4FNQA

Crystal structure of gh36 alpha-galactosidase agab from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
727
structure length
723
Chain Sequence
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGSRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGIELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKARGHVAMSGNFGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaB
total genus 230
structure length 723
sequence length 727
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnqA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnqA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnqA02
3M41A 3TH6A 2NLIA 4XBSA 1RPKA 3W1UA 5I24A 2QMJA 1ME7A 2J88A 4LVBA 3N34A 5E6YA 3LBMA 3DGRA 3BVUA 4YCPA 4MB1A 2XN2A 2E6DA 4PEEA 2Z1KA 1GYNA 3EDJA 5L9FA 1OHLA 3CGTA 2QCLA 2ALDA 4DO6A 1WO2A 3TFCA 4ORIA 4LS1A 4E2OA 1JGIA 4JN6A 3OLEA 3EWUA 1KGUA 3MP5A 1SFLA 1LP6A 2ZX7A 4ZQPA 4FMVA 3L5LA 3LXCA 4FX8A 1OFPA 4PSRA 3M7WA 4WOZA 4HSOA 3U8GA 5AC7A 5LHEA 3HG2A 1QOQA 2WOQA 3G1AA 1NFBA 3HOJA 1J0KA 1YTDA 2ISWA 2ZRXA 2ZZ4A 3H55A 4LU0A 5AYXA 1PIFA 3I6RA 2Y6ZA 1KV8A 1ZJIA 5CZ0A 3G0UA 3VM7A 1UKQA 5HWMA 4OV9A 5D32A 1RPXA 3C2FA 2YR1A 1OFRA 2BY1A 2GVLA 3GDMA 5E93A 1QCWA 4O52A 1BVNP 2VRKA 1AW1A 1XI3A 4UNLA 3O6DA 2CWNA 1F74A 2D0GA 4OJYA 3P8JA 3ZFHA 3S6DA 3FEMA 1TPVA 3BVXA 4QM1A 2E0PA 1OF8A 2V30A 5HNRA 3ECQA 2IQTA 1FDYA 1TPWA 1F6KA 1TQXA 2LLEA 1SO4A 2VFIA 3TW6A 1CDGA 2O7SA 2CPUA 3LPOA 2OYKA 3KVKA 4J3SA 1GYLA 1EIXA 3S5ZA 3PUOA 4OQVA 4AWTA 3O06A 4GWEA 1YPFA 3WJYA 4GUJA 1ML1A 2DZUA 4UTMA 1GCYA 1PVNA 4QAWA 3WENA 3AMKA 3DKJA 3VX1A 3UWYA 4Q32A 1OX4B 1UASA 4K36A 3TROA 5KSWA 2J6XA 2FJKA 2H3BA 3NEVA 2X1UA 2YFNA 1F05A 5SWUA 1SO5A 2FDSA 4O13A 4UCFA 4O54A 2C18A 3UPBA 4NJJA 1W0MA 4B9YA 1KM4A 3VMPA 2ZZ2A 3G24A 1TO3A 3PS7A 2I1OA 3ZS4A 3TONA 2BY3A 3R12A 1SW0A 4PTNA 1Q6OA 3BLFA 4B5NA 1OT2A 2OW6A 1GG0A 4XB3A 4BF9A 3L0NA 3S5NA 2F84A 1C9DA 3DDFA 2XVKA 3TV8A 4JTGA 4MZ8A 4FNTA 1DVJA 1VYPX 1ZHAA 3QZEA 4OHQA 1LRQA 3MHUA 4GI8A 2YA2A 3CLWA 3GXFA 3DFPA 3NM1A 2GVGA 1GZGA 1H63A 4M5PA 5K9XA 3WDHA 4UFJA 3V75A 5D2YA 2ZUUA 1SW3A 2WKLA 1J4EA 2GUUA 1DV7A 4ZQNA 3L4TA 3TMQA 4WSKA 3VKJA 2QUVA 1DQXA 2QCDB 4IPJA 4XKYA 1R30A 1CGVA 2GJNA 3OBKA 2ABBA 3RFAA 3G3MA 2FHCA 4H3DA 3M1ZA 4Y96A 4TMCA 1VCGA 3QH2A 4GC4A 3MI2A 1UD6A 2VEIA 1KFKA 4UMAA 1NM9A 1B0IA 5CZTA 2D2OA 3GDLA 4JY9A 2OJPA 3DXIA 2QPSA 1OFOA 4AEFA 3ZWTA 4R34A 5F4WA 2A4AA 3BVWA 1JR1A 3UG4A 1XCXA 2XWDA 2BY0A 2J24A 3SI9A 1FDZA 2XVGA 2WCGA 2Z0IA 3VNDA 4GINA 3TUUA 4K7YA 2W79A 4UCGA 2NV1A 4JL2A 2PURA 4LW7A 1JIBA 4GUFA 1KTNA 2QEZA 5HDRA 3NL2A 4O15A 4XKYB 1LDCA 2QDGA 1KFEA 1R75A 1JUBA 1TB3A 2ZQ0A 4FNUA 3ATYA 5K9DA 1W56A 3E0IA 2VEKA 4EOUA 1HWWA 2Z2UA 4N02A 3IK2A 3EX2A 4WSJA 1EH9A 1O95A 2QKFA 3C2OA 3PY2A 3K1DA 1E43A 3DHDA 3MWAA 3W2KA 2ZZ3A 4FEZA 2R8WA 4J9JA 1M6JA 2DZWA 1VGAA 2WV8A 3NQEA 3BCDA 4E2DA 4GI6A 3LOTA 1QAPA 3P7YA 3EJPA 3NGJA 4CCCA 4MYAA 1OX4A 1W5MA 4WF7A 1ONRA 4Z08A 4MAZA 1G4PA 6TIMA 3A24A 3DFSA 1J0HA 3CWNA 5DXXA 4G1KA 4LRSA 2VC6A 2WSYA 2CXGA 3OLGA 4GBUA 3BAKA 3CHVA 2VR5A 3L4VA 4TO8A 4UR8A 3O6YX 3GVGA 4Q4KA 1UBSA 3BLPX 4Y90A 3Q58A 3IJ9A 1I2PA 3CZEA 4UQAA 3UCQA 4N6EA 5FF7A 2ZX9A 3HG4A 1WV2A 5U7SA 1KBBA 4JY8A 2QF7A 3TIMA 4ML9A 4D2JA 2QCMA 4X0NA 5D04C 5HPOA 3W85A 4ALDA 5HINA 2H8ZA 4LUJA 4NNBA 2XIIA 2EKCA 2G3MA 1T96A 2V3FA 1K3UA 2ZA3A 4POCA 1ZJBA 1PZ3A 3BAIA 3VGHA 3NQ8A 1OFEA 1CGYA 5L6UA 4AXKA 2V2DA 5I3HA 2V2CA 1QI3A 4UTTC 5BOOA 1DEDA 3BARA 1GVRA 3AJXA 4PCFA 5F4XA 3PC0A 1KXTA 1QDSA 4JCMA 1QR7A 3QSRA 4PODA 3QW3A 1BLIA 4BI6A 2B7OA 1M7PA 1PIGA 4JX6A 3UD6A 4YMZA 3R2GA 1HTIA 4J3XA 1J0JA 4UTKA 2JKAA 4AIEA 4HPJA 3G3DA 2GVJA 3AMLA 1LZOA 3EJQA 4MPQA 4NVTA 4S1FA 3TR2A 3BGGA 4UTTA 1B3OA 4DELA 5LGXA 2E77A 1CGUA 3W75A 3MO7A 1VH7A 5AHIA 4W9TA 3BPWA 1MXSA 1FBAA 1LRNA 4UQEA 2HS8A 3VNZA 2ZZ7A 1A5CA 2NZLA 2G97A 3C0JA 1YPIA 4N4PA 1VLWA 4RLIA 4PL1A 5AB3A 4FLRA 2PWFA 2J27A 4BI5A 5FF0A 3CTTA 5DBUA 3ABRA 1G4EA 1YYAA 2ISVA 1MW3A 3D52A 1LOLA 5C5YA 1JRBA 3S9YA 4JYDA 3DDGA 2FGZA 1IIGA 5EPDA 2VEMA 3TTSA 3D4ZA 1XBYA 4AHPA 5I3IA 1TTPA 2C16A 3IRDA 4X2RA 2ZFAA 2WPGA 2WCSA 5E6ZA 1AG1O 3FYOA 1MO0A 2X1RA 2YX0A 3L9CA 3FS2A 2A7NA 1B57A 3TSDA 2BXVA 2QCGA 3DBPA 1H60A 1QWGA 3B0PA 3LLDA 3FAXA 2QCFA 3BCFA 1GQNA 2WC7A 1U83A 2X1SA 1TV8A 2VFFA 5C2XA 3NQDA 5I3KA 3W38A 1ICSA 1JDDA 3BVTA 4RXGA 1XH2A 3PBWA 2WO5A 1Q45A 5F2LA 4P2VA 3MP4A 4HN4A 1DTUA 3W1XA 1LBFA 4U4MA 3CEPA 4HIBA 4Z1AA 4M19A 4N9EA 4OU1A 4X9SA 4JNMA 2BLEA 2NWSA 2XVLA 1UD5A 1WP6A 4JL1A 1TV5A 2BZNA 1MWOA 3CB8A 1G67A 1CXFA 5BMXA 2TMDA 2BTMA 1TQJA 3CPRA 1XL9A 3QYQA 1ZY9A 3M9YA 1KXHA 3WK1A 2E5DA 3DHPA 3DAQA 1FCUA 2JKEA 3M0ZA 3UWQA 2RDTA 4XUGA 2EACA 4MJMA 2NX1A 4NJHA 3WY1A 1KWKA 4OGZA 3VO0A 2ZRYA 4ONVA 3TJLA 4WQ6A 3NL5A 4FIQA 5HUOA 1X1ZA 