4FNPA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 227
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnpA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnpA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnpA02
3ECQA 3L0KA 3TNOA 4HPJA 5AYYA 2NX3A 3W2UA 1YXYA 2R94A 2A2IA 3CLMA 4ADSA 1A50A 2UV8G 1IIGA 1O94A 1Z32X 1CGTA 1KCKA 2D3LA 5CLTA 3L4XA 4NNBA 5KZEA 1YDVA 2HS6A 3CB8A 3G8RA 1YYAA 1XCFA 4AAJA 2RDTA 5KSWA 1H51A 3W07A 4JD4A 3OLGA 1ZFJA 3DFOA 2D2OA 2NUYA 4K7YA 1GTHA 2W79A 4LS0A 3LHUA 2C18A 3CQ0A 1KBKA 5ABTA 4OQVA 2Z0IA 1V3LA 2YW4A 3PSVA 4XTDA 3UWZA 3WJYA 2DZPA 2A7NA 4KFPA 4FX6M 3QPYA 5K4XA 5AHNA 1TQXA 3BARA 3LHTA 3KEHA 1CI1A 3UWQA 3G18A 4JCMA 1H7PA 2DZXA 1YTEA 3BMVA 3FOKA 2FJKA 3PG8A 3S6DA 1HL2A 3GR8A 2PWHA 1TPB1 1K3UA 1VPXA 5HWJA 3W76A 3W85A 4HNTA 1RQBA 1GWJA 1L2UA 3DI1A 4NJHA 3RLVA 3BG5A 3HGSA 2E5CA 4Z1CA 1WOAA 4K36A 1QI5A 1QHOA 3RF9A 1M5WA 3GB6A 5AC6A 1JD9A 2Y7GA 3M5XA 1ZJAA 5D04C 4AHQA 3BH4A 1GVRA 3EEGA 3TU9A 4OKDA 3FA5A 5HR6A 4JFUA 1E51A 3WELA 2OYMA 3DC0A 4Q33A 3LX9A 1KM1A 3D0CA 5CSSA 1Q6OA 2DZTA 1S46A 1KFBA 3LTSA 1PV8A 2C15A 2WKLA 2VEMA 2O7SA 3DX4A 1H7XA 1W5PA 3LTPA 3TTYA 4AMXA 1B0IA 2YIHA 1PE1A 1JCNA 1I2RA 1VH7A 5AYZA 4TIMA 4QQ3A 3LCXA 1NFBA 4JTKA 4NI3A 2XVKA 4EWND 2A1YA 4AYSA 4R34A 2FTPA 4XBKA 2WVVA 1Z44A 2A21A 2CXGA 1KGUA 3QFEA 3AJXA 3LGEA 3LPOA 4JDYA 3SGZA 2WANA 4MOZA 3HJZA 1RP8A 2VFGA 4XB3A 1UD4A 4IPJA 5AHMA 5K9DA 3TQVA 1S3HA 2C6QA 5J5DA 2QCMA 3L67A 5LNRA 4UTLA 4BFAA 3OIXA 3OVPA 4UC5A 2FH6A 2I9EA 3FLUA 1W31A 3F03K 3WK0A 5EMYA 3LM7A 3NZRA 4UUIA 3DFPA 3T55A 3IIZA 2QCLA 3WK3A 3WDJA 1TPUA 5C5YA 3CC1A 2Y88A 3A4AA 5EA9A 2NV1A 2G3NA 4UIOA 1LOLA 2J27A 3BLIA 4FNTA 3EKLA 1YDNA 2YA2A 1MO0A 2YGYA 1YLVA 5D03A 5AFDA 3EDDA 3W1UA 4D2JA 1RPXA 3A5VA 5E70A 5KMYA 4GJ1A 4O28A 1GG1A 2QCDB 4CN4A 4H6KA 2DIEA 3R13A 2QMKA 3FAWA 1BF2A 1B9BA 3BC9A 1BSIA 3ZR4A 3GAKA 3WY4A 1OX4B 2QAPA 3CZGA 2ZE0A 2NSXA 4JTIA 3TW6A 5C55A 4Z1AA 5FEXA 2V3FA 2YZRA 3WDHA 2ZRVA 4S1FA 1LROA 3L68A 3QRHA 4KWVA 1AL7A 4N9CA 1NSJA 4IMDA 3WNNA 4PC8A 4UQ9A 3ZQ9A 4U33A 4CQ8A 1FDYA 1IF2A 4IUOA 1KFCA 3A9IA 4IWWA 1LYXA 4TVUA 3P67A 2WVTA 3W22A 1VB9A 1UD6A 2J6XA 3U8GA 4FLOA 3LERA 3EKZA 3W86A 2ZTJA 4JIQA 4N6EA 2OYKA 4GUHA 4N4QA 3QSRA 4H7VA 1E43A 4U28A 4KMQA 1DQWA 1R34A 3HO8A 3S5NA 3DFNA 1QWUA 1HTYA 1GYNA 1KFEA 1EA9C 2NX1A 3G3MA 4OHQA 1HUVA 5I3GA 4UFLA 1KM2A 2CHNA 4NJJA 2A85A 2DZUA 3M0ZA 3MYOA 2F7OA 1TPH1 4MFEA 4CKQA 1KWKA 4LC8A 4O18A 4OV9A 5C54A 2BTMA 1H5YA 3W87A 3L4VA 2Q3RA 3TR2A 2Y62A 4HNNA 1XDMA 5CPLA 5G2IA 5BW6A 5DXYA 4A21A 1AMYA 3EJRA 3NM3A 3W1LA 1ZENA 3KRSA 5LGXA 3FFSA 2BXYA 4HPHA 3WFZA 3K8KA 3HB9A 1G7VA 2HMCA 2V2CA 3VSVA 1VRDA 3NGJA 1T99A 3LHVA 3GTNA 3W2MA 1J4EA 2OT1A 2CFFA 1O60A 1F2JA 3R8RA 3B03A 1EEPA 2YFOA 3I68A 1CXIA 3GXPA 2GVGA 5AC8A 4AWTA 3W1AA 2E6YA 3CTTA 2P1FA 3E0IA 3MUXA 1HG3A 3C2RA 2YOCA 1H63A 3UEQA 1LBFA 3LB0A 3W70A 2V2DA 4UNLA 3T40A 1ZJIA 1HXKA 1VC4A 3CIWA 5DO8A 3BG9A 3O16A 5F1VA 1MVYA 1F76A 4YWIA 1WPCA 3TSBA 3DDGA 4EIVA 2ZICA 1QPKA 3W9ZA 3NVTA 1NVMA 1BTMA 2BZNA 3WY3A 4LRTA 2NT1A 4Z0JA 4CCCA 4FEZA 5AHIA 2FPYA 4MY8A 4AIOA 5U4NA 1Q6LA 3W1NA 2GJPA 4N9BA 4R7JA 4X0NA 3KVJA 4KFNA 3M9YA 5TD4A 2XFWA 3C2EA 3NO5A 4WJEA 5HINA 3DX1A 4UTHA 1ALDA 1JIBA 3G1VA 1DEDA 1WZMA 1R46A 1VR6A 4WXYA 4HIBA 1UD5A 4NU7A 1F7BA 2VC6A 4I7WA 4O15A 2FHCA 4CNPA 1SUXA 1EO5A 3L4TA 1VJIA 2PWFA 3W83A 5LHFA 4N6FA 4MAZA 3TMQA 3UCQA 1GVQA 4S2CA 4LPCA 1XH1A 3S9YA 2YCEA 3NM1A 3KL3A 1DJNA 4DF1A 5CKSA 4N02A 5G4EA 3RILA 2WCSA 2GPTA 2XN2A 3QMSA 3WNPA 5K4ZA 2PWDA 1A5SA 3G0SA 2WNWA 4O11A 3P74A 1SSGA 3FW6A 3O05A 4NJIA 4FNRA 2G3MA 3UG3A 1SW7A 5EMUA 1TSIA 4PCTA 1VYRA 4R33A 4KWWA 4XKYB 4C1KA 1MSSA 2WSRA 4GUIA 3NQ2A 2ZRWA 2I14A 4DXVA 3W2KA 1A47A 4ZL1A 3HPZA 1OX5A 3IIPA 4BR1A 1TTQA 4JCLA 3LBCA 2Y63A 1LBMA 3KRZA 1G6CA 4MIMA 1A5BA 1FCVA 4QNWA 3N14A 2VR5A 4NJGA 4AH7A 1ZNNA 1WBHA 3W7CA 1PHWA 3A6OA 3L2LA 1PAMA 3W2LA 5EY5A 3IVUA 4CQ9A 4DELA 3KFTA 4HN4A 3W7IA 1W3IA 2DORA 1X7FA 1OX4A 3P60A 3IJ7A 4MLJA 2CLFA 3W2NA 3BAKA 2Y85A 1VFOA 1TIMA 3LCIA 3ZFHA 3S1UA 1LDCA 1I45A 3VM7A 4ORMA 1OB0A 4MFDA 3NL3A 4PSRA 2ZX7A 3W7GA 3ZT7A 4O0ZA 4MYXA 5AB3A 2X2JA 2EEXA 2OCZA 4OBTA 4RZ4A 3PUEA 1CIUA 2EAWA 4AEEA 3M43A 1FWWA 1EWDA 1CYGA 4C1LA 4UQCA 1TB3A 3ABQA 4IXXA 1UH4A 4ADTA 1QFEA 4M56A 4AMWA 1H7OA 4UOQA 3PSWA 3M5YA 4M6PA 4O10A 2WVSA 3VI2A 4A29A 2J88A 3MHUA 2QUVA 4QAWA 1OFOA 1V5XA 3IGUA 3G1FA 3W7DA 1JCYA 2V8ZA 1VAHA 2ZRZA 5F4XA 1LWJA 1JG9A 4O1CA 3G8EA 4HP5A 4DO5A 3THQA 3EJPA 4FLQA 4U4MA 3NR0A 3T78A 3G0XA 1GQNA 3HGJA 3B06A 3G1YA 3GNNA 4ZMGA 3F4WA 3BAXA 3TK7A 4FLSA 2NUXA 5FF4A 1P6WA 1WV2A 1I2NA 1Y7VA 5KZDA 3CHVA 4ADUA 7TIMA 4IMCA 4W93A 3FJ6A 3BUIA 3ZO9A 4J3WA 3TOPA 4EVZA 4UTMA 3JR2A 5LNUA 2Y7DA 3B04A 5L6UA 5I3IA 2CPUA 5D2XA 4AHPA 2F61A 2Y70A 3PBUA 1LCOA 3OG3A 4O19A 1SO3A 1BWLA 4UCFA 2CW6A 1MEHA 2ZRYA 3KAOA 2PC4A 1GZGA 3QM3A 3BUQA 4GIAA 4GBUA 1YDOA 1MW1A 3EB2A 2H8XA 4LV4A 5K9XA 3CU2A 3G1XA 4TR9A 2CU0A 1F74A 1GJUA 3LBMA 4MJMA 5CGQA 3L9CA 2QCHA 3BPWA 3C56A 2YA1A 2Y7EA 4M5PA 4LVGA 1PS9A 1LWHA 