4FNQA

Crystal structure of gh36 alpha-galactosidase agab from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
727
structure length
723
Chain Sequence
b'MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGSRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGIELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKARGHVAMSGNFGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISMMWRLKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaB
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 230
structure length 723
sequence length 727
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnqA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnqA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnqA02
2NT1A 2WANA 3BW3A 4H8HA 1TB3A 4JTUA 4AHPA 3UZJA 5A8GA 2ZRUA 5F7UA 1XC4A 1EA9C 1SR9A 2YJQA 2YXGA 4CQAA 3WNNA 4ML9A 1HL2A 2VELA 3G3MA 3II1A 1DQWA 1OSEA 4UQ9A 4NXSA 5CPOA 3K8LA 3VSTA 2V5LA 1HTYA 3W7EA 4JTTA 4IMCA 3NL3A 4N9CA 1JJKA 1TV8A 4M6VA 5LNUA 2JKPA 2GVJA 2Y2WA 3BW4A 4MB1A 2J27A 4GUHA 2WKGA 3P80A 4IMFA 3S0CA 2A2IA 3QJAA 2VNCA 3WJXA 4IXXA 1QHOA 3LV6A 4DF0A 2VFIA 4AHQA 5D37A 2G97A 4IUOA 5HR6A 3QZEA 4J7RA 5DELA 2GUUA 1TMQA 2QV4A 2HMCA 2Y7DA 3M16A 1LCOA 2CU0A 1LORA 2F7RA 1YXCA 2NXGA 4X9SA 4PCSA 2YSWA 4H8UA 5KTLA 4FNQA 3IVSA 4J3WA 5BMWA 3W07A 5KZEA 5CXPA 5A6MA 3BH4A 3LRMA 3ZR6A 1ME7A 2B7QA 1JQVA 2XWEA 3EDJA 3KFTA 3EJPA 4UQCA 3G24A 3L5MA 3O06A 1ONRA 1XSIA 1M6JA 3WJZA 2ZRYA 2ZRXA 4TIMA 3H55A 4I7VA 2BXYA 1EO5A 1QWUA 3NQFA 3ZO9A 4BI5A 3TW6A 2OT1A 3HOJA 4IX2A 2GQAA 4U2YA 3IIPA 4CQ9A 3WY2A 5D38A 1R30A 1H7NA 1ICSA 3FAWA 1ADOA 1KV5A 3VM5A 1A5CA 4GI9A 1JDCA 2QEZA 3YPIA 3LHVA 4B5NA 4X2RA 3CLWA 3QFEA 5BOOA 1QI4A 1HXKA 2DZUA 3NGJA 3GTNA 3PSWA 4AW7A 4CCDA 1P0NA 3NEVA 5AYZA 4LS1A 1GVSA 3QMRA 3BG9A 2ZX8A 4LWWA 2E77A 4AXKA 2G3NA 1K03A 3SY5A 4GBUA 1WV2A 2QJHA 3R8RA 3N2MA 3M47A 2V2HA 3LXAA 4HT3A 3UPWA 1W0MA 2GQ8A 3W85A 2VEPA 3TX9A 1KCLA 1FUYA 2Y63A 1I8JA 1FWNA 4JYFA 1J0JA 6CGTA 5D2VA 3VKJA 5BW6A 4R33A 3GIYA 1J0HA 4IPJA 2V30A 5F4XA 5ABTA 2A5HA 3LLDA 3WK2A 3BVVA 3LCFA 2BHYA 3BLEA 1JF6A 3WK3A 4LQ1A 2ZBTA 4GO9A 3OA3A 4QJ1A 1BVNP 1DOSA 4UIOA 3DHDA 2DH3A 1M7XA 5D05A 3B06A 1C9DA 1VYRA 3G1YA 5LZLA 2JKAA 3FOKA 3CTTA 2CZDA 5D2TA 4NZFA 4Y9AA 1YXYA 3W2JA 3P61A 2TYSA 2HS8A 2VC6A 4DBDA 4NJHA 3BGGA 2V81A 3M5YA 3GBDA 1AMKA 4BR1A 1Y7VA 2ZA2A 3B05A 1I4NA 3WDHA 2C3ZA 3FA5A 3ZT6A 1XCXA 2Y7EA 1KFEA 5TIMA 1PHWA 1W54A 3PBUA 2PWGA 4O28A 4ORIA 4AEOA 2FHCA 1LYXA 3L9CA 3GYEA 2X1SA 4JCMA 4DXVA 2E8ZA 3HO8A 4CCEA 2FHBA 5D03A 3OEXA 3C8FA 3LOTA 2V3DA 4LVDA 3EEGA 3T55A 3TAOA 1OX5A 2R14A 2WO5A 2QCFA 3MP3A 3Q94A 3KAOA 3O15A 4FNUA 4RXGA 3TUUA 3NQVA 4LC6A 4JYEA 4NQ1A 4ORMA 2E6AA 4XZ9A 3LV5A 4LVBA 4GIAA 1EP1A 2VFDA 3T7VA 1D9EA 1OFOA 3DBPA 3BLPX 1N7KA 3EX6A 3BVXA 4UQAA 1G6CA 2O7SA 3PS7A 2ZX7A 3W84A 4O0ZA 1TPWA 4PODA 3NDOA 3GB6A 2QR6A 3G18A 1XH1A 3IIXA 3TV8A 5DBUA 5KZMA 3MHFA 1JR1A 1I45A 3HF3A 3IVUA 3DHUA 1UKSA 2FTPA 2XVGA 4MIMA 5K2ZA 3L21A 1OT1A 5DXXA 1BSIA 3ZFHA 2VENA 3WK0A 1QHPA 4AYSA 2BHZA 3WNPA 3GR7A 1VJSA 4JD4A 3DKLA 3V75A 4ZQCA 3GDMA 3TXVA 5F2LA 4X22A 1WZKA 3AJ7A 3HPZA 4M6PA 4GXMA 2E09A 3STGA 3LGEA 5G4WA 5DO8A 2JBMA 1YDNA 1BWLA 1EX5A 4WY0B 1NF0A 3VI2A 1EH9A 2P1FA 1OK4A 3W7NA 1GVIA 3T78A 3NQEA 2GVGA 3VX0A 5AYYA 1OG0A 4QQ3A 3UWWA 3M0ZA 4M56A 3DKJA 3W71A 4C1KA 3ABRA 3L5LA 1I75A 3TW7A 3STCA 1W37A 2EF9A 1QFEA 2ZQ0A 2LLEA 4O19A 1H7OA 1DTUA 2QCNA 4PA8A 1VHCA 3BMWA 4OIFA 1ZJIA 2PCQA 3L2MA 1VQTA 4FEZA 3VCRA 3TFXA 1CW2A 1LWHA 3CZNA 2VEMA 3C2RA 4NX5A 2OSYA 3IEBA 3EJRA 1TPVA 1W5PA 3LI1A 4H4IA 5D32A 5HWNA 1GYLA 3W7IA 3WNLA 3FKKA 4FX6M 4UC5A 1JCMP 1OFQA 1LLWA 1QI3A 3ATYA 1LRTA 5AHIA 4UFJA 4K38A 3NG3A 2ZWYA 5AC7A 4NU7A 1L6WA 3FLUA 3VM7A 5D2WA 2A21A 4JIPA 3M5VA 3L0GA 1AL7A 1H7XA 3N3MA 4EIVA 1XSKA 1TMHA 1O95A 1R2TA 3EDKA 1SO5A 1OX4B 4PCTA 1DEDA 4U33A 3TMQA 4RLIA 2J9ZA 2Y61A 1LROA 1JF5A 2PWEA 3QPZA 1Q4NX 1V7YA 2Y6ZA 1LRQA 4A2RA 3W1MA 1YDVA 3N19B 5D04C 2W0UA 5K7JA 2G95A 4QAWA 1SW3A 2J88A 2Y4SA 3KXQA 3W88A 1KGXA 2ATSA 3BUQA 1L2UA 3L2IA 1KLZA 1KTCA 2Q3RA 4PSPA 2GVLA 4CN4A 3CZGA 4KWWA 1ZALA 4PCFA 1K7XA 2V3EA 2CWNA 4I7UA 5LNSA 1JI1A 1O4UA 4LU0A 4NNBA 1MW2A 2QCCA 4MLRA 3QPYA 4UQEA 1JGIA 1AQMA 2ZUSA 1N55A 1Q45A 1LOSA 1ZENA 2BXVA 2F84A 2TSYA 4WJEA 5AHNA 5HMSA 2TPSA 3GNNA 5KITA 1P0KA 4ZQRA 1KW1A 2Y7FA 3PC0A 2FDSA 2Y5EA 4U2ZA 4O52A 1PIIA 3DFNA 2YOCA 3KVJA 1TPEA 3LHUA 3NO5A 3W38A 4LUJA 2EJ1A 3GDLA 4N2YA 3EWWA 3NZ1A 3W7DA 3WK1A 1Y0EA 1YPIA 4FNPA 3W75A 1HWWA 3L4UA 2B7PA 2QCDA 1E3XA 1LBLA 1ZY9A 4HNUA 1D7FA 3UZ5A 4A22A 1R46A 3WENA 1PCKA 3KVLA 3QQ0A 1T99A 1I2QA 2BY0A 4O4WA 2NX3A 4U31A 1FDYA 1YADA 3NQ8A 2WOQA 2FB3A 3LHTA 2F1BA 3BPWA 3TAKA 1Q6LA 1SSDA 1KBKA 2YW4A 2C18A 3DFSA 1YYAA 3HG3A 5G4EA 1VJIA 1MXDA 3EXTA 3T4CA 4AF0B 5LNVA 3CC1A 3CHVA 4WOQA 3EX2A 1K8ZA 4N4PA 1X1ZA 1JXKA 4JFSA 5I0DA 1WZMA 2W79A 1OYBA 4JTIA 1TRIA 3FAXA 1W1ZA 4WZHA 4Q33A 1G4PA 4UTMA 1HNYA 1ICPA 1F05A 5KSWA 3W72A 3C0JA 4UOQA 5HR7A 3C4UA 3CQ0A 1SUXA 3DZ1A 3GVGA 3GAYA 3PAJA 2QUUA 1ME8A 4UMCA 3VGBA 1JFHA 1EEPA 2NXIA 4GC4A 2YDAA 3VNYA 2EADA 3G1XA 4U28A 1FCBA 1XUZA 