1EP3A 3PUDA 5FEZA 3HO8A 3CV5A 3G0SA 1R34A 3WN6A 3AXIA 4OWGA 1RZMA 3UZ5A 1XH0A 1QWUA 1RP9A 4NXKA 2FPTA 1VR6A 3UZJA 3WELA 3P80A 5IM51 4S2CA 1MXGA 3PULA 3LCFA 5LNSA 3G8EA 3ZR5A 4O19A 3BC9A 1PZ2A 2X2IA 3M5YA 3NPUA 2NT1A 1M7XA 2G5WA 3FFSA 4JTUA 4K8EA 1ZAHA 1HL2A 1IV8A 1KB3A 1TPFA 3VFLA 1HL8A 4NJIA 5GVJA 1E51A 3KAOA 3K8KA 5D2WA 3VGDA 3C3NA 3EWBX 2C6QA 3P81A 3S5OA 5K3VA 2V5BA 4WXYA 3NZ1A 4A21A 4JICA 3IVTA 1W9XA 5IBXC 1D3GA 3DENA 1HVXA 1TSIA 2FB3A 3UG3A 5F7UA 4N9BA 1UA3A 3OLIA 4FHAA 1YDVA 2UV8G 5AHLA 3S1WA 3PG9A 2DP3A 3IIVA 2WANA 3BG9A 3EEGA 4GQQA 1ME8A 3B03A 3BSHA 4WOQA 5BNKA 4ZL1A 3YPIA 5EKYA 1H5YA 3HPSA 2X16A 1XDLA 5H2ZA 4PSPA 3KLKA 3HGOA 4A22A 3CTLA 5D30A 2V9DA 4UQBA 1SQ7A 4HKPA 1KLZA 1BPLB 2ALWA 4A2RA 5J5DA 3TTYA 1LRTA 2YSWA 1SZFA 3MW7A 3NQGA 1I8JA 5KEZA 2ZZ1A 1UD8A 4QJ1A 2F61A 4WY0A 3RILA 1RQHA 3LPPA 4DF0A 3S1XA 1L2UA 4QNWA 3TDFA 4HNTA 1YXYA 1SSDA 3GXIA 3BW3A 4RR4A 3PR2A 4DBDA 2YOCA 1H1ZA 2QCEA 4Z0SA 4JTTA 5AHFA 2YDAA 1OX5A 3E96A 3CEUA 1RQEA 3VU2A 2OZ0A 5A5WA 1IF2A 1XBZA 1IXPA 4GFSA 1B9BA 1FDJA 3GLCA 4J3UA 1WPCA 2H3DA 4CVWA 4YL2A 1W37A 5HWNA 2YA1A 4ZQCA 1F73A 1WXJA 3EXSA 1AMYA 4IPIA 4BI7A 2F18A 1RD5A 1MW0A 3NPVA 3P67A 4O14A 4FNRA 5DELA 3TKFA 2OW7A 3HG3A 3QMTA 1BAGA 1DJQA 1R2SA 1PS9A 4UR7A 3ELFA 3BGJA 2AAMA 5E9AA 3W7QA 1SO3A 4LV4A 2X2JA 2NX9A 4JIPA 2YA0A 4TVUA 2EAWA 3CIXA 1G4SA 2WNZA 5KZDA 3TSBA 2H90A 1F7BA 2RFGA 3ANYA 2VT0A 3I7QA 5LKYA 1HL9A 1JCLA 3TA6A 1KXVA 4O28A 1OT1A 1JCNA 3SIZA 2VXNA 2WQPA 1KV5A 2RH9A 1QPNA 3FIGA 3C2EA 4O1CA 1O5KA 1TQTA 3HG5A 2EABA 4IX0A 4K8HA 4AB4A 3R89A 3LRKA 3D51A 4NNCA 2ZRWA 1OYCA 3F4WA 3LHWA 1OFQA 4HOZA 5I3JA 1XUZA 1LOSA 3TMLA 5HR6A 5CXPA 1IZKA 4DO5A 1XSJA 3GKAA 5HWJA 2E68A 4H8VA 2BX7A 3QJAA 1JDAA 1H62A 1QFEA 2ATSA 3TCEA 2X2GA 3W71A 3EWYA 2E09A 3UYCA 3GAKA 3L68A 1H7NA 2BY2A 1KWGA 2RHGA 1PV8A 4DF1A 2QCHA 3K30A 2XFWA 4UQCA 1TYGA 3L67A 3PB2A 4UQDA 4AH7A 3W86A 3NXFA 5CGMA 5FESA 1NF7A 5AC8A 3G1HA 1HXKA 3HGSA 4GXMA 1BWLA 3GR7A 1KXQA 1W3TA 2C7FA 2QCNA 3DU0A 2PWHA 1THFD 3GNNA 5HR7A 3G1SA 1C8QA 2ZUVA 1QX1A 1O60A 2EPHA 3EXTA 2NUYA 3W7DA 3BUBA 3GBDA 1G6CA 1XUUA 4JEQA 3HMJG 3STGA 3MI3A 1VCFA 4W93A 4NJGA 4GKLA 3OIXA 1NVMA 4IUOA 1ZAJA 1UD2A 8TIMA 4UTLA 3S0CA 1FCVA 2CLEA 5AHEA 2EAEA 3KRZA 2A6LA 4J3WA 4FO4A 1QHPA 1TIMA 3PAJA 3S1VA 4I7WA 1MEWA 4RK8A 2OYLA 2NUXA 3W1AA 4JFVA 5AYZA 4UFHA 2D0HA 3TQKA 3W2JA 2A21A 4K39A 1TQVA 3KRUA 4U2YA 4HT3A 4NNAA 4GQRA 1M5WA 4HA1A 1KLYA 2F7RA 3NO5A 3S42A 4BZYA 4MY8A 5H91A 2Y7EA 1PCWA 1YTKA 3R13A 1EPXA 4OE7A 1AW2A 4LQ1A 1V3KA 1L6WA 4TU1A 3STCA 2JBMA 1ZJAA 2CHNA 1I2QA 3NZRA 1TPEA 3UNDA 1QMLA 3M44A 1SZGA 5G2IA 1XBXA 1JRCA 2E5CA 1VFOA 3L66A 4IX2A 1LTDA 5J5RA 3NA8A 1KM2A 1BG9A 1PHWA 3O63A 4LWWA 2NV2A 1OF6A 2P1FA 1TREA 3FLUA 1BKSA 5LHFA 3IJ8A 2EF9A 2TAAA 1FCQA 2CW6A 5I23A 3HGRA 2G96A 1NAL1 4JFUA 4CN4A 3KL5A 1XKYA 2BHZA 4FLOA 1CXLA 3QEZA 3B05A 4FX6M 3WK0A 4XBKA 4RX0A 4FXRA 1CW2A 3I7RA 2J9XA 3VCRA 1V3LA 5D03A 1VB9A 3UY7A 3B4UA 3C4UA 1VJSA 2E6FA 1WYIA 1GJUA 1L6SA 4Y9AA 5E0FA 3BLEA 3GNDA 4L4LA 3M5VA 3W72A 3C52A 1X6UA 2Q8ZA 5G1TA 1QI4A 3FJLA 4AEEA 3KVMA 3UY8A 2V2HA 2FHFA 4IXXA 1GG1A 5F4SA 3HPXA 4XTDA 1G9HA 4M6PA 1W5QA 1VPXA 2OX1A 4DF2A 4KKXA 1XD0A 4M7SA 5D02A 3MP3A 4JX4A 4WXZA 3W88A 3FOKA 5C6MA 1F5ZA 4NJKA 5HJLA 4YCOA 4UMBA 5KTLA 2V5LA 3BO9A 3P61A 4JFWA 2OT0A 5K2ZA 4CCEA 5TD4A 1I2OA 4IQLA 1L9WA 1JCMP 3L4UA 2A2IA 2DZTA 1KBIA 1KM5A 2ZDRA 1U2YA 4BFAA 1CXIA 3IGSA 3UWZA 3W9ZA 1EP1A 2ABAA 3L5MA 4CQ8A 4H7VA 3NL3A 1R33A 4JDYA 5HQEA 5KZEA 2CFFA 4O1BA 3NQ2A 1GTEA 4DBEA 5DY3A 4ZMGA 2NXHA 1SZNA 1ZCOA 3D0CA 4LNYA 5CKSA 1EUNA 4UOZA 3MHGA 3KEHA 3GZ3A 1T99A 3EJUA 2DZVA 4BR1A 4OKDA 2QUTA 1R46A 2KZHA 5AHMA 1Y7VA 4MYXA 3W1MA 2E6AA 4CQ9A 2PCQA 4FB7A 2ZXQA 1DORA 4ORMA 2WSKA 3C56A 3PF3A 3GDTA 1KFJA 1N7KA 5I3GA 4GI9A 4XQ6A 5KITA 2ZUSA 5CPLA 1FXPA 3EDEA 4AYSA 3DKLA 4JTLA 1EHAA 2F1BA 4OV4A 1EA0A 1NSJA 1GVFA 1KW1A 3RMJA 1U30A 1LBMA 2EO7A 3O1NA 1RQBA 3LCXA 3NPXA 1WAUA 3JRKA 3A9IA 1WOAA 1PHQA 4LS2A 3KE0A 3A22A 3W37A 2V8ZA 4JTHA 4RZ4A 3WJWA 1KM0A 2VELA 1KA9F 2Y7GA 4O1AA 2PE4A 5FF2A 1CXKA 4RXFA 5HMSA 4HNUA 1SW7A 2F7FA 1UH4A 5TQLA 2ZUTA 4DEFA 2J25A 1JCJA 4AVFA 4DPQA 2D3NA 3N9RA 6TAAA 1LLWA 1AMKA 3NNTA 3O07A 4PEKA 4AW7A 1OK6A 2QR6A 3O05A 2E5BA 1OSEA 3WNPA 5DXYA 3W1QA 1PEZA 2BWGA 4R7JA 4JTIA 3KFTA 4RCXA 1JD7A 4U28A 1HFBA 4UFMA 3DX1A 4O0ZA 2WSQA 5AFDA 4OBTA 1RV8A 2ZWZA 1OGSA 2AMGA 4OT7A 4M6VA 1W54A 1WZMA 1WX0A 1JCYA 1S3HA 4LOCA 3W1RA 1JF5A 4FLQA 4JS3A 5BW6A 2ZYFA 2B4GA 2FTPA 1VZWA 4TMBA 1O94A 5G4WA 5C54A 3L2LA 1VAHA 2R14A 1JD9A 2A5HA 3EDKA 3PSWA 2DU2A 1G4TA 3B0UX 2YZRA 5DN1A 1Z44A 2X1TA 1W3NA 1S46A 2A6NA 2JGQA 2ZXBA 4PA8A 3W7LA 2Z6IA 3JR2A 3QSTA 1CXEA 4CNNA 4YLWA 3WY3A 3VSUA 3NR0A 3W7JA 3THQA 1OX6A 4UOQA 4IMEA 3WK3A 4LVGA 2V3DA 1HO4A 