4FNQA

Crystal structure of gh36 alpha-galactosidase agab from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
727
structure length
723
Chain Sequence
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGSRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGIELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKARGHVAMSGNFGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaB
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 230
structure length 723
sequence length 727
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnqA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnqA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnqA02
4LRSA 1GVSA 2DJXA 5F2GA 1SW7A 1C29A 4LV9A 4TR9A 2C14A 2BY3A 3UWYA 2C7FA 2Z0IA 1G9HA 2FQIA 3L2IA 3W2JA 3B4UA 1LBMA 1VCGA 3LCXA 5HQEA 3VO0A 2B7PA 2ZZ3A 4GUJA 4WSJA 2ZICA 1YDVA 5F2MA 3P84A 1VPXA 3PUDA 3QF0A 2OW6A 1RD5A 3R13A 1UKTA 1OABA 2QUVA 1H3GA 3GDKA 4LS0A 2OZ0A 3U6WA 1AQMA 1W37A 5G1TA 1VYPX 5HWJA 5D33A 4JTGA 3N34A 2QCHA 3FJLA 2Z1BA 1PHWA 4J27A 2ALDA 3LCFA 4WX2A 1EB3A 1XM3A 1OX4A 4I7UA 3NQ8A 3PG9A 4O12A 2ISWA 5I24A 3OBKA 5CZJA 1XSJA 1BSIA 1GWJA 5FI8A 2DP3A 2Q8ZA 3DKLA 1OFEA 5FESA 1CXLA 3NAVA 3ABOA 1ZS2A 1XI3A 2YW3A 3VE7A 4WZHA 2OYMA 2W79A 1HFBA 4RZ4A 4O19A 3G1DA 4JD4A 2I1OA 2VXNA 2Y62A 1KFBA 4JEQA 4GUIA 3IJ8A 3UEQA 1F2JA 2VUYA 3E49A 4JGDA 1RV8A 1MXSA 2NSXA 1JQXA 1XGZA 3LTSA 1TSIA 3W7LA 4AEOA 2JKAA 2ZXQA 1QO5A 4QAIA 4WLCA 4O1AA 1B2YA 2QCDA 3LM7A 1EP3A 4OQVA 2J88A 1BTMA 3WNKA 1H7OA 2ZXAA 2JKEA 2CZ5A 1VFMA 2OCZA 3NQFA 1EP2A 3UD6A 4IX0A 2Y7EA 1FY6A 4GUFA 2F1AA 3LTPA 2ATMA 1JCMP 1ZFJA 2Y7DA 4YWIA 1F05A 3Q94A 4B9ZA 4RR4A 5K9CA 3W83A 1WE5A 4DO5A 3WEMA 2E5BA 4O1BA 2GQAA 4LQ1A 3M41A 1KGXA 1G4EA 1TTPA 6ALDA 3EWUA 3RILA 1G7UA 4GXMA 1ZJAA 4LS2A 4X9SA 4JY9A 4IMGA 4XZ9A 1O5XA 4DF2A 1PIIA 3TROA 4JYFA 1CXIA 3F03K 4ADSA 3P60A 3TQVA 5LHFA 3S1WA 3HIJA 3TU9A 1PHQA 2VEPA 1YXYA 3B0PA 4C1KA 3CGTA 5F2IA 1KB3A 5D02A 3QQ1A 1FWWA 4Z1AA 5E0KA 3NL5A 1SO6A 5F4SA 3VMOA 1QCWA 2GJRA 3EJUA 4OHQA 1SSGA 1ICPA 1PIFA 2OT0A 2DU2A 1J0KA 3EEGA 1CW2A 1JUKA 1VS1A 2F7RA 3VGHA 2VKZG 1G6CA 1GVFA 3NQEA 3TJXA 3DI0A 4UTIA 1JDAA 3TC6A 3DI1A 4AYGA 4ZQMA 1KCKA 3DXIA 3PB2A 4GINA 1LBLA 2FHBA 3LHYA 4A22A 4GQQA 3IK2A 1D3CA 3VX0A 1JGIA 3GXDA 4A21A 4MJZA 2C15A 3OVQA 1H50A 2BY2A 2D3NA 3AXHA 1H7RA 3L5MA 2DZWA 4JCMA 1FXQA 3P62A 5HXMA 1UD6A 3BCDA 2WKGA 2EAWA 1H1YA 2J9YA 3G1XA 1TPFA 4O14A 3FYPA 1XH2A 1GYNA 4W93A 1P0NA 3QM3A 1DVJA 3FLUA 1CYGA 4NU7A 4CN6A 1HUVA 1KXQA 1QWUA 5G1YA 3BLIA 1DQWA 2J24A 1RQEA 4IXXA 4MFEA 1FCBA 1T0OA 1KA9F 4Z0JA 1DV7A 1LBFA 1W0MA 3TOPA 3TKFA 3BGJA 3MUXA 1CLVA 2YGYA 1E43A 1JI1A 1TPVA 2VEMA 3C0JA 3BW4A 3P74A 4HPHA 1OF6A 2DZSA 3LX9A 5AHEA 3SSJA 2IQTA 1J4EA 2NLIA 4NQ1A 2EO7A 3CC1A 2ZUWA 1UD4A 2H90A 2F7PA 3K1DA 3EX2A 1QHPA 3TAOA 4J28A 4UZSA 1U2YA 2A5HA 2A7NA 3BUBA 3U2OA 1CXKA 4R7JA 2F7OA 4A2SA 1P0KA 1PS3A 2Y85A 3WJYA 3AO0A 1LWJA 4MZ8A 2FHFA 1W5OA 1BG9A 5E9AA 1GOXA 4DEFA 4J9JA 1ME9A 2Y24A 3PULA 3HZ3A 4IUOA 3ZR5A 2XFWA 3IGXA 3QSTA 1RR2A 4XUGA 3P8IA 4BFAA 2ISSA 3W23A 5DCEA 1VFOA 3MI3A 1V3MA 2X1SA 2DH2A 2WVVB 2WNZA 2YW4A 1VJSA 1PEZA 3C2EA 1EX5A 3HGOA 3EDEA 1IIGA 3KL5A 5K7JA 3NL6A 4KFOA 3VGBA 1W3TA 4E38A 3W72A 4H4IA 3NNTA 4OBTA 2A7RA 3TIMA 4UTKA 2QPSA 2HS8A 2V2DA 1OG0A 3ECQA 3THAA 3KLLA 3WNMA 3GXMA 4P2VA 1T99A 4QISA 2QR6A 4GRSA 3TSBA 1P4CA 2FLIA 2JBMA 1P5BA 1A5CA 3L65A 4Z1BA 4K8HA 3BSGA 4LUJA 1VHNA 2V5BA 2WCGA 2CZFA 1NOFA 5CGQA 3HPZA 5DN1A 2P1FA 4MFDA 3L4XA 2E0PA 3G0XA 2YOCA 1RP9A 2DH3A 3L4WA 3CIWA 2XWDA 1BLIA 4POCA 1B0IA 3MHGA 3HPSA 1YLVA 3VSUA 4A2RA 4UIOA 4MVAA 2X2IA 2R91A 6TAAA 2CWNA 2FFCA 1Z48A 5DBUA 3QMRA 4AEFA 2C18A 3GKFA 4AMAA 4N9CA 2ZZ1A 4UTUA 5D09A 1DOSA 5D04C 2E09A 4P61A 3SECA 3A47A 3WEOA 3WNNA 5C54A 3N2MA 1EUNA 1TPUA 2CPUA 5DO8A 5I0DA 2OX1A 3UWVA 3W73A 4GJ1A 5I3FA 1CGYA 5AFDA 1VRDA 3W7OA 1HWWA 1R2RA 1IXNA 5HR6A 1E3ZA 3GK0A 4UCGA 5G5IA 2CLEA 3EWZA 1NF7A 4Y6GA 3UY7A 4UXDA 3L4YA 5KTLA 1DEDA 3IIOA 1KGUA 1KTBA 5E70A 5LNWA 2E8ZA 1GVIA 2E6DA 1TV5A 2CLHA 2ZZ6A 3D50A 5AB3A 4H8HA 5LGZA 3A4AA 1WBHA 1KFEA 3W07A 1MW3A 4AVFA 2OW7A 2NX1A 3UCQA 1JJKA 1TTQA 3NM3A 3W7KA 1KCLA 2RH9A 3S2CA 3NYZA 4Z1DA 2E1DA 1UD2A 3M5XA 1PZ2A 5EBUA 4MAZA 4FB7A 4IMDA 5CSRA 2V8ZA 1EUAA 3DKJA 5FF2A 2QPUA 2QAPA 2VRKA 1HTIA 1X1OA 4HT3A 3UXAA 3UZJA 1FDYA 3KFTA 3IIXA 1JDDA 2Q3OA 1Y7VA 4MZYA 5CPLA 1YTEA 1TQUA 1TTJA 1OYAA 3N9RA 3SI9A 3V75A 2Y70A 3G18A 2Z2UA 2YKKA 1B57A 2W6RA 3DENA 1AL8A 3L0NA 4RLIA 5CZSA 2BXYA 3EWYA 1YTKA 3O07A 4OV4A 1SW0A 2BHYA 1C8VA 5LNSA 2BXZA 2D0HA 3LOTA 3BMWA 3WFZA 3UERA 4UCFA 2QCEA 5LZLA 1ZAJA 1EHAA 5FF3A 1DTUA 2I14A 3OHIA 3LHUA 2YX0A 3PSWA 4NJIA 2ZUTA 4CQAA 3LDVA 3DC0A 4IXHA 5HUPA 1I75A 3GAKA 4UFIA 3BCFA 4WXYA 3RK8A 3CZSA 3B0UX 5J5DA 3L9CA 1KXTA 3L2LA 5I3IA 3T40A 1IXOA 2YPIA 1LLWA 5A2CA 3QGVA 1O94A 3YPIA 3GR7A 3ABRA 4U2ZA 1H7WA 1PZ3A 1DJQA 4IQLA 3T44A 4MLJA 2TRSA 3P80A 2WO5A 2NUYA 2WPGA 1GG0A 3QMSA 2P0OA 1ZHAA 3PWAA 2PWDA 5FEZA 2GVYA 3GVGA 3TUUA 2BSLA 4IPJA 3DFOA 1Z41A 1QWNA 3DGRA 4J3TA 1LDCA 3CZLA 2WV8A 2PRHA 4FX7A 1JF5A 3BLBA 3KRSA 1QPRA 5E0FA 1KM2A 