1G7UA 4O54A 3PB0A 3TR2A 1CGXA 3MMTA 1IZJA 4JFVA 1LLZA 4WX2A 2VT0A 3N34A 1B0IA 3G3DA 3VGHA 1SZFA 4FX7A 2DJXA 1K3UA 3AO0A 2WPGA 5CSSA 4WD0A 3LB0A 3GXIA 1A5BA 1UD4A 3OHIA 4LY8A 4MFDA 4X3ZA 2VFEA 1MXSA 4HSOA 2VEIA 3CWOX 3SI9A 4QM1A 4BI6A 3L68A 2WVUA 2H6RA 1Q6OA 3P67A 3BUPA 2NT0A 2CLMA 1QPOA 1GVOA 2GJPA 3VGGA 3WELA 5MHBA 3UQNA 3L4ZA 1CXEA 1GCYA 2OT0A 5F2IA 3BW2A 3MHGA 3EX3A 3OIXA 1V3JA 3BV4A 2PE4A 4J3VA 3VX1A 2Z1BA 3C2FA 3W9ZA 2E4TA 2Z2UA 4XQ6A 3AMKA 4S1FA 3OLGA 4MY9A 2DZXA 4JL1A 2DZVA 3PR2A 2CLFA 1FDJA 2ZZ4A 1E40A 4FNRA 5J5DA 1OFPA 3USBA 1Q6QA 1N8FA 3IVTA 1ZAHA 4O15A 4A29A 3HMJG 2A0NA 3OG3A 4AB4A 4WSKA 5KINA 2JKEA 4E2OA 4NUWA 5E70A 1K7FA 5LNWA 4L4LA 3HG5A 1KA9F 2UV8G 3S1UA 4JTSA 5LHFA 1TCDA 5F4SA 4JTEA 5HNRA 5E1QA 4DEFA 3C2OA 1VC4A 1QO2A 3CZLA 1DHPA 1Z44A 2V3FA 1WX0A 4ALDA 4E2DA 4WXYA 3PWAA 3KLKA 4WUIA 4CVWA 3BGJA 5CZSA 2PC4A 3LDVA 2V5BA 3L4VA 4J27A 1QNVA 4X0NA 4KWUA 2YFOA 2FH8A 1RQBA 2QJIA 4Y6GA 4PH6A 2AAMA 4WQ6A 1OFBA 1SFLA 3NQAA 3A24A 1I2OA 3MI3A 1OYCA 5K9CA 3VGFA 3EWUA 5CZTA 3P5ZA 2BXZA 2D0HA 2C6QA 1QDSA 3C2EA 5L6UA 2ZICA 2YX0A 3QMSA 3I7QA 2YYTA 3WEOA 1JDDA 4HPXA 4M19A 3D50A 2OSWA 2CLLA 1QPQA 1LBFA 3WNKA 4I9AA 4Z1BA 3WJYA 2DIJA 1H7RA 1TQSA 1W9XA 5AHMA 2C1HA 2WVSA 3L4WA 1T0OA 1VAHA 4JICA 4ZQMA 2ABAA 3THAA 3EDFA 1ML1A 4POCA 3LXBA 3N2XA 2JK2A 4K39A 4UTUA 1RV8A 1TTJA 1W31A 4N9EA 2FIQA 2ZWZA 3GKAA 3HPXA 1AW5A 2B4GA 4DELA 4TX9A 2FYVA 2ZUVA 2AGKA 3BG5A 5DCBA 3PULA 2NZLA 1H51A 2C8NA 2C19A 4YCPA 1BEUA 2ZX5A 3NPWA 3TJXA 3SZ8A 5FF7A 1GG0A 3W7PA 4PL1A 3KL0A 2V2DA 3CT7A 4AMXA 1TIMA 1VCFA 5I5RA 1O5XA 3STFA 4Z0SA 3G8RA 4KMQA 1OJXA 4RZ6A 3G8EA 1PE1A 4OBTA 4IOTA 3I65A 4JIQA 4LTSA 4XB3A 4XWUA 4AH7A 2F7OA 3NQDA 4AMAA 1KFCA 4UMAA 4K8EA 1FX6A 4NJIA 3SW6A 4CNOA 2C16A 2VFGA 3G1FA 2XN2A 3VSVA 1MSSA 4CGTA 4UFHA 2F1AA 3FW6A 2QAFA 5CLWA 1U30A 1W5MA 4IX0A 1IIHA 4FNTA 3TU9A 1RQEA 2WKLA 1R47A 2XN1A 1SQ7A 2GOUA 3BAYA 5D2XA 2FPVA 2D3NA 4BI7A 5AC8A 3UERA 1R34A 3MYPA 5HWMA 4UTKA 2X2IA 1TCMA 3R13A 4DBEA 1GVFA 1GEQA 5I3KA 1VHNA 4NJGA 1I2PA 5K3VA 1LBMA 4KWVA 3BAXA 4XTIA 1YTKA 3KEHA 1JCYA 3WDJA 4EF8A 1XSJA 3CPUA 4LNYA 4NI3A 2QMKA 3L67A 1KXVA 1EA0A 1XH0A 1TV5A 4GINA 3DX0A 4GFSA 3DX2A 3C61A 3MUXA 3HG4A 3BLKA 3ELFA 1XBYA 1TTIA 3DFOA 3BK0A 3CZKA 5I3IA 3EXRA 4IMEA 1K7EA 2NWSA 4ZZ9A 1THFD 1TJRA 3JR2A 1X8FA 3LTPA 3O6CA 4IMGA 1KGUA 3DU0A 1FY6A 2GPTA 3Q2DA 3NQ6A 3WY3A 2J9XA 3DXIA 1NF7A 2YPIA 2V0TA 2WNQA 4KFNA 1ZHAA 3CM4A 1TPC1 1VPXA 3CZEA 4IJBA 5CPLA 4UXDA 1D3HA 5DXYA 2QDHA 5IM51 4Q4KA 1P4CA 4UFLA 5SWUA 4JX6A 1WZLA 2AMGA 2EKCA 4FIRA 5H91A 3TQ0A 2Y62A 5FF4A 1Q6RA 5FEWA 3I7SA 5C55A 1KWKA 3W76A 1JCJA 1H1ZA 1WPCA 3WN6A 6TAAA 3VU2A 3EX4A 1VCVA 4UFIA 4BF9A 2EACA 1BVZA 1PS9A 1OF8A 6TIMA 4JFWA 1CXIA 3PVFA 1BKSA 3S9YA 3DAQA 4WY0F 4A2SA 3HPSA 1GWJA 1JL8A 4UCGA 3ZWTA 1KWGA 3BMVA 2JGQA 3P81A 3DGRA 5C6MA 2EEXA 4MOZA 2QKFA 3QC3A 3TE9A 3G1VA 1F73A 1TPFA 5K9XA 3M9YA 4JY8A 1RR2A 3BAJA 1L6YA 1QPKA 1VIWA 3TC6A 1CXLA 4UTWC 4JNMA 4TMCA 3WFAA 2ZUUA 4AVFA 5F1VA 2R94A 2RHGA 1YTDA 2E5CA 5I3FA 1U83A 2R91A 1RZMA 2PRHA 3HJZA 4MJZA 1AK5A 3N9RA 1C8QA 2VRKA 1HL9A 4GQQA 3A5VA 2HS6A 3TQVA 1ZJAA 2Z1KA 4FO4A 4E0CA 1JAEA 1JXJA 4HPHA 1XL9A 3DX1A 3E0IA 1TQUA 4KFPA 3LLFA 2VEKA 3W7KA 4O11A 2ZXQA 2EQDA 2Y24A 3QW4B 2VRQA 3OVPA 4BA0A 5LNRA 1QPNA 1YXDA 5KEZA 3M7WA 4UZUA 5I3GA 2FQIA 1B9BA 4JTJA 3LCXA 1XBZA 1J0KA 3JRKA 3T40A 1G1YA 3GXFA 3OLEA 3FJ6A 4MKNA 2H3DA 4A3UA 1BPLB 4QISA 4J3SA 3IIZA 1UD6A 1XCWA 4CN6A 1FWWA 1GPWA 2A1YA 1XUUA 3D0CA 3O07A 2F2HA 3CIWA 2DZWA 5AOUA 2CFFA 1MFUA 1J2WA 2ZXDA 3G1HA 3PB2A 2DU2A 3HGJA 2YA2A 1JQXA 1TPUA 2E1DA 4FMVA 4JTKA 3ZQ9A 3NQ7A 1H50A 4IPIA 5E0KA 2BLEA 2YFNA 3KHJA 1UB3A 4PSRA 1BG9A 1JCLA 3W1RA 5C54A 3PY2A 1TQVA 4WF7A 4GI8A 3LERA 4ZL1A 4JTGA 1VH7A 5KMYA 1PVNA 1WOAA 1G4TA 5D30A 5A2BA 1J4EA 1LP6A 2C0AA 2BY3A 7TIMA 1W3IA 3NQMA 8TIMA 3BUBA 3G1DA 3O16A 1W56A 3KVMA 4O57A 2EABA 1XD0A 1WAUA 4HNTA 3VE7A 4ADTA 1UCWA 2DZPA 2NLIA 1RPXA 1R75A 2WNZA 2GJLA 3FEMA 5DY2A 3LI0A 5DLCA 5E6YA 1OHLA 1G94A 1OT2A 1XXXA 4IQLA 4AHOA 5HWJA 1MXGA 3B04A 2J6XA 1G4EA 1VLIA 1EWEA 5FEZA 3U2OA 4O0KA 1YTEA 4RV8A 1IXQA 5A6LA 1PIFA 3S1XA 3G1AA 2KZHA 3UXAA 3EDEA 1HG3A 1UH4A 4JX5A 2X2GA 3AMLA 3C3NA 4LVGA 5EKYA 3W6YA 2X16A 2YA1A 4JS3A 3NQ2A 3QRHA 2A6NA 4P61A 4GNJA 4QNWA 4LXFA 2Y88A 2YGYA 4UR8A 1RD5A 1KXTA 1KBIA 1PZ3A 3D52A 3WFZA 3F4WA 4YL2A 1QW8A 1TJPA 2FE0A 1W8SA 2QAPA 5AC6A 3L66A 2IQTA 2ZE0A 3UG5A 1WO2A 2DIEA 3W2NA 5EA9A 2XVKA 4M6QA 1NM9A 3OLDA 3TIMA 3MI6A 4XTDA 4W9TA 3D4ZA 3FYOA 3BVTA 1G4SA 3W87A 3QF0A 5D02A 3BARA 4OQVA 1V3MA 4NT0A 1O7DC 4OGZA 4TVUA 3WNMA 3I7RA 5BRPA 3N73A 1GG1A 1S46A 4HIBA 4NJJA 1SO4A 4JEQA 3MHUA 3UPBA 4TU1A 3L4TA 1M7PA 1Q3NA 1XH2A 1EB3A 1MW0A 4JFTA 4MUZA 2G3MA 2B0MA 4PC8A 1EO7A 3UWUA 2Y85A 4UTWA 4ADSA 4RX0A 1VB9A 5G2HA 3W74A 4PTNA 1K8YA 2C13A 3LRLA 3MJYA 3BLBA 4MFEA 3DI1A 4NNAA 4J28A 1SO6A 3GXTA 2GVYA 1QCWA 5U4NA 3OLIA 3M43A 1VCGA 1UKTA 3FKRA 4Z1AA 1CDGA 3A4AA 3UG3A 3BVJA 2ZZ5A 2Q3OA 3W2KA 3FFSA 3R12A 1WDWA 3PG9A 1HVXA 3NQCA 4G1KA 2EPHA 2WVVA 2E8YA 1U2YA 3UEQA 3W1XA 1EUNA 1W5NA 3LBCA 3SGUA 1L6SA 2WPBA 1TQXA 3P5YA 4O17A 3S5YA 3ABQA 