3DHFA 1TCMA 1WBHA 3LCIA 2CZFA 1VC4A 1WZKA 1RVGA 5T26A 1GEQA 1YTEA 3W74A 2VUYA 5BRQA 3RU6A 4N2YA 4A3UA 3PBVA 4O4VA 4JD4A 3GR8A 1L6YA 1S5VA 2EGZA 1H1YA 1LM1A 5DFAA 3SY5A 3W6YA 2E9BA 4LY8A 5BRBA 2J9ZA 1R47A 3WDJA 2B0MA 5D2VA 2XN1A 3KL0A 3ZT6A 3MMTA 2FLIA 3LM7A 3PSVA 4NZJA 2E4TA 2WSPA 4JTFA 1SMDA 5LNRA 1L0PA 3S2CA 2E8YA 1K8XA 4AMAA 2C14A 5D33A 2Y2WA 1A53A 2ZX5A 1XBVA 4GUIA 1JXJA 4MFDA 4BWLC 3CQ0A 1E3ZA 2DH2A 3STEA 2JGYA 1A5AA 4O8RA 1QPQA 1O5XA 4H8UA 3CPUA 3HB9A 3V1PA 1Z48A 1KGXA 1V3JA 2YKKA 3EB2A 1TTIA 2HMCA 2E1DA 2Y7DA 3QPZA 3HJEA 5EY5A 4RJEA 2V0TA 1XDMA 2QUUA 3GKFA 3A5VA 1XH1A 2Y88A 4WJEA 2WVVB 5G2HA 1H7RA 1X8FA 4EIVA 3UWWA 2YW4A 1FY6A 1S5WA 1I75A 1PE1A 3W7PA 2OYMA 1FWSA 1MVYA 1CPUA 1XV8A 1W31A 3BLBA 3QC3A 2ZWYA 3EJSA 1ZNNA 3RF9A 1Q6RA 3VGFA 3PBUA 1VQTA 1OVDA 4LC8A 3JS3A 1K8YA 1OK4A 4MFEA 3BVVA 2YGYA 3GK0A 3N2XA 3T4CA 4LS0A 5U4NA 3WK2A 5A2CA 3TXZA 5F2GA 5EBUA 1G7VA 3EWWA 3SGUA 4BK9A 2QCCA 2GJRA 1VLIA 3GB6A 2DJLA 3IEBA 1KTCA 3L4YA 1BF2A 1I2RA 2AGKA 3BUIA 3PG8A 3EDFA 5D37A 4FXSA 3AXHA 3WDIA 3P74A 3SR7A 5FEXA 1ZALA 2ZRUA 2YFOA 1MXDA 4UFIA 3U6WA 1WZAA 3LCGA 4CN1A 4J3VA 3TAOA 1H61A 1GVOA 3I7SA 3WNOA 2VNCA 3G0XA 1DKWA 4P61A 2WSRA 2Q3OA 1CYGA 3VMNA 4UTIA 4U33A 1G1YA 1GVSA 3EXRA 4Q33A 5ABTA 1G94A 2WVUA 1W3IA 2CLFA 3EDDA 2WVSA 1GPWA 1IXNA 3C2RA 1EA9C 3PB0A 1EEPA 5CZJA 3NYZA 1ALDA 1QW8A 3NM3A 2PWGA 3MBFA 5EYWA 3FYPA 1B4EA 2BHUA 1CGXA 3TW7A 3MBDA 4N6FA 3GDRA 3EX6A 1OYBA 3WY4A 2D0FA 3EX4A 2ZIDA 1NOFA 4J7RA 3OVRA 3LB0A 1EUAA 1SZEA 3U2OA 1VCVA 2F7PA 1JCXA 4JCLA 1AL7A 3WNNA 1XFBA 3KL3A 2G95A 3R5EA 1X7FA 1XC4A 3L21A 1C29A 3IGXA 2WVTA 1IGSA 3TC6A 2OT1A 5AOUA 1IIHA 2ISSA 2QPUA 3KLLA 3A21A 2ZXAA 1DHPA 4PH6A 1LORA 2QJHA 4KWUA 2WNQA 6CGTA 3L0KA 5CG7A 3KWXA 2TSYA 2C19A 1D3CA 4UZUA 1IXOA 1Q4NX 2DIEA 5LNUA 4H8HA 5I0DA 1H7PA 3LHVA 3WEMA 3BLIA 3ATZA 1LCOA 3W7KA 1TPC1 1PJ9A 2H8XA 3TSMA 1JL8A 3VSTA 3I68A 4JFSA 5G2WA 4CKQA 5A6LA 1QPRA 3HF3A 4X9YA 3UQNA 2CU0A 1D3HA 2DIJA 4R53A 1TMHA 2NX3A 2VKZG 1HG3A 4S2BA 4TIMA 4GIAA 2Y89A 4O12A 5FEPA 4UNIA 3EJRA 3G22A 4AWUA 1JQVA 4KFPA 3WJZA 4O57A 3VX0A 1R2TA 4O11A 4JIQA 1IXQA 3QQ0A 4HHPA 4PCSA 2BSLA 1FXQA 1XM3A 1ZAIA 3CZNA 1WDWA 2C1HA 3M43A 1Q6LA 3W70A 4NI3A 3N73A 1KCKA 3LCHA 4QITA 1VFMA 2YW3A 2ZTJA 1QW9A 4IMGA 1FX6A 1VS1A 4FLSA 1LBLA 2YYUA 4K6AA 2GVYA 1TCDA 4NX5A 2WNWA 1K03A 4HNNA 2C0AA 3LHUA 2YPIA 3E9AA 1ICPA 1VIWA 5D38A 1P4CA 3FKRA 5K4ZA 4ICNA 4ADSA 1ODUA 4PC8A 2WVVA 1EWEA 1HNYA 2JK2A 4M56A 4UTHA 2VFHA 5AYYA 3GBEA 2VENA 3W7NA 2OCZA 1P6WA 3W73A 1EP2A 2EEXA 2FIQA 2C8NA 1DQWA 1XD1A 3NL6A 4MJZA 4K38A 1UJPA 4N9DA 1AK5A 2HSAA 3W22A 4NZFA 3LI1A 4WX2A 1CIUA 4FNSA 2X2HA 3W7OA 3HGJA 5G1YA 2DORA 3W7EA 3MYOA 3TU9A 1G5AA 1VJIA 5DCEA 5C55A 4R33A 2XN0A 4FNPA 1RR2A 3VMOA 2B7NA 4RZ6A 2QLYA 2I14A 5HUPA 3TE9A 3TQ0A 2VFEA 3NVTA 3A23A 3GYEA 1JVNA 4K37A 3UPWA 1H51A 1P0KA 3LV5A 3KHJA 2GJPA 1WZLA 4DO4A 2ZE0A 1V5XA 1K7EA 2EJ1A 2F1AA 3HQ1A 4AWSA 3E12A 1E40A 1C8VA 4GNJA 4LV9A 1CX9A 3INPA 5AN7A 4A29A 3PVFA 3STFA 4O16A 4GUHA 2Y5EA 2A85A 2Q3RA 3IIPA 4Z1CA 4H4IA 2FHBA 5KZMA 4KWVA 1GJPA 4WZHA 4TR9A 3IVUA 5D09A 2Y85A 4EF9A 1H50A 2CLLA 1TV7A 3LCWA 3DFTA 5G5IA 1UKSA 3BW2A 4PFMA 1I2NA 1SR9A 3OEXA 3LTYA 1UOKA 3P84A 1UH3A 3M47A 4I7UA 3W76A 4UTWA 4ZZ9A 1TMQA 5E1QA 2YYTA 6ALDA 3AJ7A 3IIZA 1EWDA 3LTPA 3N9SA 1AW5A 1NEYA 5HULA 2W6RA 1F2JA 2CLIA 2ZRVA 3Q2DA 3UXDA 1YLVA 3S1UA 3IV3A 4M6QA 2A1YA 3BUDA 5K7JA 4ADTA 3H53A 1GTHA 3W7RA 3N3MA 3ZWSA 1KTBA 3BK0A 4DXVA 3E02A 1N8FA 5F2IA 1XXXA 4RV8A 3IJ7A 5TBOA 4N9CA 4CCDA 5CGQA 3M5XA 2G3NA 3QPYA 4WLCA 1LOQA 3DX4A 1JXKA 5E0KA 4LTSA 1TPB1 1LROA 5G4EA 1LWHA 3IIOA 5FEWA 3DI0A 3TJXA 2GJLA 4LUIA 3CU2A 3WNMA 2DZSA 3FKKA 5TIMA 1QI5A 4HPXA 5E70A 5EMYA 3W2MA 4RZ5A 1LWJA 2R91A 3I65A 1JUKA 2P0OA 3C2VA 3ABSA 1M7OA 3VM5A 1JG9A 3CZKA 3NOEA 1MFVA 4OIFA 3UWUA 3DHUA 3GX9A 1WE5A 3CC1A 5DCBA 3R8RA 3GDKA 3B0VC 4I7VA 3ABQA 3NG3A 1AVAA 2GUYA 4XTIA 1P0NA 3GIYA 4GRSA 4EWND 5HXMA 2F2HA 4MY1A 1V3MA 4WY0F 3THAA 3W23A 1QPKA 3DI1A 3DH7A 4CQAA 4UNKA 4LPCA 3S8HA 3L5AA 3NQFA 2ATMA 2ZZ6A 4IXHA 4CN6A 1A50A 1YADA 3CT7A 1YXDA 3TK7A 3DX0A 2O7QA 3K8MA 4PL2A 3T44A 4QISA 1KM3A 4MY9A 3W83A 3H54A 3C8FA 1YDOA 3B04A 1MZHA 5CZSA 3WJSA 3UG5A 2PWEA 2NWRA 4EVZA 2ZZ5A 3TAKA 3O8AA 5FI8A 5CLWA 1ZFJA 4EF8A 1TJRA 1E3XA 1PAMA 4JGDA 1ICQA 4H6KA 4MVAA 4HNVA 3K8LA 3LXBA 1MFUA 1I45A 5F1VA 2CZDA 5LNWA 1M53A 1D9EA 3RK8A 1EO5A 4B9ZA 1PL9A 2ZUWA 1JJKA 4IJBA 2YIHA 5CPMA 3W87A 1UKTA 2YJQA 3DX3A 1VRDA 1OFDA 2QDHA 1SO6A 3F03K 3OVQA 4H2CA 4LC6A 4UZSA 5DO8A 3N14A 3NQ7A 5DCDA 1U5JA 2C15A 1FWNA 2ZRZA 2E6YA 2OSYA 1J5TA 1LLZA 2DZPA 3QM3A 4LRTA 4M8UA 7CGTA 4NXSA 2NT0A 2J9YA 1R2RA 3CZLA 1A47A 1KBJA 4X22A 2Y63A 3G1DA 3DZ1A 1A5BA 1VYRA 4U2ZA 4UTWC 4XZ9A 1XGZA 3HZ3A 1DOSA 1ME9A 4LVDA 2NUWA 1ADOA 3BVJA 1QHOA 