4FNPA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
718
structure length
718
Chain Sequence
b'KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 227
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnpA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnpA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnpA02
4J27A 2RKXA 4M6VA 1SSDA 4JEQA 3DFNA 3II1A 3L0NA 2ZXAA 3MO7A 4IOTA 5G4EA 1PZ3A 3P80A 3UWWA 3W1TA 1BTMA 1L6YA 1LORA 3DX3A 3THAA 2Y2WA 2FQIA 1QO2A 3L0GA 1TB3A 5KINA 1PHWA 1KCKA 3CTLA 1PEZA 3G1YA 4JTIA 2WVVA 2FB3A 3ANYA 1QPOA 1PS9A 1XCXA 4GI9A 3NZ1A 3UQNA 1NVMA 4J9JA 3WN6A 4XBSA 2C18A 1J2WA 2ZE0A 1LDCA 4HOWA 3OBKA 3WNNA 4WD0A 2QR6A 4N9BA 3WJXA 3IJ9A 5BRQA 1I2NA 3LCXA 1XGZA 3P84A 4ADUA 2QMKA 4IUOA 5AHIA 5HINA 1PCKA 4GNJA 3M41A 1EP2A 3NQCA 3Q58A 2ZTKA 1IGSA 4JL1A 1OX4B 3L5MA 2ZXBA 3LXCA 5EYWA 3S42A 1UD8A 1EO5A 2GVGA 3FA5A 2FH8A 1C9DA 3EX2A 4FX6M 4DELA 5IBXC 1SW0A 3K8LA 2ZUTA 1A47A 3HGJA 3RILA 3NG3A 5CGMA 1GVSA 2V3EA 1O60A 1KM4A 3OLIA 1W56A 5DLCA 1JQXA 2Z1KA 2ALWA 1VC4A 3HQ1A 2JKPA 2NXGA 4Y96A 3UWUA 3WNOA 3VMPA 4UFJA 2XWDA 1KM2A 3GB6A 3QFEA 1OABA 3K8MA 3VE7A 3LLFA 2XN2A 3G0XA 2E9BA 5LNUA 3NO5A 2C14A 3NQ2A 4AIEA 3W73A 2H6RA 1SW3A 1I4NA 5D37A 4PL1A 3ZQ9A 4FLSA 4NJJA 3NR0A 3VE9A 1GTHA 3Q37A 4JTJA 1QI4A 1VPXA 3OHIA 2GVYA 2PC4A 4JYFA 1TPEA 2ZYFA 3BUBA 3TNOA 3PR2A 1I8JA 5CPOA 3L4VA 4PEKA 2WSRA 3HPSA 2QLYA 1E3ZA 3ZT7A 1P1XA 3BUDA 4UNIA 3BLKA 1UUMA 1R47A 2Y62A 2YKKA 3B03A 3L65A 4YLWA 2G3MA 1GG0A 3FLUA 2W0UA 3EWWA 2Z0IA 1PIIA 1G9HA 4OJYA 5E70A 2OW7A 2QCHA 1V3MA 3VMOA 1F05A 1LBMA 3DFQA 5G2IA 2YIHA 1OFOA 3W37A 5FF4A 5K3VA 2YDAA 1LRNA 3S6DA 3DZ1A 2XVLA 1H7WA 5F4SA 2DIEA 3S9YA 1W5PA 3TSMA 5CLTA 2ZX7A 3ZO9A 2B7OA 2ZRUA 4LVDA 4RZ4A 7CGTA 4MOZA 4MIMA 5DCBA 4FNRA 4K8EA 3PBVA 4N2YA 1WZAA 4FIRA 2F1BA 3HPXA 1SFJA 1P0KA 2QJIA 2J9YA 2WO5A 3NDOA 2R94A 2NZLA 3ABSA 4RZ6A 1CXKA 3CB8A 2OSXA 1M5WA 1R2SA 3MHFA 2E6YA 1VIWA 1JDCA 2ZXDA 3DX0A 4K6AA 4O1CA 2CLIA 5G2HA 2ZRZA 4MVAA 2OT1A 4XQ6A 3IGXA 1DHPA 3KVKA 3U8GA 1JCNA 3DX2A 4CGTA 1B9BA 5F4WA 1FWWA 1K03A 3M47A 1GCYA 1ZS2A 2VFGA 1O5KA 3NQ7A 3FAWA 3GBEA 1CXFA 3UG4A 3EJSA 1XSJA 4IXHA 4OV9A 2F7QA 1QPRA 3ZT5A 2QEZA 3LB0A 1DKWA 2C13A 4PODA 5EY5A 3W1MA 5C55A 4FLOA 5A2BA 3B06A 3UY8A 4HNUA 2Z1BA 1R2RA 3MYPA 4UFHA 4NJGA 4LNYA 4DQWA 3TONA 3L5LA 2ATMA 2CZFA 4XKYB 3EXSA 3C56A 3USBA 1Z42A 2WQPA 1MVYA 1OB0A 3SFKA 5LSMA 4O4VA 2ZZ5A 1KXQA 1AQHA 2QAFA 1ZCOA 4X9YA 1SU5A 3WJWA 4JTHA 1V5XA 4DPQA 4O28A 2ZUWA 1IZKA 3G1XA 4JIPA 3EWUA 2VFFA 2CWNA 4AH7A 2DU2A 1XH0A 4KWUA 4JNMA 4H3DA 3N9RA 2YW3A 1XSKA 1IZJA 2CLFA 1SZNA 2DZTA 3NPVA 4O0KA 3QQ0A 1QMLA 2VUYA 3SR7A 3V75A 3W71A 5D04C 3QGVA 2ZUUA 3D51A 3UZ5A 5CGTA 3HGOA 3CIWA 3ELFA 4EIVA 3M44A 9CGTA 4OHQA 1SO5A 1M53A 3VGGA 1WPCA 4E2OA 3DX1A 1DOSA 4FLQA 3YPIA 3BC9A 4GQQA 3WNLA 2O7SA 2A7RA 2VEKA 5CZ0A 4O19A 4JXCA 4AMXA 2CZEA 4DBDA 2QKFA 4I9AA 4YXGA 2A4AA 4PEEA 2ABBA 2A7PA 4O17A 4GINA 3C2FA 3DKLA 3W2NA 3EB2A 3NPUA 4AIOA 2QAPA 4FB7A 2ZWZA 2OT0A 1FWTA 3NQ6A 4X3ZA 4DPPA 3G0SA 5G1YA 4NI3A 2C19A 2YYUA 1B2YA 4QAWA 4IXXA 4JFVA 3NQAA 4M5PA 5LHFA 5AB3A 3G8EA 3I7QA 4GE8A 1IIHA 1OK6A 5F2LA 1GYLA 4GI8A 3W72A 3M0ZA 1GPWA 4O15A 4HNNA 2E8YA 1MW0A 1DL3A 3L66A 4DF2A 4GUFA 1TTIA 1D7FA 1PL9A 1H62A 3WDIA 3TSDA 1UKQA 1MW3A 1JJKA 2C3ZA 3AJXA 3LBCA 3T44A 3W76A 4Z0SA 3H53A 2A1YA 3B8DA 3SJ3A 1B0IA 2OW6A 4UOZA 3WNMA 4O8RA 1OFEA 2VT0A 2VOMA 5DO8A 3SGUA 4ZQPA 4UTMA 2WVTA 2JGQA 3HPZA 3W1QA 4R33A 1KFCA 2HSAA 2Y7EA 2E5DA 2XFWA 3TK7A 1B4KA 5EMUA 1VYRA 3ZSTA 3QPYA 4UFKA 3S1WA 5BRBA 1FCBA 1MO0A 2C15A 5D32A 3IIOA 3NQMA 3BCFA 5E6YA 2QCEA 3C3NA 2YYTA 3HGSA 4JY8A 3QRHA 5C2XA 1Q3NA 3S1XA 2OX1A 1EA0A 3CZLA 1YTEA 4LS0A 2V2CA 1BLIA 1M6JA 2VXNA 3RLUA 1SZGA 1HL2A 1UD2A 1TCMA 3HG3A 2VRKA 3PAJA 2ZX8A 1XV8A 4QIUA 3RIKA 1FX6A 2XIIA 3FW6A 1TQJA 2WKJA 2ZZ4A 4UXDA 3GDKA 4ORIA 1XD1A 3NOEA 1OFQA 4S2BA 3PUEA 3TCEA 3HOJA 1HFBA 2JKEA 4CNPA 3KL0A 1F73A 5A2CA 2E09A 2E6FA 4GJ1A 1TJRA 3G24A 4QNWA 5F2MA 1XDLA 1A5CA 3UD6A 1ZAJA 2VRQA 3H54A 3BK0A 2X1TA 2NV2A 1UB3A 4W9TA 2E8ZA 5KEZA 1RQHA 1KFBA 3GK0A 3CLMA 4CQ9A 4HOZA 2ZZ2A 2WVVB 4GIAA 3TMLA 3A22A 3GKAA 2BX7A 2LLEA 3NL3A 1L0PA 1SMDA 4WSJA 1H51A 4AHPA 1RQBA 3VSUA 2KZHA 2D2OA 2NUXA 4LXFA 1UD3A 3B0VC 5FF7A 1TQSA 6TIMA 2ZRXA 4PA8A 4UTUA 1UH3A 2BY1A 4OV4A 5BRPA 1F5ZA 1CPUA 3MBDA 4AF0A 2UV8G 1XD0A 4K39A 4ZQMA 4NZJA 1WAUA 2J25A 3DENA 4LS1A 1WBHA 3BLIA 5A2AA 1IV8A 1XUZA 3P8IA 2BTMA 2DORA 3CWNA 2ZZ1A 3PULA 3TC7A 1GJUA 4Q33A 2WVUA 4J3WA 1M7OA 1AMKA 4WOZA 3W85A 3JRKA 4JFTA 1GYNA 1OFPA 2WSYA 1TV5A 3BLFA 3W7IA 1K7EA 1HTYA 4NX0A 1XBXA 2DZVA 4LV9A 1JCYA 4JTEA 1K7XA 2CLKA 2ZCGA 4U2YA 3L68A 3BLBA 4UQCA 3L4WA 2QV4A 1TTJA 3R13A 1L6WA 1JFHA 1H3GA 1L6SA 4NXSA 3FOKA 5AHMA 1TMQA 3VGFA 3LCGA 3G22A 3SGZA 3IRDA 4AAJA 2Y88A 2NSXA 4HSOA 2ZX5A 1JL8A 5LNRA 4NZFA 5AHNA 2ATSA 3CPRA 2RHGA 3N73A 3C4UA 3DFOA 1OT1A 3DFSA 4LVAA 4JICA 3GXFA 2R14A 5HDRA 2YPIA 3QMRA 5I3GA 1OFRA 3VSVA 3ABOA 4LVFA 2C0AA 3RK8A 3PUDA 1X7FA 1QWGA 1TO3A 1KFLA 2CU0A 1I45A 1JXJA 5CPMA 2HS8A 3P74A 2ZFAA 2J27A 2TPSA 3L2MA 3C8FA 