1XBXA 1XGZA 1CGTA 1G5AA 3AXHA 4ZVJA 3W23A 1B3OA 2ZRWA 3ATZA 3RLVA 4PEKA 3CU2A 3UY7A 2CLIA 1GVQA 4AAJA 4E2BA 5I3HA 2CPUA 3S5ZA 3ZS4A 1MEIA 4CLMA 4D2JA 2WCGA 3P74A 4LOCA 3IIVA 1KM6A 2RDTA 1E43A 1OFAA 3FYPA 2X1UA 3WJSA 3ECQA 3MWAA 3O63A 1HL8A 1BWKA 4JN6A 1TO3A 3M44A 1JRBA 2FHFA 3W1PA 4QSHA 4LC8A 4CNNA 2HSAA 3S1VA 1TREA 1GVRA 3L2LA 3LTSA 3NR0A 4B9YA 4M8UA 4JDYA 2B7NA 1IV8A 3P84A 4A21A 3I6RA 1RVGA 1WXJA 3IGUA 2E0PA 3U8GA 1KGWA 3K8KA 4GUFA 5HPOA 3HB9A 1A5SA 4O14A 4WOZA 3ZWSA 3ZT5A 4ZMGA 2Z0IA 5F2MA 3TOPA 2QCDB 3PG8A 1GYNA 2XN0A 3QMTA 3L5AA 4R53A 4FLOA 2YR1A 4IMDA 4KKXA 4MAZA 2CLEA 1S5TA 3BUDA 1CPUA 5DBTA 1H7PA 1AL8A 3GDTA 2F7PA 4LV9A 2R8WA 2QJGA 2E68A 1SFJA 1HX0A 4XUGA 2WKJA 2ZA1A 4W93A 4OV4A 1IF2A 4BFAA 3BC9A 4AIOA 2ZZ6A 2QLYA 2PURA 4UTTC 3LPOA 3UWQA 1MFVA 1CGWA 1L9WA 3HIJA 2ZX6A 2XIBA 8CGTA 3S5OA 2CXGA 3ZOAA 3PM6A 4K7YA 5E93A 4JL2A 3NQGA 5IBXC 2ISSA 4TR9A 1ZCOA 2H8XA 2X2HA 2NUWA 4XKYA 1QW9A 1XM3A 2WJZA 3GNDA 4PL2A 4JCLA 5HQEA 1AMYA 4H7VA 5E6ZA 4DO5A 1KFLA 5K9DA 1R2RA 4GRSA 5C5YA 3PUEA 1CX9A 3GBEA 3TTYA 1F6KA 1P1XA 3NYZA 3NXFA 3QYQA 1OYAA 4OT7A 2QCMA 2ZZ3A 2QPUA 1BTMA 1JVNA 3ZSTA 2ZFAA 3CLMA 5H2ZA 4J3UA 1A47A 2QUTA 1DBTA 1F76A 3AJXA 3EWZA 3R2GA 3MBDA 1UH3A 1XD1A 3CGTA 5FF2A 3EJQA 4FLRA 3I68A 3GLCA 4HOXA 3D51A 5CGMA 3S8HA 3GZ3A 1LTDA 4JFUA 3STEA 2ZYFA 1QMLA 2ZIDA 1CGVA 1TRDA 4NJKA 5LSMA 5G1TA 3BAIA 3UCQA 2X1RA 4QAIA 3EJTA 2WNWA 4RZ5A 4LVAA 3LCIA 3DENA 3KRSA 4UQDA 4O18A 4Y96A 4U3CA 1DV7A 1K02A 5BNKA 3W37A 4FXSA 2NUYA 1CYGA 3RF9A 3Q58A 4AWTA 2BHUA 4O4VA 1TYGA 1M53A 1BLIA 3C6CA 3KRZA 1OFEA 1TPDA 3BVWA 4C1LA 1VZWA 5FF0A 3B0UX 4KFOA 3P82A 4RJEA 3LHYA 3M41A 1S5WA 1U33A 4PEEA 2XIIA 3P8IA 2C14A 3OBKA 3SGZA 4DF2A 2OW6A 3H53A 4JTLA 2ZZ2A 4NZJA 1G67A 3EWYA 1QWGA 2WC7A 3WMSA 3LHWA 3NOEA 3W2MA 1KM4A 5G5IA 1LDCA 3W7QA 3MBFA 1RP9A 4ATWA 3QSRA 4R7JA 2ALDA 2Q8LA 3R5EA 3UWYA 2Z6JA 5G1YA 3IK2A 5CPNA 3T44A 1RP8A 1TQWA 1IIGA 2X30A 1MVYA 3BAKA 3SIZA 3THQA 4MY1A 5L9FA 2JGYA 3A21A 1XI3A 1WE5A 5FEXA 3TFCA 2ZRVA 1UASA 1PCWA 3WJWA 1LRNA 1O60A 3VMOA 1T8XA 3C52A 1S3HA 1EPXA 5HXMA 4GUJA 1JULA 4FX8A 3QW3A 2DORA 3TONA 2D73A 1TPH1 3CPRA 4GJ1A 3LCHA 1JCNA 3FJLA 4JTFA 5DCDA 4RZ4A 1M5WA 2RDUA 3LM7A 4UTTA 5G2IA 4N9DA 7TAAA 4MPQA 2J25A 1KFJA 3VE9A 2FGZA 4UFMA 4YXGA 3BVUA 1KFKA 2VKZG 3PUOA 1SMDA 4OKDA 4K6AA 1JG9A 5CG7A 5IBXA 1D3CA 3CTLA 2Y89A 1M7OA 3W7GA 1Z48A 2AQWA 5LGZA 3PBWA 4O10A 1H3GA 3E96A 1U5JA 5CZ0A 3PBVA 5FF3A 5EL1A 1E51A 2QCLA 1V3KA 5EY5A 3TROA 5CGTA 2NUXA 3B8DA 1DVJA 5TQLA 1I2NA 1IZKA 3GKFA 3EDDA 1KBJA 1CGYA 1AW1A 4X9YA 2A6LA 1C29A 2GJNA 3B4UA 1H62A 1KTNA 1OFRA 4UNIA 5HUPA 5FEPA 1Z41A 4PFMA 4OWGA 2X1TA 3GXNA 4BZYA 1H5YA 4IWWA 3DX4A 4O1BA 3NL6A 4NX0A 1KXQA 1SW0A 2FPTA 1OF6A 3BLIA 9CGTA 3CV5A 1VYSX 3DH7A 2V2CA 4K36A 2H3BA 4BWLC 3ZR5A 3QGVA 2DZSA 4UTHA 1OGSA 1GJWA 1JUBA 2OYMA 5CLTA 4BK9A 3GXDA 2QDGA 2V9DA 1QX1A 2RH9A 3P7YA 1SPQA 4RXFA 4OHQA 2VOMA 5D09A 2X2JA 3EWXA 3ZT7A 2J9YA 1PEZA 4LW7A 1ZS2A 3K8MA 1XBVA 1FWRA 2P10A 4P2VA 4U4MA 2E5DA 3F4NA 1QPRA 2QUVA 2ZXBA 1E3ZA 1ODUA 1TQTA 1TTQA 4H2CA 4EF9A 1DL3A 3NPUA 1PJ9A 1HT6A 1XKYA 2BY2A 4MYXA 4YMZA 2ALWA 3LRKA 2I1OA 1XDMA 3M07A 3UNDA 1MEHA 4GO8A 3TJLA 4GWEA 3G0SA 1CXHA 1GT8A 4M5PA 3O05A 4N6EA 4FB7A 5AYXA 2A85A 4FNSA 3A6OA 3O6DA 4DO6A 2PRMA 4MJMA 3W1LA 1W3NA 3TMLA 3DFPA 2ZZ1A 4NVTA 2CZFA 1VLWA 2D0GA 2FFCA 3TH6A 4N9BA 4GQRA 4HNNA 2OMAA 2Y7GA 3U6WA 4AEFA 2H8ZA 1QR7A 4N02A 4J9JA 3INPA 1NFBA 3MO7A 1GJUA 1LOQA 2TMDA 1KM3A 1TPB1 2BX7A 3IIOA 1SMAA 1EP3A 1JUEA 4Y90A 1F5ZA 1F7BA 1ZFJA 3OVRA 1W5OA 3BSHA 3H54A 4J3XA 4UZSA 1KM1A 4DPPA 3W7RA 5EYWA 3NVTA 3RK8A 2RFGA 3G0UA 5FI8A 3EJSA 5CPMA 2CHNA 2G96A 1FBAA 3ABSA 3IJ8A 2D3LA 3K30A 1QOPA 2QCGA 1HFBA 3K1DA 4JX4A 3TTSA 1Z42A 4R34A 1GTEA 2Z6IA 2E5BA 1NEYA 2ZX9A 4HSNA 3UXDA 5LHEA 1VFUA 4DQWA 1UJPA 5C2XA 5CSRA 3W3OA 3LX9A 1FXQA 2BZNA 3L4YA 3BUIA 5AHFA 5U7SA 1IXPA 3W7LA 3LCGA 3A9IA 3CZSA 1WA3A 1IXNA 1YPFA 3VMPA 2ZUTA 2H90A 1EIXA 1HO4A 3L65A 5LKYA 1DKWA 1GZGA 1JIBA 2EO7A 3KL3A 4ZQNA 1JD7A 1KLYA 4UNLA 3AXIA 1G7VA 3KLLA 2W6RA 3UYCA 1SZGA 1PIGA 5T26A 4GE8A 4MYAA 4UNKA 3M1ZA 2QPSA 1ME9A 3IV3A 2YIHA 3EKLA 3NPVA 1ALDA 4J3TA 3OVQA 3E12A 4BWLA 3A47A 5A2CA 2NXHA 4JGDA 4EWND 2VFHA 2WSRA 2VUYA 1H63A 1UD3A 1KB3A 3LHZA 3KL5A 2WSKA 3MW7A 2OYKA 5CZJA 1NOFA 2E9BA 3DFQA 4E38A 2CZEA 5KZDA 3W86A 1F6PA 3WY1A 2NV1A 3KE0A 3S6DA 2NV2A 4LPCA 4RKAA 1MW1A 1IGSA 2FLIA 1VFMA 2VR5A 5TBOA 3ZR4A 1WZAA 3W1QA 5DFAA 2F7QA 3S5NA 1DQXA 3SJ3A 1WOBA 4FLQA 1K8XA 3BSGA 1DHKA 2D2OA 3DDFA 1VGAA 5K4XA 1UUMA 1TSIA 2CLHA 2EHHA 2CZ5A 1H1YA 1WP6A 3IGXA 3IRDA 4HN4A 4AWSA 3TXZA 1VYPX 4GUGA 3HGSA 2PWDA 1KXHA 1JRCA 3EB2A 4LS2A 4Z1DA 2OX1A 2WSQA 3IJ9A 3M5ZA 3HJEA 4OE7A 3GR8A 1B57A 2B7OA 3QH2A 3HGRA 3LBMA 4O8RA 4UUIA 1Z32X 2GQ9A 2WNNA 1V3LA 3WY4A 3TKFA 4B9ZA 4MZYA 1QAPA 2CW6A 4IGHA 4O53A 2CLOA 4HHPA 4IXHA 5F2GA 4N4QA 1X6UA 2V82A 3E49A 5AB3A 4WY0A 2F7FA 1LWJA 4GI6A 2F61A 3W7CA 3KRUA 1CI1A 2VXNA 4MLJA 2WSPA 3O8AA 1UBSA 3MI2A 4Z08A 1OK6A 1AW2A 4ZQOA 1SSGA 1MW3A 2WSYA 3VGDA 4CKQA 1GQNA 1JI2A 4CN1A 2CLKA 3DFTA 4Z1CA 1BF2A 3WDIA 2OZ0A 4O16A 4GKLA 2XVLA 1D3GA 1FCUA 3VSUA 3D4YA 