1Y0EA 1UUOA 5MHBA 3W7HA 1GVIA 2F7QA 3KOFA 2FYVA 1Q3NA 2A7RA 4MOZA 3PBYA 2OMAA 3P5ZA 3TOPA 4AMXA 3DFOA 3BH4A 3F1QA 2ZX8A 3L4XA 1H7WA 4KMQA 1CGTA 3BLKA 5EA9A 3S5YA 4HOXA 1UD3A 4JTEA 3BAJA 1CGWA 3SW6A 3UWVA 3EX1A 3W1PA 1ZENA 3NQVA 3CZSA 3M5ZA 4AHOA 3ZT7A 3MHFA 3ABOA 1GT8A 5A2AA 1T8XA 2WKJA 1SSGA 4UUIA 1B4KA 1OJXA 3LGEA 2GQAA 3M07A 1P5BA 3G18A 3NQMA 4E38A 3VGEA 4BA0A 3KVJA 1JUEA 1FWWA 4QNEA 2DH3A 1Z41A 4E2BA 1H7XA 1XSIA 2PRLA 3G1VA 3CLMA 3PM6A 2Y24A 2C13A 3D50A 3FJ6A 7TAAA 2PWDA 1UUMA 2C3ZA 2NXIA 5LNVA 5CSRA 1AQMA 2D73A 3SGZA 1OFAA 5D2TA 4Y6GA 1S5TA 2CLKA 3W7IA 1BSIA 2QAFA 4J27A 3BSGA 1D7FA 3LXAA 2CZEA 4Y8FA 3QW4B 4O50A 4NQ1A 1O7DC 1KFLA 3BAWA 3BV4A 2OSWA 5LGZA 1SU5A 4LXFA 2QJIA 1JF6A 2FPVA 3TFXA 4HP5A 3GAYA 1W5NA 2TPSA 1SUXA 8CGTA 2RDUA 3DFQA 2GQ9A 2PRHA 3EKZA 4DPPA 2FH6A 1H7OA 1FWTA 1N55A 4IMDA 4IGHA 4CNPA 2ZA1A 3BG3A 5EL1A 3BUQA 3OVPA 4JYFA 3TC7A 4AIOA 1TRIA 3LTSA 1PS3A 3MUXA 3ZR4A 3VNYA 2Y61A 3LHTA 4AYGA 5DY2A 1QNVA 2WJZA 3LHZA 4N4QA 1QOPA 4QIUA 1TTQA 4ZQOA 2CLMA 3HBLA 1HT6A 2RKXA 1KBKA 2WPBA 4XWUA 4UFKA 3QRHA 3C61A 4NX0A 4KFNA 4WD0A 1B2YA 3DFNA 2V82A 4Z1DA 2VFDA 3CM4A 3NQCA 4IOTA 3HIJA 2HS6A 3IGUA 1ZS2A 3L0GA 1FQ0A 2NXGA 4MIMA 3VE7A 1AL8A 4FF7A 2DZXA 5I5RA 1EB3A 3B8DA 4U3CA 1OABA 9CGTA 4UC5A 2H6RA 5AC6A 3RIKA 4O4WA 1DJNA 3GXPA 3MYPA 3M6YA 1F6PA 2QJGA 2EHHA 3QQ1A 2YXGA 3BMVA 3VGGA 3TX9A 1HX0A 1SMAA 2GOUA 2Z6JA 3G1YA 4YWIA 2IGTA 1W5OA 3MJYA 3L4ZA 3VI2A 3W84A 4GUGA 2F7OA 3ZOAA 4ATWA 5BRPA 5CSSA 3W2LA 1VHNA 4QSHA 4Z1BA 4AEOA 3SJ3A 2ZA2A 3L2MA 2HTMA 3UERA 2VEPA 4UQ9A 4QQ3A 3RLUA 4O53A 4JX5A 2Y7FA 1JULA 1QPOA 1DBTA 2VOMA 1G69A 5A2BA 3GXTA 2CLOA 2JKPA 1JDCA 1K02A 3D4YA 1F76A 1TRDA 1SPQA 3FW6A 4O18A 3DC0A 3GXMA 2WKGA 3ZR6A 4HOWA 2RDWA 5F2MA 1QO2A 3LLFA 3WNLA 1EX5A 3P62A 1BTMA 4GO9A 1H3GA 3LDVA 4O1DA 3T55A 3ZSTA 1FWRA 1XCFA 3Q37A 3GXDA 3SSJA 2A7PA 4GO8A 2FH8A 3SZ8A 2FFCA 3NQAA 4JTJA 5F1UA 3IVSA 4A2SA 1CXHA 5A6MA 3LV6A 4E0CA 3P5YA 3OLDA 2I9EA 1HUVA 1MW2A 2Z1BA 4CNOA 5IBXA 1CLVA 1BWKA 1SFJA 4ZQRA 3WNKA 3W07A 3BMWA 1EO7A 3W2UA 3Q94A 1W5PA 3A5FA 1FCBA 4JDBA 4MKNA 3DX2A 2Y70A 3N2MA 4JYEA 3AO0A 4K7VA 5DLCA 2BHYA 3KXQA 4MZYA 4ADUA 3QMRA 3TXVA 1TQUA 1VFUA 5KMYA 3W7CA 4AAJA 3G1XA 4WY0B 4J3TA 4LVFA 1TQWA 5D05A 2PRMA 1UCWA 3LRLA 3WMSA 4IWWA 5DBTA 1UD4A 1KM6A 4MZ1A 2WNNA 2XIBA 3SFKA 3LRMA 2ZTKA 2NSXA 4KWWA 4NU7A 3WJXA 1HTYA 3NAVA 4FNQA 1I4NA 1W8SA 3BW4A 5FF3A 4JXCA 2QAPA 2Y4SA 3L2IA 4FX7A 1KCLA 1G7UA 1XSKA 5CGTA 2R94A 4C1LA 3VE9A 3A4AA 1TTJA 2DJXA 3LX9A 3OHIA 4JTSA 2FB2A 3HJZA 3F4NA 3LHYA 4UTJA 4C1KA 4AHQA 2ZBTA 3NDOA 2XWEA 3L65A 3FAWA 3W7MA 5CPOA 1PPIA 1V7YA 4FIRA 3VSVA 3M16A 5LSMA 1WBJA 1DL3A 2TRSA 2TYSA 4U31A 1J0IA 1K7FA 2A0NA 1BVZA 3PWAA 1YXCA 3II1A 2EADA 4MLRA 1UH2A 1GVQA 4UTUA 1TJPA 3W2NA 3O16A 4AF0B 3W7GA 2E8ZA 2V3EA 1UA7A 3ZSSA 4NT0A 1KGWA 3T7VA 2QV4A 3QF0A 3W1NA 1P1XA 4QAIA 4Z0JA 1FUYA 3KRSA 3W3OA 1WOBA 2GQ8A 1Z32X 1O4UA 3WY2A 1PCKA 1HO1A 3OA3A 3A6OA 4I9AA 4AF0A 1KM1A 4X3ZA 4UIOA 4KFOA 4CGTA 2ZX6A 3ZO9A 2PC4A 2CZ5A 1UB3A 4O17A 1BEUA 1U33A 1J2WA 4IMFA 4LVAA 2AQWA 1JI2A 4IMCA 5BMWA 1Q6QA 3G8RA 3GTNA 3L4WA 1TQSA 3LERA 4HSNA 1NF0A 4MUZA 3NQ6A 4PCTA 1VYSX 5I3FA 3EJTA 5A8GA 2QMKA 3KX6A 1A5SA 1XCWA 2Y62A 2B7QA 4WUIA 1QO5A 5K4XA 3RLVA 1GWJA 2QCDA 3QFEA 1TPH1 2FPYA 4YXGA 2Q8LA 5CPNA 2FE0A 3EKLA 2GPTA 1KFBA 4JR5A 1MSSA 3HPZA 3SECA 2AAAA 4J28A 1KFCA 4JTKA 4DQWA 3RNDA 1T0OA 4AMWA 3W1LA 1OG0A 3LBCA 3WEOA 1JQXA 2FQIA 2D3LA 3VGBA 2VRQA 1LYXA 4O0KA 4LT9A 1GOXA 2W0UA 3UEQA 5AHNA 1MEHA 3EWZA 2X30A 3WFZA 3ZT5A 5KINA 3TNOA 1TPDA 4L4MA 3B06A 3P8IA 3EX3A 2P10A 1JI1A 2VFGA 3BAXA 1DHKA 3CZGA 1TPUA 5CLTA 7TIMA 2ZCGA 3A47A 2CLHA 3P82A 1OB0A 1RP8A 3GXNA 3W1TA 4O10A 1GJWA 3BG5A 3OG3A 1K8ZA 3E49A 1OYAA 1OFBA 1W1ZA 4M7TA 1WA3A 2ZXDA 2YCEA 3C6CA 3MI6A 3IIXA 5LZLA 2BXZA 4JFTA 2EQDA 2BXYA 3NPWA 3O6CA 4CLMA 1PIIA 4TX9A 3N19B 3FA5A 1Z42A 1JFHA 1IZJA 4UMCA 4UFLA 4UXDA 1VHCA 3G1FA 4RKAA 4NUWA 3P60A 3ZQ9A 3QMSA 3T78A 1WQ5A 2OSXA 3T40A 1MW1A 2B7PA 1AQHA 3CIWA 3QGVA 5D2XA 4HPHA 3LI0A 3BAYA 3PUEA 1K7XA 1YDNA 4BWLA 3USBA 5EMUA 3CWOX 1JAEA 3EWXA 1CI1A 2ZICA 1QWNA 4GE8A 4ZQMA 2V81A 4ZVJA 4MLJA 3UXAA 3TQVA 3LCLA 5FF4A 3WFAA 3O15A 3BUPA 4GJ1A 1X1OA 5K9CA 3KVLA 1MEIA
chains in the Genus database with same CATH superfamily