1Q6RA 3IRDA 4AYGA 1TQTA 4QIUA 2WVVB 2YA0A 4PL1A 3C52A 3NPVA 1H7RA 3VNDA 1ME7A 2CZ5A 5CLWA 3W7HA 1GTEA 1FCUA 4J9JA 3TIMA 2VXNA 1QI3A 2YFNA 5CSRA 4UFHA 3I65A 2ZA1A 1OX6A 2G5WA 3N3MA 1JF5A 2CZFA 1OFRA 3NQVA 4XWUA 1JCXA 3P5YA 1TMHA 2E6AA 3EX2A 2XN0A 1R2RA 4EF8A 3E49A 1CGWA 4P2VA 2BXVA 4O1BA 4J3VA 3NEVA 4N9EA 5I0DA 3NYZA 2GJNA 3QSTA 2EF9A 4UTWA 3TJLA 3V1PA 1RR2A 3RFAA 2B7QA 4HSOA 3BAYA 4PH6A 1ZS2A 1WOBA 1SFJA 5G5IA 5LGZA 3TAKA 1AG1O 4Z0SA 5T26A 3UWUA 2ZBTA 3MYPA 5AYXA 4RXGA 3TH6A 3W7LA 1K8ZA 2OZ0A 3DU0A 2VELA 3LCHA 2X2HA 2WSQA 5HUOA 3B0VC 3KE0A 1UD3A 1L6SA 1H3GA 4FNSA 1MFVA 4IMEA 2ZCGA 1R47A 1K8XA 3VE7A 3H54A 4CCEA 1D9EA 1IXOA 1ME9A 1BWKA 3S5OA 5EL1A 3INPA 3O6YX 4XBSA 1RD5A 5DELA 5SWUA 3NL2A 1XUZA 2Z6JA 2B7NA 5MHBA 1C8QA 4BI7A 2YR1A 2ZUWA 3BVXA 3BVWA 2YKKA 1RP9A 2BHYA 3DX0A 2EHHA 3DFSA 3HJEA 2O7QA 2WNNA 3SW6A 2VRQA 1CDGA 1CLVA 3MI6A 2V3DA 1QX1A 3S2CA 1EP2A 1RZMA 3GXNA 2F84A 4XKYA 3VMPA 4K8EA 4YXGA 4RCXA 1SO6A 1VCGA 2AMGA 2D73A 3RLUA 1MXDA 2Y61A 1VLWA 4FHAA 2YDAA 1GPWA 1BG9A 3CZKA 4IQLA 2ABBA 7TAAA 3R5EA 3TQ0A 1ZAJA 4WOQA 1CGVA 2QF7A 4N4PA 4ONVA 1A5CA 3BK0A 3GDLA 1JXJA 3RMJA 1JD7A 4H2CA 2F1AA 3MHGA 1I2PA 4N9DA 2ATSA 2X2GA 2ZZ5A 2TMDA 4QNEA 1JQVA 3NQFA 3OVQA 3FAXA 4JX4A 3IV3A 4K7VA 1VFUA 4FIRA 1KBIA 1QPQA 1W1ZA 4JEQA 1G94A 1TPC1 3GXFA 1JR1A 2VT0A 2Y2WA 4FNQA 2ABAA 3EWXA 3KVMA 2VKZG 1U33A 4NUWA 3BW3A 3B0PA 3CWNA 3OHIA 3BW4A 3O6CA 3BVJA 3C2OA 3LLFA 2F7PA 2DH2A 1JF6A 3VMOA 1TPFA 2VNCA 4JFVA 4NJKA 2EJ1A 1IXNA 3HQ1A 3PVFA 2FIQA 3L5AA 4DO6A 1WA3A 4WF7A 3STEA 5A2CA 4NXKA 2ISWA 5D38A 3AXIA 5BMXA 4E38A 3GZ3A 2OJPA 2WSYA 4XUGA 3MI3A 3BCFA 2WKJA 2GUUA 4MZ8A 1B2YA 2E8ZA 1I8JA 4OGZA 4UTWC 4LU0A 5IBXA 4FO4A 6CGTA 1LLWA 3MMTA 2LLEA 5EBUA 1XKYA 4GNJA 2H6RA 2RHGA 4ZZ9A 4K37A 1OFEA 3VM5A 1K7FA 3WNMA 4GI9A 1OK6A 1JUEA 3G1DA 1I2QA 2JGYA 3Q94A 1XCWA 1YTKA 3W75A 1SZEA 4UQAA 3OBKA 5TQLA 3SI9A 3TSDA 1LM1A 5DCDA 4J27A 4JNMA 5I3FA 1CW2A 1ZAHA 3KL5A 3WMSA 2A7RA 1BVNP 1FX6A 1EH9A 4O13A 3CZLA 1UKQA 3KLKA 3K30A 4GUGA 2QUUA 2QCEA 5BRBA 2CLIA 5HULA 3CPRA 2WSPA 4WY0F 4O17A 3UD6A 3GNDA 4O4WA 6TIMA 1JQXA 1XXXA 3BLEA 3LV5A 3W74A 4BZYA 3NPXA 2PCQA 2W6RA 3HGOA 1W5QA 3MW7A 1OG0A 1OYBA 1Q3NA 4UFKA 4MZYA 4WZHA 1HX0A 3GXIA 1PIGA 4CGTA 5BOOA 3HIJA 3VNYA 1TPVA 5FEPA 1VFMA 3L21A 2E1DA 1LP6A 3TX9A 4TX9A 2QDGA 4IX0A 3CM4A 1C29A 5D33A 4LUJA 3TFCA 5CZTA 3GIYA 1YPFA 2V3EA 3N9SA 3F1QA 5EYWA 3P81A 5G1TA 4GI8A 4EOUA 2VOMA 1FUYA 1MW2A 3HF3A 2YYUA 3VGBA 2TPSA 1XUUA 2XWEA 3AXHA 1EX5A 1HO1A 3HBLA 5AHFA 1F6KA 2D0FA 2A5HA 3PS7A 3TE9A 3YPIA 4TO8A 3L2MA 3PWAA 3LHZA 4X22A 5IM51 2A6NA 2ZYFA 3T44A 2X30A 4MUZA 2OSXA 2OX1A 1GVSA 3HMJG 3W7NA 3WN6A 4LWWA 3CGTA 3V75A 5D30A 1LZOA 2XIBA 4UNKA 4NQ1A 3WNKA 5DCEA 2BY3A 1UA3A 1T8XA 3CLWA 1B4KA 1KM5A 1TQJA 3BCDA 1L9WA 1U30A 4GQQA 1WE5A 1BKSA 1DVJA 5A6LA 3Q37A 5E93A 5I24A 4O8RA 1SW3A 1XSJA 3DXIA 3L0GA 3VMNA 1UD2A 3W7JA 3GDRA 1I4NA 4LQ1A 1MZHA 2NX9A 1JL8A 3UZ5A 1MXSA 4UNIA 1R75A 1TYGA 2A6LA 5IBXC 1PIIA 2H3BA 1GJWA 1V3MA 2CLMA 1W5NA 1KA9F 3BAJA 3W37A 1P1XA 1VYSX 1XI3A 3LCWA 4E2OA 1TTJA 3LOTA 3L5LA 3MI2A 1VHNA 4LTSA 3B05A 4MYAA 3LV6A 2VRKA 1B57A 3QPZA 4UMAA 2E77A 3Q2DA 2D3NA 1EWEA 3TA6A 1DTUA 1TV7A 1X8FA 1QW8A 2PE4A 1G67A 1UH2A 3QW4B 3MP3A 3EDFA 3KVKA 5CG7A 4WD0A 3SIZA 1OFPA 5DBUA 5HQEA 3A22A 3THAA 1RV8A 1TQSA 3QQ1A 4WY0A 1JCMP 5FF2A 2XIIA 3P8IA 2BY1A 3U2OA 4AIEA 4X2RA 3PBWA 3S1VA 4FXRA 4NNCA 3W1RA 1JCJA 4X9YA 1WX0A 4JY8A 4B9ZA 3M7WA 1WQ5A 2JKPA 2R91A 4UTUA 1OT2A 1PCWA 7CGTA 4AB4A 3ZR6A 1Y0EA 3D4ZA 3NL5A 1L6YA 1JI1A 4BK9A 1IZKA 4JFTA 3DAQA 3PR2A 2Z1BA 2VEKA 3NXFA 1TMQA 4NVTA 4IGHA 1H7NA 1MWOA 3D51A 1XSIA 3DGRA 4O53A 2PWGA 2GVYA 2FGZA 1BEUA 2TAAA 2NWSA 3A21A 3VCRA 4DPPA 4UFJA 5E0KA 1GYLA 3CPUA 1QNVA 3TUUA 3O8AA 4DEFA 1X1ZA 2WKGA 4U3CA 2WNQA 3EJSA 3W7RA 4WX2A 4UOZA 4PEKA 3I7SA 2Z6IA 5H91A 5HDRA 1KFLA 3G22A 1I2OA 3QJAA 2YPIA 1XSKA 4WLCA 2ZFAA 2V5BA 1GVOA 4CQAA 2Y4SA 1TV8A 3PY2A 1U2YA 4O54A 3LRKA 4UFIA 2J9ZA 1TTIA 2QV4A 2PWEA 5AN7A 2GVLA 1NF7A 4CN1A 4H8VA 2QJGA 1PVNA 3LXAA 5C2XA 1Z41A 3D52A 1VGAA 2V9DA 1XV8A 3FYPA 3P80A 5DBTA 1CXLA 3ZSSA 3BVUA 1LOSA 1QPOA 3O63A 4JN6A 4FXSA 2WJZA 4U2YA 4PCSA 5G4WA 2QCCA 4DQWA 3IJ8A 2E6DA 4HPXA 3S1WA 3L65A 1O95A 5F4SA 2E6FA 1QCWA 4Z1BA 2JKAA 5F2LA 4QITA 1FQ0A 2NXIA 3EWWA 1EIXA 2J9YA 4OIFA 4GINA 4WSKA 3BGJA 1TREA 3BO9A 2C0AA 3O1NA 2FPVA 3IVSA 1BAGA 1NEYA 4IMGA 5G2HA 5LZLA 1CXFA 4X9SA 1EUAA 1IXPA 1OK4A 3C8FA 1AMKA 3A47A 4NZFA 4JL2A 2FHFA 1WO2A 3QF0A 2CLHA 2XN1A 1FY6A 3Q58A 4JTTA 1WP6A 3RK8A 1DKWA 4JTEA 2QLYA 3LPPA 3NQ7A 3QH2A 3WJSA 3JS3A 5D2VA 3S1XA 3UYCA 3GKAA 3KX6A 4MLRA 4Y9AA 1EUNA 2BHUA 4NZJA 3HOJA 2DZSA 3LCFA 5G1YA 1FBAA 3EWZA 3HPXA 1LRQA 5DY2A 2F7QA 1H60A 2TSYA 3W6YA 3G1SA 1G1YA 3GYEA 2OT0A 2QEZA 4LVFA 3HG5A 4LY8A 1EP3A 1J0HA 1DHKA 1W8SA 2AQWA 3STCA 2X16A 3NZ1A 3BUPA 3OLEA 4UMBA 3GAYA 3LDVA 3LRMA 3NQ8A 5CZSA 4FMVA 2ZDRA 3MBFA 1HL9A 3A24A 4JFSA 4O1AA 4FIQA 5F7UA 4NNAA 2ZQ0A 3ATZA 1KM0A 3EWBX 1DBTA 2V2HA 2D0HA 3NQMA 1WBJA 1UA7A 3S5YA 3W7EA 3RU6A 5HNRA 3VSUA 3SJ3A 3EXRA 2ZX9A 1ICSA 2FFCA 3E9AA 4XQ6A 