3K8LA 3HJZA 4IPIA 3LXCA 2CW6A 1QR7A 1JIBA 3OEXA 4JTFA 2RDUA 3QRHA 4UTJA 1LOSA 5K4ZA 4UOZA 3DFTA 3EJQA 4PH6A 3OLDA 4WY0B 2GJNA 2WPBA 2ZXDA 2PCQA 4TO8A 2HTMA 3UWWA 1EA0A 4M5PA 3NG3A 1OFOA 5D32A 2VOMA 3PAJA 3EB2A 3STCA 2NWRA 5FEPA 1LOLA 3EJTA 3BAJA 4M7SA 4JYDA 4E2BA 2F7QA 3RF9A 5H2ZA 2H8XA 1CDGA 1XD0A 4MPQA 1TV8A 2YYTA 1XCXA 1MEIA 4I7WA 3VMNA 3W2LA 1JRBA 1FQ0A 1ZY9A 1WZMA 3VGFA 3LHVA 1XXXA 4AHOA 1HTYA 4ALDA 1JUEA 1X1ZA 1MWOA 2NT1A 3HMJG 1XH0A 2A7PA 4B5NA 1RQHA 3W2NA 3KHJA 5AN7A 5D2WA 4RCXA 2C19A 5K9XA 1WX0A 2ABBA 3PUOA 3Q37A 1K7XA 1FCQA 4PCTA 4RZ5A 4XTIA 3BARA 2BY0A 2V3DA 2YA1A 3VU2A 1PVNA 2O7QA 7TIMA 1KBIA 1FXPA 3T4CA 1XC4A 3A9IA 4KMQA 2VRQA 1WDWA 4YCPA 3HF3A 1H63A 4W9TA 1LTDA 2WKJA 2EKCA 4ZMGA 3C3NA 1UD5A 5HPOA 1I2PA 3TW7A 3C56A 2GJLA 4NJKA 2VENA 4DBDA 3KAOA 5A6MA 2F7FA 1VQTA 2WSYA 2QLYA 1NFBA 2NZLA 1JCLA 1OX6A 2JGYA 3PSVA 3UNDA 1R75A 1ML1A 1WOAA 3L0KA 3W1AA 4KFPA 4AWUA 1DBTA 3MHFA 3NR0A 4YL2A 4YMZA 1H61A 3W2KA 3FJ6A 3TJLA 1GT8A 4LOCA 4RV8A 4WJEA 4PTNA 2X1RA 5F1UA 4Q33A 2OSXA 3W7DA 2YFNA 4N6FA 4UFJA 1MXDA 3AJXA 3GNNA 4FEZA 1BAGA 1XD1A 3EJPA 1UD8A 4OU1A 5HUOA 5F4XA 3HQ1A 3B04A 3W85A 3W38A 3B05A 4JXCA 1GVOA 2XN1A 1KWKA 3MO7A 1GQNA 3ZT7A 2ZUVA 4NT0A 2CLKA 5I3HA 3DFSA 5D2TA 3W7RA 5KITA 3D4ZA 1JCYA 3NPWA 3TX9A 1M7XA 4AMWA 1S5WA 5TBOA 4Y9AA 3T55A 3S6DA 5EPDA 1LM1A 5AHLA 1IZJA 2WVTA 4Y96A 1TMHA 2QCNA 4ICNA 4HA1A 1JUBA 5AHFA 4LXFA 1OFRA 3IV3A 4S1FA 2EHHA 4FMVA 3LBMA 3PVFA 5G4WA 5I5RA 3L4ZA 1W3IA 3HB9A 3HOJA 4JTEA 3TNOA 3BAKA 3UPWA 4YXGA 4UFKA 1SFLA 1JI2A 3CV5A 1AQHA 1WYIA 3GR8A 1XSIA 4QAWA 1QPOA 1SSDA 3GDRA 4NVTA 4O13A 2ZBTA 3MP4A 1SFJA 3LHWA 3Q58A 4J3WA 4OJYA 4HSNA 3BVVA 4Z08A 1QI5A 1IF2A 1CGXA 1YPIA 2Y88A 3DH7A 3W1PA 1FCVA 3MP3A 3HGSA 3A6OA 1WZLA 3ATZA 2NX9A 2E8YA 2EPHA 1QOPA 4DBEA 1P6WA 4U28A 2ZX5A 1G7VA 1GG1A 4JTTA 4O53A 2TSYA 4JFTA 3G1AA 3LCWA 3GBEA 2ZE0A 1XCFA 2PRLA 3VSTA 1CX9A 4UQEA 1AW5A 2ALWA 4WXZA 1AL7A 2QAFA 1SU5A 1ALDA 3W1NA 4TIMA 1WZAA 4J3UA 3MWAA 2Y7FA 3W7CA 1JCXA 1J2WA 2LLEA 3STGA 1SZGA 3NQDA 6TIMA 3G1SA 3O15A 3WDJA 4N4QA 2Y4SA 2VFEA 4JTSA 3W76A 4FLQA 4O17A 3KOFA 1GJPA 1YXDA 2X1TA 1M6JA 3TE9A 4MIMA 3KRUA 1QW8A 4OGZA 3R2GA 5CXPA 4O15A 4OKDA 5BNKA 1R30A 3IVUA 4PEKA 1HT6A 3C8FA 2CU0A 1A5SA 1OYBA 4BZYA 5I23A 1LCOA 2Y5EA 2F18A 3S5YA 5TIMA 1ME7A 2NUWA 2A1YA 4A3UA 4LV4A 4FNRA 1LLZA 2ZZ4A 4UTHA 5J5RA 4ZVJA 1XSKA 4HNVA 1GTEA 3SJ3A 2R14A 1JF6A 3TSDA 1NVMA 1YYAA 3NOEA 5EL1A 1UH3A 3S0CA 1QPNA 1GVRA 4JTIA 3S8HA 2QF7A 2DZUA 1JFHA 3CEPA 1WV2A 3O1NA 1Z42A 1B4KA 3IJ9A 1D3GA 2QCFA 4BK9A 4B9YA 3GDLA 1XBXA 1I4NA 1K7FA 1N7KA 2BTMA 4BI6A 3RFAA 5D38A 1GVQA 3PS7A 3W3OA 1TJRA 2TMDA 3TMQA 3VKJA 4UTTC 1CXFA 2CLFA 1E40A 2GOUA 4UTTA 3SGUA 4TMCA 4PODA 4TVUA 1YXCA 1A50A 1XUZA 1QI3A 4MYXA 3STEA 1OFQA 3LERA 2F84A 2FTPA 3N14A 2BHZA 2YJQA 1GPWA 3PBVA 1H5YA 1PPIA 1Q3NA 1EA9C 5BOOA 3BVUA 1AW1A 4AF0B 1UD3A 1WZKA 2EGZA 4JTHA 2V5LA 1TQWA 5F1VA 1FBAA 3LRLA 5F4WA 5HDRA 1D3HA 1S3HA 1TREA 3KWXA 3BK0A 4U3CA 3E02A 2VR5A 3I7SA 4HPJA 4FIRA 4JL1A 5AYZA 1UH4A 5HR7A 5DELA 5T26A 1EH9A 3S5OA 1TJPA 1OFPA 3DHUA 4DF1A 3WFAA 1N8FA 1R33A 1OT1A 3BG3A 4GI6A 3LTYA 1KV8A 2C8NA 3HG4A 2X30A 1ZJBA 1SZFA 5D05A 4LW7A 2E6YA 3WJXA 3I65A 3BH4A 1ZJIA 3MI2A 4LC8A 3LBCA 4RX0A 1L6YA 5DY2A 1BVZA 5BRQA 2HMCA 5G2HA 2QMKA 4HOWA 3TXZA 2E9BA 3BMVA 1OHLA 3WY3A 1S46A 4AHQA 1J0JA 3MHUA 1B3OA 2VC6A 1NM9A 2NT0A 4JN6A 5D37A 3G1HA 1X8FA 2FDSA 4N9EA 3DX3A 1IV8A 2DZXA 4JDBA 3BAIA 1J0IA 2JKPA 2FGZA 4J3SA 3M0ZA 2GVGA 3DU0A 3CZNA 1BVNP 2ZUSA 1W54A 4DPPA 3LLDA 5LKYA 2WVSA 1M53A 3DX1A 3LPPA 3WMSA 3W87A 4EIVA 2YA0A 1JR1A 5IM51 5DY3A 3HPXA 1TQTA 5EY5A 5HJLA 4LWWA 3S9YA 4NJGA 1R46A 4JL2A 3D0CA 3NEVA 2H3BA 4Y8FA 3W1UA 1TQSA 3W7MA 4ZQNA 4UR7A 1JXKA 3BLEA 3M5ZA 4PCSA 4TX9A 2IGTA 1TCDA 1M7PA 2ZQ0A 4XBSA 4UFMA 3W7QA 1GZGA 4HHPA 3QFEA 4AW7A 4NXKA 3WDIA 1TPDA 4AXKA 3WELA 4Z0SA 4X9YA 3KLKA 4O0ZA 4LC6A 4UTWC 3VM7A 3BAXA 3L4VA 4AH7A 3EXTA 3BAYA 4UTWA 1SMAA 1HG3A 3TC7A 4KWUA 3PR2A 3GZ3A 3L2MA 1VYSX 4O1CA 4CNPA 3O6DA 3WNOA 3EWBX 3GKAA 4CN1A 5A2AA 3W2MA 1G94A 2ZFAA 4HKPA 2QCMA 4X0NA 1OVDA 3DFQA 2QDHA 4ORIA 3P82A 1LOQA 3M9YA 4X22A 1QDSA 2E68A 4L4LA 1A5AA 3S1XA 1PJ9A 4K7YA 3OIXA 3LHTA 2ZRVA 4ZL1A 1UA3A 3QZEA 4JTJA 4M6PA 2EQDA 1TO3A 1VH7A 2YZRA 4QNWA 3O06A 5KEZA 4NJJA 3PM6A 1QMLA 3NL2A 1CGWA 2CFFA 3QSRA 1OK6A 2PWFA 4AYSA 1TQXA 3G22A 3S1VA 3W1LA 3WY1A 1XUUA 4G1KA 1A53A 4XQ6A 2FJKA 3TQKA 1QAPA 1LYXA 3PF3A 2C13A 1IXQA 3W7EA 4O0KA 1O60A 3BLKA 2Y89A 1AMKA 1O5KA 1SZEA 4M6VA 4XTDA 1E51A 4WSKA 5FF7A 3ELFA 4ZQCA 2DZTA 1UKSA 2WVUA 1CGTA 2FB3A 3LCHA 3LRMA 3EWWA 1AW2A 1F5ZA 2AAMA 3BW2A 3CTTA 3HG3A 3SZ8A 3WK1A 3ZR6A 3E96A 5CZ0A 5LSMA 2Y7GA 3L5LA 1W1ZA 3ZFHA 2YSWA 1GJUA 1HO4A 1DQXA 1K02A 4NNBA 5EKYA 4JY8A 3P7YA 3FFSA 3TMLA 3TW6A 4M56A 3CZGA 1JCJA 3I7RA 1A47A 3FA5A 4FF7A 1VLWA 3LB0A 1OFDA 3QW4B 4IMFA 3STFA 2W0UA 4GNJA 1XV8A 4K7VA 4OIFA 3QYQA 1QNVA 3MYPA 1ZALA 2C0AA 3CPRA 1VFUA 3HO8A 1VR6A 4LVAA 3L5AA 4H8VA 4O11A 1I2OA 1PE1A 3U8GA 2ZCGA 3GXTA 4JR5A 3CWNA 2E6FA 4EWND 1NSJA 3OLEA 1K03A 2X2GA 3CWOX 2G95A 3EWXA 1XL9A 2VT0A 4GKLA 2E5CA 1OFAA 4TU1A 2ZWYA 2VFGA 3NQ2A 3W88A 