4FNQA

Crystal structure of gh36 alpha-galactosidase agab from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
727
structure length
723
Chain Sequence
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGSRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGIELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKARGHVAMSGNFGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaB
total genus 230
structure length 723
sequence length 727
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnqA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnqA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnqA02
1W1ZA 1ZHAA 1RVGA 4AEFA 5HXMA 1HO4A 1TQVA 1G1YA 1ICSA 2YR1A 3UPWA 1S46A 3TMLA 3MP5A 2WSYA 4W9TA 4LVDA 5E6YA 2BSLA 4NX5A 4NQ1A 2WV8A 3P81A 2F7RA 2GJRA 1JRBA 1VHCA 5CZSA 4DO6A 1KM1A 4IQLA 4M5PA 1OFAA 4CQ9A 3E0IA 4FLRA 1OX4A 1TTJA 1PIGA 3G24A 3QW3A 4EF8A 1V3JA 3L2LA 3A47A 1VRDA 3N3MA 3W2NA 1QX1A 3NOEA 3LPOA 2YW4A 4B9ZA 3M9YA 1W3NA 1PV8A 4MFEA 6TIMA 2D0FA 4ONVA 3SI9A 3W72A 3WK3A 4LVGA 1PIFA 3K8LA 4OV9A 4O4WA 2YFNA 1MXSA 3VKJA 3Q94A 3UZ5A 1OABA 2D2OA 2VELA 4MKNA 4RZ4A 2ZE0A 1TJPA 2QAPA 3LXBA 3KLKA 4HOWA 2P1FA 4ADSA 1F6PA 1O94A 3TOPA 1G4TA 4FLQA 4LY8A 4B9YA 5EYWA 2XWEA 3P80A 3LX9A 1BSIA 4AEEA 1KM5A 1QAPA 3M16A 2YA2A 4JL1A 3SGZA 3ZSTA 2H90A 1M7XA 2RDWA 5MHBA 1IIHA 1E3ZA 2AMGA 1NAL1 4UFJA 1I2RA 3N9RA 4FX8A 1NEYA 2QCDA 3K8MA 3UWWA 5HDRA 3T4CA 2HTMA 4Z1AA 3B0VC 3FKKA 5K3VA 1W0MA 4FNPA 1WZKA 3QPYA 1WPCA 3TA6A 3ELFA 1IXOA 3L5LA 3LCXA 4O14A 3S42A 1ODUA 1PL9A 2D0GA 3DFPA 1D9EA 2VUYA 4UR7A 3IVTA 2FPTA 3W2KA 3DKLA 2GQ9A 1TRDA 1THFD 1M7PA 1HFBA 3N14A 3HG3A 4PA8A 1HNYA 1KCKA 2YCEA 2ZZ7A 1E3XA 3WDJA 1H7PA 3L65A 3LTSA 5AYYA 3QSRA 5KZEA 4DELA 3LI1A 2E8YA 2JKPA 4FO4A 4GI9A 1JCYA 3LV6A 3BLIA 3GXIA 1QR7A 1OT1A 2IQTA 3BAYA 3QC3A 3ZS4A 3GNDA 2ZX5A 4IGHA 4OWGA 3W7NA 4PEEA 1G69A 1VCGA 4MB1A 4AIOA 1I2NA 1LOQA 4MLJA 1GPWA 1J0KA 5CLTA 4BI6A 2ZXQA 2OW7A 4OT7A 2YOCA 1ME8A 3VGDA 4AW7A 2V2HA 4J3VA 3BVJA 2Y6ZA 3MBFA 1KW1A 5DCDA 1KGUA 3WN6A 4NJKA 1LYXA 1UA7A 3L0NA 2V5LA 5TBOA 1OSEA 1F73A 3KXQA 4FX6M 4H7VA 2V5BA 1CGWA 3EB2A 2ZZ2A 3GXDA 4WQ6A 5EMUA 3W73A 4HHPA 4E0CA 2DP3A 3BK0A 1H5YA 4Z08A 3P74A 4DO5A 1YADA 1KFKA 1YDOA 5G4EA 3BCFA 1HL8A 5DY2A 2OYKA 3WK2A 3TCEA 3ATYA 1EO7A 3W1PA 3F4NA 3BUBA 3ZSSA 3OLEA 1D3GA 4BWLA 5KZMA 4PTNA 3BVTA 5HR7A 4UTWC 4GUHA 1UB3A 2X16A 1SO3A 4GQQA 3RMJA 1JI2A 4UIOA 5K9XA 2Q3OA 1AQHA 3B0PA 2Y2WA 1L6WA 3O6YX 4UMCA 3ZWSA 2FYVA 3W07A 4GUIA 4IPIA 3BCDA 3EDEA 4LS0A 3HOJA 2EO7A 1P6WA 1XH0A 1QOPA 1PVNA 4MPQA 5CSRA 4Z0SA 1WE5A 4AMXA 1TPFA 3EDKA 3CT7A 5LKYA 3SGUA 4NJGA 2EADA 3NM3A 2YKKA 4UCFA 5I0DA 5C6MA 3M0ZA 4RXFA 4J27A 4UUIA 2JKAA 1K8YA 2YDAA 4GFSA 3STFA 3KL5A 2ZZ6A 1JQXA 1XBVA 1OFOA 5KSWA 5A2CA 1J0IA 5K9DA 1LORA 4KMQA 4IX0A 5AYZA 3I68A 1KXTA 2XIBA 3CV5A 1G7VA 4X2RA 2NSXA 1JVNA 2Z1KA 1SW3A 1K8ZA 2B7OA 1WZAA 3LCFA 3O06A 1OYBA 3II1A 5CG7A 3BLPX 5BMXA 3NR0A 3K1DA 4M6VA 4IJBA 5G4WA 1H51A 4FXRA 1PZ3A 3BVXA 4UFKA 5HR6A 4NJJA 3M47A 2P10A 2OSYA 3P84A 4PSRA 1PPIA 3QSTA 4GIAA 4UFIA 2E5CA 4JFVA 3KOFA 2QLYA 5DBTA 5AC8A 2J6XA 3FA5A 3MMTA 4WOZA 3DFSA 3E12A 1KLYA 4ZQRA 3N2MA 2FB3A 1EA9C 2J24A 2EF9A 5FF7A 3M07A 1B57A 4DQWA 2C18A 3BW3A 4PFMA 3VSTA 1Q6RA 1SO6A 4FHAA 3S8HA 1Q3NA 4CN1A 2V3FA 5AHEA 3GXTA 1DJNA 2V9DA 4TMBA 1F7BA 4IMCA 4CGTA 1H1YA 2BHUA 5HJLA 3DGRA 1FUYA 4UOZA 1RR2A 1W5NA 5TQLA 3N73A 4KFOA 1OFPA 2A0NA 3E02A 4CQ8A 2BLEA 5I5RA 1IZJA 4Z1BA 3IK2A 3B03A 4P2VA 1RPXA 3ECQA 4Y9AA 1U30A 1GVFA 3P67A 4TIMA 1ZAHA 2QAFA 2GJLA 1CGYA 1GJUA 2V2CA 3BV4A 3PC0A 3LTYA 1NOFA 2ATSA 3DI1A 1XH1A 5HWJA 3I6RA 5CPLA 1MW1A 1XD0A 1JXJA 3VSVA 5AHMA 5D38A 3K8KA 2W6RA 3GXMA 2VFEA 1A53A 3TSBA 3MYOA 3U2OA 1OFRA 5G5IA 4OE7A 2F1BA 1W3IA 1VGAA 2C13A 1JDAA 2PCQA 3BGGA 3CWOX 3EWWA 1LBLA 3P62A 2J25A 4GQRA 1EP1A 4LUJA 3CQ0A 5LNUA 3NQ6A 4BF9A 4JX4A 4XKYA 4CKQA 3QMTA 2E77A 4LV4A 3NQ8A 3P5YA 1Q4NX 1A47A 3CM4A 4JYFA 3EJPA 2X2GA 5LHFA 1PEZA 1DOSA 2C0AA 3MHUA 1GTHA 4UTMA 3PG9A 4LVFA 1OFDA 3LXAA 4DF1A 3CEPA 4KWVA 2ABAA 3MW7A 3BUPA 3BAIA 1K02A 3DXIA 2VFGA 2E5DA 1Q45A 1S5WA 3LHUA 1HX0A 1J0JA 3W23A 2CLIA 2FIQA 5TD4A 3D0CA 3HGSA 4NNAA 1Q6OA 2GJPA 5G2WA 2HMCA 1B0IA 1W9XA 3KVLA 3L4XA 3T7VA 3FAWA 3OG3A 1JQVA 1B3OA 1PJ9A 3I7RA 4IMFA 2P0OA 2R8WA 4JDYA 2ZUVA 3KVJA 3MI3A 2A4AA 1H62A 4NX0A 5L9FA 5EKYA 4PCFA 1XSKA 3EWYA 1BPLB 4XBSA 3L2IA 3UNDA 3PULA 5HQEA 3CLWA 2Z6JA 3L4ZA 3QMRA 3G1FA 3FKRA 4QM1A 3SIZA 4HA1A 3GDKA 1HWWA 3CEUA 2BY0A 3TH6A 4UQEA 5I23A 2C15A 5CZTA 4CCEA 1UH3A 5LHEA 2F1AA 1KV8A 3FFSA 4ADTA 3TNOA 3EJUA 3C4UA 4ML9A 4S2CA 1DEDA 3B0UX 4FIQA 1ZS2A 2C7FA 3WK0A 1TQSA 3MHGA 5H2ZA 4QISA 1G67A 3USBA 3Q58A 5AC6A 4WJEA 2QJGA 3BC9A 3LGEA 3TIMA 1H7RA 3P82A 4GC4A 2NXHA 3W7LA 3LLDA 2A5HA 1OYAA 3C2FA 5I24A 4O16A 2WNQA 5AC7A 3NQEA 2CLHA 4BZYA 3WENA 3DFQA 3FYPA 4O10A 2ZBTA 1TPDA 3OLIA 4JIQA 3W7DA 3TK7A 4CVWA 1E51A 1EUNA 3LCIA 2E68A 3CZKA 1AMKA 1SUXA 4UQ9A 1WDWA 2FPYA 7CGTA 3W84A 1CXIA 5E93A 4IWWA 4ZQMA 4RK8A 1MO0A 2XVKA 1SR9A 3CTLA 5IM51 3ZQ9A 3FJ6A 3BAKA 3RNDA 3PBVA 2PRLA 1F74A 1PHWA 1SZGA 5LZLA 3SR7A 3P61A 3W76A 1QPNA 