;  1WTQ A;  4IFD H;  4K6L A;  2AUJ D;  3P75 A;  3K5N A;  2I46 A;  1NUC A;  1TQO A;  4FXG C;  1AW7 A;  3OW7 A;  3TP6 A;  3LWE A;  4IUU A;  1IHZ A;  5CV9 A;  3VR4 A;  1CM9 A;  3CQZ B;  1MSH A;  1HUN A;  1LAC A;  4KY7 A;  2EYJ A;  4PMW A;  1QOH A;  2SOB A;  4KMU C;  5IGE A;  4CJ1 B;  5COY A;  4CKE A;  2E74 C;  3Q0A A;  5BN3 A;  2DNC A;  3T51 B;  2F0S A;  1TII D;  4FF4 A;  5TSS A;  2PW5 A;  3KBX A;  2F0J A;  1KDA A;  1MSG A;  2ICE C;  3P1H A;  1SND A;  1F9Q A;  1VMC A;  2JE6 I;  4TKO B;  3GD7 A;  1LAB A;  1I3Q B;  3OWE B;  5JEA J;  1EYC A;  2MPM A;  1RF2 D;  1EY6 A;  4HED A;  5FO8 B;  1ZKO A;  2IJ0 A;  4N9P A;  4ZKC B;  4DN4 M;  1BNZ A;  5COR A;  4V0B A;  2CHB D;  5FO9 B;  5A35 A;  5BN5 A;  1F2M A;  2CVR A;  1LTG D;  3TZD A;  3JAM L;  4X3T A;  3EA6 A;  3A7L A;  2EYP A;  4L6T B;  1OXX K;  2FIN B;  5EBD A;  1A2T A;  1B50 A;  4PMC A;  2G9D A;  2BOS A;  2KVM A;  1EY5 A;  2DNE A;  2K6A A;  3H94 A;  3Q23 A;  5IGC A;  5EQ0 A;  1WTW A;  3KLR A;  2JA7 B;  5KRU A;  1Q90 A;  4HCE A;  2NWG A;  3HOV B;  1HUM A;  5DNF A;  3NXW A;  1CK1 A;  4FXK C;  4RGO S;  1SYB A;  4U68 A;  2X69 A;  1JQY D;  1CQV A;  1Q12 A;  5CV5 A;  5K36 G;  3VR3 A;  1PLF A;  1PTO D;  2EYO A;  2F0O A;  1EY0 A;  2PQE A;  1QIL A;  3BDL A;  3GTM B;  1DD2 A;  1I50 B;  2SDF A;  3QIA A;  3SDZ A;  4FP5 D;  1PZI D;  3D4D A;  1EZ8 A;  3SVM A;  2PCF B;  1AFP A;  1BDO A;  4OO1 H;  1O80 A;  5C44 B;  4KI0 A;  4ME5 A;  4FF2 A;  1DJR D;  2B2T C;  1CTM A;  2N55 A;  2PZU A;  3AMU A;  1V1P B;  2RDH A;  1TWF B;  1SSO A;  2ENB A;  1ILP A;  4CJ2 C;  3I4L A;  1D6E C;  1GUO A;  3HRZ C;  2F0L A;  2KA7 A;  3TME A;  4IN3 A;  2FJ2 A;  1EY7 A;  5CV8 A;  3MA2 B;  5KYL A;  1V1P A;  4DGZ A;  1AZP A;  1E0B A;  2PMZ B;  5IGG A;  1I4X A;  3NTH A;  4BY7 B;  1L0Y B;  1BF4 A;  1M4V A;  3I4N B;  3SEB A;  1WTV A;  4RGM A;  3M7N A;  4ZAI A;  3T4A C;  2PO4 A;  3KLS X;  1SJE D;  3LWU A;  4MIU A;  3T56 B;  1KNA A;  1B9N A;  4IAL A;  4KY6 A;  2EYL A;  3BS1 A;  3C1E A;  1Q1B A;  2L12 A;  3PUW A;  4XQQ A;  1ZXT A;  1SMY D;  1XTC D;  1VMP A;  2L0C A;  1U4L A;  4IUV A;  2WV6 D;  4EQP A;  2VNU D;  1CT1 D;  3BZD B;  5G3L F;  1S5E D;  3M4Y A;  1MI2 A;  2VUM B;  2LS0 1;  3S2H B;  1Y8N B;  3S1Q B;  3V2T A;  1F2Y A;  1STH A;  1SJH D;  3OSO A;  3M3Y B;  4BWG B;  1SNP A;  2K01 A;  4K14 A;  3HOX B;  1MGS A;  2LY7 A;  1NSN S;  1QWY A;  3A8K E;  2O2L D;  5E4W C;  1JCK B;  2F0G A;  4ABN A;  2K28 A;  4L63 B;  4FF3 A;  2EY1 A;  3ERO A;  2KJX A;  2EOT A;  3NQI A;  2RQX A;  4H7B A;  1TS4 A;  1HXY D;  4OIJ A;  1G91 A;  1LT6 D;  4C3H B;  5K5P A;  1GHK A;  2XNA C;  1RTN A;  1RHP A;  2HDM A;  3G6J B;  2R7Z B;  3IFD A;  3IL8 A;  3BVZ A;  1EEI D;  3SR1 A;  3VR2 A;  3ZYY X;  2VB2 X;  