2ZYFA 4LPCA 1KWGA 2WANA 3PUEA 2QJGA 4QJ1A 1VB9A 3K30A 1R34A 3AXIA 1FCUA 3IIVA 1LZOA 3W1MA 2ZTKA 3M7WA 2G3MA 4IJBA 4KWWA 5LNRA 1PV8A 4H6KA 3CZKA 4AMXA 3UWZA 2OYLA 1VLIA 3BC9A 2WNWA 5KZDA 3IIPA 2Y2WA 1X6UA 4R33A 4JIQA 1VZWA 2YA2A 5LHEA 3K8MA 3ZQ9A 4CVWA 4JX4A 1QO2A 3EKLA 4CCCA 3R5EA 4NUWA 2CHNA 4PSPA 2ATSA 3FYOA 3OA3A 4QITA 3WY4A 1AMYA 5K9DA 3MYOA 2FH6A 2ZZ5A 1KM6A 3IGSA 2VFIA 1JD7A 2V30A 1CXEA 3BAWA 1IGSA 4ATWA 5CGMA 4JX5A 4K39A 2H3DA 3LV5A 4CNOA 3AMKA 4UQDA 3THQA 4FNTA 1ICQA 1YPFA 5CLTA 2F61A 2PWGA 5E6ZA 2PWEA 2C1HA 4LS1A 4FLRA 3BW3A 1W5NA 1WAUA 2WC7A 7TAAA 3FOKA 3AMLA 2XN0A 3KL3A 4JICA 2RDTA 2WSPA 4FXSA 3UWUA 2GQ9A 1V3LA 5D2YA 3A21A 1JG9A 3NPVA 2ZDRA 2H8ZA 3A23A 3FAXA 1GJWA 4UQ9A 4FNQA 4N9BA 3G8RA 4HOXA 2YYUA 2EACA 1H1ZA 1OF8A 3M43A 3A5FA 4J3VA 2NV1A 3W7PA 1VHCA 2CZEA 2QEZA 3PBWA 4FHAA 3N19B 2OSYA 3I68A 1HL2A 3L0GA 4GO8A 4BI5A 3LCGA 3ABSA 1Q6OA 4J3XA 2ZA2A 3ZT6A 4N6EA 3R89A 1YDOA 3W1TA 1XDMA 3EX3A 3DZ1A 4UMAA 3WJWA 2E77A 3ANYA 3VM5A 2O7SA 3EDJA 1W5QA 5HNRA 1M7OA 1WXJA 2DZVA 3TTSA 1SUXA 4NX0A 2Z6IA 1DL3A 4M7TA 1SQ7A 3L21A 1OGSA 2B0MA 1L2UA 2QJHA 3F1QA 1KLZA 5D2VA 3QQ0A 1GYLA 1QFEA 4N02A 3LI1A 4OWGA 1EO5A 1KXHA 2QUUA 3W2UA 3JR2A 4EVZA 2CLLA 4RJEA 3W9ZA 3NA8A 4PCFA 1MZHA 3ZS4A 1W31A 4NX5A 1XKYA 4HNUA 4AIOA 1HNYA 3OLGA 4FX8A 3EXSA 5SWUA 4MB1A 5F7UA 2WSQA 2EJ1A 1C9DA 1LRQA 3W71A 3GXIA 1TRIA 4JFVA 5D30A 3BVJA 1LORA 1KTCA 4U4MA 5CPMA 1U30A 3SY5A 1TPB1 3NZRA 4U31A 2TPSA 3EJSA 5U7SA 4QQ3A 3V1PA 3KL0A 1XDLA 4HSOA 2WSKA 2PURA 4S2BA 3NZ1A 4XB3A 1O95A 4DO4A 2EEXA 1F73A 3BVXA 3P81A 1SR9A 3W6YA 3TONA 3KX6A 3RLUA 5DLCA 4AEEA 3KRZA 4ORMA 3GLCA 1F76A 2VFDA 4U33A 5K4XA 4FLSA 1OX4B 2ZX7A 1WA3A 3CB8A 3CM4A 5KSWA 5IBXC 2J9ZA 2OT1A 4OE7A 1Q6QA 5IBXA 1XBYA 5A8GA 4BWLC 4HOZA 4X3ZA 5HULA 4BWLA 4MY1A 3CPUA 4JNMA 3MI6A 4LT9A 4O4VA 3N3MA 1KFCA 4AWSA 3P61A 4O54A 4JYEA 4Q32A 1NF0A 1U33A 1T8XA 2VEKA 4GE8A 1IZKA 1RPXA 2VNCA 1MSSA 4PFMA 4WY0A 1EEPA 1K8ZA 3ZSSA 2ZZ7A 3VNDA 2GUYA 4UTLA 1TRDA 3INPA 2RFGA 5KZEA 2QCDB 2WJZA 3EXRA 2G3NA 4MY8A 1ZCOA 1L9WA 3AJ7A 1TYGA 4K8EA 5ABTA 2E6AA 1W5MA 1I45A 1GEQA 1BWKA 4UZUA 3WNLA 1FWNA 1VC4A 1EWDA 2FB2A 4H3DA 3FEMA 1V3KA 2DORA 1TQVA 3WJZA 4NZFA 4K38A 5C6MA 1JXJA 5U4NA 1W3NA 4GUGA 1HL9A 3A24A 3BVTA 2YR1A 2PRMA 3C2OA 4JCLA 4IMCA 4TMBA 3C52A 4CN4A 5L6UA 3Q2DA 4BI7A 1O7DC 3TDFA 4Q4KA 2QCLA 3DHPA 1QWGA 3GTNA 2NXHA 4O28A 5HWMA 3GBDA 4FXRA 2ZX8A 1M5WA 2C3ZA 2Y63A 4BF9A 4ZZ9A 1QW9A 1QX1A 3GXPA 1XFBA 3CZEA 4U2YA 3W70A 3TSMA 3WN6A 4AAJA 1CGUA 5E93A 3ZSTA 3UWQA 5KINA 4UC5A 3W75A 3BUQA 6CGTA 1AG1O 3M44A 3B03A 1F6KA 3BUIA 3EKZA 4UFHA 2XIIA 4MKNA 4NXSA 3CTLA 1K8YA 1MFUA 1TPEA 1RZMA 1XCWA 1MO0A 1SO3A 1TV7A 1JD9A 3NGJA 1DJNA 2J27A 2NXGA 3HGRA 5F2LA 3DFPA 2YFOA 2V81A 3UG5A 4JTKA 3O8AA 3DFNA 5AC7A 1HVXA 3BUPA 3GDMA 3QJAA 1TCMA 3QPYA 2UV8G 3USBA 1L6WA 5AYYA 5CPOA 3WK0A 1OSEA 4PC8A 1N55A 3N73A 4DXVA 1U83A 2X2HA 1XBVA 1J5TA 3GXNA 2DIEA 1UB3A 3FS2A 4XKYA 1TMQA 3IGUA 3ZR4A 2WKLA 2ZRXA 5DCBA 4UQAA 1BEUA 1I2QA 3PBUA 5FF0A 4PL2A 4EF8A 3MMTA 1K8XA 1FWRA 1YADA 3C6CA 1C8QA 2PWHA 1VYRA 4HNNA 4KFNA 1TPC1 4FO4A 1QPQA 2C6QA 3KE0A 3W7HA 5CGTA 5CG7A 4D2JA 3EDDA 4QSHA 2OSWA 5BRBA 2XN2A 3BUDA 1TB3A 4CLMA 4ADUA 4ZQOA 4JFSA 3FW6A 4LVFA 4CQ9A 4UNIA 1OYCA 3NXFA 2G5WA 2YDAA 3S5NA 1KBBA 3M5VA 2V0TA 3OVRA 1KLYA 2ZZ2A 2GPTA 2GVJA 3E12A 3VX1A 2Q3RA 3LLFA 2RKXA 3LCLA 2R94A 3WY2A 4AIEA 1VCFA 5G4EA 3TR2A 5FEWA 5CKSA 3LRKA 5DXYA 3I7QA 1KGWA 3ZOAA 4R34A 4PA8A 3QW3A 1B4EA 4O10A 3TFXA 4K37A 3SGZA 4CQ8A 2D3LA 3D4YA 1MW2A 2D2OA 4HN4A 1KM5A 2BZNA 1J0HA 3G3MA 3IEBA 2ABAA 3C4UA 2TAAA 8CGTA 9CGTA 4M6QA 5AHMA 2F1BA 2QJIA 3S42A 2PC4A 3CT7A 3D52A 3W86A 1G5AA 2VEIA 2HS6A 3GB6A 3RMJA 2JK2A 4JIPA 2V2HA 3WENA 1X7FA 2OYKA 3M16A 4FNPA 3W7IA 3NO5A 3R8RA 2FHCA 1U5JA 2FPVA 3N9SA 2QDGA 1SO5A 3H54A 4N9DA 3VMPA 5EMYA 1I8JA 1S5VA 2A0NA 3CHVA 3LI0A 4MJMA 3JS3A 5MHBA 3F4NA 5C55A 2TYSA 4MY9A 2ZRYA 2A6NA 4HPXA 1ONRA 5L9FA 4WY0F 3TK7A 3KVLA 2NV2A 1VGAA 4NZJA 3LHZA 3LV6A 3NQGA 4EF9A 4WD0A 1ZENA 3UZ5A 4UOQA 4EOUA 3NQ7A 3KVKA 3TTYA 5G2WA 4DQWA 3IRDA 5I3JA 2CZDA 3ABQA 3C2FA 3HJEA 4BR1A 3VGEA 1G4TA 1FWSA 3H55A 3FKRA 3NDOA 4GBUA 2EF9A 1JRCA 3KVMA 4FIQA 4O18A 4S2CA 3LGEA 2B4GA 2A4AA 4CGTA 1RVGA 3DAQA 3WK3A 4O16A 8TIMA 4FNUA 5E1QA 4NNAA 1V7YA 2A21A 4J7RA 1SW3A 4RXGA 5A5WA 4K36A 1MEWA 4ZQRA 1ME8A 1W9XA 3KXQA 3NQVA 3RU6A 5EMUA 2Y61A 3ZT5A 1KW1A 1BF2A 2FPYA 4AHPA 1KFLA 3HG5A 3WK2A 2PE4A 4MUZA 4UMBA 5HMSA 3RNDA 4JS3A 3JRKA 5TQLA 1KXVA 3IVTA 3M5YA 1FDZA 1V3JA 2FE0A 1AVAA 2V82A 5I3GA 4HIBA 1WQ5A 1XBZA 2X2JA 4IGHA 1CI1A 4OT7A 3GYEA 2NUXA 2WQPA 1WP6A 2D0FA 3W84A 1K7EA 3VFLA 4JDYA 3A22A 4GUHA 5EYWA 4JTUA 2FIQA 5LNUA 2FYVA 1UOKA 2OMAA 3M6YA 1KM1A 1MFVA 1GCYA 2EAEA 1UUOA 4AF0A 4AWTA 5KMYA 2C16A 2VFHA 4LU0A 5FEXA 3O05A 3B06A 2ZXBA 4PL1A 1UH2A 1CGVA 4MLRA 3EDKA 3VNYA 2XVLA 3MBFA 4FLOA 5DFAA 4JFUA 4KKXA 5DCDA 1EP1A 1UASA 2CLMA 1O4UA 4XBKA 3RIKA 4GI9A 1IIHA 3NQ6A 5CLWA 4GWEA 2I9EA 4ZQPA 3BLFA 3BO9A 4UTMA 2NX3A 2X1UA 5CSSA 2J25A 2AMGA 3UG4A 5A6LA 3VGDA 1MW0A 1OB0A 3BGGA 1HO1A 1FWTA 3R12A 2YIHA 1ICSA 1KM4A 3I6RA 5K3VA 3WJSA 1JVNA 3OVPA 2CXGA 