2NX1A 5CZ0A 2FHCA 5LGXA 1IF2A 1TQJA 1UD2A 4LWWA 2CPUA 1VYRA 2Y63A 4CLMA 2E5BA 2Y62A 2A7RA 5LGZA 2YA1A 4DEFA 1P1XA 4YLWA 1F5ZA 2QMJA 1WZMA 4S2BA 4M19A 3FAXA 3HB9A 4UQCA 1N55A 5K4XA 5KMYA 1KGWA 3QMSA 3DC0A 3NA8A 4WUIA 1R30A 3CTTA 1FWTA 3MI6A 1KBJA 5F4WA 4AWSA 5E9AA 1KFLA 4JFWA 1OK6A 3BG5A 3LTPA 1P5BA 1TTQA 4GKLA 2WVVA 1A50A 1G6CA 2ZCGA 1TQXA 1SSDA 4FB7A 2FHFA 3RILA 3VSUA 5SWUA 3C2RA 3UPBA 1OB0A 3TU9A 1KWKA 4N9CA 4QAWA 1KM4A 2Y85A 4UTHA 3GX9A 4N4QA 4WOQA 4TR9A 4NXKA 3E49A 4D2JA 1SW0A 1S3HA 5AFDA 4OHQA 1FDZA 3W86A 3WDHA 4JCLA 4PSPA 4YCPA 3EX3A 1TCDA 4XQ6A 1I2QA 5CGTA 5D09A 3LHZA 4J7RA 4QQ3A 4HNNA 2X2JA 3U6WA 2ZYFA 1QWUA 2ISWA 2EJ1A 2PWHA 4JFUA 1UD3A 3A5VA 3BG3A 1VLIA 1RP9A 2ZZ4A 4UNIA 3LRMA 3NQ2A 1CXKA 3NQVA 1TV7A 2OSXA 1MW2A 2ZA3A 2WSPA 5HULA 5HNRA 2HSAA 2VKZG 3W7CA 1DBTA 5F1UA 2YX0A 2H8XA 1HXKA 2I9EA 3SJ3A 1I75A 4JN6A 4EIVA 1E40A 1KXVA 1X7FA 3EX4A 4JYDA 5ABTA 1CYGA 3BPWA 1LWHA 1XSJA 1M6JA 5CZJA 1JCXA 1R33A 4K37A 5F2IA 3NZRA 4U28A 4NJHA 1VPXA 3VI2A 3FW6A 4J28A 3VGFA 4AMWA 3GDRA 4A21A 2VEMA 3OBKA 4WY0B 3HJEA 2QR6A 4GI6A 3G0SA 5DLCA 4MZYA 2G97A 4Y8FA 3HGRA 1TPEA 1WQ5A 4O57A 1EHAA 1CW2A 1M5WA 5F7UA 2JGQA 1X1OA 1UD6A 1WV2A 2TRSA 3KWXA 1ADOA 2VFFA 1SO5A 4R53A 5HWNA 3TXZA 1OF8A 3RK8A 4X9YA 3W83A 3GYEA 4WY0F 4U31A 3WEMA 2QPSA 3FIGA 4O4VA 4MYXA 2VR5A 1PS3A 4K36A 4XKYB 1VB9A 4K8HA 4LC8A 3HPZA 4LS1A 1FCBA 1V3MA 1YTKA 1MEHA 4HNVA 3BSGA 1QWGA 3GNNA 4XWUA 1TPH1 2QCNA 3G8RA 3BW2A 3WNMA 2FFCA 3FOKA 2YIHA 4B5NA 5A2BA 4MY9A 1IXPA 3P8IA 4O0KA 3SZ8A 2YW3A 3BAJA 2BXVA 3C8FA 2G95A 1VFUA 3LPPA 1TPC1 3EDJA 1Q6LA 3WFZA 1D3CA 5FF3A 3DHPA 2PE4A 4JTJA 4O8RA 2CU0A 4UFLA 2XVGA 2YXGA 4UZSA 3VE7A 3NVTA 2W79A 4QJ1A 4LXFA 2ZXBA 3HPSA 2XFWA 1QWNA 1JDCA 2Q8ZA 2FLIA 3W1UA 1C8QA 4UTIA 5C55A 4AMAA 1JIBA 5EL1A 2J88A 1XV8A 1HL2A 1NSJA 2G3MA 3UERA 5E1QA 1G7UA 1UH4A 4JEQA 3L2MA 3ZT7A 3LLFA 1SZEA 4DO4A 3KVMA 3W7OA 2QV4A 2QJHA 3MP3A 2PC4A 3O63A 4UNLA 1R46A 1VR6A 1H7WA 4N9DA 5DCBA 3CZEA 3G1YA 3MWAA 1Z42A 1G4PA 3GDTA 1MXGA 4HN4A 3C56A 5TIMA 2QDHA 3NAVA 2D0HA 2CZFA 4A22A 2A7PA 3UQNA 5E0FA 3LERA 4ZVJA 1B9BA 3SW6A 3VGBA 2GVLA 3S6DA 3LXCA 4GXMA 4Q32A 5A8GA 4YXGA 4Z0JA 3EWUA 3DFOA 2CZ5A 4PEKA 4QAIA 1F6KA 1WBHA 3OVQA 2WQPA 3T55A 5EY5A 1OK4A 2VENA 3IIZA 1L0PA 2GUYA 1SU5A 1LZOA 1TTIA 1RQEA 2Z1BA 4I9AA 1YTDA 2CZDA 2V81A 4XTIA 3A9IA 4JNMA 3O16A 2ALDA 3W7HA 4WSJA 3NXFA 1LBFA 2WANA 3HG5A 3KEHA 5D2XA 3WJSA 1WX0A 1MZHA 1WOAA 3DHUA 3W75A 1OFEA 3OLGA 1XBYA 1M7OA 3NO5A 1LOSA 4HIBA 3C2OA 3GXFA 3R89A 2OYLA 4LVAA 1VJSA 4HP5A 2CHNA 1YXDA 3VO0A 4MLRA 1MFUA 1ZCOA 2FDSA 1SW7A 1JUKA 2ZXAA 3DX1A 3WJYA 1LLWA 3CZLA 1MW0A 1IV8A 3R8RA 3BVWA 1WYIA 4ZQNA 3W71A 1EA0A 4P61A 1LM1A 4WZHA 3NYZA 4UTWA 2IGTA 1UKQA 4KKXA 3HF3A 4ADUA 4O53A 3KL3A 5FEZA 2GVGA 5FEPA 1CGXA 4GRSA 2F7QA 2WJZA 1FWWA 1VLWA 4BI7A 3LV5A 3E96A 4JCMA 3BMVA 1F05A 3L5AA 3A23A 2PURA 3K30A 3ABSA 3EXTA 5F4XA 3S5ZA 2BTMA 3WJWA 4GI8A 3UG3A 3UYCA 3KRZA 1OHLA 2FH6A 2HS6A 3PUEA 3TQVA 2AAAA 1W5MA 4LTSA 3IIPA 2DH2A 3GIYA 3IGUA 2C19A 4JGDA 3TR2A 1OVDA 4X3ZA 6TAAA 3NEVA 1FQ0A 3O15A 1ZAIA 1H60A 3THAA 1AW5A 1XUUA 4TVUA 1U2YA 1L9WA 5F1VA 4R34A 2EACA 5U4NA 1IXNA 3D4ZA 3QGVA 3VMOA 5BOOA 3NPUA 3EDDA 1YPIA 2DZUA 3B4UA 1UA3A 5BRPA 1LBMA 3TQ0A 1IIGA 1XI3A 3PBWA 3NPVA 1Z32X 3KX6A 1MEIA 4FIRA 4UMBA 4Y96A 1LRNA 1U5JA 1TPB1 3M44A 1UD8A 4JL2A 3BUIA 3P7YA 4LPCA 4UTTC 3NQGA 3PSVA 4LV9A 3A4AA 4JTTA 3OVPA 3MYPA 4UTTA 1FDYA 2JBMA 1S5TA 2QPUA 4JR5A 2FHBA 4KWWA 4WLCA 1H7XA 1CX9A 4FMVA 1K7XA 3GZ3A 1TJRA 3A5FA 3JR2A 3SECA 2TMDA 3C3NA 1JDDA 3BH4A 1JRCA 2WOQA 2CLKA 1TCMA 2ZRYA 3P60A 3RU6A 2QJIA 3UWVA 2WCGA 4GJ1A 2X2IA 2ZX7A 5E70A 2ZDRA 3S1WA 2A85A 4MUZA 1VAHA 3BLBA 1XBXA 4AHOA 1O7DC 1H63A 4IMGA 4IPJA 1MSSA 4WY0A 3W6YA 3HZ3A 4I7VA 2J9ZA 4Y90A 3GTNA 3W1MA 1BKSA 1TYGA 4RKAA 3S1UA 3M5ZA 4J3SA 1I4NA 4LNYA 3L4TA 3GK0A 3FS2A 4E2DA 1E43A 2ZX8A 2VFDA 3BG9A 4ORIA 3EWZA 1C8VA 3IVSA 5K2ZA 1PCWA 2DZTA 4FNQA 3O05A 3EEGA 4CNPA 1ZY9A 1U83A 2QUUA 5IBXC 4RV8A 2TAAA 3N2XA 2QMKA 1BVZA 4TX9A 3O8AA 3CIWA 1FWSA 3BSHA 4GBUA 2E8ZA 4GO8A 1DQWA 3PUDA 2YYTA 2CFFA 2GQAA 3STCA 3W7JA 2V8ZA 1L6SA 3WELA 2E6FA 2WSRA 2Y61A 1VZWA 2OJPA 4UTJA 1QNVA 3W7EA 5BRQA 2BWGA 4YMZA 2DH3A 1RV8A 2YJQA 2X2HA 1ZJIA 1VH7A 3DKJA 4O50A 4POCA 3CWNA 5F2GA 1BWLA 1LCOA 2VEKA 4CN6A 2EAEA 2EEXA 2GPTA 4YCOA 1IXQA 4OIFA 1DQXA 1GG0A 2OX1A 3CIXA 4O18A 2QCLA 1XM3A 4O17A 5LNSA 1GVIA 2QCDB 3TW7A 2TSYA 3W1XA 5AB3A 2FB2A 5I3FA 8CGTA 1TV5A 3H55A 1G4EA 1EB3A 3M5VA 3N9SA 3AJXA 3WY2A 3UG5A 1KB3A 4HOZA 3MBDA 4MZ8A 1AQMA 5CPNA 1H61A 4HSOA 1UCWA 4HPHA 1KTBA 3NDOA 5DELA 1T8XA 2B0MA 3M5XA 3PSWA 3TFCA 2E4TA 1WOBA 1X1ZA 3W22A 4O1DA 3KAOA 1H3GA 3S5OA 2C8NA 4NNBA 2BX7A 4OV4A 1XSIA 1SPQA 2VEPA 7TAAA 1T0OA 2Z2UA 5D2WA 3D51A 3W37A 3PG8A 1TQWA 1JF6A 3IEBA 2ZRZA 4H4IA 4J3XA 3OLDA 2J9XA 4NJIA 3CPRA 3WJXA 1QFEA 2FPVA 4L4MA 5EA9A 3WFAA 4EWND 1KFCA 1OX6A 2NXGA 3AO0A 1TPVA 1PZ2A 3HJZA 3TKFA 1G9HA 1UKTA 1SFJA 3VFLA 4BR1A 3GKAA 3KVKA 2GOUA 3F03K 3W3OA 4A29A 1CXEA 4AYGA 2JGYA 3JRKA 1LDCA 3WNPA 5D2VA 4WF7A 1P0KA 3QQ0A 3EJQA 5LNRA 5CLWA 4MIMA 3MUXA 1GEQA 1GVSA 3UWUA 1P0NA 2R94A 1XCFA 5FEXA 