2C7FA 1LTDA 1QAPA 5A5WA 4YCOA 1NAL1 5K7JA 1A53A 2CZEA 4WOZA 1MEWA 2ZRUA 2EABA 1M7PA 3FEMA 1FWTA 1GJPA 4CNOA 3BG3A 1XBYA 2I1OA 2BHZA 1CGXA 1QPRA 5DXXA 4R53A 5BRPA 3PB2A 1KM4A 1UB3A 3K8LA 2XVLA 2QDHA 3PB0A 2VFEA 1Q6QA 2VFFA 3QEZA 5CXPA 2B7PA 3DDFA 6TAAA 3WDIA 2F18A 4UTTA 3C2VA 4MB1A 1F73A 3NPUA 4LUIA 4J3XA 2A0NA 4NX5A 1SZNA 2H3DA 5EKYA 2CLKA 5HWMA 3VGEA 4B5NA 1VZWA 1ICPA 4GKLA 1G9HA 1JUBA 3LI1A 4K38A 5I3HA 4O12A 2X1TA 3C0JA 1U5JA 3EXSA 3TJXA 2ZTKA 3W7OA 2V81A 1EO7A 1TO3A 2V5LA 3W2JA 3NQEA 4FF7A 2FHBA 1ML1A 4GC4A 4LVDA 4POCA 1TPWA 3P7YA 4WQ6A 5C6MA 4UQEA 1SW0A 1DL3A 2NV2A 2FQIA 1L0PA 4NXSA 1X1OA 4UR7A 1EHAA 2E8YA 4KKXA 3TFXA 1TQVA 4LT9A 2A4AA 2Y24A 1JFHA 4QM1A 1VCVA 2FE0A 1HVXA 2E9BA 3BGGA 2IQTA 1KV5A 1N55A 3BUBA 3AO0A 2Q3OA 1VJSA 3LXCA 3CZSA 1VLIA 4CNNA 1DQXA 4BA0A 1IZJA 2OSWA 1JJKA 1XGZA 1N8FA 3FIGA 3QGVA 1W9XA 1XFBA 1QHPA 3LRLA 4GI6A 1CXEA 2ZZ4A 4IJBA 4RLIA 3TQKA 3GBDA 1G4SA 1THFD 4YMZA 3L2IA 4Q32A 5HWNA 1JUKA 3SR7A 2FB2A 1NOFA 1XD0A 2ZWZA 3VKJA 3R12A 1OF6A 1UASA 2ZRXA 1OFQA 3C6CA 4BI6A 3FJLA 3MHFA 3SECA 3C3NA 5FEWA 3VX1A 5BRQA 3HZ3A 1WYIA 1TPDA 2Z2UA 2BSLA 2ALDA 5D37A 5KINA 1BLIA 1JAEA 5FF7A 1HO4A 2CLLA 1KM6A 1H50A 3TV8A 1KFKA 2XWDA 3GVGA 3G0UA 2B4GA 3GXTA 5KEZA 1KXHA 4K8HA 3IJ9A 4RKAA 1G4TA 3QC3A 2ZZ1A 4E0CA 2TYSA 3CEPA 3TTSA 5D2TA 4DF0A 1I75A 3TMLA 4I7VA 2OW7A 3WFAA 3W1XA 1D7FA 3NQGA 1ME8A 3EX1A 1YXCA 4ATWA 2GVJA 4JTSA 2BWGA 1FXQA 2ZX8A 3NOEA 4FNPA 1TQUA 4L4LA 2JGQA 4TU1A 1RPKA 1JDDA 3ABSA 2Y6ZA 4UQDA 3VO0A 2E09A 4GUJA 4M7TA 1KLZA 3KVLA 2C8NA 1DHPA 3E02A 4JICA 1B4EA 3S5ZA 3L4ZA 2RKXA 1QMLA 2QPSA 1VCFA 4UTTC 3VE9A 3NL6A 1OFDA 3WNOA 1OYAA 1P0KA 1UCWA 3GDTA 4OE7A 5TIMA 1A5AA 5CPOA 4UR8A 3BLFA 3W73A 4UQBA 3AJ7A 2ZZ2A 1EB3A 1P5BA 1PHQA 2NXHA 2J25A 3FKKA 4MJZA 3GK0A 4G1KA 1FXPA 4JX5A 1SMDA 1QPNA 1XH2A 4AEOA 2X2IA 5K2ZA 1R2TA 3B4UA 2HSAA 4OV4A 1OVDA 1TCDA 3W38A 4HHPA 1SU5A 5D02A 2DP3A 3BW2A 4RZ6A 1S5VA 4O50A 5F2GA 3TXVA 4AVFA 4O0KA 4RR4A 5CGMA 4LVBA 4WY0B 3TDFA 1WZLA 5DY3A 3I7QA 2C1HA 1AW1A 4LVAA 1JDAA 1QOQA 4E2DA 1J0IA 2R8WA 3EDKA 2EO7A 1Z48A 3DKLA 4HKPA 3ZWSA 1JCLA 3ZT6A 4K6AA 1UH3A 4ZQRA 2RH9A 4ZQMA 3QW3A 3M47A 3D4YA 4J3UA 3GKFA 1DORA 5LSMA 3O6DA 1M7OA 4ZQNA 2F7RA 4NT0A 3MP5A 3TAOA 1RQHA 3W88A 3H55A 1KXQA 1GOXA 2C13A 1MW3A 4PL2A 3GDKA 5K9CA 3TXZA 3NPWA 1XD1A 3MJYA 1VQTA 5FEZA 3W71A 3P82A 1P0NA 3DHFA 3W23A 3M41A 3S8HA 4H8UA 2DZWA 1D3GA 3S0CA 1W5OA 4QISA 4RXFA 2B7OA 3UPWA 4O16A 1QO2A 4ICNA 5EPDA 1SMAA 5KITA 4JTFA 2ALWA 5F4WA 1KGXA 1Z42A 4HA1A 2X1UA 1EPXA 3P84A 1AQHA 3GBEA 8CGTA 1AQMA 1YXDA 3IIXA 2YXGA 2ISVA 3G1HA 3M5ZA 2WV8A 3ZT5A 1LRTA 3FYOA 1H1ZA 2H90A 1AW2A 4DBEA 4ALDA 2DJXA 2C19A 1VYPX 4AW7A 2PURA 4ZVJA 4MKNA 3WY2A 2A7PA 3WY1A 2OYLA 2V30A 1AW5A 3GXMA 3H53A 3NNTA 1T96A 1TTPA 3DFQA 1W3NA 4PEEA 3QQ0A 1TJPA 2AAMA 3DHUA 3GX9A 5HJLA 3CWOX 1V7YA 3PUDA 5I5RA 4MVAA 1G5AA 5A2AA 3UWWA 1TRDA 1K7EA 1ODUA 4GRSA 3BSGA 2QPUA 3HG2A 1DJQA 2C3ZA 3UNDA 4LV9A 3S42A 4KFOA 3W7MA 4DPQA 4OJYA 4AXKA 3PBVA 1JVNA 1FCBA 4JTJA 3P8JA 3A23A 3PUOA 4Z08A 3UZJA 5A6MA 1N7KA 1J0KA 2E4TA 1W56A 5LNVA 3KOFA 1HWWA 4DO4A 4HOZA 3EDJA 4JS3A 1QWNA 4GXMA 3VFLA 1AK5A 2E0PA 1YADA 4M7SA 1UKSA 3FKRA 3EJQA 5L9FA 5DLCA 1QDSA 4PCFA 3BSHA 3EX6A 4UZSA 1SZGA 1XBZA 5CPNA 3LHYA 2GQAA 1J2WA 2P0OA 3WJZA 9CGTA 5BMWA 3UY8A 2ATMA 3EJUA 1OSEA 3WJXA 1XC4A 3OEXA 5CZ0A 4ORIA 1O4UA 1H1YA 1Q45A 3STGA 2BLEA 1UUOA 3C4UA 1V3JA 1CPUA 3B8DA 3PAJA 1F05A 3I7RA 3DHPA 1TJRA 3EDEA 2JBMA 3UQNA 1ADOA 3MO7A 1B3OA 2RFGA 1E3ZA 2VENA 3UXAA 2XVGA 1LLZA 2FDSA 5AOUA 2EQDA 1QOPA 5D2YA 1W54A 3DBPA 1X6UA 1VHCA 3JRKA 4GWEA 4UMCA 1EA0A 1FDJA 1MEIA 2YYTA 4O14A 3SY5A 4Y6GA 2F2HA 1IGSA 3W72A 1TPEA 3SZ8A 4LXFA 1SQ7A 1UBSA 1PCKA 3HG3A 1OYCA 3ANYA 4M19A 2NXGA 4JTHA 3W1QA 3VNZA 2HTMA 3QZEA 1FWNA 4BWLA 3E96A 2BY0A 4YL2A 5AC7A 3MBDA 1TRIA 3MP4A 2EACA 1L6WA 4UTKA 2RDWA 2WC7A 2ZUTA 4AWUA 1HT6A 2GQ9A 1BVZA 4O52A 2ZUSA 1NM9A 3L4YA 3EXTA 1OT1A 1F5ZA 5A8GA 5U7SA 4J28A 1FWRA 4UZUA 3VX0A 1SSDA 4XTIA 2PRMA 5FF3A 3DFTA 3FS2A 5HMSA 1UOKA 2ZXBA 2QJIA 3GXDA 3TC7A 4BI5A 3LTYA 4KWUA 3PG9A 4UCGA 3GLCA 4IPIA 1W0MA 4K39A 4FX7A 4NX0A 2BX7A 1KBJA 1PIFA 2ZZ6A 2ZZ3A 2DZVA 1HL8A 1PL9A 1CXHA 2YJQA 3TKFA 2CWNA 4UXDA 1FCQA 4RZ5A 2VFDA 3W1PA 2YSWA 3ZR5A 3WJWA 4JTUA 4X3ZA 2WO5A 5BNKA 3BUDA 2GQ8A 3IVTA 4MY9A 1JDCA 5E6ZA 3P5ZA 5D05A 2DH3A 1PPIA 1JRBA 2Y7FA 1OF8A 2CLEA 1G7UA 4GO8A 3LHWA 5D32A 4IXHA 5CZJA 1KB3A 1M53A 1K8YA 4JTLA 3NQDA 2WQPA 4EF9A 3CV5A 3L4UA 3WNLA 3LI0A 3NQCA 2PRHA 1MFUA 3UG5A 4Q4KA 4JYDA 2ISSA 3SGUA 5FI8A 1XBVA 3DI0A 1OFBA 1XM3A 3P62A 1XDLA 3STFA 3ELFA 2Y89A 5I23A 2FLIA 1RQEA 4FNUA 3UXDA 4RK8A 1KCLA 8TIMA 1XL9A 4GQRA 3IGXA 5E6YA 3EJTA 1JI2A 2Y5EA 5F2MA 3BV4A 1OHLA 3W7PA 2CZDA 3OVRA 4ML9A 4AMAA 3PBYA 4O4VA 1VS1A 3NG3A 4OWGA 2GJRA 1H62A 3VSTA 2IGTA 2G96A 4OT7A 1FDZA 1WDWA 3DENA 3DH7A 2WSKA 4Y8FA 2QCNA 3B0UX 4PSPA 2QKFA 3IK2A 2VEPA 5LKYA 1KTNA 5I3JA 2ZWYA 4LS1A 1ZJBA 3GDMA 4E2BA 1KV8A 5H2ZA 4BWLC 5KZMA 2ZA3A 1SFLA 5KTLA 3KWXA 5J5RA 3DKJA 3CTLA 2VUYA 2WVUA 4JDBA 5LHEA 2NLIA 3ABRA 2DJLA 1G4PA 4CN6A 2HS8A 