5J1TC 1FP9A 4B7IA 1RPKA 3NFNA 2QMJA 4LVBA 3N34A 5K33A 1DE4A 1S9VB 3O6KL 1E9PA 5HHNA 4LBAA 4AJYV 4YCPA 4IKIA 4C6PA 3B9NA 1WBXA 2XN2A 3K2MC 1AQ8A 4B3LA 3QG0A 4F20A 1E42A 5IK3B 1OHLA 3CGTA 3OYZA 5AW1B 2QCLA 1OKEA 1E90A 3WLBA 3EGDA 3WFBH 4GG8B 4E2OA 4JN6A 5AQ0A 2OL3H 1NS4A 2WGQA 1HP5A 1YEFH 5C0QA 4NCC2 4OCXL 3FU0A 3SQOL 2WOFA 1H5VA 1N6VA 3MP5A 2CLVA 4F2BA 5J89A 4LAKA 3E2SA 2X4UB 2VURA 3R4IA 5BZAA 3UGRA 3ASNB 2X09A 4YBLC 1X8CA 4ZGYA 3VUSA 1HI6B 1OF0A 2BX5A 2PNCA 1OFPA 2CLZA 2D2JA 3M7WA 1D5MB 3OU8A 3SCVA 1BF6A 1VACB 4TULL 3IKCA 5CUSH 5CEZD 2DVUA 1QOQA 4EUPG 1EEQA 1FFNB 3GBNL 3GZPA 2WBGA 4GQ0A 3VXTA 1J0KA 4O5LL 5D7SH 3HQNA 3DIVA 4XX6A 5CPQA 1A7RL 2ZZUT 1NAMH 2PR4L 4L65A 4R97B 2VQ4A 3PQYA 4Z7WA 2ZZ4A 3H24A 1IAIH 4OF5A 4U6YA 2X87A 3I6RA 3WIFA 3D2UD 1ZJIA 3DX7B 3WLPA 1FVEB 1UJTA 1CLXA 4QMEA 1HHJA 5FYKD 4ZFZA 3ULVC 4ZX4A 3MHZA 5LA1A 2XYBA 4MNGB 3TYZA 4UZGA 1E15A 3MV9D 4F37F 1FZMA 1M42A 1TFPA 4S1RH 3T0ED 4B9IA 1I7RB 1A64A 3GDMA 2JQZA 4Q4SA 4ZG1A 3BPOC 3S3DB 1A1MB 1QLRA 1BVNP 2VRKA 4MJ2A 4NO0A 3BWUC 3PTMA 4YXLH 4UNLA 3O6DA 4M5YL 3D85A 4LLDA 3GSXB 3X41A 1XLFA 3NURA 4U1HB 3P8JA 3S6DA 3PDGA 3X14B 2P26A 4ZBJA 1FIEA 4GZJA 2Z31A 3W7SA 1TPVA 4C65A 2J8FA 4P7NA 3VD1A 3FRPA 4XAKD 1X1JA 1AKJB 3CH1B 2CGRL 2V30A 4HULB 4LQFH 4TOQA 1SOKA 2RFXB 2J5WA 2RB8A 4PGBB 4P7LA 2VQTA 1K8DA 1FDYA 3IS1X 4M24A 5ALCL 1TPWA 5ESAA 4OZGA 4TUKL 4FG6C 3AREA 1F11B 1QTYT 1SO4A 4DZ8A 4DEPC 4KJYB 2CPUA 2OYKA 4TQHA 2Y7QB 3D33A 3PJLA 4OQVA 4PU2A 1GOGA 3NRFA 4FXGA 5IVXB 5K9QG 1LWIA 2ADFH 4AWTA 1YPFA 3WJYA 2VZ3A 4OUIA 4K23H 1T0MB 1GCYA 5B3JE 1PVNA 1XCQB 3DRQA 2XH2A 2I5GA 2Y1YA 2FGBA 3EOAA 3GW3A 5JXQA 4JKPL 1TZIA 2DI9A 2HRGA 2PR9A 2KZKA 3KPNA 5K39A 2NX5B 4IOFD 2LVCA 2EVIA 1OX4B 4Q32A 3UWYA 1VRXA 2F54A 5IV2B 1BIHA 2N4IA 1J18A 3AIBA 1KR0A 1XX9C 2J6XA 1J9TA 2JELH 4ICXA 1WT5C 2H3BA 2GI7A 3AREC 3EYVA 4HCGA 4Z7OF 1W9UA 3MBEA 3BDBA 5C0DA 3QUZA 1X5YA 4UCFA 3GF8A 3GNMH 1HOCA 1U91B 4HKXB 4O54A 2C18A 2FJHA 4Z7UE 1FG2B 1Z9AA 3W25A 4QLKA 1XYBA 3ZYZA 4LIQL 3X3XA 4B9YA 3IMUA 1GJIA 1KM4A 4GIRA 1TO3A 5CJXA 2PZ0A 4ONFL 1P2CB 1CB4A 1YCSA 3CUPB 5D7JD 3ZS4A 1OARH 3S4SB 4QRPA 1IVVA 4N2OA 4D1IA 2XQBL 1CFTB 1KD0A 2D7TH 4JHAL 2A9AA 1E27B 4GW5A 1NOAA 4XB3A 4B9KC 1UQSB 3L0NA 3REQA 1CE1L 2R0LH 3HS0C 1JZ2A 3P3TA 5I03A 4WJXA 4NERA 3OG4B 2YPKB 3S5NA 4BDVA 2XVKA 4JTGA 5J13C 3MLSL 5T33L 3TURA 1DVJA 1GS6X 3ZDYF 3IMBA 1FHVA 4PWHA 3MLUL 1VYPX 4OHQA 3ZHFA 2NY3B 1NDWA 5IGXL 2YA2A 2GBAA 3F5WA 1RULH 1X5IA 3O3UN 3VD2A 4Y1TA 1TELA 4H9TA 4QQUA 1GZGA 2YPVL 2VERN 3R4RA 4U1NB 3V5DA 1VKXB 5K9XA 5D2YA 3IJEB 1SW3A 4PGJA 1MCOH 5B7FA 1ZSHA 2JTYA 3ZJ8A 3L4TA 3MJWA 1W2VA 3BQUC 1JGVH 3HNTL 3I6GA 2UWEB 1BHGA 1WEJH 1MJ8H 3D69A 1SNZA 3NIGB 2KQNA 4HZLA 2BWIA 4OKVB 2FHCA 4QTHA 2NVDA 1KFAH 4BJHA 3M1ZA 4KMTH 1OZQA 3IWVA 3HFMH 3UTTB 1YUHA 1U36A 1IKNA 4L37B 4D9RD 3MI2A 3WLRA 3NJGA 1KLFA 1B0IA 1OK0A 4P5MA 4UMGA 5I17B 5KYYB 2JTDA 1LEIB 1MAJA 5CZTA 3DIPA 3FRPG 2OJPA 5F6HI 3DXIA 3BOVA 4AEFA 3K6FA 2PPCA 3QXAB 5GZOC 1RBOB 1FGVL 1RERA 4WEUD 5I1JH 3MZ2A 4UWQB 1VBRA 4I77H 2PGWA 3U0PA 4YBQD 1AD0A 4XT1C 3MQIA 3MRBB 4ONGH 3X3GH 1B3IA 1GZQB 4KZEH 2VO5A 1FDZA 2XVGA 5EH1A 2FJGB 3S36X 3BFOA 2W9LA 2CO2A 2A73A 3OM3B 3QO1A 4X8CA 3VFGH 1F1SA 3NCYS 3HUJE 4JL2A 1A9EA 2FJFA 4OLXH 2HQAA 2PURA 4S3GA 1BBDL 3PJWA 3QULA 1E0TA 2MH4A 3ZJAA 1P4BL 3PZGA 1QVOB 2GDUA 4GUFA 3BP5B 1NMAH 1VFAA 4RMTA 4APQA 3CFBA 4JRXD 4NC1E 5D9MA 5HDRA 1ZVHA 3ZYOA 3TYGH 1AIFA 2P5WD 2QDGA 3IFNH 3EH2A 1ML0A 3ISYA 1ACYL 3G6DH 2O72A 3P0GB 3QAZC 4JQXA 1W56A 3ATYA 1R5WB 4XMPH 2X4TA 1V6WA 3RNQA 4U1IA 2VEKA 1HWWA 1IWPA 1W4NA 4FEMA 1O95A 5FS5A 4BH7B 1W72A 3NQIA 2B77A 3SGKA 1WMPA 3C86A 5BYWA 2NNFA 3WSQL 1Z3GL 1E43A 3DHDA 3MWAA 4PUKA 2P8CA 4LAQL 4KY1H 3UBHA 4FEZA 1T20A 2YAHA 1B31A 3CE1A 5ECVA 5HJ3B 6REQA 3QUZB 1QBML 2DZWA 4RZKA 3B6SA 4ZS7L 4Z3TA 1AE6H 2WV8A 3DO4A 4YHPA 3RWCA 3V0VA 5REQA 1GGTA 5HHQA 5KBNC 4YSCA 1R6WA 3NGJA 1IGYB 1T4KB 1S5HA 2VC2L 3OGSA 4CC0A 2PODA 4KITB 2DDQH 3NZ8B 2CQTA 3NK4A 1OCCB 1OX4A 5E5MA 3MRJA 1W5MA 2FWOA 3NGBB 4AKQA 3OGRA 3FT0A 3MRLA 3A24A 1RJRA 3RTQB 4JFDE 5EF3A 1JUFA 1R24B 1J0HA 3NIFF 4X5XB 2PMQA 4ZTXA 4M43L 2H3KA 3QHTC 4YSUA 3VC5A 3AMOB 2A3BA 2YAFA 1C90A 1DQJA 4Y2DC 3LKQA 1MUWA 5A3HA 3ARWA 1I8LC 2Y7MA 1HKFA 3CHVA 5DURB 4GBUA 1IGYA 3TH2T 1S7SA 3SKOA 2VR5A 1A6AB 2IWEA 1N7NA 4TO8A 2H9GB 1C9SA 3GVGA 3WBEA 4Q4KA 3NA9H 1NOWA 2V2XA 4U6HB 3KWWB 4XP1L 1CBVL 3IJ9A 1CDIA 3Q3GB 4G7RB 2W5FA 4L2YA 2I25N 5E8EA 3UAJC 3LD8C 1SYVB 3HG4A 1M05B 4NQED 3NEXA 1WV2A 2VR7A 5GGUB 5IROA 1M6OB 2OL3L 3O8XD 4U1NA 5T3ZH 5D9OA 1BP3B 2E27L 1DANT 1FV1B 5CLZA 4KRNA 2GJXA 2JIWA 4A37A 2PD5A 2IMRA 4DB7A 1IBFA 5HI3D 4KRPB 4QP0A 5CJXC 5ACZA 2XIIA 1EJTC 2AK1L 2V3FA 3IWUA 4MA7L 3V16A 2XICA 3EYUH 3HMXA 3DMMD 3PAZA 1CLKA 1WDQA 3GYCA 4E9XA 1AS6A 2D7NA 5GS1A 1GW1A 3VGHA 3MT1A 2IKIA 1D6ZA 4P9ML 5IESH 2W60B 1OCWL 3QVAA 5IJVB 2D3JA 1CGYA 1H3VA 3LSOA 5LNDA 1FFQA 4D3CH 2V2DA 5T8GA 2R39A 1QI3A 3EG9A 5JW4Q 1LQSR 4OUUB 5LXVA 5E6IA 4QY8B 5IROC 4ZMYA 3WKQA 4YDJA 2CPCA 2XQYA 4Z7VE 2B16A 1JK8B 4L4TD 1LO4H 1QDSA 3NH7L 4JCMA 4YNYA 1QR7A 5SX4I 4YLCA 1S7UA 3UAEA 1KPRA 4PLKD 4XVJH 2YXOA 4JX6A 5ABZA 2J75A 4UT6A 3AISA 4AU0A 3ARSA 4UTKA 2Y1ZA 5M2FX 4BF7A 4F9LC 3QZMA 1SPDA 2EDFA 2V5TA 2JKAA 1E6ZA 2UUDH 3ARDD 5DRXA 2XG4A 