4O19A 3P5ZA 3BMWA 2C16A 1T96A 5HINA 3BAXA 3DAQA 3B06A 2PWEA 1A5CA 1OYCA 4R7JA 2A6NA 3NM1A 2XIIA 3N34A 3W1NA 4IMEA 3O1NA 4O12A 5KZDA 4RR4A 4N6EA 3L4YA 1Y0EA 3OEXA 4TMCA 4O28A 4FXSA 1CGVA 4O1BA 4RZ6A 2ZZ3A 7TIMA 1W8SA 3EX1A 4MVAA 3VGHA 4N4PA 4QSHA 3WJZA 4QIUA 4WXZA 1JULA 2GUUA 1ICQA 3HPXA 1KXHA 3CZNA 1KWGA 3W85A 4HNUA 4LT9A 3TJXA 2Z0IA 2A7NA 1J2WA 4ORMA 2JKEA 2WVSA 1ME9A 1YPFA 2QCCA 1I8JA 5L6UA 4UZUA 2NT1A 1JD7A 4UMAA 5A5WA 4AAJA 2EKCA 4NXSA 3HG2A 1O60A 2Y24A 1VYSX 3T78A 4R33A 3GBEA 3IV3A 1BVNP 3W1AA 2FE0A 4I7UA 1JI1A 5DO8A 1QOQA 4UOQA 4FLSA 3G1AA 3I7SA 2ZRVA 3NPWA 4CCDA 3GDMA 1WO2A 1FBAA 2WVTA 3DU0A 4JYEA 5CKSA 5FF4A 1EWDA 4JFSA 1C29A 3WNLA 2QCHA 3TSDA 4GE8A 3EWBX 1UH2A 3RF9A 1VYPX 4S1FA 6ALDA 3EDFA 2Z6IA 4JD4A 1EWEA 2OMAA 1DJQA 5DBUA 4JTFA 4BI5A 3DDGA 3GAKA 4RJEA 1W56A 5I3IA 3W87A 3M43A 4JDBA 4RLIA 3NL3A 1R2TA 2BXYA 3LRLA 2YGYA 4NVTA 5F2MA 3ZR6A 1GVOA 3W2JA 2F61A 3NPXA 3PF3A 3DBPA 3DX3A 4DPQA 1OJXA 3IVUA 2XN1A 2QCEA 3DX0A 1HL9A 3L67A 4N9BA 4OBTA 1CIUA 2B4GA 2QCMA 4K6AA 4FNTA 1UOKA 1GJWA 1W37A 1W5PA 2V2DA 1IZKA 2ZTKA 2G5WA 4O52A 2E0PA 1I2PA 3BLFA 3HQ1A 2QKFA 4U2ZA 2DU2A 3R2GA 1UJPA 2ZICA 1ALDA 4M7SA 1Z41A 4O15A 3GB6A 4PL1A 3V75A 4GINA 2V3DA 3UCQA 2Y7EA 5E0KA 3WK1A 3B8DA 5CXPA 5D03A 2H8ZA 1UUMA 3C2VA 5D33A 1VCFA 5I3HA 5DXXA 1BEUA 4QNEA 2V82A 3W38A 3G0XA 5J5RA 2QUTA 1EP3A 5D37A 4CNNA 1XGZA 2BHZA 3CZGA 4E2BA 3LBCA 5G1YA 1K3UA 5GVJA 1JCMP 4C1KA 3HMJG 4UFMA 2VNCA 4NNCA 4XBKA 5CPOA 3O07A 3OVRA 3ZOAA 4YL2A 2G3NA 2TPSA 4LVBA 2DORA 3QH2A 4O1AA 3W7PA 3DI0A 3IJ8A 1CLVA 3DX4A 4LRTA 4OQVA 5LSMA 1VCVA 4UQAA 4G1KA 2V3EA 2ZA1A 5HPOA 2OCZA 3U8GA 1KGXA 1QI5A 3WY3A 3LCLA 4JTKA 3EJRA 2WPBA 1V3LA 1EX5A 4AVFA 1JL8A 6CGTA 3W7GA 3EJTA 1KFEA 1N8FA 4H6KA 4HNTA 2DIJA 4JTUA 2EGZA 2NUWA 5FF0A 3QRHA 3DHDA 4UQDA 2FGZA 1AG1O 2B7PA 4ZQPA 9CGTA 3HG4A 1QCWA 3YPIA 3ABQA 1V5XA 3HGOA 3S5NA 3L66A 2ZUSA 3DDFA 1XH2A 3LHVA 1TSIA 1GG1A 4J3WA 1MVYA 3O6CA 2AQWA 1Z48A 4IX2A 2FTPA 3W74A 4O1CA 3CU2A 3CHVA 3LCGA 1W31A 2X1RA 2ZRUA 4KWUA 2Y88A 1PCKA 1QMLA 5HMSA 3AMLA 1VC4A 4MJZA 1O5KA 3NQMA 1MFVA 1OF6A 1YXYA 4O0ZA 1UBSA 3M41A 1KM0A 4L4LA 5J5DA 3VMNA 4OGZA 3NL2A 4AYSA 3TMQA 1TRIA 4JTHA 2EABA 1XCWA 3G22A 3PR2A 3GBDA 2OSWA 4K7YA 4GWEA 4O13A 3DX2A 2VRKA 4PL2A 1ME7A 3KL0A 2ISSA 2TYSA 4J9JA 5G2HA 2ZFAA 5KINA 5H91A 3KE0A 5DFAA 4LW7A 3BGJA 2OZ0A 1OGSA 2VFHA 1LROA 3PY2A 5DN1A 2EQDA 1A5SA 4WX2A 3R5EA 3AXIA 3W1LA 2ZWYA 1XXXA 1N7KA 1H50A 1SO4A 3G1HA 5DXYA 3SFKA 1ML1A 3KLLA 3WNNA 3EJSA 2A2IA 3Q37A 1K7FA 2G96A 4AWUA 3NQAA 2WKGA 3HGJA 3MJYA 3PB2A 1KTNA 4CNOA 4DXVA 4M56A 3L21A 5KEZA 1NF0A 1PE1A 5FI8A 2PWGA 1GVRA 1OG0A 2CZEA 3S0CA 2DZPA 4M8UA 2DZSA 3BVVA 3GXNA 1VIWA 2W0UA 4EF9A 3G3MA 3W7MA 4AF0A 1JR1A 4NU7A 1QPQA 1JXKA 3TC7A 3M6YA 3FLUA 3GDLA 3W2UA 2NX9A 2WNWA 5EBUA 3C52A 3TJLA 2ZX9A 3TUUA 2QEZA 4UTLA 4MYAA 3LHWA 1B4EA 2EPHA 3L4UA 4FEZA 1I2OA 3CC1A 4JTIA 3W1RA 3BARA 1FDJA 1FY6A 5BMWA 1H7NA 3PVFA 5IBXA 3NQ7A 4I7WA 4M6PA 1R75A 5CSSA 1L6YA 3G1XA 5G2IA 4E38A 2BY3A 3GAYA 2E6AA 2ABBA 1EO5A 3D50A 3STGA 4BK9A 2ZWZA 2WNNA 5K7JA 1QW9A 2CLEA 3EX2A 1PAMA 3INPA 4X9SA 2C6QA 4MZ1A 2YA0A 3BAWA 1WP6A 5BRBA 1KTCA 1BAGA 3A6OA 2UV8G 1UKSA 1VFOA 2ZQ0A 4O54A 1PS9A 4JTSA 3NQCA 5D2TA 3LHYA 2ATMA 2QDGA 3CGTA 1EIXA 3DZ1A 1NFBA 2OT0A 2H3BA 3NZ1A 3LM7A 3EKZA 2ZXDA 1FWRA 2A1YA 4UTUA 5KTLA 3A22A 3T40A 1RPKA 3F4WA 1ZFJA 1KLZA 2ZTJA 3GR8A 3PM6A 1CXHA 4EOUA 2H3DA 4MFDA 3GLCA 3LI0A 1TB3A 1BWKA 2YZRA 4EVZA 3I65A 3NG3A 2NUXA 1O5XA 3GVGA 2BY1A 1CGUA 1W54A 1DKWA 3AMKA 1G5AA 1MW3A 3AJ7A 3L5MA 3SY5A 4OJYA 1QPKA 2E6YA 1TIMA 3A21A 4U2YA 4UFHA 4UC5A 2VC6A 1AK5A 2XN2A 1SSGA 4J3TA 2ZRWA 1YLVA 3PUOA 3LCHA 4N6FA 1SFLA 3GKFA 4IMDA 4DF0A 5BNKA 5FESA 2BY2A 4ZL1A 1AW2A 4ICNA 3LBMA 2Y5EA 2WPGA 1HVXA 3NL5A 3ATZA 4LOCA 3GXPA 3WNKA 1Q6QA 1U33A 2Y7FA 3JS3A 3M7WA 4XUGA 4BA0A 1HUVA 4IXXA 5D2YA 1YDVA 3O6DA 2ALWA 4MAZA 1QHPA 3UG4A 3FEMA 1KBBA 2RDUA 3S9YA 1WAUA 3G1VA 4Q4KA 2WNZA 2XVLA 1XFBA 1XKYA 1K03A 2PWFA 4RCXA 3WNOA 1EUAA 1SZFA 3W2LA 1FCVA 1A5BA 5EPDA 1ZALA 1SMAA 4K7VA 2V30A 4WD0A 1R2RA 4H8UA 1JJKA 2EHHA 1FXQA 4GUGA 1XCXA 2F7PA 3PS7A 5AHFA 4DBEA 1G94A 3TQKA 1XUZA 5D30A 4X22A 1W3TA 1XC4A 4MOZA 2DZVA 8TIMA 3VGGA 3VE9A 4HSNA 3G3DA 3CPUA 4PCTA 1JAEA 2B7NA 2C1HA 3S5YA 4PC8A 3PB0A 2A6LA 4UTKA 2WC7A 4GUJA 4CN4A 4ZZ9A 1Z44A 3S1VA 4JX5A 1NM9A 3UXAA 2WSQA 4IXHA 5BW6A 4O11A 2AGKA 1LTDA 2BHYA 1C9DA 2FH8A 3MI2A 2HS8A 4AHQA 1G4SA 5I3JA 2Y4SA 3H53A 4NUWA 1DV7A 2VEIA 1PHQA 2NXIA 3DHFA 2DJLA 4U33A 4HPXA 4GNJA 3CB8A 1X8FA 3BO9A 4Z1DA 3VX1A 4NI3A 2GVJA 1QO5A 3IGXA 1NF7A 1DTUA 1YYAA 1RD5A 1AL7A 2XWDA 5AOUA 1H1ZA 4JTGA 3W1QA 1R2SA 1I45A 1KM2A 2OT1A 5AHLA 3B05A 3FYOA 1JCNA 3VM7A 4HPJA 2NT0A 4NZJA 3LB0A 4RX0A 1LOLA 4JX6A 1ZNNA 3TTYA 1EEPA 4UNKA 4Z1CA 4TO8A 3VNDA 2D3NA 4H8HA 3OHIA 3RLUA 3HO8A 1B4KA 4A2RA 1RP8A 1YTEA 2QF7A 3L0GA 3WY4A 3NNTA 1OFBA 1EH9A 1GJPA 4FF7A 4NT0A 1JG9A 1W5OA 4XZ9A 2NUYA 2C3ZA 3G18A 1NVMA 4U4MA 3TV8A 4Q33A 3HIJA 2J27A 3LCWA 5EMYA 2E9BA 4IOTA 1LWJA 2RFGA 2ZUUA 3A24A 1JD9A 3DENA 2QCFA 2I1OA 2J9YA 1GT8A 2OYMA 3V1PA 4DBDA 4K8EA 3DFNA 3TAOA 3BUDA 2E09A 4OU1A 1VQTA 2NLIA 