1UJPA 1QI4A 3B8DA 2CLIA 3ZWSA 4GFSA 4BA0A 3NPXA 3PY2A 3DHDA 1H60A 3B0VC 2GUUA 5BW6A 3WNPA 3ZO9A 3DBPA 3II1A 1DHPA 3VNZA 2A2IA 1MVYA 3GAYA 3O6YX 4GQRA 4QNEA 3SR7A 1G67A 3CEUA 3EX4A 4C1LA 3C2RA 3CIXA 1H7PA 5H91A 1UCWA 2BWGA 1QHOA 5BRPA 1Z32X 2QV4A 4N4PA 3LXAA 2NWSA 1Q6RA 4IOTA 3NQCA 1QOQA 2DJLA 4RKAA 1R47A 2FH8A 3H53A 1DORA 5BMXA 2CLOA 3G0UA 5D03A 1TIMA 2WNQA 3FIGA 4O1DA 4H7VA 1ADOA 3KEHA 1LP6A 3DDFA 1OJXA 4ADTA 1PIGA 3W7JA 4RXFA 2BXVA 2WVVA 1HX0A 2XWEA 4DPQA 2ZX9A 4QIUA 1W56A 4I9AA 2Z1KA 1P1XA 4GC4A 1WPCA 5K2ZA 1L6SA 3W1QA 3DX2A 2QMJA 1DKWA 1EPXA 3DX4A 1QPKA 1KFKA 5DBTA 2Y6ZA 3G1VA 1EWEA 3DHFA 4UR8A 4WOQA 3TFCA 3VGGA 4UUIA 2BLEA 2XIBA 1YTDA 2ZUUA 4YCOA 5CZTA 1KBJA 2V2CA 4H8UA 1F74A 1SO4A 1T96A 3EX1A 3NQAA 1RP8A 3GXFA 4IX2A 1WOBA 1KFJA 2G96A 2ZRZA 3G0SA 1SMDA 1S5TA 2QCGA 2HSAA 3TV8A 1Z44A 3VI2A 4JTLA 1JCNA 4KWVA 3MP5A 3P5ZA 1HXKA 5CPNA 1V5XA 2E4TA 4NNCA 3SIZA 3G8EA 2D0GA 2ZRUA 3MJYA 3UY8A 1FX6A 5GVJA 5AYXA 1WBJA 1SZNA 4YLWA 3W1XA 2DZPA 1A5BA 3SFKA 2YXGA 4M19A 1F7BA 2GVLA 3HBLA 1VIWA 3TH6A 1GTHA 1KM0A 3EX6A 1UKQA 2P10A 1DHKA 3SW6A 3K8KA 1I2NA 1VCVA 7CGTA 3G1YA 5I3KA 3QH2A 4N2YA 5KZMA 3L4UA 4GIAA 1KBKA 3BG5A 1H7NA 2A6LA 3BV4A 1MXGA 4HP5A 4O57A 5G2IA 3W7NA 3D51A 3GIYA 3E9AA 5AOUA 3L67A 1TTIA 2ZTJA 3O6CA 2R8WA 4QM1A 3OG3A 3W74A 2Q8LA 2V9DA 1ODUA 5AHNA 5E6YA 1BWLA 4R53A 3RLVA 4CCDA 4MYAA 3GX9A 1D7FA 1JQVA 1LRNA 1ZAIA 4M8UA 2QCCA 3IVSA 3O16A 4UMCA 4WOZA 4Y90A 1R2SA 3TA6A 1TPWA 2FPTA 2YCEA 4RK8A 1G4SA 4UNLA 3W7GA 3L66A 1G69A 2V3FA 4Z1CA 1OT2A 4LVBA 3HG2A 1W5PA 1OX5A 4CNNA 4IMEA 3QPZA 3NQMA 4WUIA 3S1UA 2A85A 5HWNA 3VSVA 4DELA 1H62A 4LY8A 3QC3A 1H7XA 3CU2A 1FDJA 2VFFA 4NJHA 4E2OA 2QKFA 2Z6JA 3EJRA 4ONVA 4A29A 4O4WA 2V3EA 1VAHA 3CLWA 3T7VA 3W1RA 3DDGA 1PCWA 5TD4A 4LRTA 3T78A 3NM1A 3M1ZA 5AC8A 1BKSA 4XWUA 3BSHA 1Q4NX 3TCEA 4O52A 1JDCA 4MOZA 3QMTA 4LNYA 3E0IA 3DX0A 5EA9A 1HL8A 1W8SA 2B7QA 3VCRA 1NAL1 2G97A 1B9BA 3ATYA 1E3XA 4E0CA 3LPOA 3P67A 3UPBA 3L4TA 4UFLA 2ZWZA 2JGQA 1JAEA 1TQJA 3CLMA 2DIJA 2ZIDA 1PL9A 3N2XA 3NPUA 1CPUA 4ML9A 1G1YA 1FUYA 1I2RA 4MZ1A 4UQCA 4PSRA 1G4PA 3PB0A 4X2RA 1UBSA 1Q6LA 4CKQA 3TXVA 4FX6M 3A5VA 4GI8A 2EADA 1OK4A 3F4WA 1MW1A 1LRTA 4LVDA 2J6XA 1MEHA 4WF7A 4RZ6A 4UQBA 1JULA 5C2XA 3W37A 3G24A 4WQ6A 1THFD 2ZA1A 4LVGA 3UQNA 2OJPA 2E5DA 4I7VA 3BVWA 2BX7A 4HNTA 3OLIA 3PG8A 5FF4A 3IIZA 1KTNA 1KM3A 3P5YA 4H2CA 2J9XA 4O50A 1VJIA 4O8RA 1PCKA 5D2XA 4AB4A 4IWWA 2WOQA 2AAAA 1CIUA 3FKKA 1LWHA 3G1FA 4K6AA 3MBDA 4L4MA 1RPKA 2ZA3A 1ZNNA 1EIXA 1AK5A 4E2DA 2B7NA 3L68A 2RHGA 1JL8A 3WDHA 1PS9A 3EDFA 2QUTA 2EABA 4NI3A 3LXBA 2AGKA 3G3DA 1YDNA 4JFWA 1KV5A 1OFBA 1UUMA 2WSRA 4FNSA 2VELA 1WO2A 1UA7A 1CXHA 1BPLB 2F2HA 3PC0A 3ZWTA 2ZRWA 3GDTA 5BMWA 4DF0A 1XH1A 3M07A 3GNDA 4LTSA 3P8JA 3UYCA 4GO9A 2ZX6A 2X16A 4PEEA 3UG3A 3BLPX 3TAKA 4OV9A 2XVGA 5AC6A 3BPWA 1Y0EA 2BY1A 5LGXA 3MW7A 3FAWA 1D9EA 3VE9A 4CCEA 3QEZA 5C5YA 1PAMA 1NEYA 4LUIA 1F6PA 1RQBA 1ZAHA 2GJPA 2KZHA 3M47A 3HGJA 1K3UA 5A2BA 3TQ0A 5LNVA 2WCSA 4XKYB 1IXPA 3IJ7A 2D73A 2GQ8A 2B7OA 3CQ0A 4JX6A 3S5ZA 3C2VA 3W22A 2WNNA 4DO6A 1EO7A 3UXDA 2XVKA 5DXXA 5HINA 2AQWA 1TPH1 2NXIA 3NL3A 1LROA 3BG9A 3C61A 2RDWA 2H6RA 1SPQA 4UNKA 2BHUA 1Q45A 1R2TA 5AHIA 1L0PA 3NVTA 3LCIA 3O63A 3KVJA 3PBYA 1H51A 2ISVA
chains in the Genus database with same CATH superfamily
2AXHA 5GZOC 3ZJKA 5DK2A 2WZMA 5DJDA 2J8HA 1G9HA 3L2IA 3ARSA 1OAUL 5JBEA 4KOCA 2XTSA 3SSGA 3F2DA 3LDBB 1RH8A 2DQIL 2O4EA 1K8IA 2P8BA 1HHGB 5IWLA 4XNXH 3N34A 3FJLA 2EP6A 4V1DB 1EB3A 2PCEA 5I24A 1MRFL 1XG4A 3STLB 4M3KB 1DXEA 3BANA 3D0VA 4O19A 2XFRA 1TA3A 3CQIA 3EH1A 5FWQA 3T6CA 1RV8A 2NSXA 1SEBB 2VH5L 5CG0A 1DQVA 4FULA 3PWNB 2APXA 3H26A 2CWUA 3WXVL 3AQXA 2APFA 5IW1A 2C10A 3AMOA 1TKWA 2Y3AA 1ZFJA 3HAEG 4Z7VB 3ZLFA 5AW4B 2OJZH 2PTXA 1UXSA 1SYVA 4NZUL 3KN4A 1Q1JL 3LIZL 4AJVA 1GZJA 1QVOB 5FO8A 3ZHDA 2E7HA 5C9XA 1JS4A 3S1WA 5ITFA 3ECUA 5CF3A 4ZBJA 4PS4L 1J87A 3EJUA 4OHQA 3FTXA 5ISZE 4AQOA 1KJ2H 1IGFL 1G6CA 5DQPA 4E3VA 4UTIA 1KCKA 1ETA1 4GINA 4GG8A 5D4QA 3PZUA 1D3CA 4CNSA 4YSSA 5C08E 4IOFD 3QUYC 2WKGA 3LS9A 1H1YA 1GYNA 1QWUA 1HU8A 2Z92A 1HSBB 2E7FA 1DN2A 1GOOA 4AIBA 4YDZA 2VEMA 1M9HA 4JFHE 4AKPA 1BYCA 5C07D 2BNJA 4JFXB 5J12C 2H90A 4H5SB 4JK0D 3K1DA 4AYFA 1J8VA 1U3HD 4J1UB 5LIUX 1U4EA 3DGCR 3RG6A 3WJYA 1U8HB 4K3HA 2FATH 1GOXA 1MCOL 1VFOA 2AEOA 2XQ0A 3TN6A 1TV3A 1JHTB 3MACH 2PBOA 1NGZA 3RBSA 3NPSC 1F6AB 4W7WA 3SXXA 3SDCD 1AIZA 1FWGC 1PU0A 2HTAA 4Z77B 1U21A 3L65A 4XVOA 2DM4A 2KUTA 3L1OL 4HMEA 4DCQB 2KBGA 4G1MA 2IXVA 5CGQA 3EYVB 4MFDA 2ZUXA 3EPOA 3QUMB 3L4WA 2G9HA 1KB9K 1JZ5A 5C0FB 4B9JA 2BOCA 1R19A 2VDPB 1PFCA 3U6RA 3VFSB 4I13B 3K1GA 3QMRA 5DZJA 4N9CA 2NQ5A 4C59B 2E09A 3HMXL 3O3EA 3OMNB 3MS8A 1FBIL 1E4IA 4H20H 1B9KA 2W9MA 1P0SE 1VESA 1OTUD 2CLEA 3ZKXB 1FL3B 1QBMH 2X2YA 5JVLA 4CU6A 3BWUC 2ATKA 1KTBA 3FTUA 5DT1H 3Q1EA 3EGJA 2X6AA 5EZIL 2ZZUT 1AR1D 1VEMA 4BXSV 4Z0XB 2R9HC 2AV7A 3NM3A 1FZKB 2RH9A 2VCBA 3O9WB 4FB7A 2J7BA 5FOOA 3IPBA 5CN3A 1TWZA 3FUHA 2OPJA 1URIA 3OKKA 2BP0B 1JDDA 4HULB 3W01A 1B3XA 1UXMA 5CPLA 3BW9B 5FYKH 2VUOA 4LDOB 3O2DA 4FQPA 5KVDH 4F0LA 2VGIA 2W6RA 3OZ9H 4PY7A 3L0NA 5CZSA 