1XL6A 3BPOB 3CIVA 4TLKA 3MMEA 1XGUB 1BWWA 4JM4L 3TR2A 1UCTA 1BBJB 5H2BB 4GKNA 2HLFD 2J7LA 4ZUVB 3UTOA 1FORH 1QNZH 2Z65C 3QQ3B 1UB6A 3L9BA 5T1DL 4FQXB 3LKSB 2WQ8A 4ZMZA 2WXOA 1UOWA 3BT2H 3RX5A 4EN3D 3LQLA 5GRYA 4L1GA 1FRBA 2CGRH 5AHIA 3BANA 3BPWA 4UV7L 4DYKA 4IOSD 2FMNA 1ZLUH 2I07B 3N5AA 2F53D 3NJXA 3QCVL 1K70A 4R4BA 4UQEA 5DRWB 1KJ2B 4OM0L 5DJYA 1A5CA 2ZZ7A 3QV8A 1PO9A 4DJFD 2OAAA 2VXVH 4BDVB 3A4WA 1TR9A 4P5KA 2V6HA 4W8AA 5B7YA 3ZTJG 4W88A 4FLRA 1P7HL 1KDJA 3HPAA 1SBSL 4L29B 2AERT 5JDSA 3N40F 3BKML 2MTAA 3O4LA 4XNQA 2YAPA 1XTMA 3WKMH 4ERSL 1YYAA 4EXQA 1N6QL 1UWXH 3BJTA 4APQC 5HYSG 2DWDA 2EVHA 1UEMA 3W56A 4X6DB 5DRZA 2GITB 5C0EA 1U8CA 1PEWA 1HAUA 4RDWA 4B3KA 2WLZA 4FFYA 4L9XA 4PBFA 5JZ7C 3KHOA 1PX4A 1QW7A 1ZQ5A 3LQZA 4UTFA 5I3IA 2ZUNA 2X4SA 1TTPA 1A4AA 4YNGA 1IM3A 3HI1B 2WCSA 4DW2L 3VFPA 4NRSA 4NRXA 2X1RA 4F2EA 2YXFA 1T04A 3GUTB 1OWQA 4WU7B 3WLSA 6REQB 3SCWA 3VXRA 2QCGA 1BD2D 1MI5A 3S34H 5C0CD 3P9LA 5FYKU 1IEBA 1Y07A 3UBFA 5JPMA 1LDPH 1GQNA 3VNMA 4MKVA 5F9WC 2AQ1A 2P43B 5IB3B 3TX4A 2VFFA 2FQDA 3IYLW 3TYBA 5C0AD 5C2XA 2NTFA 1ICSA 3QDGA 2VSCA 1RIHL 3BVTA 1KLGA 4O02A 3V52H 1NGWB 4NZ5A 4Z42C 3PDDA 4FZ8H 2NY6D 1ONQA 5DMJB 2A1WH 2ARJA 5FGBC 2WO5A 1W6CA 2ZVRA 4WFFE 1NOUA 4HIBA 4JFHE 4AZCA 3KPOA 4ZAKB 4PRID 2UUDK 1E65A 2NX5E 4HIJB 3E6FB 3WI9A 2AS5M 2W61A 4OU1A 4X9SA 2VR3A 1QR1A 3P0XA 4JNMA 4JE0A 2BIMA 4CGUB 3IJDA 4LPXA 2AXFB 3QE5A 2VXQA 4Q6JA 3ATEA 3CIQA 1MCOL 1TV5A 2R8SH 5EF2A 3KS0H 1PTDA 3PWUA 3OQ3B 4G6AD 3PP3K 4QT5A 4PCYA 3VTTA 3B8VA 5DMNA 2BOFX 2TMDA 3I50H 2G5UA 2BTMA 5EIIB 3CPRA 5CU5A 4NC2B 5ENLA 4BSVA 2SFPA 4IHOB 2APVA 3X1BA 1IGCL 3DAQA 1A1MA 1QLRB 1E6SM 3MSPA 4DVRH 2FBJL 3M0ZA 3UWQA 1UC5A 1UXWB 2AV7B 3HE6C 1TFVA 2PW1B 4NJHA 2CKNA 3WY1A 1ZVSB 4OGZA 5F3HA 4E36A 5DC4B 4JN2A 4J8RA 4K8GA 4FIQA 5HUOA 1EP3A 4LRNH 2GKIA 5FEZA 3L7EB 3N6HA 3MV8B 3H7LA 2BSRB 4IBVA 2GBVA 5E08L 2PDKA 5D2NB 3HR6A 1NP0A 4Y2OA 3X3GL 5AG8A 1PKLA 1R34A 4JM2A 4KJWD 2XG9A 3KPQA 1CFQB 4OWGA 3CXDL 4U1MB 4BUQA 3U9IA 4NKDB 3MOAH 1XRFA 1VR6A 1YEGH 4WUUB 3RKDD 4DVBB 4PUMA 1T1XA 3FTWA 4C1NB 4CJ1A 1NMAL 2WV3A 5LNSA 3G8EA 1QSEA 1T66C 4PPTA 3RO8A 3VNKA 3FFSA 2G5WA 5FECA 1WEJL 1HL2A 3OHMB 4L4VE 3RIAF 1E5JA 2X6MA 5JQ6L 3L2NA 1RZQA 3IV8A 1E51A 4A3YA 3K8KA 1T1ZA 4PGCA 1K1XA 2EKGA 3VGDA 3C3NA 4LCIH 2MJWA 4JGMA 4GG8A 3ZDZE 3S5OA 4CEXC 1RZGB 5LIWX 1ZTVA 5CWSB 4IMLA 2RJMA 3MV7A 1X7IA 2ZSWA 2AGJH 3CPLB 5E51A 4XV0A 4AX7A 4X4ZA 3Q1EA 1TTAA 3TNNA 4YDKH 3B7YA 3S96B 1GQJA 2EPOA 4Q8PA 1YN6A 3P3RA 2JVUA 1BAWA 4NO2B 4OCWL 5LO7A 3DENA 1I3VA 4HHLA 3PANA 3BP4A 4LL1A 5F7UA 1AJ7H 3TEZA 3CBJB 1RW9A 1I3UA 4MNQB 4OAWA 4DP7X 5AHLA 3CHPA 2DP3A 5ETUA 2WANA 5HYIA 4LNRA 3EEGA 1YECL 1D6VL 3CIAA 3BSHA 4WOQA 4OT1L 5HVHC 4ZL1A 1E4WL 5F9DC 4JB9L 3VSNA 2YEZA 1UVQB 3GXUB 3MODL 1N8ZB 3P4OA 3Q8FA 4OI7A 3NGBC 3VYPA 1M41A 2VC7A 5EKYA 4J35A 3TN3A 5ALBL 3FO1B 4PSPA 2BNRB 2OPCA 3KLKA 4L4OA 4LB4A 5EU7C 3HGOA 1K4DB 3GQFA 4RNIA 4WKFA 2LU7A 4AC7C 2Z1VA 5D30A 3AU6A 3IJYA 3GKZA 4M03A 4NUMA 1ORSA 1HINH 2J6WA 2YSSB 4HKPA 5AC5A 1BPLB 1R4XA 3TNMA 2HT4D 3TTYA 1OC7A 2Z9TA 1ZLWH 2P47B 2PGEA 3AU1B 3NQGA 3H2NA 5EFFA 1MEXH 3UBXI 2ZZ1A 3MLWL 1UD8A 3BOFA 1OINA 2D3VA 3MRMA 5DQDL 4OGAD 3EYPA 4QJ1A 3MCLL 4WY7L 3RILA 4KQ4L 4BQCA 5AFAA 2YCLB 1RQHA 4ZXLA 4DF0A 1EV2E 2H26B 3R8QA 2NUPA 4HNTA 3RMEA 3BZEB 3QAZB 4HUVA 4HMNA 1SSDA 3LEVL 4RR4A 4KDVA 3X12A 3PR2A 4RPQA 1IC0A 4PR5A 4NWUH 4JTTA 2XFXB 3BZJA 3MRDB 2IXQB 3A9BA 3GFYA 3LNEA 1KBVA 2NY5C 3E8UL 3ARRA 3TBSA 1RQEA 3CEUA 3VU2A 2E5DA 1UA6L 3DBXA 3JXAA 5IQLA 1IF2A 3K1GA 5A5WA 4G5ZH 4LNCA 5AW8B 2ZT9C 4KK9D 3NJ3A 4FA3A 1FDJA 3GLCA 1ZIBA 4J3UA 5HJBA 3PAVA 4K94C 3CVIH 2PI6A 2DJ4A 2JCCF 5DJ8A 1U5HA 1WXJA 3F64A 4MZRA 3EXSA 2BVQB 3C6LA 3IN0A 4IPIA 4IU3B 2W65A 3NZGA 4D7BA 5AVNA 3TKFA 4GSXA 3QMTA 5DJAB 1NICA 3QUMH 5EORL 3WLLA 4JO4L 1A7OH 2ZSVB 2CE6A 2IPKB 1XBRA 4ODUB 2FVNA 1WK0A 4ZQKA 3BGJA 2AK4E 1RH9A 5EFIA 3KIIA 2IC2A 3SBWC 5DYOA 3DI3B 3W1ZA 1J96A 1QABA 2A74A 2DQEL 3RX7A 4JKLA 1B4LA 1CE6B 2XRAH 2CRYA 4KXZH 1ESOA 5HHPA 1DO6A 1Z5LB 2YXVA 3THUA 5IB4A 5AW7B 1BEYL 5KZDA 1FL5B 4HWBH 3V0AC 2Q76A 1JCLA 3FXYA 3TA6A 4YIQB 4RNLA 5JIWA 1JCNA 3SIZA 3SY1A 2VXNA 1S9WA 1RUKL 4K3EL 3IB4A 3CX5K 1RWFA 1R17A 1UB5B 5KG9A 1QPNA 3AWGA 2RIKA 3D06A 3DROA 2AQSA 2V33A 3KGSA 3RVTD 3QXBA 4O1CA 5CILH 1XR8A 4Y4HC 3TT1H 1UIPA 4JFEB 4Z7VB 3HG5A 2A7BA 5JA9A 1KM3A 5EN3A 1NAMB 4UBDC 4NAMA 1BRLA 2QVKA 1O6SA 4RSYA 3F7RA 1OYCA 3DN5A 3LHWA 4DESA 3Q2WA 1XUZA 4XCEB 3A4XA 2WWMD 3CCHB 5CD5C 3I9GH 2CWUA 1XIHA 4YHGA 4HKJA 2CBOA 3DSNA 5DMGD 4L0ZA 4ZFOL 3CFNA 2OZ8A 5PTDA 4LU5H 4E9YA 1CR9H 3QJAA 3MNWB 4BZHA 3SDCA 1FHGA 4XODA 3G5YA 1OQOA 4MMWA 5FDYA 3TCEA 4YEEA 1GCFA 1XIWC 1JDFA 3C5JB 3ROOB 2AP2A 4HXBH 3L68A 1H7NA 1KWGA 3H0TA 3CFKA 3V5KB 1T0NA 5E8OB 1NCCL 1Q0XH 