3D4YA 4UXDA 5D32A 2A21A 2QCGA 2O7QA 4LUIA 4AH7A 2YFOA 4YWIA 3QJAA 1HT6A 3D52A 1TPWA 1KM6A 3VMPA 5C5YA 1VFMA 3QYQA 2VXNA 2VT0A 2BZNA 3WDIA 1DL3A 5AHNA 3KRSA 3TONA 2WSKA 1QI4A 3UWQA 5C2XA 3LOTA 2GVYA 3CZSA 2F7FA 3UEQA 3LDVA 3TROA 3W7RA 1TO3A 1TV8A 5D05A 2PRMA 1RZMA 1V7YA 2WVVB 5KITA 4GUFA 3W2MA 3L9CA 2FJKA 4AEOA 1CGTA 3VCRA 1CXLA 1J5TA 4ZQOA 1Y7VA 1JGIA 4W93A 1RQHA 2V0TA 3L0KA 3DFTA 4WSKA 3OIXA 4JTEA 3LHTA 4RZ5A 3UXDA 3IIVA 1QHOA 2CW6A 1HTYA 4AIEA 2NX3A 4C1LA 1XL9A 3IGSA 1O95A 4AHPA 1T99A 1KV5A 2C14A 1MWOA 1YDNA 5LNVA 3G0UA 4WXYA 1A5AA 4UQBA 3BLKA 1J4EA 2Q3RA 3NGJA 5I3KA 1ZENA 4OKDA 3G8EA 2DZWA 4M6QA 3STEA 3FJLA 1ZJAA 1QPOA 1ONRA 5D04C 4AWTA 3VU2A 3DH7A 1GYLA 1K8XA 2X30A 1ICPA 1XD1A 4N2YA 2BXZA 2GJNA 3VNZA 1S5VA 3VM5A 4QNWA 2YYUA 4KFPA 2X1SA 1WBJA 2GQ8A 1TQTA 3KHJA 4NZFA 1H7OA 3E9AA 4LC6A 1W5QA 4HT3A 4BWLC 2NWSA 3G1DA 4Y6GA 3EX6A 3ANYA 1QI3A 1TTPA 3C61A 3L4WA 3KFTA 3W9ZA 1JUEA 2EAWA 1GYNA 3TSMA 1RQBA 4AB4A 3NQFA 1OX5A 2ISVA 3BLEA 3R12A 5A2AA 5AYXA 1EP2A 3UY7A 4DPPA 3TXVA 2WKJA 4XB3A 4GO9A 4A3UA 4LU0A 3P8JA 1OFQA 2RKXA 1PIIA 1OX4B 1IGSA 4DF2A 1KFJA 5E6ZA 3LRKA 2CLFA 4QITA 4LRSA 3EXRA 4N02A 1VJIA 5AHIA 1CDGA 3QEZA 3TDFA 5K4ZA 1TREA 3IIOA 2VFIA 1CI1A 3W7KA 1GTEA 1FCUA 1FX6A 1KCLA 1WXJA 5CPMA 3WEOA 2CLOA 5D02A 1TMQA 3T44A 3N19B 2B7QA 1KM3A 5F2LA 4ZMGA 2X1TA 1AVAA 4N9EA 3TFXA 4XTDA 1L2UA 3IRDA 4KFNA 2Y7GA 3KRUA 3QF0A 3W7IA 1ZAJA 3HBLA 4UR8A 2X1UA 3THQA 5U7SA 1X6UA 2DJXA 5C54A 1UASA 3ABOA 1DHPA 4PH6A 1VS1A 1FWNA 3IJ7A 2RHGA 4K39A 3TX9A 3W88A 3M1ZA 2LLEA 1K7EA 2Y70A 5DCEA 1GZGA 3UD6A 2WO5A 3G1SA 1HG3A 1KA9F 1QDSA 1HTIA 2RH9A 2ZIDA 2PWDA 4E2OA 1LLZA 4JTLA 3IJ9A 4LS2A 2WKLA 3TAKA 3Q2DA 4PODA 2ZRXA 1LP6A 1ZJBA 3TW6A 3TTSA 5CGMA 1VHNA 3ZR4A 3S2CA 1BLIA 1KFBA 2D73A 3AXHA 3QM3A 3QQ1A 5FEWA 5FF2A 1EPXA 1WA3A 2F2HA 1YXCA 1F76A 3I7QA 2E6DA 1QW8A 1BG9A 4JFTA 1KBIA 4CQAA 1JCJA 1AMYA 3MO7A 3ZT5A 1TQUA 5G1TA 1R47A 2ZA2A 3ABRA 1O4UA 3L4VA 3QW4B 3QFEA 3H54A 4M7TA 3S1XA 4BFAA 4JICA 4PCSA 2RDTA 1LRTA 3R13A 1MEWA 1GQNA 4HOXA 3NL6A 4MJMA 3PAJA 2Y7DA 2I14A 2KZHA 3ZT6A 4FNUA 3RFAA 2CLLA 2DZXA 4HKPA 3EWXA 3W70A 1BF2A 1XDMA 3B04A 2O7SA 2OW6A 3BUQA 2H6RA 2F7OA 3W1TA 2CWNA 2Q8LA 1J0HA 3SSJA 4JS3A 4IUOA 2VRQA 2CLMA 3VNYA 3NQDA 5K9CA 3UZJA 4JIPA 2R91A 4K38A 3UWZA 3F1QA 1CXFA 2E1DA 3BVUA 3VX0A 3RIKA 5F4SA 3IIXA 1AL8A 2NZLA 4ALDA 1B2YA 4MY1A 3C2EA 3OA3A 1DORA 4AXKA 2ZZ1A 1UUOA 2YSWA 4H8VA 3C0JA 2F18A 2D3LA 4U3CA 2NV2A 3PBYA 4A2SA 2R14A 3QPZA 1TPUA 1WZLA 1D7FA 5CGQA 4CCCA 4RXGA 2ZZ5A 3CLMA 1GWJA 1BTMA 2NWRA 4JY8A 3ZR5A 2DIEA 1GVQA 3UY8A 3ZFHA 5A6LA 2QUVA 5A6MA 5AN7A 4TU1A 3MHFA 4UCGA 2YPIA 3M5YA 1KXQA 1D3HA 3TE9A 1JFHA 1HO1A 3C6CA 1CPUA 1SZNA 1SQ7A 1QO2A 4H3DA 3ZO9A 2ZUWA 4FLOA 3WY1A 2F84A 1M53A 4J3UA 1TMHA 5LNWA 3GR7A 3PBUA 3RLVA 1MXDA 2WCSA 1XBZA 5DY3A 3W7QA 1AW1A 1JF5A 1SMDA 3EKLA 3TC6A 5I3GA 1DHKA 5HUOA 3PWAA 3UWYA 5HWMA 1F2JA 1R34A 4JY9A 2Y89A 1LRQA 4MY8A 3VGEA 1UD5A 3BW4A 4X0NA 1JCLA 2CXGA 4ZQCA 1DVJA 3MP4A 5HUPA 2AAMA 1FCQA 2ZUTA 2NV1A 2FQIA 1UD4A 1FXPA 4FX7A 4FNSA 3L68A 3ZWTA 5T26A 3QZEA 1OT2A 4ATWA 1GCYA 1V3KA 2PRHA 2XN0A 4JXCA 2JK2A 4LQ1A 3WMSA 1GOXA 1P4CA 2ZX6A 1QPRA 4H2CA 4FNRA 2WVUA 1XDLA 2VOMA 1KBKA 4AF0B 1JUBA 3EXSA
chains in the Genus database with same CATH superfamily
1LMKA 5EORL 5JYLA 1IGCL 1Z9NA 2XPGB 3OKMB 3HOGA 3CXOA 1ZHAA 4PMOA 2DD8H 3RITA 4X6CB 1K9EA 1L6XA 4U0QB 1EGJL 1HO4A 2IMMA 3ES6A 3QFJD 1FFOA 2P3YA 1YX1A 1JZJA 1RCYA 4AV0A 2W81C 3C5SB 4KT2A 3AQZA 3HW7A 1Q13A 3LVTA 4LVDA 1NSMA 2BSLA 1EFXD 4UT9H 4NQ1A 5G5DA 4XMWA 2Q8AH 5H4ZA 2WV8A 3P77B 2BOBB 3N06B 3US9A 4EI6B 2W5PA 2WVYA 1UKOA 4MSSA 3WDPP 2WXJA 3LB6C 1KNOB 4OJFH 1TEFA 2XRAH 4Z3FA 2V5TA 3MA7A 1MDLA 2I5QA 2J7EA 5CZSA 3BSZH 1MUJA 5HJBA 4ZYKB 2L5HA 1C5DB 4HPGA 4FLRA 1TTJA 1LO2L 2HRGA 3AQXA 3F7LA 4EF8A 5FKPA 2B14A 3E8VA 4LRNL 1V3JA 4RNIA 1E2VA 3L2LA 5LGKA 2B39A 1VRDA 3N17A 2ZJSH 3W2NA 1QX1A 4MLIA 1PX3A 3LPOA 1VFFA 1OQXA 4KCWA 3N9GH 4ZRGA 4B9ZA 2V7NB 4MFEA 3T8QA 3U1SL 4OT1H 1RUKL 1NOWA 4EKXA 2VM4A 3SI9A 3WD0A 3DV4B 4XMLL 4R97B 4OV9A 1PIFA 3K8LA 1R38A 4ACZB 4FR6A 5E2WH 4A29A 1L9OA 3VKJA 2ITCB 3PZVA 3UZ5A 1LO0H 2OAAA 2HPIA 4URTB 4JDTH 1IVTA 1LEGB 2ZYIA 3CSPA 1AZNA 3ZLHA 1AHWA 2NY0B 3KLKA 5LWYH 1DTNA 2J7DA 1QVBA 4WGKA 4HAKA 2ZCHH 4OQTA 5D7LE 5HI4D 1RIHH 1AHKA 4TKWA 4FXGB 1LD9A 1RFDL 1F6PA 4H20L 4LY8A 3REVB 1MMFA 3X3XA 3P80A 4P2OC 1BSIA 1HXMA 3CCHB 2V2WA 1UIOA 4OVUA 1QAPA 4HX1A 3TCLA 4O51B 5IVZB 4DGIL 2PDFA 4FXGC 3ZSTA 1M7XA 3DUUA 1DSWA 2RDWA 3SGZA 3UXIA 4XO3A 2N01B 5DX7A 2AMGA 3DBXA 4X42A 4UFJA 4MDIB 2DEWX 1KJ2L 3FO2B 1GVEA 1NEYA 2H9AB 2ZP8A 1A7RH 5BXTA 2HT2C 3CMOH 1SJAA 3UWWA 3FSAA 4MLSA 2HTAA 4MJID 3G6MA 3EEZA 3GG8A 3B0VC 1XYBA 1TO5A 1SYVB 4AIZB 1UGKA 1YEDA 3L7FA 4IRJC 1GW1A 2R24A 4RGNB 3L3GA 5AKTA 1X7QB 2YXWA 4HETA 4IG2A 2YRLA 1T5AA 1WPCA 2QIIA 3TA6A 4F91B 3N43B 1MLCB 3IGLA 1W2PA 5CPSA 4F7TA 4P5MB 3SYOA 3N12A 3SCUA 1N59A 5LAPA 1D9EA 3PY9A 4XXWC 4Y89A 5TF1L 3PZTA 5H8MA 4RAUA 4OFPA 1XWVA 2FPTA 2N7BA 3KM2A 1BOGA 1JPIA 2WHLA 1X6LA 3WIHA 4IQEA 3QFWA 5B1JA 2NYZA 1A6VL 1YNTF 1M7PA 1THFD 2Z7ZA 3HG3A 4XC1L 3N14A 