1WXJA 1QX1A 5D09A 2A2IA 2NXIA 1JF6A 1YADA 2EAEA 1GQNA 4YMZA 3CIXA 2HMCA 1U33A 1ODUA 1FWNA 1WOAA 1VJSA 3STFA 4UNLA 5DY3A 5HWJA 3LPOA 4UQEA 1HG3A 3KOFA 4GUIA 3S1VA 1W9XA 3UZJA 1TPH1 1CIUA 3DI0A 5D38A 4XTDA 1T96A 2AQWA 3ATZA 4BZYA 1QHOA 1O4UA 4ORMA 4AWTA 4YCOA 2PWDA 1UASA 4MZYA 4GO9A 1FBAA 1KGXA 4POCA 1TPB1 5D05A 3BGGA 1UD4A 1UOKA 1YLVA 2C1HA 2CLOA 4HA1A 1PHQA 3DI1A 2EGZA 1AW2A 3FIGA 3W23A 3W2KA 3A9IA 3PF3A 2NUWA 1ZNNA 3E12A 5K9CA 2BY0A 3IVTA 1XH1A 2GJLA 4OT7A 1JRBA 2ZA3A 1KFKA 4BR1A 1RZMA 2V5LA 2Z6IA 1NFBA 4GI6A 1GVRA 3QZEA 4MUZA 4Y8FA 3W86A 3GKFA 3EX3A 3HF3A 3IGSA 2BSLA 1XBVA 4AHOA 1EX5A 4CN1A 1JI1A 3SSJA 1W5OA 1K8YA 1EIXA 2EQDA 2F7FA 1VAHA 1Y7VA 2Y63A 3TW7A 3FKRA 1H7NA 4JFWA 2BXZA 2I9EA 1SUXA 3W1NA 4ZQCA 5AC8A 5BW6A 3Q2DA 1CGUA 4NNAA 1AL8A 3M7WA 2A21A 2AAAA 4FNPA 2PRMA 2F1AA 3BG3A 4M7SA 3WK3A 2CZ5A 3UWQA 3KL3A 4HPXA 1JAEA 1KV8A 3O6DA 1YDNA 5CSRA 4WXZA 1SQ7A 3UWZA 3VM7A 4MFDA 3TQ0A 1EUNA 2GOUA 3B04A 4ZQNA 5I5RA 3LTPA 1UA7A 3TTSA 3WY4A 3BAKA 3HG5A 3G1HA 1THFD 2G3NA 4UZUA 1ME8A 1JULA 5AHLA 3NPXA 1UH2A 3LCLA 1EP1A 4FNUA 4J28A 3LV6A 3BAYA 4HSNA 4UQAA 3LV5A 3NM1A 4KMQA 1WV2A 2WV8A 5J5DA 3WDHA 2XVGA 4DO6A 3VGEA 1E51A 1LWJA 2WKLA 5LGXA 3FS2A 5I24A 1O5XA 3LCFA 1NF7A 4FF7A 1QAPA 3HIJA 1YTKA 3EEGA 3PBUA 4MJZA 5D33A 2P1FA 3TA6A 4O14A 4N4PA 1VGAA 3IIZA 3BV4A 3KRZA 3DHUA 3L67A 3W7CA 3F03K 1UH4A 4GQRA 1C29A 4WXYA 2F61A 2Q8ZA 4TIMA 4UTTA 2QCLA 2BY2A 3C2VA 1K8XA 3GDLA 3M5VA 4DBEA 2WCSA 5K2ZA 5LGZA 3RU6A 1O94A 3LBMA 3H55A 1GJPA 1NEYA 4X2RA 1GOXA 3PS7A 4LTSA 2QCCA 3G1AA 3LHVA 4UTJA 2DJXA 4Z0JA 1KLYA 1XKYA 2X1UA 1S46A 1JG9A 3PB0A 3WJYA 1BF2A 3VKJA 1QWUA 3TU9A 2FYVA 2P0OA 1FWRA 4JCLA 5G4WA 1TPC1 4R53A 1TQWA 3EX4A 2TAAA 1W3IA 3NL6A 3GDRA 5A6LA 3WY2A 3I68A 3R5EA 4PH6A 5DBTA 1XBYA 5AHFA 2WPGA 3S8HA 1K02A 1H7OA 3PY2A 3VGDA 1KTNA 4AVFA 1Q4NX 3GZ3A 1I2PA 3DHPA 2EADA 2P10A 1XSIA 3ZOAA 4CKQA 1S5TA 3SZ8A 1FY6A 4O10A 5A8GA 3WENA 1WQ5A 1W3NA 2YA0A 3N3MA 4EWND 3TV8A 4A22A 1SPQA 3N2XA 1F76A 1FQ0A 2CPUA 2V81A 2VFIA 1UD6A 3L4UA 3NQEA 3WEMA 2QJHA 1W5QA 4JYEA 3T7VA 4WSKA 1N8FA 1R33A 3O1NA 5I3JA 4H8HA 2FB2A 3BG5A 1AMYA 3MHGA 2OZ0A 3S2CA 2E77A 1H60A 2NWRA 4ZQRA 4XUGA 2FDSA 2Z2UA 2F18A 4L4LA 4LU0A 1H63A 6TAAA 2VEIA 4KWVA 4EVZA 3BVVA 1I2QA 2QPUA 4MPQA 3BSGA 3MWAA 3GLCA 4YL2A 3W83A 3G18A 3CPUA 3PG8A 1XC4A 3R89A 3ABQA 1GTEA 4UTTC 1QPNA 3G1SA 5LNSA 1VHNA 1OHLA 8TIMA 3FYPA 1V3LA 2PURA 4Y90A 4CNNA 3I7RA 3G3MA 1KM1A 3W70A 1K3UA 4TMCA 1MSSA 2QCMA 3VI2A 3G1DA 2O7QA 1TIMA 3TR2A 3LRLA 4HHPA 1BG9A 3GXNA 5CPLA 3W9ZA 2FTPA 3GTNA 3RFAA 4AMWA 3FKKA 4OBTA 3SECA 4HNVA 1KTCA 3IIPA 2E5BA 3P8JA 1RPKA 3VU2A 3LTYA 2YFNA 2X2JA 3M6YA 4GUJA 1OYCA 1PIFA 4MZ8A 2GJRA 4QM1A 4ADTA 3MI6A 4NQ1A 2I1OA 3L4YA 2WNNA 3AMKA 2F7PA 3GNDA 1ML1A 2WVSA 3EJPA 3L0KA 4GKLA 3DFPA 1XBZA 5E6ZA 3A5VA 1MWOA 1YPFA 4LV4A 4WJEA 4Z1BA 4AF0B 2BXYA 3UYCA 3DDFA 5KSWA 2IGTA 3SIZA 5C5YA 3BW2A 3LGEA 1HX0A 2EO7A 1Z32X 4O53A 1G4PA 1TQXA 2OCZA 2RDTA 3EDEA 3KAOA 1RP9A 3W7PA 3C2EA 2EPHA 2X1SA 1ZFJA 3VNDA 1KM6A 4RLIA 1MW2A 5I3FA 1DTUA 5DN1A 3MP4A 1DJQA 1MFVA 1W31A 2BXVA 1KLZA 3PUOA 1BWKA 1FXQA 2TRSA 2A85A 5HXMA 2AGKA 1J0HA 4IMDA 4NX5A 2ALDA 4MYAA 3C61A 3Q94A 4IPIA 3C52A 1G4EA 2E6DA 2XVKA 1JD9A 3BUIA 1G1YA 1P6WA 4JX6A 5AOUA 2GJNA 5FEWA 3W38A 4CCDA 3CZGA 4J3TA 1U83A 4UMCA 3W07A 2QUUA 2WNWA 1QO5A 4JIQA 1F74A 4CN4A 1CLVA 1T0OA 4WY0A 1ICQA 1DHKA 1TRDA 3EJUA 3EJRA 4CNOA 3O8AA 1MXGA 2EAWA 3F4WA 2F7RA 4MB1A 2V3DA 1I2OA 4UCGA 3NGJA 4RCXA 5I0DA 5K4XA 4XB3A 1I75A 3KEHA 4B9ZA 3P7YA 2TMDA 1LOSA 3TUUA 2VEMA 1YXYA 4CLMA 5HR7A 1WZLA 1LM1A 1KA9F 4N9CA 2ZUSA 1LLZA 4P61A 1CGYA 4RV8A 3R12A 1ZJAA 4FNQA 1P0NA 1DJNA 1JIBA 2QCNA 3UPBA 1X1ZA 3KVLA 3LHZA 3WJSA 4C1LA 4AMAA 4M6QA 5A6MA 2ZZ3A 3VMNA 5DXXA 3FJLA 3LXAA 1KXVA 3C2OA 4NNBA 4JFUA 1H5YA 3VX0A 2B7NA 3BVUA 2OSYA 4FXRA 1MEIA 1U5JA 3GXMA 4WOQA 4HNTA 1AW5A 4UTWA 2FH6A 4J3UA 3ZT6A 4FEZA 3S5OA 2OJPA 3SY5A 2B0MA 3QMTA 5CZSA 1JDAA 4IMFA 4CCEA 3ECQA 5FF3A 1FCQA 1LCOA 4LVBA 1TRIA 4A21A 3KXQA 1SO6A 3TDFA 4A2RA 3OG3A 4KWWA 5G2WA 5K9XA 3LHUA 4ADSA 3AXHA 4DF1A 3RLVA 3MJYA 3THQA 2YR1A 1HXKA 4WX2A 5LHEA 4TVUA 1XH2A 4MY9A 1OX4A 3BMWA 2FHFA 4WLCA 2PRHA 4RX0A 4IMCA 4QQ3A 4OU1A 4LT9A 2WSPA 3NAVA 1UJPA 3NPWA 4JS3A 4JTKA 2VC6A 2WSQA 3KFTA 2ZIDA 3NL2A 1TQUA 4LWWA 1TPWA 3AO0A 4Y6GA 2OYLA 3OEXA 1PAMA 4JTFA 5I3KA 1OK4A 2VFDA 3FAXA 3STCA 4JTLA 3KWXA 3BW3A 1ME9A 1GZGA 1C8QA 1TV7A 3GR8A 5CZJA 3N19B 1LP6A 5U7SA 2DIJA 3UG3A 4AEFA 4S1FA 3MUXA 1SZEA 1N7KA 1KBBA 4BWLA 7TAAA 3PBWA 3LHYA 3RF9A 4JFSA 2G95A 3W7JA 5CZTA 3N34A 1VFMA 3M07A 3WK1A 2ZZ7A 2CLMA 4O52A 1NAL1 3W22A 3HG4A 4DEFA 1QWNA 3MI2A 3IIVA 3EDKA 3GXTA 1CGWA 1JUBA 1LZOA 4AWSA 5F7UA 2EHHA 2ZZ6A 1LTDA 1LWHA 3DU0A 4ZZ9A 1YXDA 3L5AA 5J5RA 1F6PA 3P82A 3PG9A 3W2JA 1OSEA 1ZAHA 7TIMA 2J9ZA 4K8HA 2Y6ZA 2VFHA 4DXVA 5AFDA 4TU1A 5KMYA 3UERA 3W7DA 3BLEA 4M7TA 3MP3A 3TAOA 2GPTA 4LQ1A 1QPQA 1ZY9A 1WZKA 1ME7A 4U31A 1XCWA 4WZHA 2YA2A 3DHDA 1CX9A 4H6KA 2ZRYA 3TC6A 3KVMA 1W5MA 3W7OA 3OLGA 2BWGA 2DH3A 5KITA 1VZWA 3KLLA 3KVJA 2YFOA 2TSYA 1X6UA 3VX1A 1UCWA 4ZL1A 3C0JA 3MW7A 