1XH0A 3L4WA 1W5MA 2E5BA 1CXKA 3ZOAA 1S5WA 2E68A 1M7XA 2B0MA 4A3UA 3CIXA 4AF0B 3WENA 4M6VA 2DU2A 3W1TA 1W3TA 1XCXA 1U83A 3LCGA 2EGZA 4JY9A 3TCEA 4IOTA 1IV8A 4GO9A 3W84A 3WEMA 3ABOA 4JR5A 3I6RA 4N2YA 1SZFA 3DHDA 2J9XA 3II1A 2JKEA 3ATYA 3RIKA 1DOSA 2VFIA 3E12A 3EWUA 3EX3A 2ZZ7A 3LCLA 1JXKA 4GUFA 4FX8A 4LC6A 2WPBA 3G24A 1WZAA 4PA8A 5AHLA 3KL0A 1S5TA 4B9YA 4LNYA 3KRUA 4UTIA 2WNZA 1KTBA 5F1UA 4J3SA 2ZXQA 4PTNA 1TCMA 4OU1A 1E40A 2QJHA 4CLMA 3N34A 4QSHA 1LRNA 2FH8A 3PULA 2H8ZA 4PODA 2Q8LA 4AEFA 1PJ9A 1J0JA 1QWGA 3C2FA 3TC6A 4MPQA 1HNYA 3KXQA 1R30A 3O06A 1GT8A 4J7RA 6ALDA 1DV7A 1UKTA 5HR7A 1ZALA 2OSYA 4JYEA 2ZA2A 1V3KA 2GJLA 2ZUUA 1MXGA 1LORA 4Z1DA 4O1DA 4ZQPA 3TROA 1LOQA 1CGYA 2F1BA 3BLPX 4P61A 1MW0A 2X1SA 2NWRA 2PRLA 1GVFA 2JK2A 4IMFA 2QCDA 1PZ2A 4CVWA 1OJXA 1W37A 3WEOA 1JRCA 2FPTA 5AHEA 4XZ9A 4ZQOA 4MY1A 4HNVA 1TQWA 1K02A 3CZEA 3KLLA 3BVVA 2WOQA 1KTCA 1KXTA 1WAUA 2E5DA 3LLDA 5FESA 1JULA 2P10A 3O07A 2TRSA 4U2ZA 4U31A 1WXJA 3VGFA 1ONRA 4LW7A 2DIJA 5F2IA 3USBA 3HPSA 1KFJA 3PF3A 4HOXA 4RX0A 3LXBA 2ZXDA 4RJEA 1KWGA 1UD8A 4FLRA 3M1ZA 3BAWA 2CLOA 5LNSA 5HPOA 5E1QA 2V82A 1PZ3A 2FYVA 2RDUA 1KM3A 3N2MA 3VGHA 3PC0A 3NA8A 3VU2A 3W7KA 2WCGA 1QW9A 1KBBA 2C14A 1OGSA 4BF9A 2G97A 4UTJA 3R2GA 3HGRA 4H3DA 4RV8A 3K8MA 1EP1A 2QCGA 1H7WA 2AAAA 3M16A 3TW7A 4GE8A 1GG0A 2NZLA 2EAEA 1SR9A 3T7VA 4JGDA 2C16A 3G3DA 4AWSA 4FB7A 1KXVA 3BVTA 5G2WA 4I9AA 4Y96A 3W7QA 2FB3A 2G95A 2KZHA 1FWSA 3K1DA 3UPBA 1D3CA 2F7FA 1IXQA 1R33A 4LOCA 2EPHA 2NT0A 4QJ1A 3UWVA 3GR7A 3SSJA 1UJPA 4M6QA 3BAIA 4JL1A 5A2BA 1CGUA 1O5XA 1M6JA 4YCPA 2Z1KA 5CGTA 1YTDA 3N19B 1E3XA 1GEQA 1CX9A 5DN1A 3VGDA 3M44A 2OW6A 1QI4A 3UG4A 5HUPA 4JIPA 1WZKA 3NQ6A 4CCDA 4WUIA 2YW3A 4HNUA 3DX3A 3OLIA 3VGGA 1ZAIA 4A2SA 3QMRA 3W3OA 3L66A 1QR7A 1J5TA 3N9RA 4HSNA 5DCBA 4WXZA 2NUWA 5K3VA 1D3HA 1K7XA 3D50A 1KLYA 2BY2A 1R2SA 2WPGA 3CEUA 2D0GA 3AMKA 3L0NA 5I3KA 4M8UA 2X1RA 2QCFA 1HTIA 1C9DA 1OFAA 1O7DC 2Q8ZA 4HT3A 4LRSA 1GVIA 2QAFA 3TSMA 2BXZA 2EADA 4H4IA 3ZSTA 1ZCOA 3IIVA 4QAIA 3BMWA 5D09A 4AF0A 1YPIA 2W0UA 4MZ1A 3UWYA 4O57A 4Y90A 2QUTA 4DF2A 3MWAA 4HOWA 1C8VA 2AGKA 5GVJA 2QMJA 3R89A 5D2WA 1NF0A 2VFHA 1ZHAA 4W9TA 1T0OA 1HFBA 1PS3A 1BPLB 4UFMA 2ZIDA 3QMTA 4TMCA 3OLDA 5E9AA 3IEBA 2J24A 3U6WA 4I7UA 1H61A 1G4EA 1SPQA 1KW1A 4IX2A 3L5MA 3DZ1A 4A22A 3IGSA 4WSJA 1F6PA 3P61A 1K03A 4JX6A 1OABA 5E0FA 1IIHA 3AMLA 4H8HA 3CT7A 3M6YA 3PM6A 3QYQA 3C61A 3HG4A 1PEZA 1G69A 3N2XA 3EWYA 3SFKA 1UUMA 5TBOA 3UY7A 3BLBA 3DX2A 4GFSA 3W1MA 1ICQA 2ZUVA 3BLKA 3N73A 1XBXA 2ZX5A 4DBDA 1VIWA 3M07A 3EX4A 4J3TA 1O5KA 3NQAA 5CPMA 1ZY9A 2ZXAA 2OMAA 3NDOA 4TMBA 5HXMA 3F4NA 3O15A 4JXCA 4JTGA 1SO4A 1Q4NX 1JGIA 4S2BA 1AVAA 1TV5A 2EKCA 1GCYA 4JFWA 3WK2A 1SO5A 4ZQCA 4LS2A 4PFMA 3ZS4A 1AL8A 2VEIA 5FF0A 3OA3A 4JYFA 4A2RA 1LBLA 4AHOA 3CZNA 2GOUA 2YX0A 3NAVA 3M5VA 1KGWA 2V0TA 4L4MA 3UERA 3WK1A 3A5FA 4YLWA 3RNDA 3ZWTA 2R14A 3TONA 1RVGA 1P4CA 3IIOA 3KHJA 3T4CA 2ZX6A 2GUYA 3G1AA 5DFAA 1QO5A 2QR6A 5LNWA
chains in the Genus database with same CATH superfamily
1DBKL 1TIUA 3OKNB 1QA9B 3AYTA 3C2YA 2VC2L 1YNKH 5A6SA 2W0PA 3RUGA 1I7ZA 1HSBB 2YW4A 3PSVA 1AQ0A 4DLMA 1F4YH 1BLNA 2GK2A 2I57A 4NC0B 4OFYA 1YTEA 3S3GA 5ESAA 2JVUA 5IHUL 1W2VA 3ZHKA 1JZ7A 4P23C 3TH2T 1ZHNB 3OJ2C 4GXVH 1P4IL 3C8KB 1FFRA 1HQTA 2VJXA 4OKDA 1C3FA 1PZAA 3ZKMC 4DGVH 3U2JA 1U8IB 3DX4A 4L3EA 4AITA 3WF4A 4AMXA 2F5AL 3ITGA 4AQ8C 4A2GA 4EOWH 4QMEA 5CP7B 3U9PL 3RJQB 3LGEA 1RP8A 3HVNA 2L04A 2GJ6E 1GW9A 3G6DH 5J5DA 5L9DH 4JFEE 2I9EA 1IFRA 2VSMB 5TDOB 3F03K 3PPHA 1MRDL 3X13B 1PFCA 3WLHA 5CZRA 4HK6A 3VFVB 2KZBA 5F2FA 3A5VA 1S7XB 1U8CB 1GG1A 2FO1A 5EIIB 4LGPB 1S7RB 2QAPA 3WFEH 1P4LA 3S6TA 1K72A 1LROA 1IC5L 4B3KA 5EBLA 4UQ9A 1DIDA 3DI2B 3ES6B 3SGJA 3P67A 3RIFF 1Q6FA 3W22A 1CF1A 1ESOA 5I9QC 2HK0A 5E24E 2DM2A 4XAGA 3Q65A 3ZKSD 1ERNA 2VP8A 3GNRA 1RUQL 5I3GA 3I6SA 1ORQB 2VUOA 4WKZA 1MFBL 3ZE2E 4YFLI 5CJ8A 2EKJA 3TR2A 5D2LF 4N5EC 1A3LH 2A9NH 3NM3A 2YEQA 3FFSA 1CTOA 4BGDA 5IEKB 3G6LA 3G5ZB 2Y7QA 2RUSA 3I9IA 3R8RA 5ILTH 4BKNA 3EOBA 3GSRB 4WO0A 1CXIA 3GQYA 4MHHG 3CCHB 1F4XL 4G42A 1XLJA 3P77A 4JNZA 3TSBA 3NVTA 1KCUH 3WY3A 4Z95L 3BOXA 3NJKA 3EFFB 2WVXB 4U7MA 1Q94A 1NGYA 2IGLA 3CFBB 3UR8A 2C9AA 4APQC 3QDJD 1QT1A 2X0HA 4PPTA 3V0WH 3IUDA 1T20A 1GZQB 1NC4B 5I6XC 4F0RA 1U8LB 1VJIA 3Q0HA 4YXLH 1E9PB 3VXSB 3BH9A 1G0CA 4DF1A 2CJUH 3WJJA 5K4ZA 4L1SA 1T0NA 4EPEC 2A6DB 4R33A 1VKXB 2X05A 1B4RA 3T4YB 4K3GA 1C12B 3QDMA 3IIPA 2BOFX 4BR1A 1TTQA 4LASL 3GSVB 3CSGA 1PAMA 3WQ8A 3F00A 4MA7H 4DELA 1P5UA 3BV7A 1XKJA 3U9WA 2YUVA 1RUPL 4DM2A 2XY2A 5DUBA 3W02A 4JDZB 4PR4A 3SB0A 3TQPA 2Y6SD 3J7HA 4M56A 5C09A 4NN7B 2VXVL 2A77H 2OMZB 1FGNH 2VWEE 4PRBA 2O6FA 2Y22A 2CA4A 2ZOOA 5E00A 4HFUH 3ZMRA 3GMLB 1XGEA 4MD0A 1WA2X 1CDHA 3FHQA 5KZDA 1MFEL 4JPWL 4FX5A 4ZMXA 2Y9RT 2I9TB 2EDNA 2G41A 4I9XA 3QR2A 1BSLA 2Z2BA 3FSTA 5IVOA 1OSZB 2CHXA 2OMBA 5CN3A 3UBHA 1D9KD 4FXGA 4M5PA 1G1CA 4PL1A 1W6TA 4AX3A 3TIMA 4YDKL 3UEZA 4NQCA 5CSRA 1AJ7L 2G5WA 2FDMA 4H9XA 3P5YA 2CUHA 1MFDL 4RDWA 2OULB 3OZOA 2R1LA 5C9JB 1CFNA 2J7DA 3QSTA 3B56A 5G5IA 