5D8WA 3ZLFA 1KCKA 5I6LA 1S5IL 4LH8A 1CE6A 4AM0A 5FA3B 1ZHBB 2AV7B 3LTSA 3RKDD 2R29L 1I1YA 2NTFB 4LGSB 5IHSA 2DUZA 2BMKA 2NZ9D 1AZ1A 1TYJA 4LUSA 2WAQA 2JKPA 2YL8A 2OI9B 4LFYA 4BZGA 4XHJD 2FSEB 3JZ7A 1U91A 4G6FB 4WDXA 4B7IA 3GXIA 2WWKT 4JHMA 3SCVA 2BO0A 4D6GA 3KS5A 2O30A 1SPQA 4OWGA 3W7NA 1G69A 3NTCH 4KX8A 4DKEL 4OSUH 4OZOA 1BZEA 4G43B 4BI6A 2R23B 2SODB 3RUGB 4M1DH 2ADGB 2GTWA 2R9HD 5KBLA 1KD0A 5IB3B 1G7PA 1OD0A 3RUBL 3QISA 5ICYA 1AO7E 3IN0A 3L5JA 3M8OL 1Y0LB 1ME8A 3B9OA 3S3CB 3UO8B 1AS6A 1TQCC 3BVJA 3V4BA 2VZTA 5AYQA 4PRPA 3UXFA 1ZK5A 1LLOA 5ISZE 3W26A 5CS7A 3BH8B 1S38A 4Q8WA 3SE9H 1A1OA 2WHMA 1NCTA 5E8OB 2JJVA 1KC7A 1B30A 3T0VA 4BFNA 3L0NA 2GK0A 1DLFL 4UQ2A 4P23D 4FX6M 4H7VA 4NUPA 1CGWA 1KJVA 4RISL 1TUFA 2V5BA 4N26A 5KAQG 3RUGF 3PZOA 5E2UL 4Q22A 1AE6H 3T0EB 5FYJL 3V0DA 3TJHC 3TROA 4HH8A 5C71A 5PTDA 3DN5A 4E0CA 4JM2B 4JY6B 4D9LH 1H5YA 4L64A 1SIIA 4LEBA 3P74A 5E23A 3S35X 4CADB 2VP8A 3PCYA 2A38A 4L8CA 2DLHA 1VBJA 1ZLSL 2AGJL 1IGJB 3FB8B 5BZXA 1BQKA 1D6VL 1OP9A 1P53A 2MEJB 3ILPA 1T66C 4UB0L 3ATYA 3ZZQA 4JIEA 4X99B 2R82A 4V2XA 4DJED 4BFEA 3ZSSA 4BINA 1D3GA 4XRCA 1PYFA 4BWLA 4H9VA 4OW6A 2YD7A 4PTNA 1AAJA 1E4KC 2FAUA 1KTDB 4ZTPL 3ULSA 1I9CB 4HHLA 1OCZB 4AC7C 4E3TA 3ESVF 1SO3A 4BE5A 2FIKA 5EBLB 1XH3B 4N0UB 4PTUA 4BZ1L 5ICZB 1GS7A 1R5IA 3JZYA 1L6WA 5D4IA 4CSPA 2Q2LA 2X4RB 4YWGL 4Z7OF 2FYVA 3T05A 5EN2B 2P5EA 4RDVA 2QVFB 1NUFA 4PYGA 4GUIA 4OAWB 4NM4H 3TM6A 3BCDA 1UACL 2QZRA 4NN5C 1OAKH 3KBVA 5FA4B 4DGVH 2JJWA 1XR8A 5FOBB 3GSUB 1HQRB 4X98A 2PGEA 4JQIA 2X3CA 2MCPH 2LT9A 3VFTB 4LKXA 4DY1A 1PVNA 1ZIAA 4X8GA 1IAMA 5IOPA 4A66A 4Z0SA 1NFDE 5LKYA 4PBDA 4RFNB 4NN6B 4Y5VC 3S88L 4X6BB 2CQTA 3A4WA 4XX1E 5IB5B 1T5WB 4UCFA 5GS2H 2IBBA 1SPUA 5E4EB 5C6MA 2AABL 2KL6A 3UZWA 2B5IB 2P26A 4WJ5B 4J27A 3FT3B 1IEVA 4JGJA 4R3SB 4RXFA 1AHWC 3MFFB 5EO1B 2PEVA 1H0DB 1SXAA 3G6DL 4A55A 1HESA 2EEBA 2YDAA 5DD5H 4YHLL 3STFA 2ZZ6A 1FSKB 3KHQA 3HRZA 5A2CA 3MV8D 1F90H 1SZRA 4FOKA 4XMKL 5C3TA 4TN9A 3LDBB 5FO9B 3QXDA 2XIBA 3CV5A 4EUPH 5ADOH 1G7VA 2QSQA 4X2RA 2HPMA 3VD7A 1JVNA 3WF3A 2Z1KA 5IV2A 4MNHB 5BJTB 2W9MA 4ZYKA 3C6LC 4KPHH 5CH9A 4G56A 3RRXA 1YYCA 5GHWH 4PVBA 1XB3A 3CSGA 4BQ6A 1FNGB 3AT8A 4EVNA 5CG7A 4JG5A 3INUL 3R4RA 5FEBA 1ET8A 1QUNA 4LVHB 1G7MB 3S0PA 3EGSB 3WF4A 3MLRL 1BFOB 1SFHA 1ETJA 2C1OB 3FB6B 3FO1B 4LL4A 2XH4A 5G4WA 1J87A 1ERNA 5LBSH 1NINA 1U8IB 5HR6A 4I13B 2VDMB 3Q3GA 2IKJA 3OAYH 1J1XL 3RNKA 2OSYA 3T8MA 4CKVX 1WFUA 2P10A 1DVZA 3E6HB 4Q4SA 1PPIA 4NC2B 2JQZA 2PNDA 1EDGA 2P3EA 1Y5XA 2QGHA 1AA1B 3O41B 3CMOL 4MZRA 4Y9FA 2WUCL 2E5CA 2EKGA 4GMTH 2VX7A 1MF2L 3KBWA 4D9QD 4TNVK 4EN2A 4KPLA 1LEGA 3FSOA 5I5MA 3AI0A 2WV3A 4WOZA 1SVDA 2BVPB 1WMPA 4RUBA 3DIPA 4PTVA 2FB3A 1JDFA 2A6DA 4HK6A 2F5BH 2J24A 2PWVA 5FF7A 2VXQL 2ZOTA 3M07A 1B57A 3T81A 2HQAA 4HS6B 4FHAA 1EEZA 4XPHL 4UIMA 2V3FA 1XLEA 2H3NA 4H2HA 1RIHL 1SF5A 4PJGE 5FACA 4YL4A 3HS0C 4R2GC 1R6WA 4WQOA 2C3XA 3ARUA 3FUIA 1SY6H 3Q1SL 5DQJA 5LKNA 3BWAB 5T3ZE 1UI8A 1H1YA 4JFXA 1LEIA 4XUGA 3UBXB 4JUTA 4NP4H 5CP7A 3Q7JA 1RR2A 1W5NA 5KSUA 1KB5A 3RA7H 8PAZA 5TQLA 1MQKL 2LR4A 3LNIA 4JN1L 4CQ8A 1G9ML 1OAXL 1YEDB 3L7FB 5CP3A 5J06A 3C5QA 1OL0A 3U1SH 3NDYE 4F15C 1IZJA 3BSZL 4YHEA 4HJUA 3HE6C 4DP1X 2B4CC 3Q8EA 3FXYA 4IRJA 2ACQA 1R5VA 4AENB 5BRZA 3KPMA 4LCSA 3TL5A 1K6AA 3P67A 4OLZL 3H9ZA 1CD8A 1SJXA 3U2SA 1F8IA 4R5XA 4UT9L 1ZAHA 3C08H 3WD3A 3PYCA 4FG2A 4MDJB 4W9LC 3LTYA 2C9XA 4G6JL 5HWJA 3I6RA 3B2UD 4TNWK 4NPYB 2VVNA 1MW1A 5IMOA 4PTTA 5D38A 1O5QA 3K8KA 3MRCB 4IPPA 5ESVB 1MN0A 4JFYA 5I15H 4PJ8C 1A53A 4KS0A 3FS9A 3BDYH 3GRWA 5JHLH 1BDYA 2AAVA 1GPFA 1U5VA 3ARRA 5CEYA 3MMDA 3WSQH 4OZIF 4BCXA 4DX3A 3ULVD 1VGAA 1JDAA 1P7KB 4HTYA 2OULB 3II2A 1B90A 4Z7OE 2VDNH 3P62A 3H42L 3QJTB 3P1VA 3IVKB 4LUJA 1EP1A 5CEZD 3G5WA 2Z64C 4DZBA 5D2LE 1NS0A 4XKYA 3RDJA 3UBPC 4OECA 1KPVB 1K6QH 1NGQL 5EIIB 3S46A 1OOAA 2I25N 3H9HA 1UP2A 3QY8A 3T0UA 5KOVC 1YNQA 4US5A 4ODUA 1Q4NX 4NO0B 5HGDB 3CZ8A 2PZNA 3IPWA 2Z1VA 1LOHA 2WXHA 1O6TA 3APCA 1NAKH 1V0KA 4V2CB 3WLKX 1BREA 3LEVH 1PZSA 1DOSA 4A2LA 5DZJA 5JPNB 1GTHA 3FVDA 1VADA 5CCKL 1W1YA 5CF3A 3DETC 3NAAL 1ZHKB 4R90H 1BSLA 5AAMC 3ID7A 3KOYA 1MN4A 2ABAA 2A7BA 2GJZA 5AW6B 2Q7NA 3DPDA 1AR1D 2FWOB 3NQBA 3V5CA 3MLWL 3QQ4A 1NEZG 1N9PA 3EOUA 3QC6X 2PW1B 2ZD0A 4AY0A 1J0JA 5F0LB 1J2BA 4HUMB 2G8ZA 4C6DA 3CLEL 4PP1C 3D6GA 7REQB 1FWAC 4NNAA 5G2WA 1F6AA 3DX7B 3W01A 1ZPTA 1NC2B 4KKAD 4J6RH 3R0NA 4G7VL 4CRPA 1MRCL 2OZNA 2QQQA 4PJ5A 5I1IH 1EDQA 2VVSA 3A9BA 3I7RA 3LKRB 4JDYA 5A40E 5IFJA 3CK0H 2ZUVA 3KVJA 1JGEA 4OCNC 2UUDH 3QQ9D 4M48L 1H62A 4P8UA 2W1NA 2X70A 2RJHA 2XM1A 3E3HA 3EWYA 1TU5A 4QHRA 3L2IA 1BX2B 1OP4A 2EYSA 2GTQA 3V18A 4EP8C 2Y1VA 3UNDA 1PFOA 1GZQA 5DR5L 4UQ3A 3CLWA 1R5IB 1XTMA 2OZ4L 2VDKH 3AQYA 3KNBA 2C79A 4PMNA 4FP1A 2NTSP 2G4FA 1R3LA 4L61A 3SIZA 1E8YA 2A6IB 4GHRA 2P5WB 2EUXA 1IAII 3CEUA 4AIBA 2OX5A 4YTTA 1JYWA 1IE4A 2OSLA 1YEKL 1UH3A 4WW1A 1CT8A 1MDAA 4OKVB 1SJVA 1QATA 5FYJU 1UR4A 4PG9B 5DGQA 3N5AA 3MJ8A 2Q7YB 1P6CA 2HJKB 3UP6A 4ADTA 3QAQA 4P57A 2G3IA 1Z1WA 3TNOA 1WVZA 2BNJA 2DYSB 3QFZA 1QYGL 2EE2A 1TKKA 2MCMA 1QNSA 3IDJB 4IFKB 1VZHA 5ACLA 1HSBA 