5CGQA 5F1UA 4GO8A 2ZTJA 1RD5A 3VFLA 4O4WA 4J7RA 2FHBA 4U33A 5TQLA 3N2MA 1JRCA 1V3JA 3UNDA 3W84A 4E0CA 1TPVA 3U2OA 4O1BA 3CT7A 3G3DA 2YJQA 3W1XA 4H4IA 6ALDA 4LRTA 4K7VA 4BWLC 1R2TA 1MFUA 1RPXA 1CXLA 2VR5A 4J3XA 4UR7A 4CQ8A 4HT3A 4Z08A 2FPVA 2J88A 4RK8A 3O07A 4QJ1A 3MP5A 4J3SA 4N02A 4UQDA 3KLKA 1OFDA 3UWVA 5AC7A 2HTMA 3LLDA 2H3DA 2V9DA 5FF2A 4Q4KA 2QMJA 4HP5A 5FEPA 1KM0A 4PCSA 3E9AA 2DH2A 5ABTA 1X1OA 2YGYA 2I14A 1VHCA 1WO2A 4LUJA 4MY8A 3A21A 2CLEA 3TTYA 3V1PA 1OX6A 3W2LA 1CGVA 2D73A 3W1LA 3A23A 2YW4A 2X2IA 1EEPA 2Q3OA 1EWDA 3P67A 4LVGA 3DGRA 3HGRA 5DBUA 5E0FA 5LNVA 3OLDA 4AWUA 4O13A 2Q8LA 3E96A 4CCCA 1FDJA 1SZFA 3AMLA 2JGYA 3CM4A 2QCGA 4N6EA 3ZFHA 4OKDA 5DELA 3DBPA 2FE0A 3ZS4A 1UKTA 3QW4B 1GT8A 2QDHA 4UQ9A 3DH7A 3INPA 4UC5A 4BFAA 2R91A 4RXFA 4RXGA 1S5WA 3D52A 5D03A 5DY2A 1KBKA 3LHTA 2Y85A 1JCXA 3UPWA 5TD4A 3G0UA 5AYZA 5AYXA 2EJ1A 3CEPA 3HJEA 4MJMA 3L2IA 5CXPA 3BG9A 1ONRA 4ATWA 3L9CA 1PZ2A 3NL5A 1Q6QA 3BVTA 4WQ6A 2FGZA 1P4CA 2W79A 1IXQA 3JS3A 3CC1A 4ICNA 1IIGA 2IQTA 4IX0A 3CWOX 1SSGA 1TQVA 4M8UA 3DKJA 3HJZA 3OA3A 1ZALA 3D0CA 5F4XA 3TAKA 8CGTA 2WNZA 2YOCA 2JKAA 4YWIA 3L4XA 2WNQA 1IF2A 2ZX6A 4U28A 3NEVA 3K30A 2EACA 2YXGA 4U2ZA 3GAKA 5AC6A 3D4ZA 3TMQA 1HT6A 1JDDA 2XIBA 1AL7A 1C8VA 3WFZA 3CZEA 2OYKA 4EOUA 4PSRA 3TX9A 1JUKA 3MI3A 3N14A 4JCMA 4LOCA 2NT0A 1CXHA 1JVNA 3BVJA 3S5YA 4JY9A 3AXIA 2J24A 1ZAIA 3W7LA 4H8VA 3VCRA 1DQXA 1EB3A 1XL9A 4XWUA 2BHZA 4H7VA 3SW6A 3LOTA 4IMEA 3W7MA 3UXDA 3WEOA 3EXRA 3QMSA 5TIMA 5HMSA 4PCTA 1PIGA 3GXPA 5G1TA 2OSWA 3EWXA 4UZSA 5SWUA 3A47A 3P60A 2V2HA 2VEPA 4MY1A 5HUOA 3DDGA 5CPNA 2OYMA 3BMVA 3NQVA 4M6PA 5LNWA 2D0FA 2D3LA 2ISWA 1R30A 3CZNA 1K7FA 5D2XA 2ZWYA 4JGDA 1DORA 4NXKA 4Y9AA 1QDSA 3M16A 4NJKA 3PB2A 1VB9A 3M1ZA 1GVOA 3DC0A 1OVDA 4NNCA 4C1KA 3TJXA 3G1FA 3A4AA 1BVNP 3O6YX 2QCDA 3W2UA 1SO3A 5EL1A 3EKZA 4K7YA 3QEZA 4WY0B 1XCFA 1QNVA 4FNTA 3CQ0A 3QYQA 4RKAA 1E43A 5EMYA 5HR6A 3FYOA 3BGJA 1QPKA 1SW7A 3I65A 3JR2A 4O57A 5E0KA 2Y24A 2X2GA 1H61A 2D0GA 1PV8A 2ZUVA 3KHJA 4FLRA 1XM3A 1OJXA 2BY3A 1NSJA 4JTTA 2RH9A 3FJ6A 3EDFA 3CTTA 1A5BA 1A53A 4N6FA 5I3HA 1T8XA 3LERA 3G8RA 1TTPA 5MHBA 3VO0A 5KZDA 1AW1A 4BI5A 4B9YA 5KZEA 4G1KA 2FPYA 1JQVA 1G67A 3BAWA 1KXHA 1SO4A 3GYEA 3ZWTA 6CGTA 1TREA 1GG1A 1M7XA 3B05A 4JX5A 1IXPA 1R46A 1QOPA 4BF9A 4L4MA 3O6CA 3B4UA 2YSWA 2Y5EA 4O0ZA 3IIXA 3NNTA 3D4YA 5DCEA 2E0PA 4BI6A 2F7OA 4HPJA 4N9DA 2YCEA 5FEZA 3QC3A 3IEBA 4CN6A 4XZ9A 5T26A 3BH4A 4CQAA 3GVGA 3QM3A 2WPBA 3IK2A 3LDVA 3IGUA 2E68A 4HIBA 4IMGA 3WFAA 2WJZA 1LROA 1FDYA 3W7KA 1WE5A 4KFPA 1YDOA 1Q6RA 1R34A 1GVFA 3L2LA 3TSBA 4ZVJA 3LM7A 3EDJA 5C54A 3GXDA 2G97A 4AYGA 4X22A 1GJWA 3UG5A 3WDJA 1B3OA 4LS2A 3T4CA 3W7NA 3ZR4A 5HNRA 1F6KA 3I6RA 3G1VA 2V0TA 1AVAA 1TJPA 1DV7A 4W93A 2VFEA 3NYZA 1DVJA 4JDYA 1H1YA 5DCDA 2VELA 4IJBA 4O1AA 1W1ZA 1FCUA 4LPCA 3WMSA 1H50A 1YXCA 5G5IA 3W1RA 3LX9A 1QR7A 3FEMA 3LTSA 3UY7A 1VFUA 1A5SA 2Y7FA 1M7PA 3S0CA 1NM9A 3P5ZA 1VS1A 2Y7GA 3TKFA 4IX2A 4PSPA 2GQ8A 1AG1O 4NVTA 1GWJA 1KTBA 3KL5A 2C16A 1KV5A 1BVZA 2H90A 2PWHA 2V2DA 3DHFA 4O12A 2NX3A 1FDZA 4GUGA 1XI3A 3K8KA 3ZR5A 1G6CA 2VNCA 2HS6A 1VJIA 1VYPX 3W7QA 1D3CA 4MLRA 2R8WA 1O7DC 3UEQA 1Z44A 3C2RA 5D02A 4DO5A 2WKGA 1TMHA 3PM6A 1EHAA 2V8ZA 5I23A 4UNKA 2Y89A 4ZMGA 1VRDA 3CU2A 3GX9A 3MYOA 1QW8A 3W1UA 2VENA 4RJEA 3STGA 1CI1A 2NT1A 2GQAA 1T99A 2DZWA 1WDWA 3GDMA 3B0UX 4QAIA 3LCHA 1BPLB 1VCGA 1PPIA 4QISA 2D3NA 2F2HA 5L9FA 2G96A 3WELA 5EBUA 3GNNA 4TMBA 4MLJA 1ZJIA 1WZMA 5F2GA 1R75A 3P62A 3A24A 1QW9A 1WP6A 2BHYA 1H7RA 4XTIA 3DX4A 5FESA 4Z1AA 4Z1DA 3QSRA 3L21A 2DZSA 1OFAA 3U6WA 3LXBA 3EX1A 1XDMA 1OT2A 1VCVA 2RDUA 3W6YA 1WX0A 4JD4A 4UR8A 1K8ZA 2WCGA 2NXHA 4QNEA 2ZQ0A 3PSVA 1TCDA 4IWWA 5EA9A 1HNYA 1H7XA 3OVPA 1JR1A 3F1QA 4JTUA 2ZICA 1KFEA 3D50A 3QF0A 4GUHA 4UUIA 1EA9C 3BARA 3P81A 2DZPA 1UD5A 1J5TA 2BHUA 3RNDA 1Q45A 2CZDA 3R2GA 1V7YA 3E02A 1Z41A 2E1DA 1S5VA 3EJQA 4PTNA 2NV1A 1XXXA 1JCLA 2EABA 3LRKA 3DAQA 4A3UA 2ZA2A 1TTQA 5K9DA 1EPXA 3NQDA 5CG7A 1GEQA 5E93A 3STEA 1KCLA 2QPSA 2J6XA 4CVWA 2ZX9A 4BI7A 5DXYA 4N9EA 1VLIA 2H8XA 5KZMA 2DP3A 5D30A 4UQBA 1IXOA 4NUWA 3LI0A 3TQKA 5FI8A 3EKLA 3KE0A 3W7GA 4UMAA 3L4ZA 3W2MA 2XN1A 3W88A 4D2JA 5E9AA 2X2HA 3NZRA 3QSTA 5D2YA 1FUYA 1W0MA 3CZKA 4FHAA 4J3VA 3A6OA 3B0PA 3IVSA 4DF0A 4Z1CA 5HWNA 4IQLA 1PE1A 1H7PA 2AMGA 4FX8A 4M19A 3EX6A 1G7VA 4UTKA 1TQTA 3T40A 3AJ7A 4HN4A 1O95A 4A2SA 1S3HA 3BAJA 1W5NA 3TIMA 4DO4A 2C6QA 2X30A 1E40A 4AHQA 1SMAA 5CKSA 3S1UA 1JD7A 3A5FA 2ISVA 5D2VA 4RZ5A 3M5YA 3TQVA 4JX4A 3NQ8A 2WSKA 2QJGA 2A6NA 4MFEA 5FF0A 4KFOA 3ATYA 3NVTA 2F84A 1HL9A 1U2YA 4H2CA 2ISSA 3NXFA 1KFJA 1Q6LA 2A7NA 1LBLA 4GXMA 3RMJA 3E49A 5F1VA 2V3FA 3BVXA 1G94A 1FWSA 2Y61A 1L2UA 3HO8A 1XUUA 1YTDA 3I7SA 1JF5A 2TYSA 3TH6A 3EDDA 4AEOA 1QCWA 4S2CA 4UMBA 3BAIA 3VGHA 1ZENA 2J9XA 4Q32A 5FEXA 1KM5A 3W1AA 5KTLA 2B4GA 1UKSA 1L9WA 3HBLA 1NF0A 4K38A 4R7JA 5H2ZA 1D9EA 2W6RA 4AW7A 1HUVA 5HULA 3W74A 4LUIA 4LC8A 3GXIA 4I7UA 2Y70A 1JUEA 1HWWA 1ICPA 2H3BA 1GVIA 4HKPA 4PFMA 1A50A 4I7VA 5AHEA 3IJ7A 1VCFA 2BLEA 2ZBTA 1MEHA 1LLWA 3QW3A 1OF8A 5HUPA 5BMWA 3QQ1A 4GWEA 