4X4ZA 2D1ZA 1YTKA 3NSDA 4PJ9C 1EHAA 5FF3A 1AJ7L 3DC0A 1TJIH 1QQDA 4IXHA 3KYNA 4ZSOB 4UFIA 5CP7A 5AD0B 1B0WA 5C0GB 1LF1A 1JGEB 2A3AA 1L2QA 1FJ1B 4IU3B 2QHAA 3GR7A 4XD4A 3GHEL 3NA9L 2V2TB 3ZHLA 5AG9A 4K5NA 2IPKB 4RV3A 3EA3A 3PNRB 3C09C 5D55A 4Z18A 1XF2B 4UTJA 1LOSA 4JM2C 2ZKYA 5EF1A 3SBWA 2VOMA 3E1F1 2I25N 2WB1A 4GRMA 5D7KD 3GLZA 4I0CC 1CDGA 2DYSB 2YYTA 3SDXF 1I8LC 5C6TL 1WUNT 3EFOB 2MCPL 4RPPA 5C09B 4AMKL 1W8EA 5AVNA 3HMJG 2A7PA 3EW3B 4PV9A 1B5TA 4KRTA 4QF1A 4JRLA 3FFCA 3OKDA 3G04B 1C5CL 1YMMA 1BEYL 1BYBA 3QUZC 3IUDA 4DK6A 4YSQA 1LTDA 1DJSA 3WZ0E 1OJOA 5F21B 4OT1H 1ML1A 3ILPB 1KCVL 3BE1L 4OZIB 1X7QA 2YX9A 1K8CA 4AE0A 4YMZA 1P7HL 3E1ZA 2OSXA 4A2FA 7FABL 1GW9A 2RA1A 2YC1B 4J5NA 3MODH 3NDZA 3BRDA 4RE2A 5B7EA 2GJZA 1PYMA 1NGPL 4G2DA 3UO1L 4G9PA 2P24B 1BZ7B 1NSVA 2OP4L 4AC4A 4FS0A 3T0TA 4Y96A 1JUBA 3P9MA 3EYPA 5FEBA 4KUZH 2E6JA 3U4EB 5JIPA 1CTMA 5K9OA 4Q4QA 1FV1A 3GR8A 1IBFA 3NPZB 5L2KA 3NABH 1DQDL 3H9SB 1S7TB 2WOHA 5IROC 2EDJA 1FCVA 4RNLA 1ZL1A 1QPXA 2XFGB 2BK8A 2AJ3B 3ATZA 2E8YA 3HN8A 3HUJA 2CRZA 1OZTG 1WFOA 5IQ7H 2OKOA 3ZHFA 2I9LA 3AI0A 4RGMC 2VR9A 1XKJA 4TIMA 1K3ZA 1WZAA 3TN4A 1ISYA 4QRRA 5JZ7D 4DW2H 3AREA 2E28A 4Y4FD 1VIZA 4YLQT 3LQAH 2AQSA 4FXKB 1XF4A 1LOHA 2R4SH 3F00A 2JCCF 3CSGA 4GAFB 3KRUA 1TU2B 3V0IA 4X7FC 4G6MH 1MUJB 2V17H 2F08A 3LKNA 5A6SA 5BS0B 4LL9A 3WJMA 5E5UB 1CS6A 1ME7A 4JMNA 2ZZ4A 4PJIF 4ZVJA 1FAIH 1XRTA 1BLNB 1ZBVA 2DWSA 3NRFA 3DYOA 1QASA 3O1NA 4G9FA 2QCFA 2QJMA 4U49A 4PRHE 4QR7A 3R58A 1EIBA 3PNUA 4MJJA 3GC4A 3FRPA 2AFNA 3IMRA 3DOHA 3VA2C 4YHPA 3ZLGA 5EO0A 1S3TC 1HILA 4IGBA 3C0QA 2AAVA 3C8KB 1IGYB 3MPHA 5JR1H 1ZB5A 3N44F 2QF8A 4FALA 1TREA 4PFEA 2J73A 4IOSD 5LHDA 1FDLH 4GG6F 4YHGA 1F58L 4W6WB 4ONFH 2Y25A 4KTEH 1RSFA 4JDTL 1RVKA 3MI2A 1Z9OA 4ZX5A 4OZGE 2VC6A 3CHXA 3QZBA 3S96B 3PBGA 4J3SA 4P5TB 4XCFH 4K7PY 5F3HA 4RNFA 4PUEA 1AANA 3LLDA 4B5VA 1OM9A 3VH8B 1NBQA 2J1XA 1Q0YL 1JZJA 2H3BA 4UM9A 4KQNA 1NIFA 1M7PA 1AS8A 3TZNA 3ME3A 1D2KA 1KTKE 3WELA 2XTLA 1DPMA 2CMRL 4P46B 1CCWB 2QV5A 1AXSA 1RJQA 4OCRL 2OOFA 1RIUH 1W9DM 2IALA 5IF0A 1I31A 3IS1X 1R17A 5AECA 3W2MA 4ZS7L 3DFQA 4G8EA 1ZBCA 3GXUB 1LOQA 2AXFA 1S5HB 1L6ZA 1MHHB 1SXCA 4N0UE 4H2HA 4PWGA 3RR4A 4ANVA 3MLZL 1M1XA 4KTGA 2OSLA 4Q6YA 1ZLSH 3MR9B 1U2HA 2WHMA 1S5MA 4Y4KD 2IDTA 4O9HL 1C16B 4ZQKA 4NGHH 3VZZA 1C92A 2CA4A 4HLJA 3MLPA 3LCHA 2JF1A 4UF7C 2PABA 2MPAH 1MCSA 4V1DE 1R3VA 3MBWA 3TMLA 4RDBA 2AJSL 1MCHA 4MBRA 3KPSB 5I1EH 1GA2A 1F86A 3STFA 5G55A 4XPFL 4L1DA 1XV8A 3QYQA 3ZTCC 1T04B 4P7RA 3FCBA 3M88A 4BZEA 2Q7NA 2GDUA 1BV8A 3GXTA 4U1JB 3MWCA 3V52L 3ESOA 3EWXA 5KJRL 1MMYA 3N9KA 1WCBA 1H8LA 3BH8B 1G7QB 2WANA 5JNYA 1OADA 1FZOA 4Z7VE 4N2CA 4TTUA 15C8L 3QW9A 3C60B 4N6RB 5AZ0A 4B4FA 3EKLA 1WEJL 2KERA 4LQFH 2VOTA 4XH2B 1SM3L 3MN8A 3BD5A 4HIXL 3AU1A 1FVCB 1BM7A 1CXEA 3GRBA 2RDYA 4PLJD 5D8JH 5CLTA 3B2VH 4FLRA 1PX4A 2COVD 5F3BA 3HJ0A 3WBXA 1MQ8A 4D6GA 3GH5A 4K15A 2F9BT 4KI1A 4UQ9A 3HKFA 4NHUB 3H7LA 4E41A 2QKIA 5D7HA 2VISB 4F4RA 3M43A 3BVNB 4G6CA 2QEZA 1HL2A 4GO8A 1Q6OA 4BY3A 2IKGA 2WC3A 3T6ZA 1X5HA 4L8CB 3MGOB 4P3DA 3MPCA 4FR1A 1A6UL 3WS3A 2NX5D 3DI2B 4NRYA 1W5QA 1GMIA 4H88L 4KV5F 4UQIM 2QJHA 2LHAA 1RSCA 1KLZA 4N02A 4HS8L 3O8XD 4GMTH 1E4KC 4RJEA 3C8DA 2WHKA 1WMPA 4E68A 4FX8A 3X40A 5A16A 4AGNA 5DGQA 2QVTA 3GRWH 3KPTA 3N43F 1TPB1 3PWJB 4I18C 4AGOA 2KPWA 4QQ3A 3KL0A 1G6RB 3BZ4A 4ZD3L 5I6KA 1G84A 4LCIH 3B9KB 1F4XL 2EH8H 1WA3A 4FNLL 1SIIA 2Z93A 4W9ZA 2FTYA 3NVDA 3RX7A 4OI7A 1QSFB 1LD9B 3V4VL 4IL2A 1M05B 1K8DB 1S1PA 5JPNB 3PXJA 1Q8JA 4XAFA 5FUOH 4YIQB 2C3VA 3MFFA 1AUSL 5EULV 4MG4A 1SHXA 2MNRA 5I17A 1U92B 1EWDA 3ECBA 1B3JA 3PLYA 1NM4A 4JFQA 4KROD 5TF1H 3PQYB 4C6IA 1GMEA 2GT9B 5G2NA 1SJBA 5KSUB 3KM2A 2BLFA 4TLKA 4F9LA 4LCCA 1UZGA 3KP0A 1K2DA 3W70A 3WLNA 1USQA 3WIHH 3W75A 4N5ED 1AG1O 3NCMA 4K23H 1EKMA 4JVPA 1UJ3B 2HKFH 1J01A 1P7TB 3NGJA 1F8MA 4JAMB 4EPKA 4BWTA 4DEWA 1NCDL 1TCMA 1L6WA 5AYYA 3F58L 4BZ1A 3WK0A 2C9AA 2BGSA 3N73A 3MOQA 5IG7A 1TMQA 3SOBL 5DCBA 5KOMC 4LMQE 1I2QA 4L1HA 3SDAD 1FWRA 3WUFA 4N28A 3F7PC 4K7PX 4L37A 4MS8C 1C8XA 2OSWA 1IT9H 2XN2A 2P0IA 4WV1B 5IFHH 2FECI 1D9KB 4ABUA 1E1EA 3A3HA 1IJ9A 4AD1A 2GPTA 4AQ0A 1C5DB 2Q3RA 2IPTL 4ODTL 4ZSOE 4Y9FA 4WGHA 5DXYA 4R34A 4S39A 5I75C 4ELMA 3UTOA 4HIEB 1KJVA 3F3HA 4AYID 5J56B 4H9MA 3LEXB 3OPZL 1PX3A 3W86A 3C5SA 2XQYK 1NWTA 1T8QA 3LH2H 3ZKSD 3TZVC 2FHCA 4YWGL 4HS6A 3NIFB 1S6NA 2DQTH 3GIZL 4CC4C 1G7MB 2FT7A 1S9XA 1YYML 1EXGA 5L9FA 1BJ1J 1XXDC 3SQBA 3UZ5A 5FR3A 5CINH 4WKZB 1X9RA 3AAZA 4MNHA 4HCLA 1F0LA 1WUEA 4MJ4A 3NBJA 2A7BA 1G4TA 4LIQE 5CR1A 1UWAA 2OL3A 4GBUA 4PM1A 3IPFA 5C09E 3DAQA 1HI6A 8TIMA 4ZPVA 4YBLC 5C0EA 1CDJA 4K36A 3ZXWA 1Q1PA 3BE7A 2YGOA 5E1IA 3WK2A 1LMIA 3JRKA 1V3JA 5GGUA 1BGXL 1SMOA 1TLMA 4HXBH 1A6TB 1FLRH 3WEZA 3T4WA 2PDIA 4OZIE 5B39A 1SO0A 5HYQB 3I50L 1TUXA 1HNFA 3M6YA 1O5RA 3N1QC 1SBSH 1ZP3A 4LNRB 3H23A 3QYSA 2XVLA 1E9IA 3LSCA 4A55A 4UMSA 3KYOB 4XBKA 5J13B 3NQ6A 4GWEA 3EJZD 2PP9A 2DKSA 4NSKA 4W9FC 1WJ3A 1KM4A 2X9YA 2FMNA 4FGMA 1WG3A 3TT3H 3OKLA 2BINA 4NKIH 4IIBA 4UAOB 3ZO9A 3SDYH 4PJDB 3QZOA 1M7DB 3H9SE 3WI9A 3CQHA 1Z32X 2FYYB 2E5EA 6FABH 3T81A 