3ZZLA 1VJZA 4FN0A 2AJSH 2FO4B 5AKQA 4Q8VA 4NQEE 4PG2C 1TFPA 2JKXA 5C3IA 3ZRCC 3MHGA 5H2ZA 1HC1A 1M7IA 2A77L 3O6KL 3GM0A 2MIZA 3Q58A 2VL5A 3USBA 5AC6A 3WTVA 2CJUL 1TTFA 1JRHI 2GI7A 2D7TH 2GAZB 3OJDB 4HIIB 1FDLL 1LDPH 3NT0A 5DD1H 5A2FA 3F84A 3N2JA 3TIMA 5TJWK 1QSZA 3ME0B 4JO3L 4MGGA 2A5HA 1KJ2A 4XC3L 1OYAA 3QY6A 4TS6A 4DB7A 2ITFA 3TEUA 2Q76A 4LHUB 3DLQR 4BZYA 1E9PA 2ZBTA 2IAAC 1E4NA 1DBBL 1NBYB 3G5EA 4IU3A 4S1SL 1KSRA 4Q8UA 2ICEB 1S3TC 5ENLA 3U30C 4NQDB 1NBVL 2C1OA 4OLWL 1I8IB 3KWTA 3ULUD 3MV7A 4YAQB 3TS8A 1RUPL 2EYTB 3EOAA 5CU5A 5C0GA 3LN5A 3E6HA 1QNOA 3N6YA 1AMKA 3N1MC 4YDKL 4TQEL 2VJXA 4XPAH 4H1LA 5FV2A 5JZ7D 2FPYA 1CXIA 5E93A 4ZQMA 4RK8A 3CJJA 1XIGA 3RFRA 5I8KH 3APFA 3V0AC 1HOEA 3CTLA 3BAKA 4JDZA 2NUTA 3D0LA 4F7CA 1GPOL 3PBVA 2PLKA 2PRLA 2VXTH 4F3HA 4MD0A 3QRLA 3DIFB 4BYHA 1PHWA 4WGVB 2VDGA 2HJFA 1UWYA 3H6JA 3AM8C 2EIEA 1S7SB 5CZ0A 3QVQA 1KV7A 3T8XA 1T80A 1WAAA 3D12B 2AI0L 4UIMB 3CFJA 4Y9OA 5I1HL 1TQJA 4KK9D 2CPUA 3RZWA 1VYRA 2Z34A 3VFWA 4BHYA 3ARVA 4GRLA 4CLMA 3GKZA 1B2WL 1RZJL 1T04B 2E5BA 3KCJA 4LARH 5DZPA 2YA1A 3MKGA 3U82B 1ZP4A 5INDA 3FQNA 2R1YB 4YDIL 1D6ZA 3EMCA 3X11A 4JFXB 3MLYH 2IBZX 2P48B 3FH5A 3RVTD 1F5ZA 4Y1SA 4RGMB 1W8GA 4PRTA 2VDNL 2YUXA 4RDQF 3SKMB 4S2BA 5KSAD 3VUPA 4M19A 1QBMH 3GFXA 3Q2CA 4XUYA 1E6ZA 5BS0E 4UQCA 4K3GA 3MRJA 2OX4A 1VGEL 5HATA 5K4XA 3DX8B 4W85A 1RZIB 4DJEA 1R30A 1GAFL 5A6JA 2W9EH 1M9SA 2ZNXA 1J88A 1ET7A 3HVNA 3IMSA 2CM5A 3DYMA 3ILQC 4XP1L 3QLLA 1ZXKA 2INFA 1NUGA 3VKBA 1GGIH 1ACYH 1OK6A 3ZYOA 1V6YA 4WUKH 3LTPA 1MOEA 4L1SA 2X88A 1GGCH 4KHTL 1PSKH 3PWJA 1A50A 1A7NH 5D7SH 2ZCGA 3MGOA 2FHFA 1S7QB 2EZ0D 3PP7A 1TFHA 3VSUA 3C2RA 3SDXB 4YE4H 3M0YA 1MQ8A 3GD1C 3O6FB 4H04A 3WLNA 5IQMA 3W25A 2ED8A 3O2VH 1H9VA 2CLZA 1HI6B 3TO4C 4AQ1C 1TJXA 5F7FA 1TJ0A 2VDPH 5T3XH 3O2LA 4N4QA 2UZPA 1L7TL 4CCZA 4D2JA 1L3NA 4QTHB 1EBHA 4OHQA 4HDIA 2ENPA 2DL9A 4NCC1 1C9SA 1YEHL 3TGXA 2PTYA 3U7BA 1GYWA 4AL8L 2PTWA 1SN0A 4JCLA 5C0FB 3WA2X 4EPBC 1TCDA 4F9JA 5JIPA 1I2QA 1E9LA 5CGTA 5BOFA 2FRGP 1A9EA 3F2BA 4V27A 4DZBB 2UXGA 1Q90A 4MZ3A 4E68A 1HYSC 5ICXB 2ZYFA 3U6WA 1GS8A 3PWUB 4JFUA 4AZ7A 5I18L 4ROPA 4XBJA 4YXKH 4JW3A 3HPAA 3B1UA 3LRMA 2A79A 3NQ2A 4PLJC 3MBED 5I0YA 3NQVA 1OC6A 5T1KB 4WWKC 1ED3A 4UDTB 3BRDA 2BODX 3B7YA 4JFOB 3F58H 3TTEA 2VKZG 3MOBH 2VCBA 1RBAA 2OGJA 3DBNA 2PD5A 3RFZB 3NCJH 2PDCA 4JQIL 5AY7A 1AANA 1XR9B 2I9EA 3FRUA 4JEJA 1DVUA 3SJ3A 4CD5A 3DX6B 3SDDB 3BKCH 1E40A 3UZQB 1KXVA 3OZMA 4EIVA 4P2RA 3R6IA 4JYDA 4X7DC 1AD1A 3I50L 3KLQA 3T08A 3SY6A 4S11A 3R79A 3A64A 1J18A 1TZGL 4JK0D 1CFSA 1MAML 3UXLA 2C1PA 4KXBA 5FUOH 1HILA 3MODH 4KESA 4QGYA 4HK5A 2VWEE 4QGTA 4ZS7H 3CV2A 1DUYA 3QORA 4FXKA 2JLPA 4PJ5B 4AUUA 3ULVL 1OP3K 2J6EL 3VI2A 1V02A 4FALA 1HHKB 1NLBH 5GNYA 3EMZA 1KMGA 4CDHA 3LKNB 4TVPH 1PG7L 5B8CC 3PUGA 4YBQD 3WLRA 2QQNH 4LSVH 1MI5A 2VEMA 3IRSA 1HCFX 3HJEA 3OBKA 4E2VA 3QWRD 4PRBA 1A4KB 4BTYA 3G0SA 5KN5A 3GEWB 3VFSB 1DDTA 1KEGH 3D33A 1EJUC 4TTDC 5AZ2H 3HGRA 4V1YA 2E7BA 2WNXA 1KJ3H 1BYAA 1M5WA 2JGQA 3QPKA 3RL1A 5FR3A 2TRSA 1EDTA 1SO5A 1I4FB 1MQKH 2IDCA 5HHMD 3TXZA 1FRGL 2ZCZA 5C9UA 2QR0B 4PS3A 3MNWA 3QJRB 2X2UA 4X9YA 1WIOA 2QPSA 4I3RH 1QFUL 4OCYL 4RWYH 4MYXA 3ECBA 4O4VA 3SB0A 3BL3A 1LQSR 3VQ1C 4K36A 2P49B 3A4FA 4LPXA 4NPKA 3UACA 3AHYA 4QE5A 5C7HA 4AYID 1GHSA 1B4JL 4M3PA 1GZHA 3T1GA 5CIPH 1QWGA 3BMXA 2EG6A 3BE1L 2QCNA 4QLRA 4NSKA 2CJSA 3LZNA 3QR0A 3V5KA 1IT9H 4MNMA 5GJTH 4A7GF 3GT6A 5GGVY 4BJHA 1ZT1A 1SPDA 5FOOA 3SZ8A 3GI8H 4M03A 4JJ5B 5SWSD 2YW3A 4WEVX 3FTWA 4FTVD 1YEEL 3ULVH 4PRHE 2RIKA 3OJDA 4UTBL 3QUXB 2G95A 43CAB 3H7LA 1JUFA 3FDGA 3TPKA 3TNMA 4QHLA 5E5RB 2P5EE 4ZW5A 4ATDA 4OUEA 1OY0A 4FQXD 5GGUB 1DE4B 3WFZA 3ZO0A 2GJ6E 1RJYA 2IH1B 3QHZH 3GDCA 2CLVB 3RWEA 4NAJA 4J40A 1AZZC 4GZ7A 4OZFA 2ASHA 1I8IA 5JMOC 2P5NA 1ZIBA 1ASQA 3DGDA 3ESMA 1S7UA 2DQ6A 1ZOXA 2WMIB 4FYQA 1GC1C 3EXLA 2I5GA 4AMAA 1JIBA 4MA1B 5DRNB 4O0QA 1XV8A 1QACA 4X6DF 5D1XB 4LEXL 2IBZY 2ZZUT 1RJLA 3MKKA 1J8HA 3UERA 1G7UA 3DFYA 2PDPA 2J73A 4F24A 3I6TA 2F58L 2QPEB 3LLFA 3JWOL 4OZGA 1FL6B 3X3YA 1GOOA 1NAL1 2G0WA 2Y5JA 2IANB 4PRDA 2W9LA 2XU9A 4H0GA 2H6OA 3FU7B 1X5AA 3HRPA 3MP3A 1QR4A 2YD0A 4HHAA 2XI9A 2WIMA 5F3BB 1F8TL 3GRWL 4Q8TA 3CFJB 3CZEA 3G1YA 4LAQH 2CBMA 2ALAA 3MWAA 1BTCA 1Z42A 5JBDA 2QUNA 3FMGL 4F9LA 4ZAKD 2EVGA 4HJ0C 3WL0A 4AMCA 4HN4A 4OVVA 5I75B 3MNMA 3NCBB 5IESL 3C2AH 4ODXB 4IJCA 1OPGL 4DAFA 2GWNA 2P80A 4A22A 1KKRA 4LLYB 4AZBA 4XCCH 3LERA 1MWAB 1Z89A 43C9B 3OYZA 2NX5E 3MRJB 1DWHM 2GVLA 1PTGA 1MCNA 3ABZA 4DKTA 1KENH 1SUHA 5A8GA 4Z0JA 3DFOA 2R2EB 4AGMA 3GGWA 3TVMB 2CKNA 4QAIA 4JMNA 1XIWC 2D7MA 1MFCH 3HLAA 3RX2A 3BIKA 4KERA 2WQPA 2P8MB 2VM3A 1OJMA 4B91A 3Q06A 3IIZA 1BQSA 2GUYA 2YLHA 3PWJB 5CR8A 4YHPB 1LZOA 3MGOB 1GKQA 1DJSA 1XIHA 1ZGDA 2X6VA 5JHMA 1Q1PA 1P4UA 1XQ4A 1TVBB 2IOMA 5L88L 3H3PL 3OKLB 1THCA 2J44A 2R1WA 2XPGA 3DNKA 1SYSB 3OKMA 4LKCA 4XTIA 1K1XA 4PMXA 4S1DD 4R9OA 2HK1A 5D9SA 4B3ZA 3W7HA 3WH8A 3NXFA 2OMUA 3VYNA 4A7GA 4OJCA 5DA4A 2WANA 3FTYA 1OSZA 4PS4H 4L4JA 2VN5A 1WX0A 2HT3D 2Z7WA 5CBJA 4K9EH 4L5FH 3W75A 1HSAB 1SM3L 1OFEA 2EPKX 1FC1A 1KBGH 4G80A 4GS7B 2VW4A 3NO5A 