4R34A 3DXIA 1RV8A 3O05A 3HG2A 5HPOA 3T78A 1RVGA 1BWLA 3VSTA 2CLLA 1HO1A 5IM51 3P61A 2ZDRA 2GVLA 1J0KA 2FPTA 5HQEA 4B5NA 1OFBA 1WOBA 1X8FA 3BW4A 2JBMA 2ZA1A 3NM3A 4TR9A 1EH9A 4LY8A 1KGUA 4WF7A 3CHVA 4EF8A 2FHCA 1CW2A 1AK5A 1QHPA 3IJ8A 5LZLA 4OQVA 2QCDB 5AYYA 2FLIA 1KGWA 5CLWA 3EJTA 4NJIA 3O15A 1KWGA 2A6LA 1MXSA 1JI2A 4LRSA 1JXKA 1QOQA 2XWEA 4IGHA 1OGSA 1V3KA 4AXKA 1U30A 1KW1A 4WY0F 4UTWC 3M43A 4GBUA 3VGBA 3BUQA 4UFMA 4OE7A 2V82A 3W87A 5D2WA 1VYSX 1CXIA 2C8NA 3CV5A 1J0IA 3O63A 3IVUA 1UA3A 3MHUA 1YYAA 4BA0A 1SR9A 3WNKA 3BUPA 3DFTA 3VM5A 1TSIA 4QSHA 3QH2A 1WA3A 1HL8A 2Z6JA 4OIFA 3O16A 3W7EA 3BLPX 2A5HA 1MXDA 2NX1A 1QI5A 1KXTA 1JCJA 4JR5A 4O11A 1B57A 4LC6A 3TROA 2YZRA 2PWFA 3NA8A 2CHNA 4FX7A 1W3TA 1F7BA 3SI9A 5U4NA 3CGTA 4GC4A 1VR6A 2X16A 2DZUA 3KRSA 5EPDA 1MZHA 2ZXQA 3PWAA 2YX0A 2YA1A 3HMJG 2PWGA 3EXTA 2ZRWA 4FO4A 2GUYA 4MKNA 1VLWA 1OF6A 3TXZA 3LCIA 1DBTA 1JGIA 1P5BA 5BOOA 4UTHA 4TO8A 3BAXA 5E1QA 1W54A 4YCPA 4ALDA 1KB3A 4H8UA 3UXAA 1NOFA 3VNYA 1D3GA 1WYIA 3CEUA 4FXSA 1TPDA 4X9SA 3OIXA 2XN0A 2NX9A 1G4SA 4HOXA 2G5WA 2CLHA 2RFGA 4UIOA 3ABRA 3LI1A 4LW7A 4UFIA 1W37A 4UTIA 1I2RA 1EO7A 1A5AA 2NLIA 2NWSA 2RDWA 1KWKA 3LCWA 4UTLA 3TFCA 3K1DA 1J0JA 1SFLA 2JK2A 3NQGA 1B4EA 3QJAA 3PSWA 1FCVA 1DEDA 2GUUA 1DQWA 3W7HA 1TPUA 4ZQOA 2A0NA 3EWBX 3R8RA 2Y7DA 3UCQA 3ZR6A 1LOQA 3LHWA 4XKYA 3M5XA 1G69A 4FMVA 1W8SA 4QITA 3T55A 1G5AA 3BVWA 2GVJA 4FIQA 5I3IA 1IXNA 2DJLA 3TE9A 4N4QA 1GVQA 2X1RA 4MZ1A 1PS3A 3LRMA 2ABAA 4O54A 1LRQA 1D3HA 1TV8A 4GFSA 2Y4SA 2FJKA 2V5BA 5AN7A 1OYBA 4A29A 5D2TA 1G4TA 1QFEA 4PCFA 3L4TA 2QUVA 2AAMA 2QDGA 2PRLA 1MW1A 4OWGA 3WNPA 1F2JA 2NUYA 1TYGA 4JTSA 3PC0A 3W75A 3E0IA 1RP8A 4K37A 3MBFA 3OVQA 1LOLA 1XFBA 4NT0A 2EEXA 3GBDA 3EWYA 3N9SA 1HTIA 3GIYA 1H1ZA 4EF9A 3GR7A 1YDVA 4O50A 2PE4A 5GVJA 2C7FA 1KBIA 1BKSA 2WANA 1RQEA 3P5YA 3TW6A 4NU7A 1OX5A 2E5CA 1OYAA 5LKYA 2H8ZA 4WUIA 3FFSA 4X0NA 4JTGA 3W3OA 1ALDA 4RR4A 3EWZA 3WJZA 1ADOA 1WBJA 3WK0A 2PWEA 4UFLA 5HWMA 2D0HA 3GDTA 1AQMA 4AEEA 2B7PA 1CGXA 4FNSA 3QPZA 1HVXA 3CLWA 1BEUA 1Z48A 3LPPA 1JCMP 2GQ9A 4E38A 2PCQA 3C6CA 3TFXA 4O16A 1VFOA 1EWEA 2EF9A 3ZSSA 2CXGA 4I7WA 4ML9A 5CSSA 2WOQA 3F4NA 4M56A 3VNZA 1CGTA 2E6AA 3MMTA 3NQFA 3S5NA 4E2BA 4K36A 2V30A 2CW6A 1FXPA 2VKZG 1UUOA 2B7QA 3TJLA 3CZSA 1Q6OA 3BO9A 4O1DA 1N55A 4JYDA 3OLEA 4OGZA 1UBSA 1LYXA 1CYGA 4UCFA 4HPHA 1QI3A 3S5ZA 1ICSA 4UOQA 4U3CA 3KX6A 2OMAA 4ONVA 5C6MA 5L6UA 1Y0EA 5BNKA 1RR2A 4PC8A 4KFNA 3BSHA 3UWYA 3ZWSA 5HJLA 5H91A 1PVNA 4GRSA 4NJHA 4PL2A 3M9YA 4P2VA 3W7RA 1ZJBA 2Q3RA 1VQTA 2QCFA 4IPJA 2FIQA 3O06A 3BPWA 2E4TA 3WY1A 2CFFA 4TX9A 4BK9A 5K7JA 3TXVA 2QF7A 1PJ9A 1G7UA 3PVFA 3TOPA 4E2DA 2DZXA 4MAZA 2QUTA 5IBXA 3IV3A 3OVRA 1YPIA 1CXEA 3W1PA 1CDGA 4JL2A 1PCWA 4JDBA 1ZHAA 1OG0A 1VH7A 4U4MA 1BSIA 5EKYA 1E3XA 3HZ3A 1EUAA 3GAYA 2FFCA 1J4EA 1HO4A 1EP3A 4AB4A 1BAGA 1MEWA 1LBFA 3KRUA 1TPFA 2ZRVA 4MYXA 4JN6A 5TBOA 5F2IA 5BMXA 5DFAA 1KM3A 1LRTA 3BCDA 5A5WA 2WC7A 4KKXA 4XBKA 3WY3A 3M5ZA 1KBJA 2GJPA 3HB9A 4AYSA 4O18A 2EKCA 3PBYA 2BZNA 5K4ZA 3WK2A
chains in the Genus database with same CATH superfamily
2HT2C 1KOAA 5JHDD 4M8RA 1QO2A 2WQRA 1R3KB 1XQLA 5D1QE 4TPRL 1A3QA 4L3EE 3W01A 5C6PB 3ESOA 4K4KA 5J7CC 1AHKA 5B8CC 2H1LM 1NOWA 3WJXA 2PPAA 2EEFA 2FBOJ 1N5YH 4ADUA 5C86A 3MRIA 4M43L 2D1ZA 4YC2B 2ZXBA 2F15A 4BGLA 3FN3A 2CRMA 2H0JA 4IOSD 1NSNH 4TL4A 4ZB0A 4HDIA 5CN1A 1LK3H 5HDWA 3LS4L 1OM3H 3SM0A 3JT2A 1KM4A 4L5FE 4GRWH 5CCJA 4FS9A 3HQ1A 4UT9A 2NXGA 1EAJA 2C3HA 3OKMB 5FUCC 2B1OA 2YRZA 1O7DD 1F90L 1NC2D 1XTMA 3QXAB 5DS8A 5I03A 3WNJA 3OHIA 1EDQA 1TEFA 3UGVA 3GKZA 1NLBL 1OTTD 3NZ8B 1PBGA 3KEDA 3L4VA 3BUYB 2XQ0A 4PRIB 3P9MA 3UJ2A 2R56H 1PSKL 5AZ2H 2G3MA 1PX8A 3NFNA 1X8CA 3PFUA 4L6HA 4G6KL 2ITCA 4OJYA 4OAWA 1GL4B 3VMOA 1HINH 1QLEL 3TSMA 5CLTA 1O6VA 2VC9A 4YVUA 2OR9L 4CEUC 4ERGA 1HHJA 2AJZB 1ETZA 4LHQB 4HC1A 2ZXDA 4Z9KB 2D3JA 4H9XA 2B9BA 3DX2A 4OGAC 2CFGA 3ZT5A 3QUKB 3T6XA 3A6CH 4ILSA 1AS6A 4FQXD 3UFIA 2OPCA 1T89A 1WBXB 5ADPL 4PULA 4N9OB 4N26A 3N1PC 1L6FA 2DQHL 2FZ3A 5JHBA 1UQYA 1OV8A 4C4BA 3B9OA 5EZIL 1T5KA 4X50A 4ECNA 3T8QA 4H3DA 4B16A 2NY1B 1X1NA 4CW1A 1QMLA 4PJIB 5BS0B 5F0LB 4OHQA 3UJJL 1BX2B 2IQ9L 3MRGA 2CO1A 3FB5B 4GQQA 3WFDL 4AT6B 2VEKA 4IJTA 1WBYA 4DUXA 3P3SA 4O17A 3ABZA 5KYYB 3IACA 3APCA 4KAQL 2WBXA 5LHFA 1GTFA 2F08A 2O9RA 2Z35A 1KIRA 1K9DA 4DF2A 3AJXA 4LCSA 1ZBWA 4L1WA 2I07A 2Y22A 4KEZA 4QEGA 3B8DA 4PI2A 1GZ1A 3OP2A 3VIFA 1U8LA 1T04B 1D7DA 1D8CA 4LLWB 1K5NB 1CZ8L 1Q63A 1JNNH 5E6YA 1OLZA 5D1QC 2YYTA 3C09C 1FZJA 4QXTB 2VLKA 3S1XA 3F6LA 5C0CD 3GFZA 1HL2A 1P5UB 3NZUA 3K0WA 3V8CA 2BSSA 4FFYA 4R0LB 3ITTA 1N7MH 2ZKMX 4J1UA 4XE5B 4F7CA 2VRQA 4IU3A 3ZIMA 2C9XA 4RMQA 3D18B 4MS8C 3WLIA 2JI1A 3FJNA 5EA0H 4YGVA 4ODTH 3VSUA 2KZHA 2NUXA 3O6FC 1UD3A 5JQ6L 4FJZA 3ZVHA 4QOKD 1BZ9A 1GH7A 3WN5B 3MLRL 4QO1B 4D3CL 2ZAHA 3RTQB 3E0GA 1XUZA 3P8IA 4FFYL 4G8TA 4WHTA 3T3MB 3QYSA 4JFTA 4DVRL 1B3YA 3FDKA 2CLKA 2ZCGA 3X3GH 4MJIE 3L4WA 3S8GB 1EAPB 3VKBA 1LXKA 2QVTA 4NUJA 5LNRA 1ZA6B 1AZ2A 1B5TA 1KIQA 1GOMA 1LD9B 1POKA 3FRPG 5DA4A 3VSVA 4YIQA 3MUAA 1X7FA 4MMZC 