5A5WA 5F1UA 2ABBA 7CGTA 3NL5A 3NA8A 3TSDA 1WYIA 1KV8A 3UY8A 4O50A 1RPKA 1ZAJA 1PL9A 4YCOA 2IGTA 3IGSA 2DH2A 5HUOA 1PS3A 1VRDA 3L0KA 3EWBX 1BAGA 1KM0A 1OX6A 1L0PA 3TC7A 2ZDRA 5DCEA 2YA0A 1B2YA 3P8JA 1OVDA 3DX3A 3E9AA 4Y8FA 3NAVA 4JR5A 4O1DA 4JDBA 3GXPA 3A22A 2NX1A 2YW3A 3RLUA 1H61A 4K37A 1AG1O 1DJNA 5EBUA 3PF3A 2Q8ZA 1UH2A 4WXZA 4MZ1A 2OJPA 5EMUA 5FESA 3S2CA 3KX6A 1I2RA 5D2YA 1OX4A 1JCXA 1DJQA 3W1AA 1NVMA 3F03K 3LTYA 2PWHA 3BLFA 1YDOA 3W7OA 3SFKA 3L4XA 4QITA 2WV8A 3F1QA 5F4WA 1OFDA 3CB8A 3NPXA 2OW7A 4LUIA 3W2UA 3GXMA 5BMXA 3EKZA 4NXKA 3TCEA 2OYLA 4OJYA 3W7JA 4FHAA 4S2BA 3ZSSA 5HULA 1KBBA 1B4EA 4DO4A 2RKXA 4MZ8A 2WVVB 3IJ7A 5I23A 1MO0A 2PRLA 1V5XA 1MEWA 2VFFA 2F18A 5AN7A 3VGEA 3B0VC 1W5QA 3A5FA 4CCCA 4JYDA 3N14A 1TV7A 2NX9A 4O12A 2D0FA 3HZ3A 1T96A 3TNOA 5CKSA 1VS1A 2A7PA 2YKKA 3SECA 3GDRA 1YLVA 1B4KA 2ISWA 1CLVA 1X7FA 2A7NA 2YZRA 1CXKA 1FWTA 5HDRA 3GK0A 4ONVA 3VNDA 2HTMA 3FS2A 1WBJA 3PUDA 3RMJA 3TA6A 4UR7A 4ADUA 1EHAA 3LXCA 3CWNA 1JD9A 4UTLA 4UMBA 3W2LA 4HNVA 2QCEA 3W70A 3JS3A 4JXCA 4Z0JA 1DORA 4K8HA 2ATMA 2ZZ7A 3UWZA 1A53A 2C15A 3W83A 4CNPA 2C7FA 4FIQA 3TK7A 5K4ZA 1FXPA 5AFDA 5BRBA 4JTHA 2ZTKA 4M7SA 1O94A 3QEZA 1MZHA 1ZNNA 3BCFA 1KFBA 3O6YX 1UD2A 1VFOA 2GUYA 1FQ0A 1PZ2A 4WLCA 1CIUA 2P0OA 3A23A 4XBKA 3RILA 4YLWA 3CEPA 4JY9A 3V1PA 3BAWA 5HJLA 4I7WA 2YCEA 4AF0A 3UWVA 1R2SA 4NNCA 4TO8A 1VR6A 5CGQA 5DN1A 1X1OA 1QWNA 1UA7A 4LVFA 4ZQPA 3HG2A 1GOXA 3P62A 1SU5A 4MVAA 1IXOA 3SSJA 2PWFA 2FB2A 1PHQA 2OSXA 5E9AA 2TRSA 2ZA3A 4HP5A 1KCKA 1H60A 3VFLA 4H6KA 1SW7A 3ABOA 5DY3A 5D33A 2E6YA 3TDFA 5A2AA 1G69A 2ZTJA 3DI0A 4UCFA 1PAMA 1OABA 1ZJBA 4UTIA 3RU6A 3KWXA 4ICNA 4EVZA 4OU1A 4LS0A 3BCDA 1UOKA 1XDLA 1J5TA 3Q37A 4XKYB 4CQ8A 2XWDA 3G1SA 4HA1A 3O1NA 4S2CA 3VNZA 1WQ5A 2ZRZA 1A5AA 1R33A 3NZRA 1OB0A 1NAL1 2Y70A 5AHLA 1AVAA 3GX9A 1S5VA 5I24A 5EPDA 3WNOA 1SO3A 3UG4A 1A50A 4RCXA 3LCWA 3W73A 4QIUA 1WBHA 2ZUWA 4H3DA 3DHPA 5TD4A 1XCFA 2E6DA 3B0PA 3G0XA 3W1NA 3LPPA 3MP5A 4L4MA 2NSXA 5E0FA 4GUIA 3C56A 1EWDA 4O1CA 4XBSA 4FXRA 1LZOA 3EX1A 1QOQA 2DP3A 3MYOA 4Q32A 2BY1A 3UD6A 3DC0A 1UD8A 1CGUA 1NSJA 2I14A 5EMYA 2OCZA 3VO0A 5BRQA 1HTIA 4LRTA 4YWIA 2O7QA 2BSLA 2J24A 4H8VA 1FCQA 3CIXA 3HQ1A 4O1AA 4FLSA 1F2JA 2A7RA 3S42A 2XFWA 2NWRA 3EXSA 3TQKA 3BG3A 4FF7A 3M6YA 5I3JA 5HINA 2FH6A 3R89A 3W7MA 4RK8A 4AIEA 4WSJA 4RR4A 3W1TA 3N9SA 5G2WA 5LGXA 2WCSA 2EAWA 2V8ZA 3QQ1A 2I9EA 1SZEA 1O5KA 4DF1A 1ICQA 1JUKA 1P5BA 2E6FA 3MP4A 2QF7A 1RQHA 1F74A 3BO9A 1JDAA 1LOLA 4HPJA 3FIGA 2QMJA 1G9HA 1TTPA 1PPIA 1QI5A 1AQHA 4AWUA 1TQJA 2FJKA 3LCLA 3NNTA 1C8VA 3KVKA 1GTHA 2WVTA 4N6FA 3B03A 5GVJA 2ZXAA 4MY8A 1PV8A 6ALDA 3S1WA 3TSBA 1HUVA 2RDWA 2EGZA 4LRSA 4QNEA 4TMBA 4LV4A 3GDKA 2BWGA 1KM5A 2DJLA 3ANYA 3C2VA 1UUOA 1MWOA 3SR7A 3CEUA 3TSMA 1W3TA 1FDZA 1HO1A 1P6WA 2G5WA 4DPQA 1CXFA 3M5XA 3RNDA 2TAAA 3VMNA 3QSTA 1EUAA 2QCHA 2YYUA 4AEEA 3NM1A 3L0NA 4AYGA 1FCVA 2AAAA 1H7WA 3EJUA 3HBLA 2DZTA 4HKPA 4K7VA 3E02A 1J0IA 2WQPA 4UQBA 1ZAIA 2BTMA 3NM3A 3W22A 4LT9A 2ZCGA 1QO5A 5J5RA 1FWSA 3PBYA 4AMWA 3NL2A 1EP2A 1KM2A 1SZNA 4O13A 1XV8A 3DDGA 4UOZA 1LM1A 3HGOA 4HOWA 3RIKA 3KOFA 3P60A 3QM3A 4M7TA 2FPYA 2GJRA 1UKQA 1UD5A 4UFKA 2EAEA 5AHEA 4EOUA 1GJPA 3W1UA 4HOZA 3G22A 1KTBA 3GAKA 3RFAA 3WEMA 2A4AA 3DHFA 3PSVA 3W7HA 2ISVA 4UTJA 4OV9A 1UA3A 1XFBA
chains in the Genus database with same CATH superfamily
4DVBA 3QUZB 2CWUA 5DURB 4OY9A 2C3HA 1JZJA 3G5VA 2PYEE 5FUOH 2EPNA 5MERA 3G3MA 3SYPA 1DQWA 3CXDL 2DT1A 3GRWA 4X9HA 3MANA 1DCLA 3OKKA 3GUTA 4F40A 1YJDL 4PS3A 2W1NA 1ZMYA 2L7EA 3AALA 4DF0A 3VFNB 1XIEA 3C09B 2QV4A 4CAGA 1LCOA 4HKZA 2RQEA 5BCAA 5EOTA 1INEL 1KJVB 2R0KH 4DUWA 3EDJA 1OM0A 3G24A 4B91A 2VM3A 1WFUA 5CSYA 4RBPH 3MLWH 4ECNA 2BMKB 2BXYA 3C6EA 2BCKA 3S36X 4AUUA 3BZ4A 4B5NA 1QI4A 4FQXC 3PSWA 1KPVB 3W5MA 2QSVA 1IC4L 1GVSA 5HYJD 4N0UB 2G3NA 4GBUA 4FPSA 4DTGL 1I9RH 5DO2C 1RZ7L 3UPWA 3UYIA 1E5CA 3OG2A 5C9UA 3ZDZB 5BO1L 4XNMB 4A2EA 3ITCA 3S35X 1HSAA 4NQXB 1JPSL 1PKQE 1M7XA 5DJDA 3C75A 3NIFE 4YHZH 1LL1A 1PSKH 5AUMB 5MKGB 2ILLA 1SY6H 3R43A 4ZTPL 5CC5A 1XLLA 4BZ1H 3GI9L 4JCMA 3D25B 2WZSA 1A1OB 4KKLC 1QR1A 3EEGA 2Q9OA 4BINA 4X6FB 1QYGH 3NT0A 1HQRA 5CJQH 3E6FA 5FYJD 5HHME 3FNDA 1PQZB 4R85A 4Z8FH 4RW5A 3V0VB 5EIVA 5AW6B 1GPFA 1Q0EA 1MLCB 5KZMA 3QFJB 1R5VB 1HSBA 3MBWA 2WHVA 2FUTA 2YLLA 4L7ZA 3L21A 2E59A 3V5KB 4M93B 1AH1A 3H26A 3MY9A 4PJBA 4PWIA 2F5BH 4ZQCA 5F2LA 2HQAA 1ZA3B 4PMRA 2JTDA 4MMIA 1NF0A 1T7WA 4DEPC 1MCPH 3LD5A 1V0NA 1IL1B 5CH9A 4YFLF 3GC3A 4MZRA 3TFXA 1E6OL 1XBDA 2IVFC 3UVIA 5KYYA 1MCOL 4OT1H 3GC2A 2QJDA 2IAMD 2X09A 5D1ZA 4C4BA 1QNZL 4N85A 3WF4A 2A21A 1YMMD 4JIPA 2WO3B 4BZ2H 3O6KH 2PZ0A 1NC2A 1BYAA 4HYRA 5IMMB 1HH9A 4BQ8A 2BSBA 5BXFA 3CVHH 2AQVA 1S5IL 2W0UA 3K6FA 2R23B 3IJLA 4R8WH 3QYMA 1SBBA 1K7XA 3WTVA 5B39G 1E0OB 2P46B 4K5OA 3QPYA 1LOSA 1ZENA 2TSYA 5T1LB 4YDIH 1U3ZA 1LP9B 3FTWA 3HKZA 2HFGL 3NO5A 3QR0A 4Y1AB 1HN1A 1WKDA 4F66A 3UBFA 3W75A 2MCPH 3E2QA 1LBLA 1NCJA 4O4WA 2HJKA 4U31A 3LMJH 3UJJH 2XHNA 1JWSA 3W11D 5JBEA 5KN5B 4NFDA 1Q6LA 2HVKB 1WAAE 3VI4A 2ICSA 4MUPA 1FOBA 4GP4B 3QNZB 4G8FB 1M56B 1ORSB 5I0DA 5DJ2A 3DERA 3AXLA 2AABL 3EXLA 1JK9A 