3X1BA 3QEGL 4LKXB 1MI5A 4X9IA 5B38B 3TH6A 4JRYD 4PTUA 5HUOA 4IMEA 2X1QA 5FSDC 2YCLA 4XBSA 2RMNA 4HHHA 4BI7A 1DLHA 2V7HB 4BQ2A 3MI6A 4NF7A 3QN3A 1QX1A 2F84A 1BVKA 4UT9H 4LB8A 1Q72L 3QAQA 5MP6H 3AZRA 2GITB 1LMKA 4JY6B 2A74B 2F1AA 3V6OA 4H1LH 5KYYB 3IV3A 1U36A 3IGAA 1JZGA 4TL5A 3LRHA 1SBSL 2ABAA 2IUZA 2PXYC 3SDCA 3IRZA 4JKMA 4MDIA 4NQSA 2AJSL 3NBNA 4M8QB 1TPFA 4WIWA 1EXPA 4DOHB 4IBVA 2ED7A 4MJID 2ISWA 3AIEA 1FL6A 1B2YA 1GIGH 1BVLA 5F3FA 3NP4A 4WTZA 3EYOB 5LDSA 6CGTA 1KEML 2OTDA 4Q8PA 1KEGL 4A2DA 1OAKH 1OK6A 4KKPA 2YK1H 5TQLA 3QCVH 3MRBA 2WSPA 3ULUC 4F5CA 1MUJA 3QO1A 4O4WA 1J96A 5IMLA 5C07B 3AIWA 2W6RA 4OY9A 1F6LL 4OD3H 5I0WA 1HX0A 4ROQA 1PIGA 1O0VA 3U2EA 1U8OB 1TPVA 5E6ID 3CM4A 3MNZA 3WIHL 2WN2A 4TQEL 4X6DF 3N9SA 5EYWA 1E0VA 1J5OL 1MHHB 4B50A 3TIDA 5AHFA 1H6UA 3V6FB 1F6KA 1IT9L 4HKXA 1DTNA 4BSWA 4KXZI 4PI0A 5IM51 5HGDA 3LN4B 5D30A 4AMKH 3DX9A 2WQAA 1JZHA 1MYRA 1U1JA 2ADJA 4E5XB 1QSFE 4UNIA 1MXSA 2A6LA 2WB7A 4F15C 3LKNA 4E0RA 4F7TB 2IH1A 1U8MA 3GEWB 2CO7A 2XFYA 3QPZA 4DN4L 3C08L 5AB0A 5HQMA 4WO4C 5HYJE 3QPEA 2PE4A 1G67A 4HA0A 3ONBA 1MWAH 4U1HA 3GSMA 3L1FA 3E3QE 4NNCA 5EPMB 4DQAA 2DBLH 3P4OB 1OT2A 1PCWA 3CZFB 3SOBL 2DDQH 1HEZA 1IZKA 4R9HA 3PR2A 5CUSL 5ECGA 4A7GA 4QO1B 5ISZB 3D51A 2GVYA 3CFCL 4JM2C 1IBGH 1QNVA 2VR4A 5DD3L 3QHZL 4Q22A 1LM8V 3QEQE 4AVIA 4WDUA 4PMNA 4P2OC 4BUHA 1GYUA 4EUPB 1TT6A 3NSXA 2PU0A 2PDFA 4X6DE 3L9BA 1Q9KB 4PTTA 5C2GA 1A6TA 4H8VA 3AQDA 3LXAA 1SYVB 1FDLH 3KGSA 2J7HA 4LCVA 1J8HB 4I87A 1U3HB 3QGKC 5G4WA 2WXDM 4MYPA 1F3XA 2DW6A 2G5RA 1NFIB 3DV4B 4LCYA 1TVLA 4MZ3A 3EPMA 1MZRA 2V5JA 5KW9H 1JXGA 3L3JA 1UYWL 1AMKA 2QIWA 2VLRB 2CLHA 4ZUUA 4WWKB 1D5XA 2ZPKH 1YE6A 4DXXA 3QE5A 1P9MC 1KPRA 3KX6A 1BYPA 4PZVA 4EDWH 1A5KC 2EVHA 3ARDC 4OFKA 1V0KA 2J1ZA 4GW4B 4OH2A 1H60A 3QZAA 1U1HA 3W6YA 5JQ9A 5D7IA 2OT0A 3I6KB 3QVQA 3QULB 3GTFA 5AB1A 3TA3D 3NQ8A 1JRHI 5GRJL 5A16B 1WSST 3RL2B 5CKGA 1SXSA 5F7UA 4FIQA 4YAQA 4XTRD 3NQMA 4KQ3L 4ACZA 4PJ5B 1ICSA 4D0DA 2FFCA 3E9AA 1S7WA 4I6VA 2VZSA 3D6GA 4UIKL 3GG7A 2I1OA 1WMPA 3IMTA 1XYZA 4R26H 2VDKH 3PB2A 4PTMA 3VOFA 2H6PA 3A67H 5D72H 1Q6QA 5FA3A 3B4YA 3LHAA 1IGCL 3MYZA 2E9MA 1TR9A 2LOEA 5I3HA 3DUHA 4Y2DC 4NSKA 2AQVA 4BFKA 1NTDA 3TT1L 3OB8A 1BZOA 3B7YA 5EOQH 1A6AA 5BZWB 4NXSA 4LT9A 4MMWA 2I85A 1VCVA 3VACA 1HDMA 5HVHB 2WLYA 1KB5A 3H6AA 3AO0A 4K68A 4PG9A 4BA0A 3SDDA 1XGZA 1W3HA 3D2UB 3GBDA 3B2UC 1THFD 3IK4A 5KZ6A 2GC7C 1NOFA 4S0HA 4PGLA 1PJWA 4YE4H 4Q56A 3ILPB 2Z2UA 5KANG 1BLIA 2ICEC 3ISRA 3GVGA 2F8OA 1HKKA 1IT8A 1OY0A 3VIHA 3RQ3A 1FH9A 2LAGB 3VXTB 1XIWD 4NQXA 3B9KB 1W1TA 3WQ6A 1UZ6F 2D03H 3PXJA 3RVXD 2WTRA 4ATWA 2C1IA 4X9GA 4LSPH 5H4YA 1VACB 2JKSA 2XIDA 2O5ZL 3HE6C 3VO0A 5AW3B 4M7TA 3KVLA 2F7IA 4UTTC 2JB6A 3W27A 3KPNB 4K55A 2ZZ2A 2INEA 4LVHB 2XZZA 4Q7DA 1KTKE 3ARFB 2BHFA 2I60L 4PRPA 4I5UA 4L37B 3ZYOA 3R06A 4HHPA 2JCWA 2DWEA 4ZW6A 4GAFB 4ZTOL 4UUJB 4OLYL 4OZIB 3V7MA 5I76A 1GZ1A 1K9EA 4P3CL 1D6YA 5FHAH 1T7ZA 1XB6A 2P45B 4GUCA 1G1KA 2IPUK 1XHGA 5IP4A 3H9ZA 1JGUH 1TJ1A 1YEIH 1CR9H 1FYHB 3CN0A 3AMDA 3O2DA 4M1DL 4LLDA 4MKMA 3NZUA 3QZWA 2XWCA 4J1UB 5DDHA 1EOKA 5EFIA 5HHMD 3MVIA 3C2AL 5C0DA 2XG5A 3TC9A 1YXDA 4I3GA 3ESNA 3L7FB 1KIRB 3URQA 3TBSB 3CDFA 3CXHK 4BV1A 4GSDH 1BYCA 3FU6A 4MRBA 1R0AL 2K6WA 3NJNA 3TYUA 3VRLF 1TRDA 4PS3A 3WFCL 3IJYA 1PZUB 3J07A 2YPLA 4OJYA 3P40A 4JB9L 3PUUA 3C5SB 3KCPA 3LNMA 4Z08A 4F8NA 3LZ3A 4C91A 4TTDD 3TVMD 4AV0A 5JIQA 2FB4H 3BD5A 4L80A 4IGBB 1YYMH 1XBZA 2L8AA 1LNUB 2HSIA 1J2WA 4OVVA 3WJZA 3W0WB 1M7UA 1MCOH 4NPKA 4ZAKD 2DKSA 1GGIH 3D05A 3S4SB 1HXMA 1AKPA 2V37A 2XVGA 1S5HB 3V4VB 3U30C 3DMMA 1QMUA 4Z3FA 1OYCA 1CE1L 2LABA 4GPNA 4OIIL 3MBDA 4H83A 3UWEA 3THCA 2ZCKH 2PCXA 4QTHB 1TNMA 5A8GA 4U3SA 4BXSV 5GZNA 5DMKB 2OXGB 2OQEC 2YKLL 3X1FA 2DWDA 3LTYA 2B8OT 2WQRA 3RWEA 4H6RA 4NX0A 2CRIA 5DWPA 1PIFA 2X1WL 2R1MA 5KS9E 3Q8FA 4EDXA 3ZJ8A 3M7FB 1N7NA 3EOLA 5E8PB 2HWGA 2FMOA 2I5GA 4FQ1L 1OZQA 1S9XB 3WYZA 4Z2JA 2X89A 4JANB 4MJ5A 3IFOB 1HIMH 3M0IA 2FEDD 5EU6A 1QAKA 4KWSA 3P0WA 4ML9A 4LBSA 2ZXEB 4RAHA 3TTEA 2LVEA 4JZJA 1FDZA 4R0LC 3DH7A 3IK2A 1S9VB 3TYFB 4FMFA 2NLIA 4TULL 3ABLB 2XFFA 3JSSA 4MXVF 5L4JA 2IPUG 1E7VA 4BA8A 1LVEA 4L9LB 2CG1A 2BG5A 3U4EB 1U83A 4BK5C 1GZPB 1ML0A 4UWMA 3W84A 3VOJA 4JR5A 3R8HA 3TURA 1CLXA 1DFBL 2JKEA 5E5LA 3L54A 1HS6A 4XB8A 3U0PA 3QIBB 3PGCA 1EBGA 4IH3A 1SM3H 3VFMA 2OGYA 4PTNA 4H6EA 4GY0A 3KBNA 1JGDA 2CE6A 3TC6A 3W4RA 2B08A 3E9UA 1ZHLA 3SCPA 3I6GA 4JQXA 4ZMQA 4JYEA 4E41E 4XRCB 1OD0A 2QQ6A 2B20A 2AKMA 2QCDA 4WFHE 4AQEB 1JRCA 2IOIA 5FDYA 3D18A 1NSXA 4HNVA 5EZIH 3ISIX 3NFNA 1W2KT 3PV6A 4EI5B 3BJTA 1O6TA 4EXKA 1XLEA 3VXUB 4HPYH 2H9GB 1NJ9B 2ZYRA 3DEQA 2AERT 4JQVC 2GQ3A 3VU2A 3C3UA 4EBQL 2ZUYA 3AHYA 3AY4C 2FZBA 2BIPA 3TW7A 4IBQA 1LD9A 4HEPG 3ALXA 2R1NA 3WKMH 4JTRA 5FACA 4CMHC 2KZHA 3K1DA 3RDKA 1YY9D 1ES0A 2Z1VA 4ZYKA 4D6IA 1HHIA 1M7DB 3BAIA 4Y19E 1U91B 3N5AA 5F9WB 1XBRA 3FEQA 3VGDA 4HCRL 4LAQL 5HUPA 1J7VR 4JIPA 2DIKA 3WLBB 1EQPA 3W01A 1HXJA 3PWGA 1QR7A 3KIIA 1J5TA 4F24A 3PJWA 1X4ZA 1NOUA 4YJZL 2JE8A 2HLFC 3PQYD 1KPVA 4YIQA 2HCZX 6FABL 3ES8A 