3DVGB 4ZSOB 1CN4A 1M2OA 4ZUSA 1U41A 1B88A 1NSXA 3UTZA 4HJJH 1GK8A 1QRQA 4FP1A 1TYGA 1SVCP 3SBPA 5TDPA 3AABA 3MJ8B 3HBLA 4Q6XA 2XTJD 1HGWA 5FESA 2WXPA 5GGUA 3GNOA 3T3PE 2G41A 3QFJA 1M05A 4JRYB 1QOXA 3HGSA 1TZ8A 3CWHA 4GSDH 1CFSB 2C7FA 3TBWB 5IMKA 1W3TA 2PWHA 4CC1A 1YHTA 2P5WE 2QCNA 3G1SA 1C8QA 4LAJH 2J1YA 2ZUVA 3VFLA 4WW2B 4ABWA 3O4OB 4IBLT 3DLQR 5BZWA 2NUYA 4LVOB 5IVOA 4B5ZA 1ITBB 2IH8A 2VSMB 4ERSH 4Z9KB 3S3GA 2YAMA 3FNKA 3QUYB 2QPXA 3LH9A 4W93A 4K8RL 2FSEB 4GKLA 2UX6A 3AQZA 2Z6FA 1HQRB 8TIMA 4WEBL 5JMOC 2V9RA 4JJ5A 1E2WA 5T1KA 4A8RA 4WU5B 1NP2A 3KRZA 3R06B 3NOIA 5JXED 2MUCA 4G1EB 2YL6A 3NOYA 2J1WA 3K13A 2JI2A 3CK5A 2B4CC 1MCEA 3S1VA 3ARTA 1HEHC 4ZNCD 5KANI 1I1FA 4UQ3B 3W1AA 3SDYL 3OZMA 5AYZA 3MLTB 3NCJL 4XO5A 1E55A 4UV4L 1NGXB 4JM2F 3S34L 4AJWA 3ESVF 4U2YA 5DSCB 4KERA 3WTWA 1F1GA 3IT8D 4HA1A 4YWGL 1M5WA 4PJ8B 2WLYA 5BXFA 5I66A 5FJUA 2WLKA 5KN5B 2Y3AA 1OQFA 2OCFD 3K4WA 3VG9B 2K1MA 3URBA 4EVNB 1F00I 5DO2D 1FGNH 1F07A 3MUCA 4FA8A 4JEJA 2NXYB 3QUXA 4EOWH 1EPXA 2DJMA 4F8LA 2XM1A 5DMIL 3TEVA 3S8FB 1SEQH 4AZGA 2JBMA 3LV3B 4XE0A 1ZJAA 1ANUA 3E8VA 4BXVA 1OAYL 3KXFA 2E59A 5BXFB 3O6FD 5E8EB 1Q6GA 3OYXA 2LLGA 3RPMA 2UXTA 1RK0A 4DP2X 4E9RA 5J12C 1RURL 1I3RB 1SZGA 4AEHH 2ZE3A 1XBXA 2E5CA 1WFJA 1N5YH 4E3VA 3B2UD 4JN1L 2PDLA 3TW9A 1LTDA 4S23A 1THAA 3NA8A 1PHWA 2YWZA 5AOLA 4QRRD 2WHJA 2NV2A 4QHUA 3ANUA 3WYRA 5C08B 1QQDA 1DDHA 3OKDB 3FLUA 3EKCA 2QQNH 4WDIA 3VIOA 4P46D 1JPSL 3MXVH 4DY1A 3HGRA 3DFHA 4HUUB 4JFUA 2BVUA 5LAXB 5C0BE 1XKYA 3V0SA 1L7TL 1M7DB 2QGBA 5C0FB 4FX6M 3WK0A 4F7CB 3BDYH 2R29A 1DWFM 5HP5A 4RX0A 2NY2D 2Z31D 3SAZA 2F19H 3HAEG 1C5DB 4RQQA 2CR3A 3HPLB 5F88A 1JOVA 2A38A 4GKZB 5DZ9A 4F2MB 3I7RA 2J9XA 2OQJB 2V5DA 3VCRA 3GC4A 5D03A 4NLHA 3SCMB 2O0TA 2LFGA 4AEIL 4LDLB 2E6FA 1KXQE 2OTPA 1ISWA 3RWIA 5D72L 3RL1B 1GJUA 3EFFB 1QASA 2X3AA 3VGAC 4HYWA 3VFOB 5AZ1A 5GHWL 4DUVA 4X83A 4JRYA 3GNDA 4L4LA 3C52A 4XZIA 1WUEA 4M8QA 4Q6IA 4QXWA 5E9DA 1FE8L 2Q8ZA 1QI4A 4AEEA 4RGOH 4BHYA 2V2HA 1J5IA 1XGRB 1XLDA 4GW4A 3T0BA 2WXGA 1GG1A 1R19A 4Y4HB 4Y9EA 5F4SA 4L5FL 4ZUSB 1MWAH 1ORQB 1PCXA 3DX8B 3H0TB 4NUGH 3V5KA 3WIIL 3BLCA 3HIIA 1VPXA 4L1WA 4M7SA 3VNJA 5JPNA 1GHFH 5FACA 4M62L 3W5MA 3FOKA 2BNQD 4J2QA 2PDJA 1F5ZA 2PAJA 4FTVD 2FGLA 4ASTA 4ZK8A 1BVOA 3QDMD 5DD6B 4F8PA 3GO1H 2CR6A 2R2EA 1ECQA 3BO9A 2NSQA 5IHHA 4BH8B 5TD4A 2FX9H 4PM1A 4R7NB 2VZOA 4HJEA 1W3JA 2EDOA 3FO2B 4IQLA 3AZSA 4X6DE 2G2PA 5IVZB 3L4UA 1WTGT 4FQHA 2DZTA 1L9RA 1V77A 3SE8L 2VDKB 4S1DD 4F9PC 2YBVA 3PWJA 4E4PA 1JGUH 1Q72L 2WBJD 2EUXA 1G9NL 1L8NA 4BFAA 3QJRB 3IGSA 3AY4A 3QFJD 5AW5B 5HBBA 2XH7A 4XZUA 3W9ZA 2XNAB 1KFAL 3IN2A 4QXTA 2HXTA 3EZ4A 4XWGL 2ADGB 3CBKB 4YDVB 4DZIA 1AHKA 3AIUA 1ECZA 4CQ8A 1X7SA 4ABUA 5IFPA 4FEIA 3NL3A 4C6CA 5FUOH 4HX1A 1HXJA 5HQEA 4XN9A 3M88A 4EI5C 1JN6A 2WW5A 1GTEA 4ZFFA 3DOPA 5DY3A 4ZMGA 1VFHA 3T0XA 1ZCOA 4NBZB 2A6JB 3F7VB 3MLYL 4NCC1 4XPAH 5FO9B 1JMXA 2F74B 4H83A 4LEEA 1IBBA 1H8NA 1OSPH 3MHGA 1QFWI 1T41A 5ACLA 3MCKA 4MDJA 1IQWH 4DKAA 3GG8A 1WBYB 1R5VB 4BRJA 2IPWA 1RK0B 4N2FA 4OKDA 1Q6CA 4F7PB 2KZHA 4BR1A 1GS7A 3OTTA 3VUAA 5DHYA 4W9LC 5AHMA 2Z91A 1WCBB 4KFOA 5I8OL 2B20A 2IPKA 1PQZB 3B8SA 1NKRA 1KSRA 1XQKA 2E6AA 3SCQA 4UT9L 4U1GB 1DORA 4ORMA 3C56A 4P3WA 1IEAB 2Z4TA 1S2TA 1TR1A 3P02A 3IFNL 1NCGA 4F3FB 2X42A 1N7KA 3RNQB 3GDTA 4RETB 5IQ9B 4FI6A 4WV1A 3TA4D 5MEOA 1DYSA 1S39A 4XQ6A 8RUCA 5KITA 3SJVB 4I9JA 5CPLA 2GY7B 3F6IA 2YXMA 4M6NH 3TO4C 1S7VB 1CJYA 2BOCA 3EDEA 1U9KA 1DBJH 5PAZA 1EJ7L 5ENWB 1QVBA 1H0DA 4GAJH 2C4FT 4IFKB 3CVHA 4L9YA 1XBDA 5FSEC 1S8DA 3V0JA 1GVFA 4ZB5A 4XVEA 3NFSH 3K5SA 4ALAH 3NO3A 1QBMH 7FABL 3PUUA 1QALA 3MPHA 4WI9A 1YNLL 5IM7B 3O1NA 3GJEA 2ESVA 3JT2A 2B1HH 5J1SC 1Q85A 1RQBA 1EERB 2DYPD 3O0RL 3R8HA 3QH3B 4KUZH 1I8IA 2XBDA 3JRKA 2DDQL 3A9IA 1F42A 1LO2H 2IPTH 1PHQA 1WOAA 5M1TA 1PKQB 2J8UA 3KE0A 4JTHA 1HQRA 1W1YA 4XC1L 3DNKA 3WJWA 1GHSA 4M0XA 1L3NA 2PDNA 4F0MA 4HNVA 4PE8A 1LEIA 1TU5A 1UC6A 5CKAA 1U1HA 3HQOA 4K3ZA 1E4XL 2Y7GA 3AALA 4O1AA 1E6OH 1N2RA 1ZD6A 2CLRA 2R0ZL 4XPBL 1KB5L 5CSGA 3AU1A 1OCOB 4MJ5A 4L48A 5FUCE 5AG9A 5CA3A 4MSWB 1EJXC 3N2CA 3VVGA 3I9IA 3OKEB 3SRDA 1C7TA 5F21B 3RY6A 5BCAA 3NA9L 2VX4A 4HCHA 4UWMA 5JBDA 1JCJA 4YTQA 3FB6B 2CKBH 4DPQA 5T91A 1GAFH 4FHKA 2RHEA 4PJFA 5G5DA 3UT0A 3GG0A 3O3DB 2X4QA 4ZMOA 6TAAA 2FX8L 3NNTA 3UFIA 2AK4A 2GJZA 4KJPC 4JDVA 2DLTA 2MHAB 3UTZB 4G6FD 3UMTA 3O2LA 1YPZA 2TSBA 4EKJA 2WVXB 4DM2A 4CQBA 3FSOA 2WUBL 2VKWA 3KM2A 3SGEI 2YD9A 2E5BA 4OVXA 5DXYA 3MACH 1IC7L 2PTUA 3O8XA 1OIMA 4ODVL 3W27A 3RWDB 4U1HA 1PKQA 2HRHA 2ZXEB 3A4FA 4UANA 5LGHL 1NBYA 4XZMX 5CHNA 2JJWA 3W9DA 3IUDA 1Y65A 3MSGA 1T2JA 2VDOB 3V6ZB 4P2OA 1S9XA 3VI4E 4Z7NB 3AQUA 2EE9A 3OHXA 1FYHB 2ZF9A 3C2SA 3DX1A 4Q14A 1H11A 3TN0C 2WSQA 4JBRA 2DQJL 1PGRB 3VFSB 2X2UA 3RGBA 3M0KA 1NJ9B 