2DSUA 5EUOE 4ACTA 1QZNA 2ZWNA 3V0JA 2BFVL 3SGKA 3FT1A 1AG6A 1MFBL 2JQMA 4URIA 3VCLB 5J1AB 1E5JA 4E3VA 5EFDA 3L9YA 1RK1B 5A8NA 5F7DA 2VDLH 2VT0A 3N34A 1B0IA 2JKLA 1KCZA 3GVQA 3TO4A 4FX7A 2NY7L 3M64A 1H09A 5EEYA 2VFEA 4I8DA 2F6XA 4BI6A 3SCSA 2H6RA 4IOFC 3OKLB 1XIWB 3BZGA 1A4JB 2IWEA 1RFDH 2FB4L 2EDYA 4XTRD 3DETD 4U6VL 2Z2UA 4MNLA 2NYYD 3GLZA 2OULB 2Q7NA 5IESL 1A1NB 1E40A 2ZZ4A 4YBQD 3IVTA 2A0NA 4M43L 3S98A 4FNLH 5SWZB 2EXOA 5LA2A 1XG4A 2G4JA 1KA9F 2PMZA 4KO7A 4XNZB 4OQTL 1ZS8B 1XLFA 1KTDA 2ON3A 1QO2A 4UT7H 4BK5A 4AL8L 1Z44A 5I19L 4Y7MA 4UIMA 7XIMA 4J27A 1MCHA 1UGNA 1NCBL 5DEZA 1MAKA 1HNFA 5I06A 1OAUH 1Z5HA 2FBJH 3FVMA 1PDZA 2EIKB 3C2EA 3TYAA 1G6VK 3OKNB 4NQCE 1IM9A 2DW6A 1DYSA 1NWRA 3WNKA 3RRXA 1PEWA 4GRWE 3N04A 2B0SH 4IG2A 1BIIA 4JZ5A 3N2XA 4NBYB 2KZWA 4N9EA 1QTYT 1CVSC 3PWPE 4CQDA 1PLGL 5E8NA 1UEYA 3KWUA 3PULA 5AB9A 4HQVA 4JRYE 3QWQB 5HSFA 5FDWA 1D5XB 3PTDA 4IFOA 4XX1E 4M7JL 3H8NA 4WJ5A 1TIMA 5GS1A 5AKSA 3B9AA 1T04A 3LTVA 4XWUA 1Q2RA 4AH7A 4PRIE 1TTFA 4JGUA 4CGTA 3V0IA 1FYTA 1IIHA 2BS71 4LB3A 3D6NA 4X8XA 3QPKA 2QLVB 3R1GL 1Y5WA 4Q8OA 3UERA 1XIMA 1ISVA 4C6JA 3N1PC 3MBEA 5DFVD 3MUGA 4KWVA 3WXWH 3QOKA 1S7VB 2IEPA 4RESB 3LUTA 2QMKA 2Y9RT 2VWEC 5T8GA 3C61A 3KP0A 3HCVA 1FWGC 4CVUA 3B6SA 2WXRA 5J6GA 3P0GB 3ARFC 4Z7OF 3LNGA 1X8FA 3FYEB 1VACA 1XZ0B 2XKUA 3NJLA 3AMGA 3EFFA 1XQ4A 2YUXA 1TQCC 3EGXA 2AMGA 3GB7B 1P4UA 5PAZA 3UR7A 3QDJE 1YEFH 3F4VA 2XIQA 4WW2A 3WIFA 6TIMA 4GRLB 3U6XA 3PJTA 4A2SA 2CXEA 4AFYA 1GWJA 1JL8A 2J62A 3UDWA 3U2SA 5C6MA 3FB7B 4I2XA 2VDOH 1F07A 5DJYA 2E5CA 5HNTA 1AK5A 2HS6A 3E0IA 1FNAA 1BF8A 3W7KA 4O11A 2PDJA 4NENA 4LBAA 3WTWA 4NQQA 4ONHA 5KEZA 3DI2B 1XICA 1A5NC 1MFUA 1D9KA 4Q4IA 4FMVA 2R0LH 1XCQB 2P0IA 3ZHDA 4GXWA 2WYZA 5EC1A 3PTQA 5ABFA 2IADB 3CX5K 1ASOA 5LCVL 4CGUB 2AVFA 4HNTA 1GZPA 2QTEA 1UCWA 3LQAC 5E6SB 5J12C 2GJLA 5DY2A 1QSFA 4P05A 1P4BH 4M1DH 4NN6C 5CSGA 2OZTA 1BGAA 4RV8A 5DT1H 5A6LA 4M1CC 3WFEL 2KZHA 3UXAA 1YPZE 3R8BB 4Z9KB 2X2GA 4FA8A 1OPOA 2X16A 3I02A 1DBMH 1GZJA 2UXTA 3ATDA 3NQ2A 3IDJA 3PTMA 2P5WD 1UXMA 2QYGA 5CBBA 2IPGA 1JERA 1OF2A 4HCRH 2VSKB 1R0MA 1RBAA 4HA0A 2ZYRA 5I09A 1E9OB 4KC3B 1E6PA 4DJFC 2I7GA 2APSA 2CHDA 3GSOA 2VP8A 5FYKE 2C9XA 4YHLL 3GMMB 4NM4H 2IKIA 2ZWLT 2HVJB 1Q3NA 4JFTA 4JQ4A 3F5WB 2DLHA 4C57C 4Y8AA 2GVYA 5C3TA 3CHEA 3HG0A 4OZFB 2VH5L 4WDIA 3ARDD 1FC2D 2AAVA 4B9PA 4ELMB 2J72A 5JW4M 4KRNA 4MD5B 3PREA 4X0KA 4K73A 1I7TB 1NICA 2FEDC 2DVTA 1OSZB 4FP8L 3RLVA 3QAQA 5MEOA 4AY1A 1FVDA 2F6KA 1KM6A 1OFAA 3UTSB 4AD2A 3QFYA 4HN8A 2HSAA 4GYBA 3UGXA 4YHPA 2B7NA 1IV8A 4N2AA 1RVGA 4WWKC 1FJ1B 1NEZB 5DR5L 2PTXA 1E2ZA 2Z0IA 1A4AA 3QG6A 1OVZA 4R53A 1DDTA 4LEOB 1E8XA 3VFWA 2F7PA 1A3RH 4LV9A 4P0DA 3LNMA 4C6PA 4XUGA 4AC4A 1ZVYA 2FMNA 2LTQC 1B31A 2ZYIA 3AU0A 4J2PA 4Y2DD 3OGCA 1WMPA 5DJ8A 3S5OA 3EYFA 1LUCA 6PTDA 5LBSA 3K46A 5IBXC 2NUWA 1NBVL 1J8HE 4UV7H 1WCQA 1Z9PA 3GU2A 5C07D 5DJAB 2RD0A 5D8JH 4CRPA 2XZCH 1KIUB 4HIXH 3EBAA 2JI1A 3FSWA 2WUBL 3QUZC 4UINH 2B1AL 4E9YA 3S5LA 3AJXA 2WSDA 3CH1A 3R2GA 4H9YA 3CGTA 2LR4A 4I85A 5FF2A 4F0KA 2NYZA 1T2QH 4IQEA 1FFNA 3N42B 2YCLA 2YN5A 3MV8E 3O3BB 1LO4H 1M3IA 5ESQA 3AT0A 3WH8A 2GJXA 4UQDA 1K85A 4BRJA 2HBXA 3BFQG 3VRIA 3RVWC 4BTXA 4KVCL 3C09C 4O4VA 2R1WA 5FYLD 4C1LA 5F9DC 5ANME 3TBCA 4X6EA 5IQ9A 2IUZA 3S3GA 5DANA 4AK2A 1RWGA 1WQVT 2CJUL 3SE4A 1VRSA 4KI5D 4RMSA 1OAYH 3K7UA 1XI3A 5IJVA 4N8CH 3ZE2E 5I17B 5FO2A 1UASA 3C6LA 3VXMA 3IVKA 3PIQB 4WCYL 2XSAA 2D73A 4GKZB 3V4PH 3LCHA 4JTFA 2DSZA 5IIEA 1E90A 2RDUA 3DJSA 2FGZA 3ULUD 3KS6A 4WIWA 3BVUA 2J8GA 4X6BB 4ALAL 1H3GA 4PB4A 1JHTB 5CZ0A 1XS2A 2W88A 4X9BA 3V5HB 4K4KA 1UTDA 5TQLA 1ZZMA 4CCZA 3U0PA 4UIKL 5JH2A 1KBJA 3F58L 1YA5A 1PJWA 3HMWH 1CO1A 3L1EA 1CZ8H 1OC7A 2B1HL 1D5IL 2XHYA 3F3HA 1W0WB 1PDYA 4GAYA 4XWOC 4Q0XH 5A6AA 4HGKC 1UCBH 1VGKB 4XCNA 3IXTB 2MPVA 2RH9A 2PN5A 3IFLL 2GOKA 2Q76A 3R25A 2UZYA 3ZT7A 2AC0A 3I9GL 1MG2C 1U1JA 2IGLA 4YSDA 4XP5H 1E3ZA 2DICA 4I3RH 5DQ9B 3FQRA 3O11A 4JNZA 4EF9A 4GBXD 1PJ9A 2CO7A 5AYBA 4KITB 5CCKL 1SVCP 1RY0A 4GO8A 3QQ9D 2L5HA 5L9DH 4M93C 1CXHA 4M5PA 1MCFA 3A6OA 2XPZA 2DZBA 1A3WA 4MJMA 3O3UN 2OMAA 1J7VR 3CFMA 3UTTD 4GVFA 1EJRC 5HHXL 4H9ZA 2ICWI 2NR6D 5HYJE 2HXUA 3B9EA 1FNGA 1F7BA 4GNVA 3OVRA 3EHBB 1MNSA 1X4YA 2V17H 2R27A 3GNPA 3STZA 1LEKB 2NLJB 4DGVH 2AEPL 2FX8H 1EKMA 1GIGL 3W3OA 1NBYB 1R3HB 3L3OC 3UJFA 1IXNA 2GQHA 1GW0A 2AOSA 1DKWA 4WGHA 3BI9X 3RITA 3E7JA 1BWWA 3BQUD 4MYAA 5CC7A 1WD9A 4KU1A 5FSEC 3UCRA 4ZW7A 3ES7A 3QZWG 4EWND 4Z1YA 5ADPL 1UD3A 1J1PH 1SFSA 3LHZA 5B8CA 4KX8A 5CZJA 4E38A 2YPLD 4PV9B 5KZDA 5FYJE 3FS9A 5EZPA 1BG4A 2POTA 3DXAD 5I1JL 4PJGF 2JF1A 5DD5L 4S3FA 3BH8B 3PDGA 4WU7A 2CFWA 3S4CA 2HG0A 3JZYA 4QKXB 5BZDB 2WHLA 3WFBL 1CICD 3IGAA 1ZUAX 4DETA 3BO8B 4OZHA 1DQTA 1U58B 2WSQA 1DQKA 3DUSA 1Z32X 2WNNA 3TKFA 4AV5A 4JPWL 5E8EA 4KK9C 2CLOA 3M0MA 1X6UA 4ZS6D 2HNEA 4GIOA 2XZAL 3UBXB 1OBAA 4ZQOA 5TFSH 4CKQA 2CLKA 4NAFA 3B34A 4ERIA 4GCAA 5GJSH 4O16A 4DWSB 2PDPA 2PO6A 4HBCH 1GQIA 1KV8A 1ZAJA 1PL9A 5IFPA 1SLWA 3KS0J 1MJ7L 2VW4A 3MU7A 4F7KA 4JRXA 4MD4A 3VFPB 4NJAL 3NAVA 4PAZA 3A22A 1VFBB 4PVNA 3SQSA 3JYCA 3REWA 4HSQA 4K37A 2X6BA 3GIZH 3DDMA 