4IKJA 3FQ1A 4Z7NB 1IE4A 4ZRGA 1Q63A 1RJOA 3QJHB 3B2XA 5CEZE 5T3ZE 5GVJA 2V68A 1K85A 5CSUA 5CJXA 2ZIDA 1XIMA 3IEBA 3Q1SL 4XBJA 4IX2A 4KXDA 1TR1A 5H6HA 1OABA 5TQ2L 3VH8B 1IMHC 5E0FA 3OG4B 4AZCA 3D47A 4PJCA 3VD5A 1TJXA 3EWYA 3CYJA 1FL3B 3T9PA 4GFSA 2XSAA 4PS4H 4R90H 2NLYA 1Z5LA 2OMAA 5JLZB 3Q8BA 1BXCA 5E4IA 5LAPA 4XNBA 3VWJA 2CFKA 3OA3A 1GW0A 2BO0A 4A2RA 4D3CL 3NAVA 3HMXL 1E6NA 4YU1A 2WWNA 1YEHL 4IKKA 5D5ME 4CC1A 5KSUB 2EEBA 3RA7H 5IFJB 3AGVA 3SHSA 2OXHB 5J12C 1IQXA 3BJ91 5HHNA 2JTDA 3DFOA 2AL2B 2W79A 3FFDB 1KBKA 4PBEA 3DIDA 4H8WC 2ODHA 1KB5H 1DCLA 5REQA 2BZDA 4AK1A 4R27A 1AGDA 4ANXA 3KLHC 4DK6A 3DVFA 4AZ8B 4FG2A 4GH3A 1T40A 5M2FX 4RAVA 2RFXB 3BG5A 1DSFH 5C08E 4YBQC 5B4MD 5D04C 4L2YA 3C6LD 1Y0LA 4HIEA 2AV1A 4OOZA 4Q33A 3PZMA 4MJ6B 4BCYA 2NTFA 3BWUF 3VWKD 4NJ9L 2O7SA 1B0RA 1KFAL 3QORD 3DXAB 4TIMA 4BZ1A 4R5TA 1OTSC 2C3HA 4PJEF 4BQ4A 5A6TC 3UNTA 2CXGA 1OO2A 3QNZA 4X7FC 3UAJC 3LPOA 3WJLC 3VXMB 3HJZA 4HFWA 1A7QH 4IG2A 2BRQA 5LNRA 4UTLA 1E65A 1W31A 5K9KA 1MIMH 1W6CA 3EA1A 1PGRB 4FYSA 3LD8C 1TPUA 4ZZFA 1BQLL 4OF6A 2J27A 1I8IA 3ULVF 3MLTA 1OGTA 4QHRA 3L12A 4RGNE 4YSSA 5CD5D 2JF7A 3OG6B 3RLSA 3O3DA 2WXIA 4DYEA 3O2LA 1A4CA 2YZRA 3GZAA 2J6EA 1HL4A 3BZFB 4Y5VB 3W26A 1IF2A 4K8RD 1VB9A 4NUGH 2FATH 4YHPA 3TW9A 2VCAA 3FZUD 3PBMA 1RK1A 4N6EA 4GUHA 2XZAH 4RFNC 4H7VA 4AENA 4KQ0A 2XSBA 3O2DH 1KFEA 4XXWA 1MIEL 2Z7GA 3KM1A 4JY4B 1GGBL 2A85A 4RZBA 1KWKA 4GBXA 3VI4A 1BOGB 1ZQ5A 2AV7A 1D5MB 2YBUA 4QYAA 2J2ZB 5JXQA 4TVPE 3HB9A 1NAKH 3RX2A 4X0KB 4HIHA 2K8MA 2Q8AH 1XLGA 3A6BL 2X03A 5IM7B 1WICA 4L5ZA 2QS8A 3T3PB 4PRHA 3K81A 2VLMD 3OR7A 5F1VA 1LHZA 3DECA 3GZQA 4XBMA 3CSYB 4GXUN 4S39A 2AJUL 4J23A 4MMZB 3F7QA 1J5CA 4L6DA 5HY9A 1RIVH 2XFWA 3GSWB 3H9SA 3A4DA 1P43A 3MBXH 2R69A 4M48L 1SHXA 4N6FA 2HE5A 2NY3D 3LS9A 2VM4A 3WUFA 4ZO7A 4KY1H 5G4NA 2XN2A 3QMSA 2WNWA 4Y4KB 1SSGA 3ECVA 4ODUA 5GGTL 4H7ZA 2ZONA 1NBZB 2IWKA 1A47A 3AIBA 3CDZB 4K71B 1TFVA 1DP0A 4DJEC 1FCVA 4PLKD 4NFDA 2AGJH 3W7CA 3PDDA 4AGOA 4KDTA 5DUML 4NNXA 1FG2A 5ICYB 1OX4A 1A22B 1LDCA 4F93B 4RISH 5FKYA 4H0IA 3K71A 4YHML 3UO1H 2X8RA 2Z7KA 2HEJA 3WS6A 5J57B 2A4CA 5HDLA 3T0EB 3ELQA 1RBLA 3E38A 4OF3A 1NGZA 2J88A 4FADA 3G6AB 1AY1H 1WDAA 4G9FD 3S6CA 2Z91A 3GIZH 2BS9A 3G0XA 2YXFA 1GQNA 1HIZA 4LLMB 3GNNA 1DL7L 3WX7A 4HUVB 4F91B 3BDYH 2JIXB 4GRMA 3K72B 4W93A 2V7NA 2J8UB 2OK0H 3H2NA 4O00A 4EWJA 4LCIH 3GK8H 3GRWL 4GSXA 1E5BA 1E6XM 3D25A 2HVKB 3V0JA 5CGQA 3AG3B 4XE5B 1TQTA 3MRCB 4JFOB 4S1SH 2E9JA 1MF2H 3DUSB 1FCUA 1FWBC 2E6AA 2PPDA 4P2VA 3AWNA 3Q1NA 3RWDB 4XIAA 1WOBA 5MEQB 3NFSL 1VRXA 3QIWC 2WBJB 2AQNA 4TPRL 3CC5B 2AEIT 1H3GA 3WBAA 2EYRA 2XG4B 1G7HA 1IXOA 5BVPH 4IJRA 5H2BB 3AALA 2EE2A 3BUYA 2VGFA 1SXZA 2O7QA 1CDGA 1CLVA 4LEXL 2Q7AA 3DSFH 1QI2A 2AMGA 2Y61A 1WTLA 1NPUA 1U3NA 5TFSH 4G8EA 3CFQA 1J1PL 3KZ8A 4LH8A 4K9EC 4S0SD 3B40A 2OZ4A 1U5HA 1I53A 2R0KL 1JQVA 4JX4A 1FNGA 1U33A 4NUWA 1HKVA 2MPAL 1WCBB 1W9PA 1BFVH 3MOQA 4MWFB 3MA7A 4I5BB 4TUKH 3I9PA 4E38A 3V52H 4UILH 4HALA 4FO4A 1LLWA 2LLEA 3L3OA 3LEYH 1OFEA 4UR9A 2BMKA 1Q8JA 5F1IA 3VAVA 2YBRB 3CVBA 2WZSA 2WOBA 1ITUA 2X4NA 1Y6MR 2VXUH 4GQZA 3QQXA 1QLRB 4ES8A 3GB7B 4LOUD 1N5AA 2UZYB 4FS0A 5ESVB 5I1CH 2APTA 1EFZA 4AXNA 5C8BB 2IPTH 4U1JB 2EH7L 3GMNB 3SCVA 4IOFD 1FUYA 1P1MA 3RWJA 4MZRA 2YYUA 3CDCA 4N0FA 3PS7A 5KBNC 1N70A 4OTXH 3HE7D 1LQ0A 2DWYA 4AE0A 3WMLA 4Y9CA 5IJBC 2ZYFA 3T44A 2PNCA 2WCAA 4B9PA 2IALB 3QFJB 4KPHH 1H9DA 4NQ1A 1C91A 3HC0B 5JPMB 3BCDA 4JIIX 3MWXA 5GGVH 1JBJA 5I24A 3VPLA 2X4SB 3L0GA 1UD2A 4MQTB 3T0TA 4DJDC 3EA3A 3NA9L 1JL8A 2CSPA 1EC9A 5IBXC 5HYIA 2H1PL 2OL3B 5HHOB 1P1XA 3DVNA 2HAZA 4ZFZA 5TE7L 2WUCH 4PG2C 1VHNA 3BPLB 2PW1B 4LTSA 2CWRA 4C6NA 2J7BA 3QAZB 2HVJA 1BRLA 1NEUA 3PK7A 5IVXA 3CBRA 4KH9A 3KPMB 1TQSA 4BFRA 4OCWL 1IAIM 1RVFL 3QG0A 4PRRA 4X2RA 2J5LB 1UC5A 1WRFA 4WGVB 2OV0A 2CYGA 4NO0D 4HUWA 1OSYA 4HSAC 4NPYA 4JFDA 2R91A 4NBZB 3NL5A 3VVGA 4D1IA 1Z9SA 2EDFA 3WKYA 5F96H 2Z1BA 3MRGA 3NO3A 3CLFH 2FGZA 1R38A 2VLKA 3F7VB 3S97C 3RZCD 1NCTA 4POZD 5DWUH 4YHLL 4UOZA 1OGAD 3S37L 5KVFE 1NGXB 1ESWA 4LX4A 1PZBA 3JVGC 1YLBB 1KGIA 3UVIA 5MENB 4B2DA 1NF7A 2VGBA 2R2HB 3TZVB 4EXPX 1CXLA 4PLJC 1IBHA 2WY3B 3HS0B 4DN1A 3IAGC 3US9A 2CK0H 3DIVA 3MROA 3QUMA 4BZ1H 3M17A 1DXEA 2GGGA 4LVNC 1S7UB 4IMGA 4D8PB 1R3IH 1GKEA 1CXFA 2W80C 2VZUA 1L5GB 4X8XA 5F6IC 1U8KA 3V4BA 4LSUL 2APWA 4HUNB 3GT6A 3MGOA 5F6HI 4C4BA 4KMTH 3NGBC 1NUFA 4TRPH 3L8QA 3DJTA 1AQ8A 1WGVA 1W0VA 3FU5A 2QKIB 1SFDA 5FC9A 4KV5E 4DW2L 3TF7C 4UM8A 4RMWA 5LAXB 4AD1A 3DX6B 2ROYA 3LQAC 4PJIF 1J0HA 1C08A 1S5NA 4G8IB 3GAYA 4GUPA 1MQQA 5ENLA 4MNHA 3XIMA 1FL5B 1Q90A 3NJLA 3Q6FA 3ZLQC 2J6EH 3MV8E 1PWLA 1D7BA 3EXRA 3WO8A 2C1PA 1A6ZA 1BDYA 2BDNH 3I6TA 1J1OL 5DRZA 3ULVL 4F0HA 4I0PD 3VD2A 4E9TA 3O3UN 3PB0A 35C8H 1P7BA 3MRFB 5GQBA 1ZLWK 4H0GA 1IR1A 3SY0A 1VZWA 3LI1A 4A35A 4QCEA 3SJNA 4H8PA 5DQDL 3GDCA 1MRFL 4KFZC 2J5WA 1C7TA 3OHXB 1L0PA 2FQIA 5D7JB 2X4RB 1J0NA 5CIPB 1F07A 1N55A 1NCBL 5IJVB 5F7HA 1S2AA 1VLIA 3L6FA 3HRZA 1JJKA 3WTXA 1YBQA 1G4SA 1QD0A 4PGZA 4MXWH 1AODA 4B9FA 3MREB 4ALAL 5DMIH 3UYOD 3F3HA 