2IH1A 2EDEA 5C0GA 1J8SA 4K07A 2DB8A 3FOMA 3NFPB 1JF6A 2I5IA 3LQGA 2W0PA 1E4NA 1T4WA 4LLMA 3PF2A 4IF2A 2CLZB 1KRAC 3C8HA 1HG3A 1HL4A 3RVWC 4LBSA 4W9EC 1QHOA 3U6RA 4Q8QA 1TJGH 3MMEA 1CFSB 5EU5A 3SAZA 3HFFA 2A74A 3OOQA 4E42A 4A55A 3HC0B 1NP2A 3EA2A 2Z6IA 3QZEA 1KIPB 5TQ0L 5I2UA 1VAHA 1FYTB 2Y63A 3LSOB 1Q7ZA 2JE8A 3VYLA 2APBA 5AVTB 1XLIA 2F1AA 1FFTB 4P5TB 3Q05A 1JGEB 4LRIC 4QX4A 2FWSA 4X6DF 3L13A 4N0UA 3WKYA 1XIFA 3HG5A 3GBNH 1YECL 1CLZL 4NAEA 3VCNA 4L9LA 1U8CB 2VVSA 3MZGB 4WDIB 4EZJA 4Z2LA 3DDMA 4ASTA 2MTPA 1RSFA 4OBSA 5DK2B 2WKLA 3QUMA 1MCRA 1AXSA 3TVMA 2EIMB 1VGAA 4OGYH 2AV7A 3UYRH 2JF1A 4PS4H 5L2KA 4DBEA 4NNYA 3WQDA 2EXWC 3CQHA 4LTSA 1R9FA 4Z0JA 1XKYA 3WJYA 1FKXA 2PGEA 1DJXA 1AP2A 1X96A 2W5PA 1DWFM 4XCCH 2QADD 1I9JH 3QVQA 2Z65C 2PXYA 3S83A 1E30A 5FKYA 2P5WA 4FTVD 3LQAC 1WC7B 3FRUA 1OT4A 5I3JA 2R69A 3IFLH 3QA3A 4W7VA 1H60A 2CFKA 4XVTH 4KWVA 1YY8B 1J1XH 4C6IA 5ESAB 5M17A 3KRBA 4ZFMA 2WUBL 3J07A 1WGOA 3KM2A 3L23A 1AH4A 3GF8A 3JZYA 1TIMA 5I82A 2CBVA 4NKOB 5F9OL 2A3BA 1TZ7A 4MWAD 3W9EB 3H2NA 3VFGH 4X2UA 2YWYA 1W2ZA 3VI4B 5AVUB 1ZL1A 4KHXL 4PB3A 4RSVA 2FUTA 3L4YA 4M3PA 2F7PA 2G4JA 4PMXA 2J56A 3EOBA 2EDLA 2YMXH 2V5CA 1GOFA 5C5YA 1SXBA 2WXOA 1U93B 4ZFFA 3EDEA 4RCAA 5A40E 3KAOA 3B7UX 2Y8UA 1HZHL 3NZHH 3U7YH 5D7LE 2LGNA 3MP4A 2HWGA 4KZEL 4NKCA 3I9IA 4HD5A 1T3FA 2ICWJ 3QUZA 1KIUA 1LP9E 1THCA 2XWJA 4NJAH 5J12B 3CE1A 3NA4A 4PGDB 1VZIA 1CU4L 3S34L 1QABA 1CLVA 4WY0A 3GC3A 5AUMB 3LA4A 4JFDE 2ICCA 3LAFA 2QGEA 4W1TA 1ZHBB 2IAMD 2HKHL 1ZTXH 2HBXA 3F85A 1B3XA 4PBFA 4IZGA 3OKKA 4PCPA 4YWGL 2EDYA 1JIBA 3Q8EA 1ETJA 4XP6H 4R7DB 3LNIA 7FABL 4UTAH 4L1BA 2IXUA 4MA1B 3SY5A 1CDUA 4M7LL 4CCEA 4GYJA 1FCQA 1LCOA 4RE2A 4LYKA 2HFTA 1ZT4B 1XIHA 3NCWA 1HYRC 3U25A 2NNRA 5LHEA 2PRHA 2WSPA 4ONFL 4ZD3L 3APDA 3QDJA 1H19A 1U8QB 4EWJA 1TQUA 2CWXA 4DT2A 1CFVH 3F3HA 3UG3A 2OZTA 2NLYA 3IAGC 5JHDE 2AK1L 3MX0B 3R06B 1F58H 3IRPX 1IAIL 3CC5A 4QXWA 2B0SH 4YXHH 4IK7A 4PJEF 1EGMA 3GS6A 4MKMA 4ZZ9A 1YXDA 5IROA 5I18L 3C5XA 3SQOL 1MJUL 1WZKA 2WWMD 3WEAA 4QG6A 1MAKA 4M5ZH 5HVFB 3OKNB 2VZUA 1CX9A 2ZRYA 3RUBL 1KBLA 1XB3A 4O2EA 5K33A 3GD1C 4WGKA 3K46A 4Y4FD 2Y25A 5JO5A 2VUOA 1TPXC 1Q6DA 1KZYA 5MKGB 3VH8A 4F92B 3H3KA 1I9RL 2RQEA 4B5VA 3AG2B 3BZJA 1O7DE 3KBWA 1JRCA 5DD0H 1KSIA 3G6JF 1QR1A 1RPXA 4QCFA 1NAKH 4KRUA 3VXQB 3B8WA 4W8LA 4N02A 4NAFA 2H3DA 3AT8A 4LAKA 4Z7WE 2W92A 5IFHL 4ACTA 1OX6A 2P47B 2HN7B 4D6GA 1C08B 2GK0B 3IGKA 6XIAA 4HIIA 4MJ2A 1KYOK 1YPZE 5C0DB 1J0MA 5FJPA 5LCVA 3QW4B 2HVJB 4L1TA 3WH5A 4P46C 5CXPA 4ATWA 5HHMB 3QQ9C 3WLRA 3H6JA 3WX7A 1E5BA 4IX0A 1CG9B 5I0ZA 1SSGA 4M5TA 4BK5A 4NO3A 3GC4A 4OZGB 2EDBA 1B0GA 2HKFH 1QSVA 1OLLA 2FVMA 1MCOH 2IEPA 35C8H 1JWSA 5GZNA 2O93L 4D1IA 1I7ZB 2C5DC 1G7MA 1GQKA 4CSPA 2YUZA 2Y2YA 1HZYA 3PHSA 4HBCL 1FRGH 1X5AA 1WAPA 4I0CC 2HJPA 1MUWA 7PTDA 3A47A 1V7ML 1ET7A 2BO0A 3AXXA 3KPNA 1WKEA 3G5YB 3HE7A 4BH7B 5C0NC 1K7FA 3QR3A 4NZ4A 4Y9AA 5G4OA 4BSJA 4WFED 4D6HA 2HT3D 1LQAA 1A5NC 1A8JH 1XB6A 5EBLB 3G1FA 1HEZB 3TA3C 2CIPA 2IFFL 3MODL 4CC1A 1O9ZA 5DD3H 1CNVA 4HG4J 1U3HA 5IREA 1RUPH 3AIEA 4IJ3B 2ACRA 3SE4C 1XZ0B 2AV1A 2FO1A 2ZUVA 3VTRA 3DIFA 3AYVA 4K23H 2CO3A 3M0KA 3PDOA 4RGNC 5IGXL 5FYJD 4QG9A 1YNKH 3PGCB 1MLCB 3B05A 1QOPA 4WI8A 3TXAA 3VXRD 1M7IB 4MTVA 4M3HA 1FORL 1A6UL 4WY7H 3HI1B 4DUVA 4FP1A 1HSBB 1NCWH 3IGUA 3VFRA 2WYSA 4HIBA 1FA4A 5I6XC 1BGGA 4UT6A 3EA1A 5C0CE 4HIHA 4MAUH 3NURA 2QHRH 4LS2A 3WDJA 3ID7A 2WJFA 4GG8A 1W0VA 4W93A 3BXNB 4QHMB 3OJDB 1BJ8A 3TYFB 3PFQA 4CAGA 4W9GC 4G7VH 1XBDA 4HCDA 3ZKSD 4EQ2A 1OD8A 2ZJSL 5ILTL 3PNZA 4NVTA 3BURA 2EIZA 2C16A 4ZUTA 4HT1L 1ZLEA 5CGYD 2Q10A 1XI3A 3KBPA 1O7DC 1OGAD 1RUSA 3WEXA 4CSZA 4QOKE 4DJEA 1FG9C 4QRTA 3ISRA 1PPIA 3SBRA 3GNNA 1OTTC 3EGXA 3D1MC 4AYFA 4NI8A 1G87A 3VKDA 1HVQA 3UMNA 2VEGA 3AQYA 4XX1G 5K1VA 2DZSA 1OFAA 2HPIA 1GKOA 3VJ6B 1XDMA 1FWHC 4L1HA 3WLNA 2CO6B 1WEJL 3B83A 1XLGA 2E27L 3F1QA 1KFEA 3BARA 4JX0A 1JHKH 5ISZD 2I24N 1L2QA 2GWGA 1XGPA 2DM7A 3MRMA 3W29A 1BQSA 3T6CA 2QPSA 3UU0A 1XGRB 1OANA 1RWFA 4KU1A 1NFGA 2H8XA 3UESA 4HMNA 3D3VB 4LGRB 1A1NB 1E6JL 1W0MA 5KVDH 4FQXC 1V3HA 2Z3FA 1LO3L 1SVCP 1KLUB 5IK3A 4DWSB 4RAVB 2FWLB 1FP8A 2O1AA 4WJ8A 4E9SA 2WVZA 3QGKC 4AZ6A 1U8JB 4G11A 4QS6A 2R8SH 4KXBA 1KPRA 1R3IL 3O0KA 4NZTH 4PGEA 2YEZA 3IDNA 2OX5B 1N3NA 3NQ8A 1RJPA 2R29H 1L9MA 4DP7X 2QJGA 2V5SA 2E7HA 2XWRA 5B39A 1Q9KA 3WCYA 4H01A 3GHPA 1CCWB 3O0RL 3DBXB 2X87A 1J10A 2TYSA 4AEOA 4OU3A 2ESVB 4IFKB 5GZOD 1XL4A 5HPCA 4ZSTA 4MMWA 2GUBA 4HH9A 3OSVA 2PI6A 1HO1A 4X6FA 3OBAA 4IGMA 4X7CC 2XXMB 1NCUA 4XN7A 4Y9BA 5C0FA 3JZ7A 3S2JA 3F5WB 4NO2B 1JOIA 4AX7A 1M6UA 4HCLA 5TDNB 3H9SD 3V0WL 4BELD 1YYAA 3CNYA 5EF2A 4JKPL 1KT2A 1JCJA 4JR5A 2B08A 3OR7A 3U4AA 4CL7A 2IS7A 3DEQA 4YS1A 4YO0B 2DFAA 4XAPA 8PAZA 3PWAA 4KXZH 1IQYA 5EZJB 3VXMA 3T3PB 2OLSA 2YDQA 1XGUB 5I0WA 4FTVE 1CT8A 1TWDA 4Q8OA 3PP3K 1I53A 4X4XA 1LURA 1ZBVA 3F65A 3E2QA 3PTKA 5BV7C 1OHQA 1DJWA 1G9NH 3G6MA 1QFWL 1KWKA 4OF6A 3AU6A 5D1XA 5ABGA 1UZ1A 4XP1L 3K5SA 4XZ4A 5J9PB 3MCMA 4XPGL 9RUBA 2GCYA 3MRLA 3UCQA 3M5XA 5CBBA 4H9TA 3B7RL 5I1IL 3CQQA 4O54A 1DLHA 