3NP3A 1YMME 1LLAA 1XIWC 1JCXA 4XNUL 1NLBL 3AWEA 3T42A 4HW6A 3G2GA 3RWEA 1U22A 3N9GH 5EU9A 4IRJB 4DO4A 4PGCB 1P84J 1MO0A 3QN3A 4WK2B 2CLVA 2R1XB 3W0WD 2EECA 4BXSV 3N0AA 4XNZC 3MNVB 4QKTA 1X7FA 3MJMA 1V77A 1FO0B 3PF2A 4KS0A 4LLVA 3WFHB 1ONQA 3BURA 4OFPA 5B38A 3EYUH 4Z0JA 4C54A 1B54A 2C15A 4CEUC 4TL4A 5TE6L 4Z6AT 2DQDH 1TLMA 3FCSB 5KW9H 5JPNB 4NKCA 3GO1H 1K8IB 5JPMC 2AQ1A 2EO1A 3V1PA 1K1XA 1R2SA 5CGQA 4ZQPA 4FYTA 2GAZB 4JTDA 4GOAA 4BFBD 3VFLA 2E67A 3CBKB 3DI0A 3R06B 4QRQB 3BCDA 5HDBB 2ZG3A 2YSTA 1INDL 3I6GB 2OVLA 2XWDA 2EDBA 3MVTA 4HA1A 3MV9E 3VNZA 3NZRA 4R7XA 4LNRB 4WZ9A 3JWDC 1YEHL 1QACA 2PDUA 4JHWL 1WBHA 1T4WA 2BGSA 3P2TA 3MP5A 3LSOB 3PGCA 3FQTB 1EJUC 3ZY7A 3MRBA 4HJ0D 2W67A 5EMYA 1BJ1H 3SGEI 5JIIA 1J11A 4Z7VA 1H3PL 2HEJA 1BG1A 4FLSA 4GSRA 3IRZA 4JHAL 5ADOH 3RIAK 5KVDE 1U3YA 1MF2H 1HKIA 5DHYB 4PTTA 2WCSA 3MRLA 2WYHA 1ICQA 1KN4H 1QI0A 3D85B 3RVTD 5BS0E 1BZEA 5K9OB 2R1KA 1Q6EA 2OL3B 4KKCC 3G08A 2WVTA 4E41B 4R7WA 4LP4A 4B95C 4GRLC 5M95B 3SR7A 4FXGA 1ITBB 4RH4A 1OTSC 3DBSA 4QF1A 3KPQB 3GE7A 4ELKB 4PYHA 3A0OA 1Q72L 5J06A 3SRFA 4JM4L 1LJYA 2WQPA 2XWJA 3QC0A 3NM3A 4K3HA 4TQ8A 4F7CB 1FRGL 3T1FB 3TBSA 1XV8A 3QZPA 5B21A 3HNTH 3HRZB 3T0VA 2VR3A 3PJSA 5E2WL 1YJDC 3E6HA 4G7QB 4UTJA 4OAWB 1VKXA 2PP7A 1KCVL 3Q9PA 5C0GB 5EU6B 3T0AA 3WNNA 2ITCA 4JFZH 3TV3L 4WVRA 3RVUD 5CPOA 1IGTA 4M3PA 1URZA 2V5LA 2R59A 4BV1A 2JKPA 3D9AH 3BW4A 3G5EA 3RPKA 1FCCA 3IKCB 1P7KB 3SQBA 4N2HA 3M16A 1YXCA 4X9SA 4H8UA 4ZSTA 5E6ID 5A6MA 2H32H 4PRHB 4X5LA 4GMTH 3RDTA 2XWEA 4LUSA 3S2MA 1QWUA 3H7LA 2DKMA 2VX6A 2ICEA 5AYUH 2GQAA 1M1XA 2Z4QB 2B77A 5IVXB 3EH3B 4K94H 3DNKA 4PJBF 4A2FA 1RI8A 3NGJA 1QA9B 2PP0A 1H3XA 3R8RA 2HVBA 3VWKD 3M47A 4FFZA 3CLFL 4IBTA 3S35H 4IIQC 2VEPA 1GHFL 1KDJA 3TBWB 4JYFA 2D1WA 2AL2A 1IGJA 1J0HA 3HC2A 2HX9A 2LQRA 1UCTA 3LLDA 2XQYG 1YEGL 5AOZA 4GO9A 1BVNP 1VYRA 3BP6A 4DBDA 1Y7VA 3B05A 1RK0B 3VXRD 3E0VA 4JZNA 3DURA 1KB5B 2WINB 5AEAA 1LYXA 4D94A 2E8ZA 4JKLA 1SEQL 2EIZA 2QCFA 5I8KH 1C9SA 3KWTA 1RZ8B 5BXPA 1RUKH 2R2BA 3T3PE 5ABAA 1FVEB 1OTTC 4AJWA 3MROA 4UQAA 4X50A 3ORWA 3PS7A 2G41A 4PODA 4AD4A 3NDOA 1XH1A 1M7DA 3HF3A 3PP3H 5K2ZA 1Z7AA 3QQ3B 2IGFH 2P5WE 3TM6A 4QRUA 3IE9A 4PGLA 1WA0X 4Z76A 5AZ2H 3LGEA 3HZKA 1KGYE 1MHEB 1BWLA 4WEMB 2VI0A 3N6YA 5DLLA 1E28A 1EX5A 5L8JB 3DIVA 1PTAA 1JF1A 4E9SA 4WJXA 4MWFB 5ACZA 1QFEA 5FL0A 4OZIA 1TPXC 4OV5B 1LO3H 3ZJ8A 1RH9A 3CZNA 4GGBA 1E42A 4QCIA 3FH5A 1T3FA 1SZRA 5T3ZD 3FKKA 1OFQA 2YXXA 1XF2A 2Q7YB 2XV0A 4J12A 4APXA 4FQ2H 2R2EA 5D4JA 5IQLA 4GFXA 3LRSA 4XVEA 1HOCA 2LV4A 1SO5A 1RY7B 2PLKA 3WS6C 1VPOL 3BYTA 1LROA 1RWAA 2WW2A 1ZLSH 5LXEA 4RNFA 1IEWA 3V4VL 3W88A 4WWNA 3ZMRA 4LSTH 4NYYA 1WT5C 3CZGA 3BKCL 4JFOB 1NAKL 3PJNA 3F7VA 4I5RA 2UY2A 3ROOB 5HMSA 4PTXA 2GSGB 2YOCA 4HCLA 1RZPA 2EJ1A 4J2XA 4Y9NA 3URNA 1WBXB 3B2PA 5CJMA 3KW7A 4WI2A 1XR2A 3QRBA 4DY1A 1BGXL 4Z23A 2Z1WA 5GZND 1BTCA 2P24B 3JWNE 3GFUA 5E9DD 1HGYA 3KPRD 1LK3H 1KBKA 5CJ5A 1MMXA 3FSAA 3SE9L 4F0MA 3EXTA 5ITFB 4IBVA 1JXKA 3RWGA 1MCJA 3WCZA 3LEVH 2VDPL 2GBUA 3P93A 1HXMB 5C07E 3SUSA 3CBWA 4UMCA 2Q3AA 1MFAL 4R27A 3FSOA 3S4SA 1XUZA 1AR1C 4HAGA 2WZEA 5C7XL 2PDQA 3WLLA 4PRAA 3LB0A 3GPSA 3UZEA 1K9DA 1Q6OA 1F42A 3DBXA 4KK8C 1F3TA 3DK2A 2GJPA 3C9NA 1OANA 3CHOA 4QSFA 4JUSA 1HEZB 2IWKA 3BV4A 4AL8C 3ZTNL 2E4TA 1RVKA 5H1WA 5FYLE 1OM3H 2HKAA 4R5TA 5KINA 4MCYA 5CFHA 4KUCD 4LCIH 3KW3A 1Z66A 2V37A 4JKNA 5C1MB 5F4SA 3JZEA 4TQEH 3VNKA 2ATPB 4JTQA 1J6OA 4HS8H 4S1RL 3KIIA 4KI5E 4AX6A 3QO0A 3UYOD 4KWUA 5BUPA 4RFOL 1SHWA 5FFGA 5JBFA 2Q71A 2C6QA 3ZJ6A 1HJSA 2BIPA 3CH0A 3OKYA 4WNQB 3EHBC 4M19A 4Y16A 5D93B 4XWGL 1LGVA 1HM2A 2WIIB 2A3AA 1VFHA 4NQCD 2NW3B 3ULUE 4W9EC 2FIQA 1P7QB 3EOTL 2Z27A 1H51A 4YCPA 3SZ8A 2VDQB 4M1RA 3LKOB 4C7GA 1O5XA 4BH7A 2HRPL 2YBRA 4JRYD 3RZCA 2O6FA 2QQQA 4XZUA 1QNRA 1N59B 1RK5A 5B1JC 1OGGA 4HNOA 4Q4QA 4HTBA 5AW8B 4JPVL 5CLWA 2OK0L 1W5MA 4IX0A 3QXTA 3AXKA 4TUJA 2XN1A 3TQPA 1CLZL 3ZKSD 5ITBL 2DEPA 5IBTH 4F15B 2PUQT 2WOFA 3WS3B 2D22A 4Q4OA 3SO3B 2Q8XA 2Z31B 1HGWA 4AZCB 1CLYH 1OJPA 5HYIA 4ZCWA 1EHXA 3MZ2A 2R4SH 1QLFB 2WP3T 4EF3A 4EOWL 3GW0A 3HPFA 5HTSA 4YVUA 4B0MB 3UTTE 3VFGH 3RGVA 3RVXC 2BVPA 5JHDD 5MENB 4FIRA 1Q6RA 2AV7A 3F12B 2BSCA 1IUZA 3Q2LA 2XISA 1XR9B 5FJUA 4DWSC 3V5CA 3LZRA 3O2VL 1KJMB 3PVFA 1BKSA 1MOEA 1E2VA 1TZIA 5LAPA 4NKDB 3CHSA 3I9AA 1MIMH 1IT0A 4HSCX 3QC3A 3N9HA 5DMKA 3P30H 4TVDA 5FFOA 1BREA 2OXGA 4BYHA 2V9UA 2OTWB 3NABL 2QXWA 3GWQA 1D6VL 4HU3A 4ZTYA 2VJ8A 3DX1A 4LX4A 1B3WA 1X5MA 2HZGA 3LLFA 3HB3B 4ZUWA 1L0YA 5IQMA 1Z2KA 4XZHA 3ESVF 4IRJC 1IBDA 3QH3B 1XBZA 3OLEA 5DRNB 4R4FL 2VERA 1BPLB 1UD6A 3X3ZA 5C9WA 1GAFL 3HGJA 2WKOF 1JPTH 2GC7C 4PHXA 4HSAC 5FW6A 2EXWD 1ETZB 3W1RA 3DXAE 3LERA 4K5NA 3NRQA 2BY3A 2NPLX 5L4FA 4YEEA 3RAJL 1PX3A 1W56A 3O16A 4PJ7E 1CFMA 4HZLB 5G5DA 3QRFM 4ADTA 3AFLA 2NLIA 9XIMA 1I7RA 4ZYKA 3QFWA 1IGIH 1OALA 2WNXA 5JPNC 1BVOA 1HG3A 3N0PB 3I9IA 3I4EA 2JCCB 2DGAA 4FQCL 2GVEA 4P61A 2I5YH 1R3JB 2CNYA 3KTSA 1X6LA 4M3HA 3U2IA 4OIAA 1RJQA 3WFZA 2FE0A 4OLYH 1GOWA 1TJGL 3OLDA 4V1DD 3MI6A 4MAYD 3VXPA 4XTDA 1Y65A 4LCWD 5D02A 1I82A 2XKNA 4JFPA 2DPKA 4OZFG 5IBUB 4M8QB 2FL5B 1HH6A 3AFJA 1T1ZB 