2AKRB 1UG9A 1CQYA 5C0AD 1GC1L 4RKAA 1T89A 3V0AC 4G72B 1U8HB 2V2WA 4E0CA 1QRNB 4F3HA 4OCRH 3QXAA 4DF0A 4MDRA 1CU4H 4QRRB 1J9TA 5FGCB 3GLEA 5C0BA 2XA3A 2R69H 3CAVA 2RKXA 1DJSA 4UR8A 3E0VA 2PDBA 1THAA 1EB3A 1ZB5A 4I2XE 1N6UA 2OJZH 4JX5A 4PRTA 3K0WA 3CVIH 1X9UA 1ASOA 3DRTB 1ZUAX 4GO6B 1CK0H 1GW1A 1ND0B 3MLSH 4NDMB 3RYSA 3QNYB 3P11L 4LGRB 3CV1A 5I1HL 4LVAA 3KNBA 3U1QA 2R8SH 4ZPVA 3VIPA 4D0CB 2PO6B 4C47A 1S7QA 3WG6A 4IBYA 3UO8B 3ARPA 4BF5A 5LVEA 4DP1X 3QBUA 1IBBA 1DDHA 1MHCA 1W72A 2J88H 1UR8A 2YXOA 3LIZL 2VDLH 4M1GL 4YH6A 3C5ZC 5FYKH 4LLWB 3FTWA 1ACYH 3KPLB 4LYQA 4XBEH 3VOCA 3BJSA 2W0LA 1BM3L 4HS6A 4Y16D 1CT5A 4DBEA 4YWGH 4LAZA 3ZTDC 5J6GA 4U4IA 4TVSa 4U1KA 5HJLA 4J6RL 4ZW5A 3UWWA 4N4YB 5DQ9A 3UMNA 3S42A 3W7MA 3ZO0A 3SM0A 4KJQC 1C5DA 1H3PH 2H45A 4ZCWA 1JPHA 5T9CE 5LNVA 4DZHA 3LZPA 3STLB 4DN3H 4Z7UE 2Y0FA 3KBPA 5FXCH 1AK5A 4M7SA 1MCBA 4DJFC 2OO0A 2AK4D 1OLLA 5DC0A 3EX6A 3OMZA 1RCOB 3RX8A 3P4MB 4QRBA 1F97A 1DQJA 3OGOE 3WA2X 2LT9A 4Q6IC 2BLEA 4PYGA 2CG9X 3PAJA 3I7RA 5JHDA 3I75A 1ADOA 3VOHA 3ZQWA 3SN4A 4LIQL 3ZW3A 4MVBD 4TV5A 4JQAA 2G5BA 2H3NA 2VDNH 4H26B 4JDEA 4GQ9L 4FFWC 2CPCA 1WJ3A 3RHWF 5EZOL 4HYTB 5GGRY 5I15L 1W0WA 1OC7A 1EAPB 1PLCA 2ZUSA 3L4YA 4WI0A 1J86A 4MNGB 4E42B 1UWSA 1W9UA 1YQVL 2OTWB 8FABA 4X4ME 3EYQC 3MXVH 4KWUA 2ITEA 4IHOA 2OZ4H 1B0GB 4HUUA 1T4WA 1KFGA 2BH0A 2WZMA 1PL9A 2HFFA 2YJQA 5E99H 4RZ5A 3FUMA 3J2PA 4YSOA 1OP4A 4XAKD 1O6VA 2AQRA 1ET8A 2JEPA 4NO2B 4K7FB 3PY9A 4X2PA 4ERGA 4PU2A 1C8XA 2VGIA 4KVNL 1UCBL 3M4HA 5D32A 3VG0H 1KB3A 3CFNA 4JTLA 4A7SA 2EXYC 2WINB 3IUIA 1TX2A 3H2WA 5CC7A 4WJXA 4A7QA 3HLAB 5F2MA 2Q6WB 1MCFA 4JPIA 5EU4B 1W3KA 3IGKA 2ESVB 2NW3A 3VSTA 1KFWA 2WSKA 3S5LA 4QOKA 4IRSD 4ZSUA 1S3KH 5IQLA 2ZA3A 1Q0YL 1B54A 4RNIA 3DKJA 3NJGA 3GM0A 3WHE1 3KP0A 4BZEA 1CXKA 5AYQA 1HOCA 2BW5A 4OK4A 4P8XA 1D5IL 5KJRH 1CB4A 1N68A 4JY9A 3BP4B 1U93B 3P3RA 1D5BA 1T5XA 3TASA 3ZKXC 2F8VA 3VJ6B 1MOEA 1EZVX 4PYSA 4A2HA 5DXWA 3LKQB 1EFQA 5AHLA 1CL7H 3ORJA 4LNYA 3CSPA 3KRUA 3FU7B 4KVCL 2F68X 4EN3A 4FFTA 3SDAD 1NPJA 3IXTB 1P7QA 2QQNL 2VWSA 1YC8A 2Z93B 3CUPB 1TJ0A 1V4YA 4WJ5A 3QUYC 1MCPL 1DV7A 2XOTA 3SYAA 2FLBT 1QLEH 2BNRA 2XRAH 1RAMA 5LO7A 3AWEA 2J8GA 4ZUSB 2MTAA 2MHAA 4GYBA 4QY8B 3VGAC 3WLTA 3D3AA 1F11B 5AZ1A 5KUMA 4XVDA 2E7LC 3F12B 3KLLA 5AVWB 2PYED 2FKPA 7PTDA 2XSXA 1HYRC 2ZOWA 3THMH 5D2LE 2UY7B 3M1ZA 2O4MA 1T1ZA 4NHCL 4NASA 3UR2A 3N2MA 3PC0A 3SN0A 5L6YL 1JWMA 1O9ZA 3MLUH 1FIGH 2X4QB 3M16A 3O8XC 3TIEB 2EAEA 3OV6A 1TLKA 2AXFB 1GGUA 4I9AA 4LL1A 1D3CA 1EPVA 5B39B 4MXQC 4ZDHB 2D7PA 4D6GA 5L0QC 2WWKT 3WN5B 2IQ0A 5GRYA 2NY2D 1IAII 2FZ8A 1NUDA 1UJ3A 1E3XA 1IVUA 1ZTVA 4UQ2B 2ALRA 2VQ1A 2AJVH 3TEWA 4HNUA 4FMKA 3S48A 1MZYA 4O58H 1TTBA 3WS3A 5LBSL 2ZQKA 3UBPC 1K4DB 2OL3L 2BODX 4Q4MA 1D3HA 4CNSA 1QOKA 4KF1A 3B9OA 3AMKA 1F41A 5JPNB 2Y72A 3SRKA 3ZQXA 3QUMH 1IEQA 5I1LB 2IPKB 1FNEB 5C9WA 1QEXA 2OP4H 1IM3A 3B6SA 3KLAB 1PKNA 1PBYA 1ZE3H 4MHHI 3S2LA 4PJXB 1QNIA 3JTSA 4HBCL 3FUIA 3IDGA 1F6PA 4ZMPA 3QA3A 4D7BA 4UV7L 3MUAA 3D39D 3PZVA 2P5NA 3FKUS 1GS7A 3WCYA 4J3TA 4QXUH 3O15A 2HT3D 3R8BB 3GBML 3OKEA 4S2BA 1S5IL 1GCYA 3ZS4A 5FYJL 2R2BB 3T8VA 2CDFB 5ID0A 5LKNA 3WQGA 3KHJA 3T0XA 5DRXA 3PJUA 4A66A 5C7XH 5AVZB 3WLLA 1WUEA 1EGJL 4XNXL 3ECQA 2QVIA 5I1EH 4PP2A 2GUOA 2CLRA 2I7OA 4M93B 3FTSA 2P8MB 3U2SB 2KMWA 4P06A 3SE8L 1CDJA 5EMLA 4DHLA 5C1MB 1ZT4B 3QPYA 1T5WA 1RSFA 2W61A 4H9MA 1H3XA 3KPSD 4ONGH 1HZHL 1HL2A 1J9YA 4GCXA 4HWBL 3HS8A 3FUJA 2E5CA 5I18L 4IKLA 4K1WA 3QFDB 3C5JB 1OBAA 3O6FA 2HTLC 4P2RE 4LSVL 4HB7A 2VM3A 5D1ZD 3OAUH 4MJ2A 3SDXB 3MV9D 1UZ8A 2V5CA 4Q8MA 3GE7A 2BJML 4NAEA 3ACTA 2P9RA 1S2CA 2C9XA 3EGJA 3PLYA 2OMWA 3SBPA 5A40E 4IPJA 5AHMA 4QRTB 4WNQA 2C6QA 4TNVF 5D7LE 4BFAA 1MJ8H 2X6VA 3QTGA 3L08A 3FO1A 1I7RA 4L4PA 5KVGL 5G5DA 1HZKA 3PUGA 1NGQH 4W4NA 3IPWA 2SODB 1RPXA 2EDYA 1QAFA 3IKCB 5K1NA 2N1KA 3WLQA 3FAWA 1CICA 2NY6D 2AEWA 2J73A 4NNYA 4R9OA 1OAUH 1HHHB 2EIDA 2PTUA 1XX9C 1DUYA 1S7SB 4IGSA 3GJFA 5DR5H 3IWPA 5TE6L 3WXWL 1N6QL 3NEHA 2O26U 3D46A 2ZTJA 5FYLE 1ZEAL 3LZOA 4JDTL 1W72H 1HNFA 1REQB 4XOEA 4G9PA 4Q8UA 2OODA 1H5YA 4F2MA 5ABZA 3NACH 1VGEL 3CBKB 2K4WA 1AXIB 4NENA 1V51A 4GGHA 3ZRFC 3E1ZA 3X3XA 2XQ0A 4ODHL 1GY2A 4UTBA 2WO3B 4FC3E 3E0IA 2VSKB 2VL5A 3QBTB 4BTXA 2DM7A 3BG9A 1F76A 3QUZB 4TTGA 5B1JA 2VKXA 3W9ZA 1SOQA 1SRDA 4L8DB 4X6CB 5MERB 5GJTH 2WXQA 4GG9A 2O4EA 3BH8A 2WHJA 3A6CH 4GRWH 4Y4FA 1ZU8A 1SDAB 3C2EA 3GRIA 3PABB 5IQ9A 3NO5A 4XPBH 2IKIA 4P3DB 2GGHA 1YEKH 1VR6A 4WXYA 3D0VB 2DKUA 2P3ZA 4WKHA 2H8PB 1CT8B 1XGRA 1B3YA 4PGCB 2OMYB 1GVQA 1XH1A 4RW3A 5CKSA 1EHNA 1QNZH 4FJYA 3WKPA 3MR9B 1YW1A 4O11A 2NNXA 1W6LA 2PDCA 2HRLA 2WSRA 2AJYH 2ZRWA 3W2KA 1SHSA 5I17B 3FMGL 1EDGA 3O0RL 1IQDB 3TPUA 4MKTA 2PYFA 4QNWA 2VR5A 4AH7A 2G2NA 1T83C 1E1CA 5LXGL 1TJMA 4PUUA 2FSDA 4AVOA 3KCOA 3P60A 3SUVA 1ZANL 1ZVSA 4P5MA 1Q13A 3VRIB 3GFXA 3LEVL 1J12A 2X09A 4AEEA 3ICJA 3X3FH 1UWXH 4G80A 3HN5A 2O5NA 3TJHD 3PSWA 5CKAA 3RUGB 4JFXA 5L8LB 2ZRZA 4ZX5A 3VXOA 1S38A 3EJPA 3M8OH 3MBEA 4AX7A 1BLNB 1JV2A 4KNTA 3ISWA 1P6AB 5IKCA 3MAWA 4I1RA 3ABXA 3QY6A 4HETA 5CZVH 