3BXWA 1UT1A 1DBKL 4MWAE 4S3AA 5DJ0A 1E6NA 4A29A 3WLTA 3PAYA 2AAMA 5E6IB 2FO8A 5KANG 2G9HB 2WN2A 4B0MM 5LBSA 1R7AA 1OWRM 3D25B 1KG0A 4JRWA 1JCKA 3BGFB 5GGTH 4JTGA 3EUDA 4YYCA 1WBJA 4IM8A 4GOSA 3O81A 4ORGB 4GAGL 1AQMA 5ITFA 3IV8A 3U5YA 4O58L 3IDIA 4LB8A 1R5YA 1RBAA 1XVSA 4NUMA 2Q8BL 3IMWA 1SDYA 3TCXA 1AD0B 2RIKA 2UXTA 3CVIH 3AIRA 5SWSD 3TJLA 4DNLA 4U6YA 3M0XA 5LBSL 1VJZA 2LT9A 1OAZH 2UBPC 2I5QA 1MREL 1Z6KA 4X7SL 3CFKB 4W4OA 5IUSA 3VXUB 3N1MC 1CR9H 3KR3L 1M9SA 1MWAL 4MAZA 4E9RA 5MENB 2E74C 1H2JA 4QGTA 1H3PH 2DSUA 2G60L 4MA3A 1CB8A 5IVOA 5BXRA 2ZKYA 1AS7A 3DSFH 2GJ6A 2ZQKA 2YBVA 3EZ4A 4J3OH 2PN5A 1BVLB 2RKXA 2M83A 4N87A 4WIQA 1U8IB 1U22A 3THAA 2Y2WA 1R3SA 4Y1AA 2QYGA 4G8IB 4YTSA 4JG5A 4U6XB 1HHKB 3DOSA 3QHZH 2EDTA 2VDIA 3LKSB 5DUBA 3BP5B 3UJEA 3DI2B 1F3TA 2A9CA 2HQAA 2QR6A 1N68A 1A6PA 1TO4A 3ELAT 5HINA 2CMRH 3FNKA 3HVNA 3QJUB 2DVXA 5EFIA 5EYWA 4QRPB 4E9TA 3M7FB 3CHEA 1EYEA 1FVCA 1S9VB 4EAYA 3OGVA 5JIPA 1A5OC 4Z7VE 4HEMA 4YDLC 1O6SA 5EEVA 3K8MA 4C6KA 3DSNA 5T1KB 1RZGA 3DXAA 4FRWA 4AIEA 1XF3B 2QADC 2OO6A 3U30C 4MTMA 2NW0A 3VE9A 3Q37A 1UXMA 1NC4A 1MF2H 4NRYB 4PEKA 4JRYA 3DO3A 1FH7A 3KPTA 4QRUB 3B03A 3L65A 3I9PA 3O45A 4TTGA 1KXTB 2Z0IA 5ANMB 1TNMA 3QRGH 2OW7A 3F2CA 1HQTA 5KAQG 3AG1B 4PTXA 6ENLA 5GS1A 4X2PA 3SE8L 2ZRUA 2DSKA 1DZBA 4Q6KA 4MIMA 1G9EA 4HYRA 2RBLA 1OTUD 3SHSA 3VXPA 1A7RH 4L3CA 4XPAL 4DN3L 2IPTL 2XQBH 3NDOA 2X1PA 3ARDA 4RZ6A 1OW0C 3DX0A 4MWAC 2OT1A 2C9RA 4OCRL 3VFTB 2XM1A 3F04A 1GCYA 2RTTA 2J2ZB 1BZ7A 3C2AL 4R9OA 5C55A 5AVVB 1MFEH 5DRCA 1KJ3H 2E40A 5IHUL 1F4YH 1KYAA 4NBZB 4HALA 3MOAL 4QRRD 4K7FA 5CEXB 1XLDA 5BO1L 2WHJA 1V6VA 3GB7A 1XQKA 4DYKA 5AW5B 1T7ZA 4N8VG 2ZT9C 1R9XA 4ELDA 5J13B 1IZJA 4PLOB 3DUHA 3C86A 3NPVA 3FU5A 1JVOA 2YAQA 4P9HC 2BSRB 2AEQL 2VMDA 3IJYA 4E6MA 4IIQA 1LF1A 1MFNA 3QHOA 4O19A 2IAMC 2IALA 5E2WH 3W2NA 3QJQB 4GINA 5FB8B 5I73B 1FWTA 3MLYL 4S3CA 2IAND 1T0NB 1J1OL 2F53A 4HW6A 1DQQB 4Z7NF 4N2EA 4NAMA 1TZZA 1MZZA 1YYML 3P6LA 4DGIH 4GXFA 1NIUA 5M95B 5DC0A 2V3GA 1MW3A 1CLCA 5D8ZA 2C3ZA 3T44A 3QDMD 3F4VA 3WLHA 4IRSA 3QZAA 5LJYH 4M5SA 3LEYL 1FWFC 3SGUA 3OAZH 1VFAB 4F80A 3KWWA 1A02N 4E5XB 1KBWA 4W87A 1S7VA 1YMME 5H2BA 2XFWA 3ACSA 4NB7A 5D2NB 2MCG1 1V77A 2B4CH 2OMXA 1Q3NA 1MNSA 3QEUB 1YTEA 2OCFD 1J05A 1UD2A 1RUKL 4Y19D 2CUHA 2VRKA 4OZHA 3VXRE 2JJSA 1ASPA 1AE6H 3V5CA 2VITA 1V79A 3F5LA 2JKEA 2E6FA 1NAML 3UVIA 1N0LB 3QNYA 3TN0D 4F3FA 1A6ZB 3P73B 4Y9NA 2IDFA 3OIHA 5F7LB 5KEZA 2E47A 3NGBC 3QCUL 2V5JA 3Q01A 1QQDA 2D2OA 4LXFA 3BLDA 4NC1E 2HVKB 2WWMC 1AVLA 1JGMA 4WEUD 2VC7A 4XN1A 4P2YA 5FECA 4Y9GA 4EMZA 1LQBC 1IR1A 1UCTA 4AW4A 1E70M 5ADOH 3C8KB 4Y4FC 2ASHA 3MNZA 2Q86A 1QSED 2VZTA 2P8CA 4B4FA 4EEEA 1OGAE 4L1GA 2OLHA 2DJSA 2WZEA 3IEAA 4DGYH 4P2OB 4AH2B 2NSXA 1H3TA 2H47C 1ONXA 4M7ZC 3MZNA 3DFOA 2DBLH 3QS2A 3FDGA 5JYLA 2DW7A 4B9PA 3MO1A 4XMWA 5EEYA 4G7YH 1A64A 1RA5A 4RVBA 2CU0A 4XVSH 2J27A 1H0IA 1XF1A 4ZYKA 3B40A 2Q76B 5TK4A 4JEJA 3MLVH 1A9BB 1QALA 5ISZE 1XAUA 1PO9A 1ODZA 3QUXB 4FA6A 2F8IA 2X4SB 4U1GB 3G5ZA 4QDGA 2ZSVA 2ZNWA 1NGQL 4L05A 3H8NA 4GNKB 2CLRA 2EGZA 4K2SA 5J6SA 3V6OA 3TNBA 5CBAA 2A77H 3OB8A 3C5JA 1FWIC 3LNFA 1GGIH 4OT7A 2VR4A 3PTQA 5K39B 1BF5A 2GPZA 1ZU8A 2HFEA 3Q8BA 3SKNA 4JM2F 3N6YA 3S2LA 2AAAA 5D5ME 5TFSH 2PRMA 1GGCH 1GYWA 1GJIA 1Q0XL 3GK8H 5T1LA 1XF4A 2OI9C 3TCLB 4MFDA 1EUNA 3IDUA 4MMXB 1I8IB 2FZNA 3ZHLA 2JCWA 3GMMB 1ME8A 3CHOA 1I1FA 2FJGA 4K15A 2X28A 1MVUB 3QPKA 4JKWA 1OAQH 4YNYB 3I75A 2HT3C 4M80A 2MQGA 1JPGA 4KUCF 4WW2B 2DOCA 1A0DA 1RZ7H 5TJWK 3UYOD 4O14A 3RGVB 4H83A 3IF1B 4XAWH 2JIXD 2PDGA 3C2VA 1FO0B 4Z3HA 3G1AA 3PZTA 1JG9A 2ID5A 1Y5XA 4I8DA 4ANWA 3B34A 3UETA 3Q7JA 4K9EH 5A6LA 1ZA3B 4M5YH 1B0RB 3BDBA 3APYA 4J1OA 4PV1C 2BH0A 1ONQA 2RFXB 4U1IB 3OC5A 3B37A 4M93B 1JGLH 3SURA 4A22A 3H9SE 3RNQB 1T5AA 3IUDA 4FOMA 1KLFB 3HUJA 12E8L 1SXAA 2RACA 3W5NA 3NJMA 3ME0A 5E03A 3I02B 2E77A 2ZVRA 9XIMA 4GZIA 1MCJA 2Z1VA 1HN1A 1INDL 3AICA 3SFWA 3W83A 5EMKA 1E7UA 5LNDA 4OD2B 1N19A 3SRKA 3W70A 3UZEC 1INQA 1HXMB 3DTXB 1IEHA 4LBAA 3IFPB 1OM0A 2AGJL 2PCPB 5CGYC 3ZE2E 4DJDA 3AYTA 1FNSH 4O9HH 4A6YA 2HPTA 1VEPA 1OYCA 4NQ1A 2DYPA 2VLJB 4OH2A 4HAFA 4PTUB 3B0XA 3PPEA 3PZVA 3DUUB 3FU9A 4R4BA 5B1CA 1JWMB 3QFJD 5DRIA 2Y36H 5MF5A 2VE6A 2JJWA 1VZHA 3VNDA 1MW2A 5I3FA 3F4DA 3PPHA 3G5XB 3QZPA 4NX5A 3BVDB 3Q94A 3R58A 1BDYA 3M0MA 3BZFA 4OCLC 1MCKA 1P6WA 5BQDA 2XXFA 4ODVH 4EXPX 4H40A 4NO5A 1XYCA 4LVOB 1QO5A 1F74A 3IGAA 3VFNB 4U0RB 1JPSL 3ME3A 4PBXA 1ZHKA 4MB1A 3Q8CA 4GY1A 4JQVA 3UG8A 3U46B 4ZAKB 3ML8A 1YAIA 1OEZW 3REWA 3QOMA 5DTFA 3MSPA 4ZO7A 2R7EA 5SWSE 2P5ED 1DJNA 2JH2A 4Y5XC 1N7QA 3V5KA 1UP0A 4XBJA 3DRTB 1K72A 1J5SA 5TQ2H 1DXIA 3JWOH 2GVEA 3TDFA 2GJZB 3RHWF 3NH7H 2AK4D 2BOEX 3MJYA 1HXKA 3IGLA 3GVWA 2F1EA 3LENA 1RVKA 3AZTA 2CQVA 3OJMB 5DMIL 2HRPL 3O6ML 4HNLA 3US1A 3B43A 4JTKA 4Q8BA 1UA6L 3HBQA 1TPWA 5GZOC 3M6DA 3R8HA 1OK4A 3FAXA 2WBKA 2YAEA 1AFVL 1EFXB 1N0XL 2A6KA 2OXHA 1LP6A 1QO3B 2XV6B 4U4BA 2OMWA 3MLSH 2YXVA 4E5TA 2G95A 3W7JA 1JV2B 5H4YA 2KC0A 3E9TA 3L3OC 3E7JA 5MI0C 4DAIA 3GMNA 1SVZA 4IHOA 1ZSHA 5J1AA 4CVXA 3WV0A 4BQ8A 