4FFVD 4DAIA 2BOBA 5JOFA 3WMPA 4R0LB 3WS6C 4MWAE 4BJLA 3BRFA 4Q52A 3R89A 2ESVD 2XTSA 3N6JA 3QDME 1FE8L 2C3HA 3JUZA 1OLLA 2H0JA 2NY5L 3APNA 4PJDE 1YXDA 3VO0A 4I5UA 1D5RA 1MFUA 2YRBA 3D69A 2F19H 1ZCOA 5E5UB 2FDSA 3PJUA 5IREA 2G4EA 5IMMA 2EEDA 4M51A 3FX4A 3CZLA 4FTVB 1EA0A 3BVWA 4FQHB 1SOSA 5AAWC 4IK7A 4S3FA 4WZHA 1QRNE 3RTLA 3RHWK 32C2B 5KYYA 3S4SG 5I19H 1QEXA 1RZGA 4FFYL 4EI5C 1HKIA 4KKXA 4GRLC 3F7YB 5D8JL 3H1ZA 2AITA 4HW6A 1JDEA 4LOVA 1C08A 1WQVT 1NBVH 3FRUB 2KX9A 4O53A 3PWPD 3WG7B 5FEPA 1URIA 1CGXA 3ZE2E 2OQYA 4OQ1A 4YSCA 1GYVA 4HOMA 4WJ8A 1RJCA 4L3ED 1L8PA 3B8VA 4UILL 4GY0A 3Q44A 1IEWA 4QROA 4JCMA 3RGTA 2ICEC 4YO0A 1VHPA 5C07D 3L5AA 1J9RA 2WXDM 3ABSA 3EXTA 4F8OA 4ZAKB 2BTMA 4AIXA 4GI8A 3PAUA 3LHAA 4GXUN 4PGBA 3IFOB 3BPLC 2BWIA 3WJWA 4DRSA 1D5ZB 1K4CB 4U1JA 2HUHA 1OHLA 2V69A 1WITA 2FH6A 3QORB 3VXUB 5I1GL 1YC8A 3OKDA 2V5DA 4ENEC 2ESCA 1X5YA 4KI5C 1M7DB 4BK5C 1KOAA 5EU7C 2NV9A 4X3ZA 3V8OA 1JPTL 3PJNA 1AD9B 4DJDC 1K5NA 4NIYE 3GM8A 3QIBA 1AW5A 2GGEA 4RCAA 1XF0A 4LAKA 3THAA 4IICA 2WTRA 4GKNB 1Z69A 4G7SB 1FFTB 2WQSA 2P9RA 1ZBCA 3LZFH 1M2VB 5I6NA 4R34A 3C60B 3QGVA 2TODA 5ABFA 5I1DB 5TGBB 4WJG3 4I5RA 2KH2B 1N12A 2X4UB 4X7TB 2DZUA 3KYKH 3QJXA 1HJQA 3IRCA 4IG2B 5AUMA 5IROA 1XI3A 3LKPB 3KX6A 3V4UL 3N1PC 3IGKA 2X4PB 1N59B 1RK6A 1UUQA 4IISA 4R26H 8XIMA 1U5JA 3V9FA 5FGBC 1WEJL 5J9PB 5KSAA 2Q8BL 3OBAA 4KO6A 4LL1A 4DFHA 3BKJH 3N04A 3FF8A 3QC0A 1PZDA 4IIQC 4OFDA 3NCFB 1W72H 4JL2A 1S3KH 3RDTB 2LVEA 1OWRM 4W5UA 1TJHL 1ACXA 1J96A 2A73B 1FDYA 3V5KB 3MV8B 5GS1B 4QLLA 2QPUA 3SPJA 3QIWB 3EYOB 4PGJA 3GKWH 1AH4A 2A9MH 1X6NA 3GYCA 2FECI 4KWWA 4NHVA 4M5TA 2Z27A 1AD0B 1NC4B 2FNWA 3D2UA 4JPIA 5T1KD 2FTYA 1UYQA 1TJRA 3CFCL 2XN9D 3CFEB 3I75B 3PWVA 3FNDA 2I7SA 1OGPA 4HSAC 1DVFA 2VO5A 5D7JC 3SE3A 1N26A 1XBRA 1AHMA 2EECA 1CB8A 3ARGD 4G43A 5CUSL 4QE4A 4C7DA 4WK9A 5C2BH 2BRRH 5AZEL 1TSHA 5JW4M 1FL3A 2BNQD 3S3DB 2ZRYA 4GNVA 4S39A 5KW9H 3CLFL 4IW4C 3LPWA 2PPCA 5T5NF 3CN0A 1CBGA 2ZDRA 1J11A 1BGGA 4N25A 3BH8A 4UIKL 5AYTA 2HISA 3D46A 2GDUA 3W82A 5KVEL 5GS0C 1OIFA 4JZJC 4KJWD 1A7NL 1LO5A 5D1XA 1NMAL 5D7SL 1MSSA 2VQ4A 1V6XA 2D1ZA 1A21A 5I82A 1E6PA 5EOTB 1A8ZA 3HZYA 4OLEA 4LF1A 1S7RB 1ZVHA 2BS8A 3CXFA 4GH1A 5CD5D 3M5ZA 2IANA 4KVPA 4PRDB 4RGNC 3GS7A 4UOJA 3GK0A 4MHHI 3GVQA 1H5BA 3F62A 4XZHA 5JUEH 3D4GA 1HINH 2OR9L 3WEBA 4BKSC 1A5NC 6PTDA 2A0LC 4A7SA 4ORIA 2O5ZH 3EWZA 1ZHNB 4JANA 4MGXA 5J8OA 3E0GA 4KXDA 1PCWA 4FNQA 1US2A 4JKPH 4PJDF 3O9NA 2X9YA 3ZE0B 1U83A 2WGQA 4NN7B 2QUUA 4R84A 2R51A 3F2CA 4MCMA 1WFTA 5AD0A 2V68A 2GIXA 2TAAA 4ZX4A 5ACZB 3N2XA 2QMKA 1I8LA 1N8WA 1VERA 1NGYA 1I7TA 2IG2L 1QWKA 5EOQH 4TX9A 4B5XA 2X2YA 3VDCA 1FWSA 2DQGH 3CIWA 3S3GA 4MJIB 3QWNA 5DEFA 4KBPA 1SEBA 3CUFA 1E6OH 1DQWA 4Z7WA 2HPTA 5CZKA 4Y5YA 4OZHF 3W02A 4MM1A 4E8CA 2WM0A 3STCA 1O9ZA 4KDWA 5JIQA 2BSSB 2ZE3A 3TYEA 4PJBF 2AEQH 4YGAB 2ESVB 3WELA 4S0SD 1A5OC 2E6FA 2WSRA 1XEDA 3HG1B 3MUGB 4MNKA 5FF0A 3MXWL 4IHOB 4LVOB 3EA1A 1MI5D 3UZEA 3HR5A 4WO4A 5DS1A 4C83A 2KC0A 2YJQA 1O66A 1RV8A 1ZJIA 3ES8A 1YO4A 5CJQH 1HQRA 4X98B 4I3SH 3JU2A 2HNHA 3HUJB 1RERA 4HKBA 4ZUWB 4AKOA 4XMTA 3D3IA 3UPAA 4IMAA 2HJLB 1AY1H 1TR7A 4RLDA 3UJ2A 1Q65A 3UR5A 2GJ6D 2KMWA 3P4MA 4DW2H 1IU1A 2EO1A 4OIFA 5KVGL 1GG0A 3CIXA 3KM8A 2QCLA 5E4EC 2VD9A 1XM3A 3IPFA 3U1PA 2R4RH 5LNSA 3TWCH 6REQB 3EJYD 2NSQA 3ROOA 4R3SA 3CYVA 5AB3A 2F9BT 4PJCB 2DT2A 5JXEC 3L5WA 1TV5A 1KGJA 3IJSB 2EDBA 3JTBA 2ITEA 3SCRA 4XISA 3AJXA 3WY2A 5EF2A 5HYJE 1QNPA 2VRAA 4C4KT 3IU4H 5FO9A 2XZZA 3BTNA 5EO0A 1U92B 3KPSE 3UZVB 3TPUA 4MZ8A 1QQDB 1UQSB 1NIBA 3VXRB 2DY3A 5CPNA 2YXMA 3VRJB 3MLTB 3QZWB 4APXA 5FW7A 3RY5A 1W9PA 5ISZB 5T1DL 4UU9A 1T8XA 4EVNB 3PSWA 4CC0A 3AABA 1EXUB 3CSBA 4PJCF 5ITFB 5CJOH 5GRZA 2Z31B 4FTVA 5FDWA 5I03A 4O58L 3W5MA 2EUZA 3P0WA 1BFOA 2HLEB 5E5LA 2VEPA 4MWAA 1HEZB 4GVHA 3Q3GB 2GITA 1TQWA 2B59A 3KBFA 4F9LC 3IEBA 3UTQA 4H4IA 5B7ZA 2C9PA 3PL6A 2OOGA 2DYPD 3OLDA 1T21A 2HWZL 2YD8A 2IKGA 4GBDA 3CPRA 3FQUA 4NJIA 1HAUA 2FPVA 4PY8I 4WEEA 3C0SA 3OKKA 1MMXA 3N9SA 4L4MA 3WFAA 3C8DA 1DANT 3HNVH 3JV0A 4N2NA 4YO0B 2NW3A 4EWND 4BDVA 3CDGA 5I74B 1IWAA 4GKTA 4P5KB 3G7TA 2PTZA 3K1GA 4M7LT 5JXAL 1LDCA 3EYSH 5A8QA 5T1MB 4UMGA 3QQ0A 3EJQA 5LNRA 1Q7QA 5IGXL 4UTBA 2BGNE 1GEQA 2L7UA 1AD9A 4DM1A 1XLJA 4AFYA 3QOMA 5L2KB 2KPWA 3GC5A 3P73A 3T0XA 4PAZA 1YEFL 2NX5A 3IFNH 4YHZH 4PG2A 1W7CA 2C16A 5DZNA 2BSBA 2HP4A 4CNUA 4JO2H 4HBKA 3BAXA 5ABFB 4DAGH 3GZOA 4EN3C 3CSFA 5D7KD 3S8GB 3CFMA 1A5CA 1MEXH 1S9WA 2QHRH 2DQEL 2YN5A 2P8CA 2HTKD 2EDEA 3BQ5A 3NM1A 1BZ7B 1TVDA 4GSDL 4YJZL 1N18A 2AZUA 3FOMA 3C5ZB 1QOXA 2X4PA 1OD7A 3TASA 4EF3A 4ZFZA 2PDQA 3O1NA 3CPLB 4BFIA 2YUWA 4H8PA 5HD8D 2E2TA 1V3IA 1IGML 3OEXA 4N6EA 5KZDA 4KHXH 5DMIL 1CFQA 5T33H 4QRPA 3IN2A 4LCWB 4F3FA 3MZNA 3EX1A 2K1MA 4MVAA 4B9KC 3HE7B 1UJ3C 1FVDA 1OTTC 3WJZA 2VXUL 1FUNA 3NIGE 4RGNE 4W1TA 3S48A 1F86A 4JRYD 4DCQA 5IMOB 2CFDA 2GUUA 3CZNA 1CZ8L 5A6TC 2IXQA 3OQEA 3WD2A 4LEXH 3MV8E 1ZA6B 4K9EL 4L5FL 1N2RA 1UM6H 5GGRB 5AG8A 2BCMA 4KK5D 4KZEL 1AGFB 3IDNB 2Z0IA 5CEYB 4GEIA 5GS2D 2A7NA 4C6KA 1J2WA 1DVXA 2G4JA 4RNHA 2ARJA 3S2LA 3I75A 3V4PL 2WVSA 3OPZH 3SDAD 