1CECA 1ORSB 2VDHA 4I2XB 4EACA 3W7JA 4UTBA 1A65A 2BXVA 1J8RA 5DJ8B 1CQYA 4DPQA 2QFPA 3NCXA 3QG6A 4YL9A 2QMJA 1S7VB 2HAZA 4Y5VB 3BX7C 4TQPA 4BH8A 3VWJB 3WKZA 4TM9A 2ZOKA 1GCFA 2J7CA 3EX1A 4P2RB 4HVBA 4F37F 4GAAA 4D0DA 3RE0A 4JTLA 3P5ZA 1XYLA 5BS0E 2E4TA 3SIZA 4L2YA 1WRFA 5GVJA 4I6VA 2V8LA 4DGVH 2VQ4A 2APBA 4TOYH 1IE4A 4XXCC 2GVLA 1KM0A 4K1WA 3V55A 3CK0H 5F9WB 3KLDA 1ZHBB 4RBPK 3AYRA 2A6LA 4LT7A 3RJQB 3W7XA 5C07A 4NHCH 5AOUA 1ZTXE 4JQ1A 1OALA 4YDIH 4Y90A 2Y36H 5GJTL 1OSPL 5K59E 4LVBA 2WLMA 4XCNA 4IMEA 3NQMA 2RIKA 2JJTA 1H62A 1H7XA 3PGBA 2Z6JA 5FDYA 3VKAA 2NZ9D 3CU7A 5BCAA 3FUDA 4HIPA 1LE5B 3RM8A 3RX8A 2UZIL 5DQ9A 4OLVL 3PPHA 1PKLA 4LY4A 4G8TA 1AQKL 2G97A 4KRUA 3SDCA 1A0QL 3LPOA 3P67A 2ZWZA 2ZIDA 4GEJA 3CSPA 3N25A 3B8IA 2HQAA 3E8UL 3U7VA 3WSQL 5FWRA 1V0LA 4P57A 1JULA 3AALA 3T2PA 1YPZB 4OTXH 4GW1A 3ALXA 5H2BA 3JVGC 1DWJM 4O8RA 3EFDL 3MBDA 1KENL 3PWLA 1EIXA 1UEMA 1XTMA 1AC0A 1LDPL 4ZFGL 4BFIB 5F7EH 1UUMA 1VGEL 1WO2A 2ICES 5C0ND 1RBLA 1W72B 4GO9A 4P59L 2ON3A 3M86A 1IYXA 4U0RC 1AIFB 4P5RA 5T8GA 1GXEA 2XVGA 4HUKB 5JPMA 1JERA 2R1WA 5ECUA 3REQA 1F4AA 3W39B 3VE9A 1XW8A 4PLKC 1I3RA 1NEYA 2FZ3B 3GGWA 3CPLA 3NCBB 3NTCH 2XKSA 1OAKH 2B7OA 2INZA 4JX6A 1NDWA 2PF8A 4LP4A 4YYCA 5HINA 3RL2B 3SQLA 5LBGA 1H5BC 3RLHA 1HINL 4YOKA 4XBGA 2WK2A 1JCVA 4EAMA 4L1LA 4K8RH 1HHJA 2V2XA 2ZOXA 3QUMH 4LNVA 3N9GL 3OB0K 1KIPB 1KYAA 3UBHA 5IQ9B 2VDPH 4GKSA 3P84A 2V9UA 3KPSE 2G8ZA 1EHNA 5G1TA 4LGRB 3KR3H 2FR4B 2Z1BA 1RWHA 1U42A 2JIWA 3OWEA 4XWGL 2D22A 2W0PA 4BTYA 1YJDH 4DX3A 4XCCL 3VE7A 3FCPA 2V5TA 2LVEA 3ALPA 3HHRB 1GORA 5D5MF 4NPYB 4JGDA 4BHYA 2ADGA 3ZMRA 1QO5A 4GSXA 4OFQA 3G5YA 4UT6A 1US2A 1RURH 4WVRA 3WNKA 4JN2B 5HGAA 1JGUL 2CZ5A 1E90A 1RKRA 3ZDYF 1FY6A 4GUFA 4IGSA 3B7TA 3UTPD 4DAFA 4QE5A 2OTUB 3F84A 3KYMB 4DHLA 5BO1L 1DQLL 3N4FA 4JGNA 1TJ2A 4PRIB 4Y4HC 1KGXA 2DEPA 3D3VB 3FSOA 1CXIA 3PNZA 4KK6C 2W65B 4KKBD 5AZ2L 5E4OA 4QEHA 2R0WH 4JJOA 3NL5A 2EXOA 3QEHA 3KVQA 4XG1A 4OCSH 3RWDA 2AXJA 4KJPD 3UXKA 2VKZG 2HKHL 4QYOA 5HVHC 1P2CB 3I3DA 1UCTA 4F92B 4IHOA 4KRPD 3IJQA 4BFNA 4LYPA 1EXUA 3OSVA 1H7RA 3KOZA 3FPYA 1UD6A 1A2YA 2EAWA 3BJTA 3FYPA 1DP0A 4XR8C 4NU7A 4CN6A 3KVDD 3EYOA 1KXQA 3H3PL 1DQWA 1QUPA 1BHGA 3V0VA 5AVHA 1JE6A 1ML0A 3GUFA 4F7CA 4IL0A 2UZYA 5J6HA 4K73A 1TPVA 2BGQA 3WD2A 2QL1A 2NLIA 2ACSA 3P0YL 4PWFA 4LIQH 4H1ZA 2R69H 4MYWB 5F89B 32C2B 4Q7NA 1R3LA 1PS3A 2PU1A 2FHFA 2VERA 1R3KB 1BG9A 3GU2A 4YSCA 1HN0A 3QSTA 3P8IA 5KSAD 3V4PL 2DF3A 4GUPA 1QSFE 3AZUA 4MVBD 2WXIA 5IFPA 4FQXC 1JV5B 3BFWA 3EJYC 4Y4FA 4CD7A 3HRZC 2HUEA 4Q8OA 2YPLB 5TNVA 2IBBA 1IFRA 1CICD 2PPAA 2FSDA 5EIIG 2WXMA 4Q9QH 4KKPA 1Q7QA 2E46A 2QPXA 3PQYE 4L4VB 3QZMA 4AGLA 1BLIA 3HI6H 4LBUA 3RU8H 3O45B 3DBSA 3A4XA 3AG4B 1NLDL 3W9DA 5DBUA 4ZMTA 4AEFA 2XTJB 2Y2TA 2F9RA 3OR6A 3QHNA 3SCUA 1U58B 1UM5L 4F33B 3N2MA 4DJFD 4JJ5B 3EWZA 1XRFA 5MHSD 1DFBH 5A69A 3IIOA 5FECB 1GEHA 2HX8A 4R3UA 2H6OA 4KWSA 2J88L 2I9TA 2QGYA 4AVFA 1JJKA 2FJFA 5FJUA 3RA7L 3RTLA 7A3HA 2OX4A 1PZ2A 1OGAD 4NOFA 4IMDA 5IHUH 2IBGA 2XVBA 5EOTA 4IOSA 5IMOA 2ZG1A 3R79A 2GBVA 1DWHM 2J44A 3CV7A 5C0CD 4JN7A 1YNTA 3KS6A 3V75A 4JHVA 1BX2B 3NO3A 2KLTA 4RLIA 2P43B 4GQBA 3BP5A 4D0BB 3QFDB 2D31B 5LAPA 2D7OA 4C60A 4H1LG 5CJ5A 1GRWA 4OD3L 1Q63A 4C83B 1BVOA 3KCLA 3B0UX 5HYJD 3FJTA 1MHEB 3SN6N 2CJ3A 3QGVA 4PJ7A 2H1XA 1IC4H 3LQAC 1FH2A 3P80A 2OTDA 2XTKA 4NQQA 5AAPA 3NIFE 3TUUA 4QYAA 3DFOA 4HU4A 4G1EA 4OFCA 4DN3H 3U0HA 1ANUA 4YTQA 3GMPA 1JF5A 1X7TA 1NPUA 3HJZA 4NI6A 5CGYD 1S9VB 2WNKA 3EJQA 4LB3A 4PH6A 3OLDA 4TPRL 5J6SA 5TK4A 2DD8H 4PH8A 2PCQA 2K3TA 1OD7A 5CGBA 3MRNB 4HQQH 1XLCA 3PAJA 1D6VH 2OJ1A 3ES6A 2H8XA 1XIWB 3GI8L 4GBDA 4Y4KA 2FLMA 2NT1A 3HI7A 4B5NA 1RQHA 3VYPA 3NT0A 2FBRA 4EZKA 4XTIA 4HWEL 2BY0A 6XIMA 3QJTB 1FXPA 4A7SA 4WNQA 2PGRA 1HSAA 1KBLA 4HIIB 4ZMGA 2J6VA 4UDTA 3RGVC 1UD5A 1XG3A 2B16A 4EVNA 3A12A 3FX4A 3HZKA 2NZLA 3LS4L 3L6FA 4AWUA 2CR0A 3O41B 3CH8A 2JIXB 1QYGH 1H61A 5A3HA 5E9DB 3AJXA 3S7GA 2EIJB 1Z3RA 2DQFA 3EG9B 2V3GA 2QQQA 1AG6A 2A74A 1KWKA 3W3BA 3GZPA 2Z35A 4NT0A 4IP4A 2VQ1B 4Y9CA 1VBUA 3S6DA 2LVCA 4P04A 1IZJA 4PJDE 2V5JA 3RTQB 3OAYK 4LXFA 3HI1B 4JQXC 1HZLA 2ZSVB 5I5RA 4UFKA 4OFKA 3GDRA 3Q05A 3HW7A 4H8WH 4I2XE 3ZE2F 1LL4A 4KK9C 3BQ5A 5ALCH 4O2CA 5K5YA 3D0LB 2J1KA 2QFRA 5FW8A 2TSYA 2W66A 2JF7A 3AOFA 3VQ2C 4RGOL 4R4FH 4WXZA 4P2RE 3QN3A 2K9FB 1NS4A 4X63A 2GCYA 1J2WA 3VVGA 1UWGH 1TVBA 3SCOA 3D4CA 1GH7A 4NCDA 4O5LL 4PUNA 3CX2A 1FH7A 4A35A 1L5GA 1ZV2A 1QW8A 2NX5A 3R2GA 1E1CA 4WEMB 3RBGA 3ARFB 3KJ4C 1HT6A 3EPNA 3UZEA 1IGJB 4FHJA 3IE9A 2PFHA 4LDLB 5LXGL 1TV4A 3O8XA 2NUWA 5BOJA 1ISZA 3FQTB 3TSDA 3UOAB 4URIA 4LYQA 1JFHA 3BESR 2NDFA 4H01A 2P88A 2W81C 4P5UA 1TIWA 2J77A 3SQRA 3C2YA 4JLRA 4GX8A 4E9WA 2FTPA 1A4LA 1EJOL 5JA9A 2CWTA 4BSJA 1EA9C 3ZKNC 1UD3A 3ROLB 1GAFL 2A4ZA 5EOQH 4U3CA 3I7SA 4Z3IA 4JL1A 3RWJA 3VFTA 5LKNA 3KG5A 1UR1A 1ICTA 3WFAA 1N8FA 4PJ6A 2Q8BH 3W5MA 3HG4A 2X30A 4I4WB 2UXFA 4W81A 1PLCA 4JZNB 4NAJA 4LC8A 2Z0BA 2DDQH 2NLJB 2HMCA 5EZOL 4HOWA 2NNRA 2VDRB 1QWHA 1IVLA 1J0JA 1YPZE 2DMGA 4RE3A 1MF2H 4XAWL 3BZGA 4N9EA 3P4NB 3IS4A 2PTDA 3UTSA 2Z7WA 1X5XA 5TH2B 2OVLA 3CNYA 1N70A 4M4RA 