3BUIA 4L8SA 1HP4A 3ZM8A 3BE1H 5I75B 3WLWC 4DWSA 1PLAA 4Z78A 1BWLA 1QSEA 1GZGA 4KQ4H 4GBUA 3EB2A 1ZBWA 4L3EB 3BUVA 3OKOA 3L9CA 1E7UA 1S1PA 3HG1D 5ISZE 1CLOL 4U5IA 1R5WA 4R5VA 3OVGA 5D1XD 3ROOA 2W62A 1VBRA 4NO3A 5HGHA 1ULVA 1XB3A 5I0DA 3ZL4L 1KB9J 2FR4B 4PJ8B 4MSWA 3UXKA 2ZCLH 1A49A 2Y0SA 5GS3A 3NJFA 1X5XA 4XP6H 1X6LA 3DBSA 4XIMA 1YNKL 1ME9A 1P4LB 1F8MA 3DG6A 1EC7A 1M56B 2WLLA 2EHHA 5EBLB 3HJEA 1A0QH 1XFPA 4DZIA 1IB5A 2APFA 2F1EA 1MXDA 4Z7WB 1M7IA 1E4NA 4JHOA 1Y5VA 2VLRE 1AI1H 4N4PA 2W0QA 2NLJA 3ROLA 3I50L 1SN5A 1G94A 5EEXA 4DGVL 4PWHA 5ABDE 3BW3A 4C6PA 3B0PA 1PZ5A 3M1CA 4ADJA 4ZFGH 5C7VA 2EJ1A 4EOWL 2ADFL 4NXKA 4F0LA 2VRAA 3HAEH 1BFTA 3K74B 2Y7QB 4APXA 4FG0A 4XMVA 1JPSH 4YHYB 1BYAA 2W88A 5EO0B 3G6DL 4PJ5E 3KDOA 5L9DL 2QQQA 3SKUD 1GKRA 4D6CA 3DOSB 3P77B 4Z7WF 3KVPA 3P2VA 1YPZB 1O1ZA 4O17A 4OZIF 4OGQC 2OR2A 1UZ6E 3KOZA 1Q94B 1NGYB 1YMMD 3GMRB 4XAFA 2OYPA 2BRWA 4XNMB 1QRKA 3VNYA 2E1DA 4TX9A 1T20B 1FC2D 4JG0L 4ANWA 1YPFA 1R3JB 5G1TA 3F5JA 4GI8A 1RWAA 3ITOA 3FHEA 2PTVA 3BH9B 3KHOA 5IJKC 1L0XA 4TO8A 4YL9A 4W89A 1WAAA 1CFTB 2QPEB 1T0NB 3LNEA 4LWWA 4XP1L 5KANI 1ZLDA 3L13A 3UR5A 1ZA6B 3EEZA 4LBAA 5BRZA 3G08B 1A3LL 1OE2A 2FECI 1MZHA 2YL5A 1YPZF 1LO2H 1P5UB 1VYSX 1OT4A 5T1KA 5GSVA 4IKIA 1EAQA 3LMJH 4UMAA 3K4ZA 5AW0B 2Z7YA 1US2A 2QQKH 2ZNXA 1DTUA 2VGLM 3K5TA 2IADA 3M0LA 3U9IA 5C09B 4MCZA 4PB9H 5BO1L 3QQ1A 5EMKA 2VDMH 3LB6D 3QHMA 1Q6EA 3PBWA 4PRBB 1CN4A 5D7KE 4QTIH 5BU9A 1VENA 4MD0B 4J2MA 1UZHA 3PNRB 2PMZA 3V0WL 3DGRA 2BSTA 1GOFA 1OIMA 5E0KA 3NDYE 4FQJL 4YXLL 1JPGA 2WNQA 4E9YA 4P4KB 3VRLE 2Y7SA 4PEKA 3H23A 4BFGA 4YO0A 2ZWNA 3HIIA 2CJUL 1TTRA 1RULH 1AGBA 1TV8A 2BSDA 4UFIA 2J9ZA 2QV4A 4FXGB 5GS1C 5L4IA 1I4FA 4EAEA 4WI4A 4NQCB 1JHLH 4AG4H 2CQVA 3MLXH 1KNOA 3WTYA 4MA7L 3EFOA 3VWKC 3KBSA 1IM9A 3L65A 2ZOKB 4GI4A 2X88A 1KYOJ 4CVZB 4HIXH 1SYTA 1TREA 5LXEA 2ZSWB 4PTUB 3S2JA 3RJOA 3L95A 1FV1B 1T3FA 4TSAH 3RWGA 2Q5BA 3NQ7A 4PGBA 1DLHB 2HNEA 4ZE4A 1EUNA 3JTTA 4QRAA 3NH7H 4A8LA 1BVKB 4HFUL 5DY2A 4K2UH 3DO7A 5M03A 4LALA 1HQ4A 5C0QA 2ZDRA 2A6JB 3ILQD 5LN8A 1G1OA 4PAZA 2HT4D 3TCLA 1KM0A 1ONWA 4B97A 1FP9A 1KGCD 3OQEA 1I60A 3GJFH 1EKOA 3MBWB 4CQDA 1CWVA 3SDCB 2CZEA 4XO5A 4NQSB 1MEWA 2EABA 8PAZA 2QJJA 5HYEA 4Z3IA 2FQEA 4JRXE 5FA4B 5BRPA 1IE5A 2R39A 1I85C 2XVLA 3OVUB 3F64A 1VF8A 4LF1A 1RU9L 1BVLB 4N8VA 4L4TD 4CL7A 3MZGB 5CSZA 5HWMA 4LCWD 2Y2TA 4DEPC 1H8LA 1Y18A 1ICPA 3AQXA 1S78C 3C0JA 3TJXA 3JWDH 3W2JA 2BT3A 3VKKA 5CPQA 4WQ6A 5C6MA 1OJPA 3MRPB 1X1OA 4ZW8A 3MRBB 4HZAA 3SXXA 3AW5A 1ZRQA 3BQUA 3ZUCA 1MUJB 5IMLB 4HCLA 1DQXA 3RGVB 3ECBA 4GI6A 1SJVA 4UTBH 2P88A 4KCVA 3RURA 1I1YB 2ZWZA 4MXVE 3R12A 3MJ6A 3C6CA 6REQB 3C3NA 1JHKL 1OJOA 4O0QA 1NGWB 2ALDA 2ARWA 3ZRSA 4RWYH 2R1XA 4UT9L 3TIDB 3TO4A 3NPSC 5C9XA 1NJJA 2QFRA 5MP6L 2EDXA 3TTSA 5D2TA 4BH7A 5CP3A 3K6FA 3EX1A 5D1QC 5GZOD 1KUMA 2F9BT 3DX9B 1RPKA 2V8MA 4AOFA 1NSRA 4KEUA 3EOAB 2P5WD 4LCRA 4YL4A 4NEHB 5TIMA 1XP3A 4KRTA 5CPOA 1KRBC 5BYWA 3P2BA 3IJDA 1RY0A 4ATTA 1U8MB 1LO5B 4Z2KA 4LFHD 2CO7B 3TP4A 3UVAA 4NL1A 3EMCA 1OAKL 4FABH 2YK1L 1S5VA 1QR1B 1T22A 3KPPA 3EO0A 1VZIA 5AG8A 4U1HB 3VC5A 3GIVB 2DQTH 4X5XA 1V3IA 2OCJA 1TA3B 4HKPA 1L0QA 3CUJA 4XG1A 1NH6A 2FJHA 1A5FH 4V28A 4N2FA 3O6DA 4L1LA 3TBBA 4NT0A 4JLRA 1RQHA 3H55A 1KXQA 5HD8C 1VPOH 4Z7NF 1OHZA 3WO4C 1KLFA 2IDCA 3P82A 3M41A 2IDFA 4BCZA 3WMPA 5FIPA 4HPGA 4XPTH 4HA1A 5JTWA 5I8OL 1FHDA 5DF0A 3FYOA 4MX7B 7PAZA 4P8UA 4CW1A 1VYPX 4I6KA 2JI3A 2D31A 2N59A 4URIA 5F7DA 3OD3A 3VXUE 5I03A 1HCFX 1ODUA 3WEBA 4LCYB 4KBPA 4LY4A 4NQEA 2J1XA 1U3YA 1YUKB 3OZKA 1POJA 5E03A 1HWWA 4JS3A 1QWNA 1OAQH 2ENPA 5K59F 2R27A 1D5XB 1USZA 4G11A 5I6PA 4HA4A 4OLEA 1KPRB 2WGNB 3CXDH 1X7IA 3OEXA 3EKCA 1G9NC 4HWNA 3SCWA 1X9QA 2DDQL 3SDOA 1R5YA 4NUJB 1T4KB 3B7RL 3CS2A 4DCQB 1U8NA 2EQDA 3QRGL 2E22A 4XVOA 4Q0XL 5I82A 3FFCA 5KJ7E 1IBGL 4N1EA 2C3GA 5A8OA 2WOYA 4MM1A 4YAQB 2A38A 4ACZB 3LS4H 3JVAA 2BS71 3QZEA 5FA5A 3EW3B 5DD5H 3RNKA 1XLCA 4OCNC 4FQXD 1TRIA 5LIKX 3RDTB 4UTKA 1HE7A 2ENJA 1ITCA 4A4AA 3D9AL 1FWRA 3WQWA 1EFXD 4AY7A 1M9SA 4EI6A 1YMYA 1FDLL 5C0CA 3LKRB 1W0MA 1BZDA 3RX4A 5EB8A 3NAAH 4NSKB 2DQUH 1K2DB 1BXXA 1JZ2A 2WNKA 3ZZQA 3OC8A 3PPCA 1A6AB 4UM9B 1JRBA 5DK3A 2KT6A 2QR0B 1KB5B 5CZJA 4PG9B 2HPTA 2LE9A 3SDDB 1PDZA 1RHCA 5FJPA 2ZPKL 5EO1A 3STFA 2E3VA 4XXDB 2RQEA 3DV6A 4RK8A 2UV3A 4DK3A 4EDWL 1ZS8A 3PBYA 5EBAA 4B5VA 4NRSA 4OJAA 5LNGA 1LXMA 2YS4A 1P4UA 1WCQA 3T1WA 2WTRB 4GP4B 4EEEA 4PP1C 3CSBA 4PJEE 1G4PA 5E9DB 1J9QA 4K35A 1BA9A 3CIXA 5JXAH 3LZLA 4OLUH 3TBVA 4G6AD 2JB6B 2F53A 3TCEA 3E2SA 1AHKA 5T3XD 4TQTA 3A67L 5D72L 3QXWA 4D0BB 3EX3A 3ULVE 2GFTA 5H35A 2WQUA 4PA8A 3N4FA 4PRPB 3R06B 5F1UA 2OMVA 2DWEB 2YAPA 1A1NA 5CGYD 1T5AA 2FH8A 4KK8C 5EOQL 5FJUA 4MG4A 1HNYA 3BPOC 3MRIA 6ALDA 3FXIC 4NZ4A 2EDQA 3L3KB 3DXAE 3T3PF 5CC6A 1YCSA 2GSEA 4JNXA 1C7SA 1MXGA 4PV8B 1FHGA 3HQOA 2VITB 3ATAA 4Y4HD 4YE4L 5F97E 2AQPA 4CVWA 1S9KC 1ECYA 3CHQA 1I3RA 4AL8H 3ALAA 3QZWB 2E67A 3CK5A 2ZAHA 1ONRA 2DIJA 2MUCA 1R86A 1K9FA 1BEXA 2ZXDA 3IDYB 4Q9RH 2P49B 4JN1H 4LEBA 2FYVA 3MMWA 2D03L 1KKOA 3ATEA 4XMKH