3GO2A 3EAKA 3TNMA 4ADSA 1RULL 5KVEH 3WJMB 4PTNA 4K3JL 4Q9RL 3LRLA 5CEXA 3BLBA 3DI1A 1T1WB 1M7IB 2R0ZH 3QUXA 1SQMA 3L7RA 4YDKH 4X4YB 3D5OF 4OFYA 1DBJH 3FFSA 3PAVA 1JPFB 2E8YA 4NOBA 4Z7UE 2KDYA 1P69B 1TQXA 4NP9A 5FB8B 3AXHA 4IOSA 2GFBB 1KLUB 2CCLA 3TZVB 4NQVA 3CU2A 1CENA 3UA3A 2UXGA 1NEZG 4JG9A 4BS0A 5DUPL 2HJFA 3ARPA 4PRDB 2E5EA 1QK0A 2GTZB 4BTYA 1G9ML 4K9EH 4LRNH 5IVZB 1QFUL 5C0JB 1US1A 4DP6X 1HMUA 2ZWKA 5DQJB 4NRSA 1A5SA 3LCYA 3AS3A 3AREA 1QEWA 2XC8A 4NN6B 4HS6B 1ND0B 1H8OA 5SWQA 4XOBA 1FGNH 4C58B 3S37L 4H1LA 1X4ZA 4KEZA 4UBDC 1MFVA 3BIAX 1L9WA 3VU1A 4YHEA 1K5WA 3Q1SH 4OCLC 5AVQB 2H3NA 1BSLA 1XM3A 3GNDA 1BBJB 1MQPA 1KFLA 5CD5C 1A25A 2FZDA 1EEZA 3PWJB 3HRZC 3AT8A 2YCJA 3V4VB 1OOWA 4J3UA 2HJLA 3A3XA 2CIPA 5F3FA 3I68A 1AZCA 2N01B 2X8RA 3AQZA 2PKDA 1QMLA 4KRUA 2AQ3A 3O4LA 2EPKX 1A6TA 1S7WA 4PR5B 4N2CA 3I3DA 4R2GC 4P2YA 4JQIA 2GYIA 3PGDB 1A65A 4PG2C 3KHOA 3C0SA 3MV8D 5ICYA 3ZE1E 2J7GA 4N90E 1IKFH 1LVNA 3PZNA 1BXXA 3GIVB 1TYGA 3SPVB 1OFEA 3UJ2A 2XY2A 3P82A 1DWHM 3OAZK 3ULVD 4KFMA 2WC7A 3SCMB 3W2MA 3B9VA 4HUCA 2YARA 1CC3A 4ATWA 4DNLA 2AJXL 5M3WA 2OFJA 1YY8B 4JQAA 5C0EA 1IIGA 5IKCB 1TCRB 1VBRA 2JALA 3W53A 1KIQA 4MY1A 5CJNA 4MCNA 2WYSA 5K9QG 3TFCA 5IY5B 5EB8A 1BF6A 4Y5VC 2VDPB 3WKPA 1LRNA 2ZPKL 1O60A 1AO7A 1I9IL 2BIQA 1S3HA 4MAVA 2J43A 4XVTL 2WLHA 2YD5A 2QDEA 1ACXA 4P06A 3FJLA 4CD5A 4DUXA 1M5WA 4UTTA 5TTRA 1TO4A 4GP5B 1MI5A 3THML 3HN5A 4WDUA 2J78A 2JJVA 1DBAL 5DZJA 1SFHA 3C8DA 3ACSA 1FZJA 2FCBA 2DRUA 1IC5H 2FEEI 1C29A 2X7LA 3NCCB 1T0NB 4CU7A 1DQML 1S7XA 2JH2A 1PDKA 1U0QA 4DIAA 4ODTL 4JTRA 1EHNA 5FGBC 1JRQA 5FC9A 1DSFL 2H3XC 3R7RA 4XCEA 2A83B 4BWLC 2H1XA 1XLCA 3MZNA 4GAAA 1WITA 3QHFH 4XN9A 3B7TA 4RWYL 1XQLA 4ZXLA 2F5AL 3WBYA 3I50H 4P5KB 2E5DA 2VDRH 4G7VL 4P2QB 1ODUA 5TE4H 4DW2L 4D8ZA 2PNDA 1KOAA 4R3UA 4UR9A 3Q1EA 5HHNB 5JLZB 4ZOCA 1JMZA 4GXUN 2D9CA 3RDKA 4DO6A 2AS5M 3WQGA 4QRPD 4PULA 2GB2A 4OZHF 1FFPA 4P3CL 4FZ8L 3VXUB 1SEBB 5HYSB 1S3RA 2V5CA 4J9JA 4NHUA 1I9JL 2COVD 4YSPA 4I8YA 2VLRB 2Y1ZA 3Q8EA 4O2CB 4HC1H 1IJ9A 2G2PA 1TEFA 4MQXC 4DAFA 5IF0A 3TTSA 2UBPC 4Y5XC 5E94A 4HJGB 2Q1FA 2NUTB 3QS2A 1IAIM 3BZ5A 5AKQA 3LH8A 1HJWA 3NJFA 4NILA 4UUJA 1Z9AA 2Z7UA 2K7PA 1U41A 3JUZA 5D6DC 1BD2D 1YPFA 3TYBA 5I6PA 3VXRE 1TDQA 1HO4A 3TEWA 2EICA 4DKAA 3WIHH 5DZNA 4ZI8A 2VDML 3EO0B 4M61A 4AENB 3EJJX 2P8PA 1AIFB 1M71B 5A2CA 1PYWB 4EZJA 3WX7A 1OAXH 4BEIA 1NOFA 2XX1A 5LXVA 3FUNA 3FZUC 4XC1L 4PTVA 1E8WA 1MH5B 1CE1L 4W7WA 2W95A 2X88A 5DTFB 5LG6A 1RLDA 3EH2A 3TXZA 5BVJA 2XUCA 4NI6A 3UBXG 3STLA 4L1XA 3QY7A 1T6BX 1V3LA 2DYPB 4B9ZA 1CBGA 3VFRB 4MF4A 4HKXA 1RZQA 1DBKH 4P8XA 3T8LA 4WHYH 4L8DA 3QNYA 5IM7A 4OFQA 1S9KC 1LL4A 3EYQC 1RPKA 3BWUC 1TZAA 1OX6A 4DGIH 4H2AA 5T3ZE 2NV9A 4Y8FA 3CX2A 2FATH 3NIGB 1H61A 1SUHA 1R5IA 5FO8A 2ED6A 3CQHA 3KX6A 1BVLA 3CNYA 3RHGA 3BLFA 3RJDA 2X4UA 4M0XA 4W7UA 4RETB 1IARB 1C3FA 4LUIA 3IARA 2I9LB 2VC2L 2E7MA 4BFIB 3L3OB 5TE7L 2ZF9A 5I23A 1PYFA 4LOVA 2Q8AH 2FX7L 3GG0A 3FMGH 3NN8B 1T96A 3DIPA 1XGQB 3DOSB 5D1ZI 3QDMB 3BJLA 4KJYA 2ISWA 4GKSB 2QVFB 1ZSXA 2ZKXA 1DXIA 2IDCA 2QHRL 2E6PA 4UTLA 4MA7H 3ABZA 3RO6A 2ZZ7A 1A53A 2FO8A 1X7QB 4JG0L 1T0MA 5E9DE 5IB1B 2JELH 5E5UB 3KPRE 4AQOA 3KR3L 1TJHH 5D93C 5BVPH 2QF8A 4OLUL 2ZOTA 5ID1A 4N3TA 7REQA 3VIFA 3LK6A 4NM8L 2VEGA 3K5SA 1IXOA 3TJPA 1X5ZA 4GW5B 3K2GA 1HINH 2GYSA 1SW7A 1G69A 3RU6A 4LF1A 4LS0A 4CQ8A 1A7PH 3QT2A 1FP9A 5HA7A 4S2CA 4I1NB 1EDQA 1FA4A 5AHLA 5EPDA 4MTMA 2RTTA 3MV9D 5FA4A 4QIUA 2WXLA 4C6CA 3B0PA 4E42B 4XT1C 3ETTA 2CO6B 1QOQA 3CMFA 5XIAA 5IB3B 4F15C 4P23B 5IBLC 4JJ5A 4RFNB 4OCWL 2BRQA 4OLZH 3SO3C 3D3VD 5FM5M 4JCWA 3JTSB 1LD9A 4QOKB 2IKHA 2Z31C 7A3HA 1TU2B 2Y36H 3VG0L 1D6UA 2VAJA 5A6JA 4Y4FA 5CN2A 4Z7WF 1N8IA 5HJXA 3AMOA 3SKJL 1MCQA 2FMOA 3RP1A 3C60D 2EAWA 1S7RA 1B4TA 3PWUA 2PYFA 2J7FA 2IH9A 1WBYB 4EUPH 3VUPA 1NDMB 3IMHA 2L7QA 4NQSB 1J1XL 1HJQA 4L3EB 4N6FA 2BVOB 1SYSA 5BS0D 4QTGA 1MUJB 5A6BA 3PDOB 4XAZA 1U8OB 4QS6A 2EGZA 3WD5L 1RUAL 3RU8H 4XMUA 4DPQA 2WWCA 3SUTA 5JPMB 3V6ZB 2DZTA 5AAWA 2IDUA 2H2PC 1UEMA 4L2YA 2GJ6B 3QLDA 2MPAH 5J5RA 4S2SA 1US0A 3QIWD 4UOZA 2NZ1A 5D4YA 3RIKA 2FPYA 4FJZA 3HB3C 4EOUA 4KO6A 4DB7A 2CO2A 4HOZA 2F19L 2W5PA 3R94A 3EO1B 1PD1A 2H2SD 1MREH 4C6MA 2ZRUA 2HK0A 3QJFB 4GUPB 1HL2A 4NO5B 4N1CA 3K1GA 3QULA 1R38A 2OMXA 1A14H 4ZOAA 2VXQA 2QHLA 3K6SB 1QTWA 2ENJA 5F7EH 2WKGA 5HYQB 1IEQA 1NMBH 1K4CB 1DVXA 1ONEA 3B56A 4IUOA 4NEHB 4KY1H 3O6FA 3CQIA 2VXUH 2X38A 1RLCL 5GNXA 5GNZA 3CHXA 4L8CB 2BIHA 3BH4A 4I0PA 3HFTA 3P11H 2CIKB 1O7DD 2WXHA 2OT1A 2DLFL 3DUUB 4QHRA 3IIPA 5JHDE 3WUWG 1ADOA 4PRBB 1A5CA 5EU4B 1MMYA 3QEQD 1L6GA 2QT6A 2UV3A 4KERA 3MCYA 5L6YL 1KRAC 1T0PB 1YNQA 4PGDA 1CE6B 1VADB 4LBEA 4Q89A 4L18A 2VGFA 1G4RA 3PAZA 4OZIF 1FWNA 3VFMA 1WFNA 4DKDC 5C6PB 1Q9WA 4M5ZL 3TIDA 3S4BA 2FSEA 1AFVL 4L0YA 4YVXA 2R29A 3FOKA 3CTTA 2LHAA 5FOBA 3W2JA 1L8PA 5KYXA 1PB0A 4PYSA 1KNOB 5D1QA 2HTAA 3TYCA 4I88A 1OCZB 1W32A 4O28A 1DLFL 3LH2L 4U10A 4J4PC 1TKWA 2PCPB 3TZVC 3O6LL 2VMDA 5E09A 1Q1JH 4IP5A 3QFGA 3LOTA 2NXZD 4R96A 4IIZA 5F7LB 3PWLB 3UH8A 1XF5A 2XQBL 4GFIA 4LVBA 1NIFA 2K45A 4Y2NA 1KPRA 4PMUA 2M1KA 5EF3A 5D9OA 4D0CA 2ZX7A 3SJVB 