5TE7H 5IBUB 3UBFA 3VK5A 3E6HB 1BXNA 3ERXA 1S5IH 5GRYA 5EY5A 1I0BA 3S9YA 2WJ5A 2YCJA 1H6UA 3ARBB 2YSSA 5JXED 4QRBA 4IICA 1JGMA 1QWKA 2QGBA 4AZCA 4B96A 4UTWC 1G6RH 4J8RB 4Z95H 3BAYA 4MJ6B 1VYSX 2H6PA 2FEDD 4GIOA 3E0LA 4O1CA 3WNOA 2WVYA 3MBEB 1CK0L 3LEYH 5A2AA 3TCSA 4OQTH 2QCMA 2R1NA 3SDAA 1HOCA 3L17A 4A7UA 2E68A 1UCBL 4K7YA 4PMNA 1BQHB 2PYFB 5CUSH 3KHOA 2ZUQB 3C6LB 3SQOH 2J2ZA 3W7WA 3S2LA 1YSOA 2B1HH 4Q3MA 2NTSP 4PWJA 3ECWA 4ORGB 1XUUA 3TQKA 1LYXA 4K5LA 1O5KA 3FDKA 4UV7L 5EBAA 3HB3D 3OC8A 5FJOA 3BQUD 1GIGH 4PBWD 3OKEB 1AW2A 3UA3A 2NR6D 3CTTA 4TXVB 3OKMA 1U8OA 5FO2A 4KY2A 1WV7T 3OW1A 4YPGB 3ZYIA 5CMAB 3FFSA 2JB5L 4MWAD 3D18B 4OVUA 1VLWA 3UPMA 4KO7A 3U9UA 2IAMB 2W0UA 1ZALA 1VFUA 2P3ZA 1HMWA 3EHBD 4KMTH 1NSJA 2ED9A 3WLMA 3DBNA 2I07A 4PMFA 2SEBA 2ZAGA 4BUQA 1BXVA 1X98A 4GXVL 4O02H 1EGVA 3H6OA 1HJXA 4PGBA 2A6KA 5B4MD 3O11B 3RWCA 5KZDA 4EI5C 4PRIE 2X4TA 4HU3A 5I6OA 2CHNA 5B1JC 4QITA 1VDGA 3D3VE 1LNUA 4W88A 1KC5L 2FH6A 4JE4B 1DQTA 3Q9PA 4HHHA 4XZBA 1TEGA 1T20A 2HTBA 5CGMA 2FZMA 1MJ8H 4K39A 2QADC 4CNOA 1A22B 3S88H 5I76A 3GKZA 4AW4A 5GGTA 1X6LA 4PJ8B 3AMLA 1OSZB 3KPLA 1OEZW 1WKDA 4OB5L 2YUWA 1JG9A 3TESA 3FAXA 4PJHB 1AYOA 3KYKL 2C9RA 1KGCE 4S11A 3M0YA 4R88A 1IEAA 3PBWA 3IN2A 3ABSA 1NCAL 2JJVA 2ZA2A 3V6OA 2G0KA 1S78D 2YPVA 4PBFA 3TX4A 1SEQL 3SQSA 1SQ7A 5FB8B 4HIHB 1NSNL 3CDFA 1ND0B 3ARDD 1YN6B 5JO5B 4GOSA 4NX5A 4HNUA 4ZTXA 1HNYA 4WRHA 2R27A 3VI4B 4R8WH 5CBAA 2BGNE 3BVJA 2KKQA 5KANI 3DNKA 4P8QA 1EC7A 3MDJA 2TPSA 4PR5A 4X4YB 3GSNB 2P7TA 4HSOA 4XB3A 3R8GA 3EZ4A 2PDNA 2GTQA 2A4EA 3P54A 3TTOA 1NUFA 2OZ3A 3GLCA 3BWAB 2DPKA 2MWCA 4Y16D 4OE7A 2W60A 2YPLE 4O4VA 4JB9L 3HR5B 5MEND 4Z7UF 1QNZH 1CLZL 3DVIA 4LAMA 1G9NL 4UTLA 3FXIC 4HWZA 2WQWA 3G5ZB 1XAUA 1MSPA 4L4VE 2WJZA 5HHQA 3OAUL 4HNOA 5EEWA 4G70B 4PD4K 4ZK8A 5BRZB 4JFEB 3FEMA 3QRGL 3BP6A 4NZFA 4K38A 2B3IA 3CN2A 2XTJE 4V1XA 4N2GA 2ARJB 5TDPB 4Q4KA 3OJDB 4O28A 43C9A 5JW4Q 2Q6WA 1QW9A 2C3XA 3H6JA 3CQPA 4B5WA 3WEAA 4ZO7A 1XCTB 5CHNA 2JV6A 2WLKA 4GQZA 1QZNA 5CEZH 1UOZA 3U1QA 3EKZA 2A6DA 3TFKD 1OQOA 3O6KL 1KFAL 4M1CD 3HGRA 4HT1L 1ZVHA 4XNBA 4I5XA 1EK3A 3RPKA 2K70A 4M43L 2UV8G 3ZJ7A 1JMZA 3WLQA 1XBVA 3VFRA 2CZVA 4M3PA 5KZ6A 1C3FA 2YQ3A 3D6GA 3RVTC 3NFUA 2HRLA 3BAEL 2ENPA 5KS9B 3EDDA 1SN2A 1CLYL 4ZQOA 4UNIA 3FQWA 3GT6A 2RACA 4ACPA 5SWSA 3TR2A 1FP9A 3JWDH 4EBQH 1E5UI 1B4EA 4ODHL 4FJ6A 4X6DF 5FUCE 3LDBC 4APQB 1EAPB 3FZUD 4WW2B 2QJJA 3P30H 1VLXA 5LG1A 1S7XB 4BDVA 5EV7A 3ML9A 4WWOA 4U1MB 1JNNH 1BBJA 2V37A 1F02I 4WEBL 3AIBA 4UIMA 4FNPA 4ECLA 3ESUF 4RVBA 2MCAA 1JAKA 2OR2A 2YD9A 4L8DB 3N1AA 2TYSA 4P9HC 1ONRA 3TK7A 1RZIA 2CA3A 1GS6X 4BELD 3UCRA 1UENA 2ADFL 2WWMC 2DWDB 4ZTOH 2AJXH 1U3YA 4NNAA 3MOBL 3P9LB 3NN8A 1NUNB 4ZQRA 1ME8A 4Q8TA 1H15A 2GW5A 4DESA 3ISIX 3SGDI 2PTZA 1KYOK 2JB6A 1R0AL 3W84A 2VABB 1K7EA 2V7HB 1RZJH 3FU7B 5E9DE 4J5TA 3HZVA 5KETA 2ZL8A 4XC1L 4QY8A 1W72H 5BZXA 1IAIL 2PDCA 3U7AA 1A0DA 1E72M 4M6NH 2QQLH 4K2UL 2AMGA 3GY1A 1EXHA 1MW0A 2D2GA 4GYJA 4W9EC 1T1ZB 1V7AA 4O8AA 2VCCA 3VAVA 1YIXA 2VXQH 4BS0A 5ETUB 1H60A 5EU3B 4PTXA 4KNUA 4IMAA 2Z1XA 3II1A 3U0WH 2CIRA 2A2IA 4Y1SA 4I89A 2YDQA 3MSRA 3CEUA 3EX4A 3WN5A 2FD6H 4LAUA 3AHYA 1R85A 2EECA 4PRAA 3BKCL 3PDOB 2WAGA 5A2KH 2YJLA 2R39A 1CTNA 3ZE0B 5H37A 1OAQL 4PB5A 4KBPA 3S3PA 3HC4H 3B5TA 4QXTB 1XF5A 4QTIL 1BGAA 3S36X 5EF3A 2BV9A 3NQAA 4KY1L 3E6EA 3EB4A 4H9VA 5DJ6A 1SMDA 4OUUA 4K8RC 4WI4A 1GZQA 5F7FA 5IB4A 1X4XA 2WJ7A 3TH6A 1GTHA 1HP5A 4NNPH 1I2NA 5SWZB 7CGTA 3H2FA 5I3KA 2NY7L 1KBKA 3NIYA 1W2PA 5AVTB 2UZXA 3BZJA 4PTTB 3QIUD 3ZKXC 1BXBA 2PBGA 2B0SL 2RUSA 2YAHA 1AS7A 1BZDA 4DF2A 1YJDC 4PWEA 3DHJA 2NSQA 1AO7D 2CQVA 4NYYA 4Z1CA 4CNNA 4QE4A 4WUIA 4Z2LA 3V1HA 2EEBA 5KSAA 5AOJA 4ZE5A 3O9WC 2H7WA 2DLHA 3ATBA 3DGBA 3NZHL 2V3EA 3W1RA 4PMEA 1PCWA 4DTGL 1RBOB 3T08A 3UTZB 4YHIB 5GHWH 2BVOB 2BRRL 1S2UA 4M6AA 3C6SA 4KVNH 4LNYA 1ADWA 1AGFB 1J1OL 1NAL1 3CCHA 2PWVA 4GSDH 4WCYL 4G7EB 3DUGA 5A94A 4S3GA 1JAEA 1TQJA 3MKKA 4XBEL 2R83A 4GI8A 4DYJA 1BJMA 5HHVH 2IFGA 5K1JA 1KTDA 2WMJA 1KTNA 5TE4L 1KKOA 4FQ1L 5IK3A 1CIUA 3CN4A 2WCOA 5AKSA 3APYA 4E2DA 1JL8A 1RU9L 4DJFA 3WJJC 3NJMA 4H41A 1OFBA 4FNSA 1BPLB 4L9LB 4A66A 3SKNA 5GIRA 3TVMD 5BOPA 2BVTA 1NIBA 5DD3H 4PRNA 3DMMB 3H7UA 1EEYA 2GAZA 4CC1A 2PTVA 2BRVX 3T0BA 1OGAA 4EX4A 5FGRA 2I5IA 1PKMA 3UZVB 5GSVA 3RMEA 5K1NA 3GMOA 4B7LA 3MX0B 3UAAA 3NTYA 2GY7B 1F6PA 1JZHA 5E4AA 1BZQK 4EUPB 4PB0L 2EVFA 5C0CA 1NEZB 3WV0A 1BFTA 1DQJB 2AQWA 3BG9A 2EE3A 4F5CE 5KG9B 1AFSA 5GZND 1A9BB 4TQEH 4R4NC 2A9DA 3ZGIA 4I1RA 5HYJA 2AHIA 3L7RA 4HNLA 4MQTB 3VC5A 4OW6A 5DK3A 3BDKA 2Y6TE 2NVAA 1XB8A 2XC8A 3RJYA 1EPVA 1WT5A 2QCHA 4XPAH 2NY6D 2E2UA 1XZ0A 3B3DA 3SY0A 1XR9B 1CXLA 3NFPA 3QIWB 4WZHA 5IT2L 1FTXA 1FHNA 3ETSA 2BDNH 2A0LC 4FG6D 5CPQA 1MJ7H 3QUGA 3SCVA 1YHTA 2QCDA 1M2VB 1NFDF 2FGWL 1VP5A 3WCYA 1G43A 4ZRGA 5J1AA 1JCMP 3ECVA 1NCJA 1R3QA 1FYTD 1U93A 3DSNA 4RR4A 5K9CA 2WW1A 5M94B 3WEMA 4QJ4B 2WMIA 5H1WA 1ORQB 5D2LA 4XISA 6ALDA 3LYRA 3CV6A 4HUNB 4XZ9A 4TVCA 2VEPA 5DRCA 3ZTDC 1CFQB 3H2NA 2W0FB 3QQ1A 2VLKB 1XS2A 4WUUD 4TUUA 3K6IA 1ESOA 4KU1A 4PJHE 4N6QA 4HPYH 3BUVA 5DDHB 1BWWA 2GTWA 3NQEA 