2CIIA 4N2AA 5FHBH 1CB2A 1CC3A 4URIA 5A16B 1AY1L 4AGLA 1VZWA 4K71C 3S36H 2YBGA 2UWEE 3G6LA 4FQPA 2FX8H 4ZX3A 1X6UA 3QKEA 3MPCA 3DRQB 1NM4A 5DJDB 3LMJL 1Z3GL 3VFLA 1WH0A 3N2MA 3V0AC 1K9EA 3QORB 3G3DA 2ADGA 4L29A 3SGDI 1CXLA 3AUVA 3DIPA 4RK8A 1NFDF 2L7QA 4GRWE 2QPFA 2YPLA 4TVSa 3PRZA 2H0PA 2ITFA 1P7KA 4M7LT 2EIBA 3WLLA 2JIEA 4AWUA 2Q8LA 1ZHNA 2Y7QB 4KJYB 5K9KA 5C09D 3WSQH 3HNTL 4EANA 3INUL 5MEQA 2XJKA 2IOMA 4MKSA 5IXEA 2G75A 5CJXA 1MCPL 5IB2A 2VURA 5E4EC 4J35A 2GY5A 4TVPL 5DT5A 2L04A 2Q3ZA 4MD5B 3O4LD 2HTAA 2EPKX 3DO7A 2AKZA 1AQ0A 1P9MC 3FK4A 1EDGA 1JHTB 3KPQA 1UB6A 5FM8A 3VW3L 3BD4A 3VG0L 1BFNA 4R90L 3REQA 1E5AA 4EOUA 5GRUH 4XWGH 4ODSH 1CXHA 4Q9RL 1JVNA 3BVJA 3SZKC 5FIEA 2N59A 4QRRE 3KPSE 4HCGA 1VPOL 4PJDB 2H6UA 1CMOA 1RAMA 1F6AA 4XMLH 4QG8A 3PZIA 2VHLA 3FCSB 1RJLA 4HUXB 3OAUH 5BZWA 3HPFA 5HI5D 2R0KL 2X6BA 4MQ7B 2NTSP 1WCQA 2VDRB 1E56A 4FP8L 1XLHA 4K7YA 5TAOA 5KSAD 4YIWA 4A3YA 3R1GL 3GU2A 3QYQA 2BS71 3LD8C 4QNPF 2IANE 4RGND 1FSKB 4D6FA 4J39A 3WO8A 5AVRB 4ATLA 5FX3A 3FJ6A 1FNLA 4FMKA 1EGZA 1TENA 2VGLM 3IDYC 3MUZ1 1NCNA 3EFDL 5I3HA 2R2CA 4IBWA 1N6UA 1SXZA 3IT8D 3MRHA 3O3EA 3MFFB 3QDME 1R46A 3O8XD 3BZ4A 4TSBH 5BMFL 2A9DA 3LPWA 1TJ1A 2WYIA 2G2RA 1PNCA 3B8VA 5RUBA 2EE9A 3PLYA 3IETB 4PTVA 4OGXH 1WNOA 3WKMH 3HLAB 3GTXA 5DCDA 4IJBA 1R17A 4L8SA 3W1RA 5AZ0A 4XR8C 4MADA 4P7OA 5H8UA 4QY8A 3CAKA 5B4MC 1A80A 2Y7GA 3QHFL 3MLZL 1SJXA 2C1OB 4H6RA 4MJHA 3BANA 3LS9A 2X89D 1W3HA 3A4WA 1S9WA 1MZYA 3C6LA 4C1NB 3RDKA 3UEQA 3C2RA 1RUQH 2CU9A 1WKDA 3ITOA 3KGRA 2VENA 5DZPA 1M6OB 3QAZB 2AERT 3OB0K 4K3EL 2YAHA 4F37F 1KNWA 1NOUA 4Q9CA 3QIWB 1ZJIA 4UT9L 1SYVA 3O3AB 1QSEE 1YCSA 3L54A 2JALA 4N42A 1IC4L 4JD4A 3V0TA 1GW1A 4TSAL 1K8ZA 2I32A 1QFPA 1S8DB 1JMZA 1I8QA 1H7XA 1FL6A 3RVUD 4AL8L 1AS8A 3QF0A 2QQ6A 1G7HB 3FY1A 4UTBH 1OTUC 2NXYC 1HOCA 1Z41A 1KC5H 2NV1A 1V27A 3NCYS 4NQDA 3D2UB 3DAQA 4MNMA 5CG7A 1F4HA 1KCLA 2NY4D 2ZX9A 2Y07H 4PN2A 5IOBA 3QC5X 1QR4A 4HD9A 2HVOA 2NR6A 2OPJA 2QULA 3H6AA 3GO2A 5I15H 3PXLA 1JZ3A 1BECA 1YNLH 3AFJA 4WVRA 2CIKA 4XHJD 3QEQA 4A2SA 4HC1L 4IIZA 3LEVL 4AENB 3V95A 3F58H 1GKQA 2G3ZA 2ACQA 3ZMRA 3HZKA 1N64L 3HC3L 2AJ3A 1CWVA 43C9A 4P4KD 1E8WA 2X03A 4HLEA 2IGFL 2HVBA 1GHFH 3W0WB 1VF5C 3V6ZA 3BVXA 3IJSA 5EPMA 1B9ZA 3UTZB 3I7SA 1FO0H 3UPMA 3VGHA 2J9XA 3SY8A 4D6CA 3HBLA 3GNMH 2WMHA 3KHOA 2R23A 1NMBH 4GY0A 2OMTB 1UP2A 4IIHA 4NHCL 3UFYA 1DE4B 1LLWA 2R1MA 4LH8A 2AI0L 2PSNA 4UBPC 5TPWH 4OKVB 1MAJA 1J0KA 3UW6A 3EJJX 1XLLA 3CPGA 1A5UA 3FXYA 1S3KL 1G7JA 4Z7OB 2XTLA 3I6TA 2K3HA 4KH2A 5LZLA 4QRSA 2P8BA 4NQVA 2YQ3A 4Y4HB 1GQLA 2HRLA 2WXDM 5AVNA 2OTDA 3GQFA 2IBZY 1U4EA 4X6CF 5EF1A 1A7QL 3O3UN 4LCUB 1ZDSA 3CHCA 4LF1A 5ID0B 1MXDA 5DR5H 3WKNA 3LM3A 3H8AA 2YZRA 5FF6A 3TEYA 2CHNA 2Q3XA 1AKJB 2C1IA 5U4NA 2R4RH 2PLTA 3KBFA 5I0YA 4AQ1A 2CG1A 1KB9K 1EF3A 2V7HB 5E1QA 2VM8A 1LNUB 2YXOA 1C5CH 1B2WH 2D03H 3TN0C 3OKLB 4LNVA 5DFTA 1I1RA 4G8FA 3CEUA 3WD1A 1IVLA 1Z8AA 1T7VA 4TQIA 4OLYH 1J96A 1KV7A 1UWRA 1NBVL 1DEDA 4NUQA 3AYSA 4WKZA 2E25A 1GIGH 2I7SA 1REQA 4CD6A 4ZEPA 4R5VA 2PPCA 2EIEA 3X1FA 3U0WH 4DKDC 1FHDA 4GKNA 4J6IA 1OYBA 1A8ZA 4AYEC 4PCFA 1W1VA 5FAGA 4JY4A 4XWOD 5I6SA 2CNYA 3GYRA 1GW6A 4FXGA 1TQBC 3TNMA 1JYWA 2BSCA 2CRIA 3ZY7A 2ZOWA 1E9OB 1CE1H 2B5IC 3IN0A 4AZ7A 2WM0A 4A2DA 3FCTA 3QFJE 4YE4L 1TFHA 3ROLB 2QR0B 2IPGA 1P84J 5LLIC 2DD8H 2EXYD 2GAZB 1ALDA 3ARYA 3BRFA 2JF6A 2GDQA 3VFUB 5B80A 2EF9A 3BD3A 4GYBA 1PZAA 1SGKA 2Z93B 3KAAA 3DHMA 4K36A 4NHUA 3DX5A 1FAIH 1UBSA 5D9MA 1D2KA 4QKTA 4W9ZA 2GTWA 1OOAA 4U3CA 5CMAB 5KG9A 3SPVA 5T8GA 4N0YL 4FFTA 4PRPB 5IUCA 1AH1A 4DAGH 4G83A 4Z2GA 1AJ7L 3TEUA 3RN6A 3POHA 5B1JC 2GSHA 2OP4H 2P5EE 1CXEA 4KKBD 3TBSA 1T0PB 3QPEA 3GAYA 4CBZA 1SXNA 1C1EL 5F2IA 3WE6A 1L9SA 4POZD 3KOWA 1M7JA 4PJAF 5AEAA 1WDDA 1BXCA 4KDTA 2J7BA 1NCAL 2AK4E 5DHEA 3L0NA 3LK6A 4DI9A 2EECA 4U3AA 2R1PA 2WP3T 3MUCA 1BTMA 1ITQA 4C6JA 4RISL 5KINA 3F7JA 3G1YA 1NL0L 4R8WH 4BZGA 5IKCA 4M1RA 3R1ZA 4GW4A 2ZE0A 3QIUC 5BZXA 4IBSA 3ERPA 1EX0A 4EXKA 4J3OD 5E8NA 4DM2A 4GUPB 2QMKA 3F7VB 5AHIA 3BH9B 4XO7A 1PCKA 3SSGA 2D22A 3S42A 3LXCA 1T03H 3FA5A 4Q8UA 5IOPA 2RJMA 4S3DA 5ALCH 1LE9B 2LTQC 5T3ZD 4G2DA 3MKCA 4LEOB 1DSFL 1IC5L 4S1SH 3VKAA 2Z1KA 3VD9A 4PTDA 2XN9D 5JW4Q 2JKPA 4Y96A 4UFJA 1JGDB 5JMDA 1J5HA 3QUML 2XWDA 3LZRA 5AL8A 2C14A 4LAQL 1U8PA 1V6WA 1J1PH 4EI6A 4ENED 4ODHL 3TY1A 4ZPTA 4YFLI 5BUGA 1J5OH 4WWPA 3KVPA 1TZGH 3OZOA 1UZ6F 2WSRA 2XYCA 4HZLA 4XNAA 3ZT7A 4Q4OA 1JNDA 4F0HA 2O5XH 1GG0A 4QE5A 5C7HA 1GVEA 1SFSA 1F05A 1XX9C 3VRLF 3WYRA 5DHYB 1K8CA 3OPZH 4MNGE 3I9GL 4BZHA 1QEXA 2B7OA 3D06A 4MOZA 4P57A 4L4JA 2Y1HA 4B27A 4IDJH 2R69L 2VI0A 1OJNA 4LSTL 2F6AA 1M5WA 2DF3A 2E6YA 4O1CA 4HK0B 4JKLA 5B3JE 3EJSA 1YJDC 3VUSA 3HI6H 5DMYA 1PGRB 4PS7A 2OMUA 1BZOA 3RBGA 1N59A 4NJGA 2X12A 2XZQH 4XKYB 2PWVA 4LF3A 3O4LE 1KXQA 3GSRB 5INCB 5DUJA 4Y4KD 1SU5A 1TCRA 4X5PA 1EXPA 2Z27A 4O28A 2VDRH 1WHOA 1KCUH 4OD1H 3UJIH 2BGQA 1YHPA 4KWUA 4DKEH 3WLKX 3N9RA 2YW3A 2DQCL 5C08A 3D51A 1WMOA 3O0FA 5BCAA 3DLQR 4ZO6A 4R88A 3DX1A 4L3AA 1B6DA 4XO9A 3NCMA 4RDZA 1G4MA 1OCBA 5I74B 2PLMA 3QUYD 5F7AA 3G0SA 