2WQRA 4UT7H 2QCCA 5IM7B 4M81A 1W0VA 1XLLA 5DJ0B 4FXFA 2NT1A 3CQJA 1IC7L 5A8MA 4L1BA 3I84A 2XQYA 4QRFA 25C8H 3NURA 2DWXA 4NXSA 1XWYA 3HG2A 1FL5B 4YOKA 2VDQH 2Y24A 4QDMA 1XGPB 1YN6B 3QIUC 5HPMA 4R33A 4F5CE 2MHAA 5AAPA 5DJ6A 4PUNA 1QNRA 1R24A 3SQMA 2CBTA 5M3WA 4LLDA 1E4KA 3W1AA 4CGUB 2WD0A 4PB0L 3BD3A 5DO8A 3T6ZA 1QOQA 1CFNB 3I7SA 2ZUQC 4D6FA 5KTLA 1WO2A 4G6JH 1FBAA 4XXWA 2JALA 4JYEA 2P8LB 1C1EH 5FF4A 1H41A 4NS0A 2J2ZA 4EBQH 1TT6A 1B0RB 3WLBB 4B9CA 5IVNA 1MFMA 3BD4A 3BW9A 3CC5A 4HJ1A 1SFTA 2Z1SA 3H2EA 4XZWA 3FUJA 4F15B 4DXKA 2G37A 1GY1A 4JLRB 2CG9X 3IMTA 1PZBA 3Q6GL 4DKEH 3LSBA 1PXGA 3VABA 5E4AA 2HLFD 2Z91B 4P04A 3S3SA 4KTGA 2RJGA 5DBUA 4LHUD 4C58B 1WKDA 3LKOA 2N59A 3DVFA 4PJIB 4Y2DA 1TR9A 3IACA 3SKJH 2K6WA 4PJ9A 1UTDA 5D4QA 4U1IA 1W56A 2EG7A 5EEUA 4ZSTA 5I3IA 1H3XA 2OOVA 3MRKB 3IPEA 5FLVA 3RPMA 3CN2A 4DGYL 2BXYA 3LRLA 3HNTL 2A6KB 2BINA 2HCZX 3FY1A 2IH3A 3BQUD 2JE8A 3Q9PA 2F6UA 3AHZA 3NPXA 3VNIA 4HYWA 4HV8A 1BX2A 2EYSB 3QPQC 4MX7A 3DX3A 3AU1B 1NSVA 1O9VA 4DPQA 4R4FH 4XO5A 2DVTA 3NTYA 4CMMA 3WQ6A 1N2VA 3IVUA 5LSMA 2XN1A 5HGHA 1I85A 1EYEA 4YHYC 4JB9L 3ZW3A 3B83A 4PJFE 4YHIB 5DD3H 1CD1A 4Y4KA 2YOAA 4IHOA 4LLAA 2R1NA 3UCDA 3HR5B 1EEYA 4A7UA 4TMPA 2JKJA 4ZW6A 5C0QA 4P5TA 4Z7NB 2ZNWA 1IZKA 5ALBL 3VXSB 4D9RE 3APYA 5FUOL 2F6AA 3NGBC 3PZNA 4X60A 4ZMXA 3HFTA 3FZUC 3M7FB 4PLNC 3AYSA 3HQ1A 2WXPA 4JVUA 2N56A 5J1TC 1FVEB 3NJ3A 2QKFA 4U2ZA 3VA6A 2BIQA 1HJUA 4M7SA 2DJSA 4Q4RA 1ALDA 4BIKA 1I3GH 1Z41A 3FTGB 1RHHA 4G5ZL 4AVJA 5EU9A 1UZ6F 2PDMA 2Y7EA 2FZBA 4MB4A 5DANA 1R3JB 2BT3A 1V7AA 4Z6AT 2H8ZA 5D03A 1PGRB 2H47C 4GFIA 1XCTA 4ANUA 4E5XG 4K23H 4CVZA 4QNEA 5JIDA 3MOAH 4L4TA 5I17B 3W38A 2F8VA 2FJSA 3NCCB 2GAZA 2F8QA 2QUTA 1DWIM 3G0XA 2BHZA 2FL5A 2VSDA 2XLLA 2YD5A 4GW4B 4S2SB 4JDVA 2D7PA 2J8OA 4HC1L 1P6BA 3QUYC 4M6UA 2UXTA 2J5LC 4Y4HB 5G1YA 3P3YA 1CLXA 5JMFA 4PW3A 2IWFA 3HMJG 9RUBA 4IU2A 1SDYA 3QIWC 2BRWA 3STPA 1T0MA 1Z45A 4XBKA 1LNUB 1KYDA 2RH0A 3PV6A 4Y2LA 5CINL 1ELSA 1RAKA 1ORQA 2IGFH 3GMRA 2DORA 1U8MB 1EGMA 3W6MA 2CXEA 1CDBA 2IPKB 2CO1A 3QJZA 3DI0A 3ELAT 3OGCB 2EYTA 3DX4A 4LSUH 3GEFA 4YFLF 4L9LA 1IL1B 2YEZB 1CS6A 2EILB 5FW8A 3TEXA 4OQVA 1E5YA 1MRDH 3IE9A 4PBXA 5CZVL 1O1ZA 1VCVA 1LO3H 4G1KA 1FNLA 2ZA1A 5AW0B 2PPFA 3QZOA 3O3AA 5IJDC 1DBJL 3TIEB 5L0QC 2OK0H 4EBQL 3ARGB 3F7VA 1A3RH 4FL4B 2W0KA 4IOSA 4O4YH 1QI5A 1CU4H 3W9DB 3LIZA 3C8KA 4LLQB 2NLYA 2WPBA 1WD8A 4ZFOB 1TUPA 2GDQA 1UB5A 1SLXA 1KGYE 4IKLA 4LSRL 4ZUTB 3U7WL 3KBNA 1JL8A 2HRWA 2HXUA 3F7PC 3EJTA 1EFQA 5DK2A 2WJFA 5DQPA 3P4NA 2DIJA 3M1CA 3R0MA 2EGZA 4JTUA 1QVOA 4IBYA 2NUWA 3WLLA 3BDKA 3PXHA 3VFWB 4QHKI 1H3PH 2DWDB 2ZOWA 1ZSXA 3YPIA 4FERA 1Q63A 4HA0A 3K5TA 2BNRD 4GXVH 1UXMA 3C5JB 3I50H 3UTPD 3ABQA 3CWHA 3DDFA 1FFNA 2BZ7A 4UT7L 3LHVA 1BWVA 4WTWA 3VTTA 3IVTA 3KYAA 4J3WA 1MVYA 3O6CA 5REQA 2CSPA 3L3OC 2X05A 4D6JA 2E22A 2CO4A 4O1CA 2I32A 1V6VA 3AIUA 3ARDD 2CKBL 2X1RA 1BZ7A 1JPST 3LCGA 2X0HA 3L3OB 3BZ4B 4KWUA 1PCKA 2ZRUA 4B9GA 3AMLA 1E4WL 4PCPA 1O5KA 4B5ZA 2B4CL 2XOTA 1EZVY 3QHFL 1BLNA 2H1LM 3BN9D 1EXGA 4ZFFB 2OVLA 5AW9B 3VMNA 3KVQA 4JHAH 4LCWA 1G4MA 4F3FB 4OGZA 4JFDB 1GPOH 3IK4A 1E1CA 1HVQA 1ZRQA 3PBMA 5CPQA 3V0IA 2VQ1B 3MRHA 3P9MA 2JTYA 2VXVH 3GBDA 5K93A 3CYJA 4DCQB 3PR2A 1M3JA 3A3HA 2EDMA 4B53A 1EGUA 3DX2A 1DIOA 1R9ZA 3QKEA 4AL8H 3BZEA 2KZ1B 2MCAA 2AV1B 4J9JA 4AI7A 1GGBL 5DO2C 5AOJA 2ZFAA 1S5HA 3BPOC 5GGSA 3QNXB 5H91A 5JOPE 1JK8B 4MCZB 2GIYA 3UJTH 3U2CA 3UF9A 1KLGB 4A8NA 5KETA 3X1NA 1LROA 2VFHA 2JTDA 5DN1A 2CO2A 2NUPB 3N40F 3H8NA 4WU7A 3SCMB 1A5SA 4YDLB 3FYYA 4LF2A 4S3BA 3R5EA 4HH9A 4XPTL 4WDTA 1AC6A 4WX2A 1HIMH 1QFOA 1PCXA 2YN3A 2WVXB 4ZFMA 1DJYA 2DW6A 4YNGA 3N2OA 1RVFH 2YGOA 4J2PA 1TQCB 3S96A 1H50A 3G1HA 5DXYA 3VIFA 1M57B 2Y9RT 5E6RB 4I0KA 5IWLC 3KLLA 4M62H 3WNNA 2R1LA 4NGHL 3WEXB 3GSMA 4XN1A 4IPLA 4WWOA 3Q37A 1K7FA 4J3ZA 1RZQA 4G42B 2BSTB 1KY7A 3T09A 2A9AA 3N6HA 3MJGX 3CAKA 3B9KA 5C08E 4LDLB 4J1UA 4JFDD 5AVYB 3WFCH 3PB2A 1JFQL 4WVRA 3VIIA 1TFVA 4M56A 1AS8A 2J2ZB 3HNVL 4I5BB 2YL6A 4TSAL 2O0TA 1NF0A 5IOKA 1HH6B 4JRXA 4PJHE 3K2KA 1GVRA 2CUIA 4IGBC 1USQA 3CPGA 3LRHA 4M8UA 3K25A 1PKYA 3K5XA 1FYTA 4NWTL 2CRIA 3WH5A 3BQVA 4AJVA 3EBHA 2NY2B 4C91A 3MJ9L 5IK3B 4E42A 3HIGA 3ENEA 1RCQA 4PMJA 2C1PB 1HILB 1IM9A 4GY7A 3WF2A 2DJ4A 1KN2L 4NU7A 4I7ZC 3RY4A 5KZCD 1JZGA 2YMOA 3DYOA 3CBKB 2DQFA 2QZ5A 3GZQA 4PJIA 4Y2DB 3TT1L 3C6SB 3IDMB 5SWZB 3IRZA 4L05A 4ZBJA 4HGXA 4XH2A 2WZPA 5J57B 5TE7H 3LB6D 4JZ5A 1ZZMA 3V4LA 1RLWA 4PWGA 2JEPA 2IH3B 4MYAA 1S9XB 5JUVA 1FH2A 5IY5B 4KZCA 3FJ4A 2DMGA 2V5MA 1AVKA 3LHWA 1H3UA 1P2CA 3CZFB 2ZOKA 4PRBB 1AH3A 3E0FA 1MCWM 1M3IA 2EXSA 1EJVC 2EPHA 3W5NA 1G7IA 4LBEB 3CC1A 4NCDA 4MADA 3HA1A 4PHZA 5F8QC 3Q5OA 3FSZA 1EZUA 2GTZB 4E9VA 1FDJA 1FY6A 3BARA 1B4RA 2EPMX 2A74C 3V0VB 1LP9A 5CSSA 2W65B 4PRIB 3KLAB 1L6YA 2IDUA 3QULB 1RLCL 2R4RL 3FUDA 3BJTA 2X0YA 4CSSA 1G1CA 3GAYA 4AQEB 1AGEA 2E6AA 3GH4A 3MNWB 3STGA 3D50A 3EH5B 5DUBB 2QFPA 3DTDA 1FSKC 1S78D 2B3IA 5J12C 5JLZA 3FSTA 1QW9A 3O4LD 4YXHL 3U48A 1BQLL 3TBVA 3C5XA 1XF3B 3V7MA 2FZNA 1A66A 2YA0A 1RIUH 1LQAA 3ASWA 2CIIB 3GFUA 4M7ZB 3M0KA 2ROXA 4PP2B 1BAGA 3NAAH 2UX6A