4I9WE 1IQYA 4B90A 4IFOA 3AIRA 5I2IA 5HVWA 4GQQA 4D3CH 1PYWA 4A21A 2AI0L 3MA9L 2GG1A 5G1YA 1UT2A 1XLFA 1OCWH 3NJKA 2WWKO 5HNNA 3STZB 1KA9F 3QB7C 4LSUH 2CO7B 3VI4E 3RVWC 3ZVVA 1IKNA 3S3GA 3Q8EA 1FNLA 3UG8A 2ZUWA 4AM0B 1BQLH 3EX2A 2ZXGA 1DBJH 4LARL 3I02A 4WJ5B 1JV2A 5DJAA 3L7EB 1MG2C 3E0GA 1LWJA 5IJDC 2YWYA 1WISA 4B95C 4HKJB 2XH0A 1RJOA 4TVPD 3VSQA 3MYJA 4OBTA 4Q52A 2G37A 3QZLA 1I0DA 1T99A 4DKFL 1L7JA 5BRZE 3TYUA 3AVEA 3H3BC 5GGSA 4JFEE 4NQDB 2Z91B 4M61A 4LUJA 3QC0A 5DEFA 4BQ3A 1NOFA 1UMLA 2R23A 2YOCA 4LASH 3BEVB 3J2PA 4X6CF 4WU7B 3MHGA 4P5TC 1J8KA 3HPSA 1NARA 4MVAA 1GKPA 2WINA 1SZRA 4OZHB 1QTSA 3MRMA 5C54A 2DTML 2NNXA 3B7RL 1KR1A 3I9GL 1JUFA 3S4SA 4P46C 3T09A 4ANUA 1MNZA 3EOAA 2MOGA 2EC9T 4O2EB 1E9YB 3O6AA 1U8MB 4NWTH 2HT2C 3UH8A 2X4SA 3U57A 4YE4L 2YAQA 4HHAA 2QPUA 1UQSB 3BO8B 4X8CA 4M7KH 1C7SA 5KS9E 3CDZB 4AX6A 4JTQA 3CC5B 4EN3B 3F5WA 2EDLA 4RL3A 4N0FB 1AGCB 1ZQ5A 2VSKB 2D03H 4ERAA 3WVFA 1Z9NA 4L6HA 3TO4D 1OLLA 2D0HA 4LVEA 1U95A 4HV8A 5IVZA 3LKSB 4WTZA 1UB5A 2BSRA 3TV3L 1GZ1A 5ENWB 4XD6A 1DBKL 4NENB 2Q1FA 1E4WL 1BSLA 2Y07H 3L2LA 3BKYL 1JF1A 1IEWA 2UY3A 4PRBA 4HJJL 1O94A 4HSAC 4NJAL 5JXEA 2A9NH 4LAQL 1U1JA 25C8H 1EDHA 4I9JA 5FEZA 4ODVH 5IHZB 5IB3B 4DPBX 3GS6A 3CZLA 1ZV5A 2WV8A 4DKAA 1NBYB 3LXCA 1QR7A 2OTWB 2GIMA 4UOZA 4JPVL 4MAYD 1P5VB 4E4UA 4TO8A 4M6UA 5IB1A 2NXZB 2NWRA 1LOLA 3MO1B 2R24A 3LKRB 3C60C 1AR2A 2IIJA 2MCMA 1AS6A 4ZFCA 3W2LA 3BS6A 2IPGA 1YNPA 1JUEA 3MU7A 1XH0A 2I16A 3DETC 2VDRH 1ZA3B 2C19A 3RAJL 4N2BA 3PUOA 1FCQA 4PCTA 4NG3A 3BQUA 4P23D 1YX1A 2VLRB 2NR6A 1H63A 3DDMA 4PMDA 5EPMA 1E0VA 4MWAA 2ZC8A 1RMFL 4BQBA 3NR0A 3U4AA 1EPFA 2X6CA 1MXDA 2OMWA 3BFQG 2J71A 4HK3J 5G5DB 5FUZH 4QRQB 3MRLA 5CKGA 2HJFB 5F4XA 2YMTA 2XN1A 3MO7A 3TLRA 5D7IF 4KMLB 1RZFL 43CAA 3V9EA 4AMWA 2WZIA 1S5WA 1XWYA 2HVKB 5FYJE 3MRFA 2WVTA 1WNOA 1Z6JT 5D96B 1N26A 3VI3B 1TELA 3UJIH 4JTEA 1DVYA 3TF7C 3L9YA 5HBBA 1SSDA 3VJ6A 1IO4C 4G6KH 4FYTA 1IILE 2VAAA 2VITB 4XGZB 3ZE0E 4TSAL 4JKPH 1QOPA 3DYPA 3RFZB 5FA5A 3CJJA 3B9KC 4N24A 4KK8C 1QVBA 4L8BA 1DJYA 4ELKA 2ZE0A 3JV4A 2WJFA 1ITBB 4OIAA 1AL7A 3DVGA 5DD1H 1SU5A 5JPNC 3HG0A 2NYKA 4KXBA 2B9AA 4IRZH 1QLEB 3UYIA 3BZEB 1S7RB 5I6LA 3MJ8B 4XAKD 1U4FA 1JWSB 5LJYH 3OJ2C 4O02B 5DQJA 1OGBA 2J8UA 4OKDA 1M7JA 2B81A 2RQ8A 3AICA 1A5SA 5SWZE 1T03L 3S5YA 4Z0BH 4QDMA 3ARDA 2G4JA 2Z2BA 5AYQA 5JHLH 3KDOA 5I8KL 1UH3A 1ZGLB 1DWIM 4CVXA 2QF7A 2Z7KA 3CH0A 1HJQA 3TBSB 1P7KB 2CGRH 2FVLA 4KI5D 3FQNA 1XO8A 1UJ3C 2E25A 1AJ2A 4LLWA 2LFGA 3DIDA 2F6AA 1T7VA 4MYXA 1WGOA 3NIGB 4W8AA 2BHZA 2YJQA 1PPIA 2PP7A 4JFZL 2AS5M 4Y16A 3K72A 4B3KA 3TJIA 3SGDH 1FBAA 5MENA 4L1TA 1MFMA 1LEKA 5LQBL 5HR7A 2ROXA 3IYLW 2N1TE 4WV1C 2G3XA 1RA5A 1D9KC 1HWGB 1UKOA 3UGRA 3POCA 3ARGD 1ZJIA 2WV3A 5HP5A 4JHAH 4R26H 3ZRFC 5DD0L 2LGNA 1S46A 4A1RA 3L8QA 1CBGA 3WNJA 4X0KB 4PWHA 3QJVB 4YTUA 1A6ZB 3UW6A 3V6FB 2Y6SD 4ZNCD 2UWEF 4R90H 4GNKB 4NJGA 4ASTA 4AK2A 1K4DA 4RAUB 3MLSH 4NKDB 5DMYA 4TX9A 1TCDA 4N8VG 4OD2A 2XSKA 4FMKA 4F93B 4AW7A 4M24A 4CEXC 3SGKA 1RK0A 2CR6A 3OR7A 2NYYD 1A7RL 3GINA 3Q6GH 1D6UA 3GSNH 3JWOH 3AY4A 4X80H 4A8LA 4ECNA 1ESWA 2D2HA 4JQAA 2J6EH 2YGNA 1IGIH 1A49A 4NZRH 1PJ9A 1U3JA 5DVKA 1DDHB 4PU2A 3TASA 3C86A 2WXHA 2DUXA 2D3VA 2W95A 1KTLA 3AT8A 3O3DA 5KEZA 1CBVH 4NJJA 4OZ4A 3RNKB 3CXHJ 4KUCF 1T83A 2ZT9C 3GUTB 2DQWA 1XGPB 2PW1B 3ELFA 4ZQCA 2DZTA 1CGTA 2BCKB 4G80A 4QDWA 3AACA 4LBRA 4FQJL 1J96A 2PW2A 4GJJA 1FG2B 2YSWA 1E1FA 1YECL 1OZUA 5F0MB 3P7YA 2YL8A 1FRGL 4BEUA 4JHWH 5CJXC 1WFTA 4M1DL 2KZKA 1YY9D 3IK4A 1L3NA 4OIFA 5J13C 4KGJA 3OLEA 2G95A 2RGSA 2GK2A 4LE8A 4FXJA 3QQDB 3KPMA 4LPCA 4EPSA 4D6DA 3QXVA 5IQMA 3AXIA 1YEEL 1D5MB 4UAOC 3TBVB 2IFFH 2G3MA 5C0IA 4DVRH 3WQFA 4WU5B 3LNHA 1DN0A 1X6UA 1VZWA 1MNSA 4KHXH 4KETA 4NNXA 2ZCLL 3R8BB 1BXAA 3L5WB 5CJBA 1LO5B 5JLZB 1PQZA 2GY5A 2VLKE 2WJEA 3IJEB 4UBPC 3IJIA 1U3HA 4FYRA 4N2NA 3LJ3A 3MRDB 3KL3A 3F7YA 4HCRH 2J55A 1F1AA 3UWUA 2LU4A 2KZ1B 3B3IB 4XP9L 3OBEA 4YLCA 4K7FB 2HVBA 4HU8A 3U1SL 1IBBA 3VWJC 2C1PB 2WBGA 2CHOA 1OL0A 4W6YB 3PGFL 5BMFH 3Q44A 2PCFA 2R2CA 1PZ5B 1TCRA 1UWYA 1A6VH 1KMGA 4I5BA 1TJMA 5I8OH 1E9OB 1PNDA 3SPGA 5F9WC 3U4BL 1QFEA 2X0YA 3W53A 3W2UA 4TULH 2GFBA 2ZKHL 1RUMH 3FB7A 4G56A 4H26B 1MYRA 1CE1H 3EKGA 4LUTB 5C2BL 2DQJH 5AENA 3ZHNA 4ZUSA 1GONA 4RBPH 4LLQB 4MA7L 1S7QA 1SOXA 3U7WH 1ETZA 3P81A 1A0CA 2OLSA 4P05A 4ODUA 1MNUH 4B97A 1AP2A 1BIIA 4JNMA 4FTVD 5I1HL 5CJ8A 3NOYA 4HC1L 4NQDE 1U91B 2ZZ7A 3ZSSA 4PGZA 4HLZH 4C4UA 3LRSA 3QFJB 3OZMA 1ZRUA 1ZCOA 2H3NB 3WNLA 1FWNA 1VC4A 3M0LA 4HCIA 4RCAA 4OZHE 3BVTA 4Y1TA 1ADQH 1RZJC 4WK4B 2QCLA 4MMXA 4PJFF 1QWGA 5DX7A 4RQQA 4BF9A 3QIUA 2ZOLA 1DLFH 2AK1H 5FYJH 1CGUA 4XPHH 3QQ9C 2HPMA 1AO7A 1SJCA 4ZUTA 4LEBA 1NQKA 2UXVA 3OQ8A 2E6QA 4WFFE 1SUJA 1IE5A 2X70B 1QT1A 3PPCA 3O4LD 3CT2A 2GITB 3ZJ8A 4I7ZC 3GXNA 1LVNA 4WO4D 3IKCB 3MMTA 1K8XA 1URZA 3DUHA 3SKMA 1VYRA 4XNXL 3DUSA 4Z3HA 2ATPB 2CM5A 3Q65A 3UTTB 4BCZA 1NCOA 3BUDA 1IVXA 2R7EB 5I5IA 4R7XA 2NY1B 4WTWA 3EEZA 2HA1A 2Q0ZX 1NDGA 3VX1A 5BJTA 3M1CA 3LQMA 3LCLA 2YQBA 3MLYH 3O9NA 2XSXA 4F2UA 4LOUC 3QW3A 4G82A 1AJZA 2X2UA 2G3ZA 1F1SA 1IC0A 1DE5A 2OJZL 5AW2B 3OB0H 1IAIM