1UB5B 5REQB 5AB3A 1FDLL 1DXEA 3I7QA 4PH8A 3SQSA 1YVLA 3PP3H 1GPWA 4M4RB 1DL3A 1P0SE 5CPQA 2DLFH 2H9AB 5LGKA 3Q6GL 1IQDB 4KVPA 3LBCA 1PLBA 5E08L 1UWGL 3SJ3A 4RGNE 4UOZA 4XXWA 1Z9NA 1NSSA 2GSGA 4JRXD 4UFKA 2NQCA 2YJLA 2G2PA 4MDJA 3RLUA 1QPXA 2DWSA 2WYHA 5KBMA 5DJYA 5ECUA 4APQA 3S3PA 3R0NA 1LQ0A 1XIMA 4Y7OC 2O9PA 4K7PH 2E9GA 4I18A 3I4EA 1B90A 3R8GA 4PJ8A 4I5BA 3HPLA 3FJ4A 3TPUA 5KN5A 2FKPA 3NIFF 4JY5H 2HPMA 2JELH 5L0QC 3QDGA 1O5QA 3FUJA 4PYSA 3TLLA 1NS8A 2EDJA 3S4SB 1AJ2A 4DN1A 4N85A 1GJUA 5I71C 1G84A 1TV5A 2J62A 3W7IA 3BVNB 2PDBA 4X6DA 3Q8AA 2VERA 3X11B 3OG4B 4DQOH 3AMCA 3H21A 5C9XA 1HJBC 4B6ZA 1PTGA 2ZX5A 4A2MA 1TWWA 4R9HA 3P4OA 4LSPL 2RHGA 5A2IH 4MJ5B 4MAYA 3DFSA 2R14A 3KPRA 2YPIA 2FSEA 1CBGA 5I3GA 4FL4B 4JQ2A 2Z92B 2FB4L 1OADA 2C0AA 3GINA 5E24E 2ERJC 5CPMA 1MMXA 3NO1A 3MMWA 3B8UA 4YBQD 4O0QA 4H1LB 4DUWA 1WOAA 5DJ6B 3LPOA 2DQIH 4H8WH 1E27B 4XTDA 2HG5A 3ARGD 4E0RA 4AWTA 2CKBA 2C4FU 3B8YA 3B2DC 4XNZB 3MUUA 1H49A 2QJJA 5LCVL 2UZ9A 3IVTA 4D8ZA 1DQJA 1KEGH 3W86A 4JLRB 2OWWA 1N2RA 3IK4A 4JFOA 2EDOA 5EOCJ 2DIKA 3TW7A 5BW6A 2WIIA 5CEZH 3O11A 1RFDH 5DUML 1ZPTA 3EGDB 5HHPB 4Z8FL 4AD1A 4K8RL 5C9KA 4HGXA 1C9WA 2E7BA 4HPXA 4PHZA 2GOUA 2CKBL 2IMMA 4JM4L 5I5RA 2OK0H 4YX2L 5KVDE 3UWEA 4RSYA 1CLOL 3C2SA 5HI5C 4LBEB 1RK5A 2YPVA 3LV6A 3N1FC 4UQAA 2XCMC 4I6VA 2X4OA 1MCFA 4MBRA 4KY1L 3NREA 5KSAC 4BFIB 3KRZA 4LSDA 2WMIB 1OKEA 2IWFA 2C9PA 3FA4A 1PF3A 5J11C 4X2RA 2UXVA 4CADB 3QIBA 3PB0A 1RD6A 3LDBB 4RDBA 4ZMVA 2YD5A 4R2GD 2BDNH 5LG1A 3LKQA 1K02A 4YHPA 3O8XC 3TWAA 4Z0XA 3LKOB 3NYDA 2ICEB 3SCMB 4DB7A 3VYNA 5A8GA 1I3RA 3Q2NA 2YA0A 2V81A 2UX6A 3ZKMD 4NQCB 3S5LG 1N8FA 4QXIA 8FABA 3TT1H 3MHGA 5F88A 2OG9A 2IPKB 4MS6A 3FX4A 3PZGA 4C47A 1QUPA 1SUHA 1W3YA 1R3LA 5I1EH 3MWAA 1D7CA 4ABVA 1XC4A 2WHVA 1Q94B 3SRFA 3VCCA 4OBRA 1W72B 4ADJA 2OGYA 2LLNA 1U8NA 4UT6L 3GTNA 3WOVA 3TIEA 4KVCH 1QBML 1BQHG 2XGZA 4AV0A 2W27A 4JFEB 2WB7A 2XFXA 3NJIA 2OLAA 3RJYA 1FNEB 1NEZB 1VRSA 1ESWA 4MZ8A 3C75A 1E2VA 4J2PA 2XZCL 2X4QB 3KNBB 3F7KA 2BNRD 4KNQA 3OKEB 4JN2A 1DPMA 1XLBA 5KSWA 1BM3H 3SIZA 3LGEA 1ZVSA 1XGTA 2HX8A 5D4HA 4BFJA 4MF4A 3NXLA 4FF9A 1MFVA 1EMTH 3NIGB 3QZBA 4IP4A 1TSRA 4ZS7L 3RVUC 3LG3A 5AYQA 1UZ8B 4CCDA 2ZF9A 3V52L 1CICA 1CB7B 1WIOA 3L6FA 5A6BD 4U3SA 4KTRA 1ICQA 1TRDA 1A4JB 2NY4C 3FQTB 4QLJA 1RZ8A 1IGJA 3TH4T 4QXUL 4GFIA 3PIQB 3V4PA 4QHRA 1EHXA 3REVA 2QDVA 1O9VA 2ADJB 2C10A 4FXKC 1XCQA 1EKMA 4KOCA 4YTUA 1ZSDA 3F7YB 3FJLA 4XHJC 2UZXB 4HNTA 1DQMH 2DQJL 2A3AA 4N0RA 1A65A 4OD3L 3K6IA 3H7RA 3VG9C 3AHTA 1X97A 5DMJB 5TE7H 3LKPA 3CBJB 3ULVF 5F9JA 4P4KC 1JK9A 1UC4A 4LSUH 4WX2A 2L8AA 4WJG3 4R26H 3KCPA 4JPKH 3NL2A 1UI8A 1USZA 3V9CA 5CD3B 1IVTA 4Y6GA 1MDLA 4MWFA 4HJWA 2BX5A 1IKNA 1TV7A 2J74A 3K6SA 4EI5D 2CLVA 1WUZA 5GSRA 1AH0A 5CZTA 3GUFA 3TC9A 4Y89A 1UYWL 1Z7JA 1BGXL 5IQLA 4TQ8A 5F7UA 1KXVC 2W07A 2F5AH 2R1YB 2Y6ZA 3NZPA 1I3GH 4A39A 4MKVA 3UYIA 4N6RA 4JFZL 3U9IA 1QPQA 1ZSXA 3UBFA 4GK8A 2CR3A 5T3ZE 2BWGA 1XIGA 2X2UA 4MUPA 4ZQTA 2JXMB 2XN9E 1FH5H 5EOQH 1JPST 4XOBA 4DQAA 4PRHD 2YD9A 4PM1A 1K8DA 3PL6B 4LEEA 2NY5H 4ATDA 4U33A 2I5YH 3CDZA 3Q3GB 3FFDB 1S6NA 5ICUA 4YK4B 2X4TB 4P5RA 2VR5A 5CGBA 1B3ZA 1RH9A 3NG5A 5AC7A 2Q6ZA 5GRXG 1OCCB 4PCSA 2CQSA 5LWYL 5CINL 2VVNA 1PX3A 2I14A 1TQCC 1WO2A 1KPUA 3TTYA 5BZDA 5ABFA 2EDXA 2Y5TA 2EDRA 5IVXE 1EWDA 2YRBA 2DI9A 1CTOA 4CCCA 4JZNA 3THDA 4U6TA 1H09A 4LPUA 1QSFB 3EW3B 1FL3A 1XG4A 2YL5A 5JPNB 3V5HA 3TJPA 2LU4A 3MBXH 3THML 5E94A 1OC5A 3SQBB 4GW5B 1MAMH 4I77L 4F58L 3QZNA 4BKLB 1HKLL 5CP3H 1G9NC 3QARA 4OAWB 1PWLA 2LAGB 2VW4A 4JFHD 1RI8A 4XWOC 2NDGA 4ODWB 4JFXB 4I0PB 1KEML 1RALA 3AQDA 1AD9B 1JUKA 1HHJB 1S5IH 3HRPA 3AISA 1VEOA 2J24A 1DBJL 2EXYC 2OODA 1FFRA 2AZAA 5AAWC 1NJ9B 5AW3B 4Q6IB 3RX4A 3D6NA 4KK6D 3MC0A 5AYTA 2PPFA 3EXRA 1U8OA 5L9DL 1BQKA 2OOGA 2D7PA 4N8CH 1JZFA 3DDGA 4HHLA 2J72A 4NUGH 2QGCA 3RKDD 4ADIA 5JIQA 2FJFB 2QSCL 2M1KA 3PB2A 2EO9A 2FZ3B 4C1KA 1GNXA 3NFUA 4M61B 2D7QA 4P49A 1ECYA 4ZNCD 3FYOA 1MQKH 4NWTH 1J8HA 5KS9E 1LXMA 4EN3B 1AHMA 1FC2D 1KYUA 2BY3A 2NSQA 4B9IA 4KKBC 2F2KA 2Z8VC 4N6FA 8XIAA 3L1OL 4PUWA 1DE5A 4GYPA 4YSEA 3GSNB 4POZC 5EBWA 5AD0B 4X5WB 3M7OA 1W80A 4A1RA 4BKSC 2YSWA 5C0IA 3UYPA 4BI6A 3D4YA 4GT0A 4J5TA 2CBIA 4JRXE 3QC3A 5IDIA 3CMJA 4CQAA 1IGWA 4QTHA 4HZ8A 4G8GD 4IRZH 3ITVA 1WE5A 4QGCA 3QSKB 1Z9MA 4HH8A 2I07B 2F8QA 3N18A 5FYLH 1K4DA 1MJ7L 4HYWA 4J3OC 5B4MD 1IQWH 3BSZA 3WD5L 4X5LA 3IE4A 2ZUQC 5LXGH 1F97A 2VLKB 1WA2X 4WUUA 3TBVB 4DK5A 3K4DA 1YN7B 1QYGH 4P59H 1M7UA 2FZBA 3EOSA 1KCRL 4M7JL 1EEYB 4LSQL 2X4RA 4WJ5B 3W7QA 2HS6A 1BWWA 2Y72A 4OSUL 4ENEC 4PV9A 3LN9A 3GDMA 3LCHA 1FZKA 5KZ6A 3CSGA 1TTFA 2VJ0A 3MRCA 3BSZL 1R75A 4ZI8A 1X5JA 4P3WA 3DX4A 1BYPA 4Q8MA 1A1OB 2FYMA 2A6JB 3PXJA 1AGDB 2F38A 2KZWA 1WX0A 2NXYD 3UDWA 4AD3A 4HWZB 4P0DA 4BUQA 1KENL 3L3HB 4HLJA 1A4MA 3BJFA 3FOLA 4WHTB 4JTUA 1KN2H 1P4BH 1UD5A 3R2GA 3PAZA 1J9QA 1S5VA 2I26N 3EJQA 3PPGA 3MV8A 3N91A 1EPXA 4P3CH 2ORBH 3RA7H 1GEQA 2CQTA 1W2VA 3Q1SL 2QGBA 3UC0L 4MQXC 3TZVD 3GJEB 3UO1L 4B5EA 4FHBD 4X4ME 1IVXA 2A9NH 1OIFA 4KXDA 4FX8A 1BEXA 4XOCA 3QFDB 3T40A 4E4UA