2PYK A;  2RA4 A;  1QNU A;  4RKB A;  5FK9 C;  2SNM A;  2R6G A;  2ID0 A;  3UI2 A;  2VXW A;  5CMD A;  3JAM E;  2F0M A;  1ROD A;  4K2K A;  2ZXR A;  4IFD J;  2DY8 A;  2H1E A;  4RH6 A;  1ILQ A;  1W6J A;  4DU9 A;  3E5S A;  2JA5 B;  1BO0 A;  1E2Z A;  1LTS D;  4CHT B;  4A3M B;  1Y69 U;  4FF1 A;  4DXF A;  5KEE A;  1V8Q A;  3NP8 A;  2JSO A;  1QNK A;  3HZX A;  3W2D A;  3R8B A;  1PYW D;  3OMG A;  1O7L A;  2HQE A;  1KLU D;  1HA6 A;  3J80 L;  1HRJ A;  3QG1 A;  1C48 A;  2NUC A;  5DM7 3;  3MWY W;  1B4O A;  1STN A;  4DAP A;  4KKS A;  3QJY A;  2EYM A;  5I9P A;  1JOK A;  1RJT A;  2KCC A;  2NVT B;  2CW0 D;  1EL0 A;  3VA5 A;  3NBH A;  5I4D A;  3MC0 B;  3PO2 B;  2WIN B;  3HG9 A;  2K04 A;  3K6O A;  2LFN A;  4QF4 A;  3NQT A;  1F2L A;  1I6V C;  4ZYS A;  1A15 A;  1YNN D;  3C1F A;  5IT9 L;  5JAV A;  3TBI B;  3GP7 A;  1JR0 D;  3ONA B;  3SE0 A;  4DNR B;  3MXG A;  1UEA B;  1PTO F;  3H91 A;  5M9O A;  4FYD A;  4HR7 B;  1TT2 A;  1ET9 A;  1BOS A;  3L3O C;  4F87 A;  2F0D A;  3PV0 A;  5AFW A;  2EJG C;  4XTC S;  1XX8 A;  1EIG A;  4ZQ3 A;  2KOL A;  3VYR A;  1G6Z A;  1CZW A;  3TP7 A;  1H9K A;  1M8A A;  3K7A B;  4KTA A;  1VCI A;  4PMB A;  3DEO A;  5J1Z A;  5I9O A;  4JK1 C;  3TZU A;  4O1N A;  3OHX C;  3K5M A;  3RZD B;  3S1N B;  2A6H D;  3R2T A;  5CC4 A;  2EXZ A;  2HUG A;  1QJO A;  4A3J B;  3C3L A;  1JB3 A;  4KK7 A;  1DZ1 A;  1YNJ D;  1PTO C;  4QUF A;  1I4R A;  2OF1 A;  2NVX B;  3PO3 B;  4M1U B;  2D62 A;  1S4Z A;  2PPB C;  3NPP A;  1U4P A;  2NN6 G;  1GUG A;  1GUS A;  1BXT A;  2F03 A;  3X3N A;  4ZLT F;  4CJ0 B;  3S14 B;  1ESF A;  4ZK9 B;  2NYZ D;  4OL7 A;  4XYO A;  1UNS A;  1BCP C;  3GTL B;  1CHQ D;  2A74 C;  1WTO A;  2IL8 A;  1EWH A;  3NK9 A;  4J8Q A;  1KLG D;  1KDC A;  1DOK A;  2F0W A;  2LKV A;  2SEB D;  3OIP A;  1JOQ A;  1X32 A;  4IUR A;  1X3P A;  3VYU A;  2IWH A;  2O4X A;  1I4H A;  2BE5 D;  1EYD A;  4I7Z C;  3VYT A;  2O5I C;  1TS3 A;  2WAC A;  5A2Q E;  5I6Y A;  1PZJ D;  2D9U A;  3SK4 A;  4XQN A;  5T1G A;  5KNB A;  3CKI B;  1STB A;  3S15 B;  3D4W A;  2F0Q A;  1O7Z A;  3GTJ B;  2RKS A;  3S1M B;  1IW7 D;  5C4J B;  5DAU A;  1SE3 A;  3KBG A;  2F3W A;  3IKJ A;  3X3M A;  1HFG A;  3SHL A;  1SMY C;  1V1O A;  1Y8P B;  2EY5 A;  4HMJ A;  3HOY B;  5K36 H;  1LV9 A;  3W3A A;  5C5L A;  2E2J B;  4KHV A;  4X3U A;  3E6Z X;  4HN7 A;  1JWS D;  1WD1 A;  3J80 E;  3QWN A;  4EQN A;  1QG7 A;  3T16 A;  1EWC A;  3H09 A;  2A6E C;  3VR5 A;  2JYO A;  1WTR A;  1KTK A;  1IYU A;  1DYQ A;  5HGT A;  3PUZ A;  2R3Z A;  3NHH A;  3BDC A;  4IUQ A;  2EYF A;  1PRT C;  3T53 B;  5LL6 S;  3SK5 A;  1LT4 D;  2M9V A;  3J7A F;  1H9S B;  3D3R A;  2BDN A;  3D6C A;  1NR2 A;  2A73 B;  3MAQ A;  1DXM A;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...