5CHNB 4KKPA 3TO2A 4TL5A 2RBLA 3NGBB 2O5ZH 1YKWA 2VENA 3P6LA 3T4YB 3DKLA 3S3JA 3L3HB 3AUOA 5FXCH 5IK3A 4Z95L 3IJIA 4OVVA 3VIHA 2AK4D 1AGCA 1IAOB 5K59E 2X0UA 4LBUA 2R15A 3NQEA 2PW2A 2ESVD 4J5VA 2NQZA 3RCYA 1I8IB 4V1DE 4LARL 4LCWE 3X2QB 5GSVB 4JFFD 1H7OA 4YHOH 2YDQA 2C5DC 3BD5A 5GGQL 2GIYA 1F90H 5GJTL 4LLDB 2DSKA 2OTPA 3UTQA 4LSRL 5EDSA 2VDMB 2LFGA 4EO5A 4FX6M 4CJ0A 4IIQB 5AC7A 4P2OA 1V3IA 2HLFC 1HKLH 1UB5B 4PTUB 2FWSA 4NQED 3AHXA 3E0GA 1JF5A 3LS5H 2Y5TA 5IGXH 2G95A 2XT1B 2PPAA 4YBLB 2ATSA 4EPEC 4C6KA 3ZYIA 5KS9E 3SY0A 1IE5A 4BUGA 1A7BA 2HRWA 1JYNA 5HHPA 1F3XA 4RGND 3RNKA 2BOBA 2XIDA 3SCMC 3D46A 1NBZA 4ZGYA 1SLUA 2PTVA 3CDFA 2AJZB 3KXFB 1AQDB 3WFDL 4OZGA 2GSMB 3TA3D 3MYZA 2PPDA 2LAGB 2Y5QA 4ADJA 3QQ0A 3D2UB 1I2QA 2JB6B 1NJJA 1U1UA 4HK3J 1FDYA 2WV3A 5E00A 3V6FA 3ZL4L 3TWCH 3USZA 3LKQA 2LU4A 4LFHD 4S11A 4C8XA 3BLOA 4WRHA 1ANUA 3CHVA 1S2VA 4K3AA 3EX2A 3BZFB 1N5AA 1W1ZA 2XYBA 4Q33A 3MACH 1MJ8H 4HZ7A 3M17B 5CMAB 3O2WH 3VACA 4B2DA 4CVZB 1ME8A 5ENWA 2V2XA 4PJ8D 4GC4A 2EADA 3PWIA 1TPXB 2PDMA 2VC2B 1CD9B 4LYPA 3ZHNA 4RFEB 1MFMA 3HS0B 3MXWL 3N44F 4HPNA 3G7TA 3VGHA 3MUZ1 2EBNA 3OSKA 2BZDA 2AI0L 2R69H 2WZIA 3IGFA 1XR8A 3T2OA 3UQNA 4LGPB 5F2IA 3KNBA 4LP5A 3EX3A 2FZ3B 3GK8L 3LKSB 2A5UA 1AXSB 1SJHA 1K4GA 3MJ6A 2CLFA 1FDJA 4FNRA 4LVOB 1OFPA 3KWSA 2CFLA 1A8JH 3ULVE 4U1SA 1OY0A 4E4PA 3HE7D 5DQDL 1RA5A 3NJNA 2R24A 2V3FA 4ALDA 3BGJA 4FS0A 1CURA 2PI6A 4Y6GA 2QJIA 3VGFA 4MJJA 3U0TB 3B3BA 4DBSA 5CN3A 2XH7A 1LBFA 4I9AA 1S7TB 2IDTA 5FKPA 4KTDH 1INQA 3THAA 4NZUL 3FT4B 4ZFZA 3TBTB 5DVPA 1L7TL 5EZLA 3MT1A 2PB1A 2CJTA 3EW3B 4J6RH 2DVUA 4OB5H 5J3HD 2A6DA 2CO4A 2ZWSA 3NVQA 1FL5A 2ZCLL 2RJGA 5DUMH 3IDMB 2I5GA 2DBLH 1RKYA 5F8QC 3BSZL 2BVUA 4Z0BL 4K8EA 2BRVX 1U8KA 1DVQA 5D2LB 1AR1B 3IJYA 1FWEC 1XT5A 3UTZA 3B8WA 3ZDYE 3U79A 3FW6A 3WLKX 1Z5LA 2GOUA 3PGFH 4PMXA 3DX5A 1MQ8A 3SBFA 4YUEH 2A4CA 5T3XL 4TLUA 5I3KA 2IQ9L 3TC3A 4XTIA 4G9FD 4EI6A 5CGBA 4IMKC 3R8HA 1MMFA 1YG9A 3CPUA 2O5YH 3BE7A 1TTCA 4GFSA 3MMEA 4GISA 4S3EA 4AM0Q 3MO1A 4H01A 5GS0L 2JKTM 3CZKA 3NACH 4QRRB 2I56A 2R1MA 4QRPE 2X3AA 3UMTA 3JR2A 4QQUA 2P49B 1NKRA 2QDHA 4XBJA 5IW1B 5H91A 4M8RA 4IKNA 3JVGC 5I6MA 4BF9A 4NHVA 2EACA 5GRUH 5EZJA 4G5ZH 3HPSA 5EO1A 1KNWA 3ILQC 3VA6A 3OKMB 2EEXA 4PJCB 1NDYA 5K9XA 1B90A 1UR9A 4W6YB 1RZMA 2PRHA 5C2CA 4HJJL 4K8RC 1C8QA 35C8H 4MXWH 1QABA 1BD2E 1JXJA 3WLQA 5DJZA 2APBA 3GZAA 3QIBB 1AI1H 1DQQB 2VRQA 7ODCA 3ZHFA 2E9LA 4XBEH 1GY2A 4A3UA 2DMGA 2OCCB 3SB0A 3BISA 4IT1A 3CFBA 3G1HA 3SDAA 3GEFA 1M6UA 5IB5B 2UYLB 3KWWA 2BLEA 1OAKL 4XCFH 1WS7A 1WDRA 4NPYA 4LSQL 3NZ8A 3NEHA 4WF7A 5IHBA 4ZL1A 5TH2A 2J88L 3FFDA 4F4RA 3BUBA 1M57B 3DMMB 3MNZA 3QZ6A 1UR3M 4XC3L 3AG1B 3HVDA 5F8RC 2Q1EA 4OCNC 1G94A 4AHOA 2DLEA 3RI5F 2BVYA 4O0KA 1TZHA 1VFLA 5CCGE 1DQIA 1ZL1A 1EOKA 5EOQH 4OOUA 2WHJA 3O9WB 5EOCJ 2A6NA 4P4KA 2Y88A 3N29A 3OQEA 3PPFA 2VCCA 1PZ3A 5IBUG 4TSAL 3F4WA 1QW8A 4H4NA 3L66A 3UG5A 1SFDA 2DIEA 2K70A 4M6QA 3QBUA 1HAWA 5BOZG 3QXWA 3QF0A 2E74C 3IFNL 3VXSB 4ORGA 3H2FA 3WNMA 4ODUB 4KRMB 1V8HA 2G3MA 2WYTA 5EIIB 4TVPD 2Y85A 1BJ8A 4X0VA 3CQPA 4KX7A 1REIA 3MJYA 1KLFB 5GRYA 3P4LA 2NTFA 2QDWA 4P7QA 3RR1A 2HFEB 3VKDA 4MLSA 4B92A 4ENLA 4KFZC 3JTBA 1TJIL 1A9EA 2ZZUT 1PZSA 4LKXA 1RJPA 2BDQA 5IOBA 4P23C 3TJ4A 3QUKB 3NQCA 2ALRA 4RFNC 4Y4HD 1G9MC 2WXKA 4AD5A 4X7TA 3TBVB 1AE6H 3CSGA 4OM1L 4RDQF 1NS8A 4EPBC 4E2BA 5C0ND 1TZ8A 1S9XA 2CGRH 1AD0A 3UYPA 2X1UA 4O9HH 2X2UA 1GYMA 4WNSA 1IX2A 1NC4B 4XI5C 5D7EA 4GY7A 4CNNA 4AQEA 4RDWA 2VD8A 4N2GA 3HI6L 4OTKA 3BOVA 3IPBA 3VD1A 5DYOA 4WOZA 4I0KA 5F3HB 2F8OA 5HHVH 4PCYA 4FLOA 3X3FL 5GGSY 1H41A 4S0TD 3O9NA 1H7PA 1X9RA 2Y07L 2R8WA 5DDHA 2QJGA 4KJWC 1HX0A 5F1NA 4L9LB 1X8CA 4ASTA 1BZDA 1GOHA 5GSRB 5C0CB 4AIOA 4W9IC 4HUKB 2V5RA 3V7AE 3HIJA 4HLZH 3NJJA 3QIUB 3ZIZA 4FEIA 1QNSA 1YNKL 1UUQA 1FAIH 4JB9H 2A3CA 2YPVH 2NY1D 4DO5A 2O92A 4N2LA 3UGUA 2E9MA 3FN0L 4FQQB 3DJRA 4CNUA 2IANB 4KKRA 4F2MB 2A9CA 4FG2A 4K23H 2ZFAA 2J8UA 3H42H 2P8LB 3GSNL 3AFBA 2QHAA 2VABB 2P28B 4TSBL 5KBKA 4H8NA 1R85A 5G1TA 3M1CA 1K8CA 4CMMA 4LCVA 2D7PA 4TQPA 4O18A 5F1IB 2XN9A 3D3VE 1M2VA 1EX1A 4RV3A 2ED8A 1TPDA 5LIKX 1IWAA 4N90D 3IAQA 1IVLA 3M41A 2XIIA 3V4UH 2J7EA 4M4RA 2C14A 4PP2A 4QI3A 4W5UA 5FYKL 2OW6A 1QVBA 1MCIA 1UOVA 4H25B 3P77A 1W0YT 1H19A 4F9PA 2KH2B 1UURA 4OD2A 4CADB 4OSUL 1A3LH 3FPYA 2OX5B 4ZFOA 4XPBL 1CTOA 3T2LA 3QQ4A 3WJWA 3SE3A 2XXCB 2XPYA 2B16A 4R26L 1EPXA 5HXMA 1E9PA 1FLRH 1RIVH 1GXEA 1M7JA 3BW9B 3IBOA 4X7DC 2Y7NA 4UU9A 4N9DA 4K3EL 1EJVC 2UY6B 3GTTA 3KPLB 2OP4L 1E9LA 4O10A 3GMPB 3LH9A 3RU8X 3OG4B 2WO4A 4JBRA 1V3HA 3F2CA 1V3KA 4DBUA 3FFCA 3KLSA 3QJHB 2NUXA 3WQ5A 4PBDA 1T5AA 3VYOA 1KJ3L 2K6YA 1EXUA 2C9UA 3B4UA 3PAUA 3T6ZA 3VI3A 2Y73A 2EYRA 1U8PA 1I8LA 1JWUA 1RHFA 1Q8JA 3TJIA 5ESVA 4N24A 3ZR5A 2E7CA 2O55A 4XO8A 3D1MC 4L1TA 2ZONA 2M8XA 3ILPA 2D20A 3T77A 4LPVA 1K6QL 2XWXA 4P5TD 3RTQB 4ZS7L 5CCJA 4R2GB 2PU1A 1LXMA 2EE6A 3D39D 1GGBL 1NCAL 2I1OA 4TRPH 2BASA 3TLQA 1OC6A 3NGBC 1NANI 1LEIA 4UTAL 3CUPA 3Q6FA 1O7DE 5HYSG 4IICA 3VWJB 4M7LL 2Z28A 3ZJKA 4UV4H 2HVNA 1YRKA 4IKLA 2IDFA 2FECL 3QEQE 1K4DA 3MPGA 1D5MA 5EU7E 5HGDA 4NYLB 4Y90A 2WMPA 4YNY<