2J88L 1UUQA 2VLRB 1AODA 2OK0H 4LU5L 4HFWB 1W54A 4JY5H 4ZCWA 1XIIA 3NH7H 4TRPL 3AT9A 5J11C 1O6VA 3AVEA 1NCIA 2JB5H 1DUYA 4B27A 3N3TA 3ZE0F 5LA0A 1DEEB 3L2LA 4IKJA 4PJ7E 5CKGA 3WTYA 1IAOB 1YQ2A 4P57B 2OQEA 2X38A 5A69A 3NAAL 1XGTA 4C5ZA 1N59B 4MCNA 1DN2A 1S46A 4BYHA 1JHTB 2FECI 2NQ3A 3T4AB 1GVYA 2GAZA 4W6XB 2BOGX 2I16A 2B31A 2GLKA 3IS0X 4Y1AB 3AAMA 3QSTA 4N26A 4YZFF 5CCHE 4YLWA 3WY3A 1EQCA 1FORL 1QNZL 5D7EA 5GGSY 3THQA 2HXUA 1TPXB 4MMXC 2GBTA 4PB9H 4YS1A 5FA4B 2JCCE 4HGXA 2GK0B 3G5EA 3WCYA 1TCMA 4HBKA 2VDQL 1WZKA 4NYUA 4WENB 5T26A 2BNQA 4PRRA 3JWOC 3QWOB 3MDUA 3MR9A 4FX5A 3BQ5A 1JXFA 3EA2A 4H44C 4JM0A 2W07B 5CSZB 3RU6A 4N2YA 2VXVL 2OKMA 2R1XB 4O4VA 3Q2VA 4KTDL 4JD4A 4MF4A 2BC4A 3KR3L 3CFCL 3MLRH 2D22A 3GR8A 4DJEC 1TX2A 1OAKL 3APYA 1BJ1H 2P7TA 3WKML 3SY5A 5BRBA 3L23A 5C07A 4LP5A 5TFSH 3WDJA 3NP4A 4P0DA 3QUYC 2WW1A 4XPHH 3KL0A 3GRGA 1NPNA 3WXVL 3KGRA 1T1YA 1WCQA 3PZQA 1AXIB 4C54A 4C91A 3N6QA 5BZDB 1N64L 1DVFC 5CCKH 5MHSD 4A3QA 3H9SA 4UFMA 1GGBH 1SMDA 4X98B 4BFOA 4HS3B 2E8YA 3IRPX 2ZYSA 3V4BA 2HX8A 4PMUA 4ODHL 3EGSA 4AMAA 4P9HL 3KLAB 2J6VA 2ZX5A 4PY8I 2O61B 3B37A 2CBUA 2NLJB 3RPTA 2FLBT 1PWLA 5L0QC 1MPAH 2IF7A 1SEQL 4FL4C 2DH2A 1EAQA 4FQ2L 4ZMLA 1JZ7A 3H21A 3B56A 4PJCE 4BZ1H 2JGYA 5IOBA 1P4IL 2XU2A 2YCIX 4ZPVB 4H8UA 4WKZB 5FKPB 3CSYB 1DCEA 4DCQB 3MCG1 1FA2A 3V1PA 1CFVH 1KGXA 2JWYA 5C2BH 1V3JA 2YKKA 1GHRA 3EB2A 2HMCA 1CDCA 1JK9B 1R7AA 3IKCB 4KBPA 4R3SB 5EY5A 4GSUA 4YX2H 4KWOA 2WWKT 1QAFA 1XDMA 2QUUA 4L3EA 3SN1A 4OCNC 3NTCL 1XH1A 2PWVA 3KCLA 1MCKA 2Y88A 3MYJA 2R2HB 2WVVB 5G2HA 1XMWA 2I57A 4QTGA 4QYAA 3UPRA 3MO4A 2FEDC 3BPCA 2QSTA 3SY0A 4I0PB 1FY6A 1EGMA 1S5WA 4BI7A 1F5WA 2PUQT 4KF1A 4LH8A 3I02A 2OYMA 4K3DH 4DOHE 3V5CA 2KBGA 4RIRA 4IRZH 1QSFB 3N1PC 4NZCA 2X89D 2YLKA 2HP4A 3E38A 2QT3A 2CH8A 2ZWYA 5IKCA 2ZUQB 1SDDA 3PL6B 1OXYA 1ZXKA 2EEBA 3EHBD 2XA3A 3G6JB 4JDTL 3V6ZA 3VGFA 3WEXB 5I1AA 1S3KH 3KBWA 3QSKB 2H6PB 1E67A 4WAFA 1M7JA 2XVPA 5SWZA 4W85A 1FRGL 3PQYE 1HHGB 2E7HA 1K8YA 4PP1C 1OK4A 2UY6B 1T7XA 3CV2A 3WBWA 2GHWB 2FBJH 3N55A 3BAEL 3CXHK 4RV3A 5C8JA 1OAQL 1XICA 5JOPE 3T4CA 3FUEA 2UZ9A 1J10A 2VN7A 3FF7A 1QRNE 4Y4KD 3T77B 5EZIL 4KI5D 4BFIA 2QLVB 2IOOA 5I16A 3MCMA 1VCAA 5EBUA 3EWWA 3OEXA 4X9GA 5HYJA 3RX2A 4XPAL 3TCLB 4BELD 1NFPA 2GJRA 2GTQA 2D2CC 3DARA 2G50A 4M6UA 1KIUB 3BXNA 3F4CA 1KTCA 4Y16C 1DWGM 2VRAA 2Y5SA 2DT3A 2PDUA 2O5ZL 4U1MA 4OZHE 2HRPH 3HE6D 4ZXBC 4QE4A 1CYWA 1ULVA 3S3CB 1A8ZA 4UIMA 3AXHA 2DZAA 2EG6A 4BD4A 1CEOA 2Z0UA 2Z2AA 5EU5B 3MMUA 1P0EA 4NYLB 4M8RA 1AQFA 2R83A 2ZRUA 5CP7A 4BE6A 3N0PB 4YHNB 2OQEC 4UB0L 1N68A 1TJHH 1EUUA 4J3VA 2X4OB 1H61A 3N50A 5T5NF 4KFEA 3PBGA 2VNCA 1JNHB 4WHTB 1HKJA 1KJVB 5F89A 1EAPA 3SPGA 4XHQA 3K71A 2X88A 2WSRA 5EEUA 2CIQA 4P61A 3NFPB 3L3HA 4HGMA 4MXQC 4RZCA 4Y16A 5IJBC 1MDLA 4M61A 5LB1A 4UTIA 3VKKA 4Z0XB 1B2WH 3I3BA 4U33A 1G1YA 3HAEH 5HDQH 1ACCA 1T66D 4IFKA 2IAMD 3PWUB 5F96L 3V35A 2FAUA 2WVUA 3KLAA 1W3IA 3EDDA 2I56A 3WLIA 3C2RA 1AY1H 4J23A 1CD8A 3TJHD 5CZJA 2IWGA 3GI9H 5KYXB 2P88A 2PWGA 4UDTB 4QYOB 3QYNA 2QW5A 5MEOB 1PYWA 3LEXA 5HANA 1LO3H 4Y2DD 1KUMA 1CGXA 3TW7A 4JZJC 4N1CA 4JFFB 1RPUA 2MEJB 5MP6L 5IWLA 1T2XA 1OYBA 3MFFB 1A5FH 4IRJA 2V2WA 1FL3B 2YD0A 4GGHA 1NOFA 3GWJA 4LSSL 2YD7A 1KB5H 3KDPB 1F3RB 1MQ8A 3OP2A 4GH3A 3PNWB 1BECA 4HUKB 2APSA 3HBPA 2DQMA 4IJ3C 4XXDA 1FWFC 3AACA 4DO7A 3SX1A 2KL6A 2NLYA 4PB5A 3VACA 1O5DT 1XFBA 4LKXB 1YW1A 3KL3A 4KH9A 4ICCX 2XIMA 1H8SA 1EPFA 4WR3A 5DQJA 1E1CB 1C29A 1ND0B 4GXVH 4TTDC 3ARFA 3TF7C 2PDWA 1IGSA 5A8PA 3FQ1A 1WSST 2OT1A 4XZBA 1CQKA 1SJAA 4QDGA 1BQSA 3BTNA 1E50A 5AOUA 5BJTA 3AIRA 1E9LA 4IIFA 3LQAC 1M7IB 5K1VA 3UTTD 1LF1A 4ZOCA 5ITFA 3AYRA 3CYJA 1CLZL 4UBPC 4EANA 2ZXAA 4FGMA 4A6YH 5FA4A 7FABH 4DX3A 1NBZB 4US6A 1AYOA 4IK6A 4GAAA 5D4IA 1VBGA 1U8MA 2TSYA 1LQAA 3CUFA 4KXAA 1D3CA 4GNVA 1Y18B 2DIEA 2CR0A 2NW2A 5I0DA 4S39A 1H7PA 1U3HC 4OTXL 3QDEA 4AKPA 1RALA 1SJHA 3NCOA 1LJMA 1LCOA 3PHQA 1YNKH 2OMWA 1TV3A 4LCWD 1TPC1 4NDMB 2VM9A 2J73A 5DRNB 2X5PA 2Z92A 3NIDB 2CIPA 3PTDA 4A05A 1CL7L 3HF3A 2V4LA 3QI9B 3SUVA 3UQNA 1D3HA 2VCOA 1DXEA 1VGKA 4IOIA 4RX4D 1BYNA 2VKZG 1IT9H 4DNMA 2ERJC 2IOMA 4GIAA 3T2PA 3WFEL 4HIHB 4PJBB 2ZNXA 3FTXA 4W9GC 4UNIA 5FEPA 2G75A 2R1WA 1JCTA 3O3BA 2NCMA 3HAEB 1QZ1A 1Q9KB 3FT3A 2MWCA 1LL4A 3GMNB 4TQ8A 1R2TA 3PNUA 1QRKA 1IXQA 4NRYA 1T89A 1A7NH 3FTZA 3WN5B 4PFEA 5LCVL 1I4FB 2D31B 4PCSA 3QC5X 1IQDA 3BP7B 1IM9B 2BINA 3AG1B 2EDEA 4F24A 1FXQA 3NFUA 5CSYA 1EKMA 5TF1H 2YAQA 1F3XA 3P82A 5JHDD 3WX7A 5CAKA 1IE4A 4N2LA 1DQML 1MCJA 4P2QB 1WAAA 4YAQB 4YZFE 5J3HC 1L9QA 3I6TA 5G1MA 5CBEA 4FRWA 2AEPH 2KH2B 4BV1A 4QITA 1KIRB 2YW3A 3RI5K 4A7GA 1UI8A 4NO3B 2EUWA 4RNFA 1WISA 3DOHA 5DZVA 3QFZA 5FJJA 1FX6A 1EWHA 1PKYA 4K3GA 2C26A 3SJNA 3VXMA 1CFMA 4W9KC 2WNWA 3QIWD 1KENH 2P48B 4RWHA 1PCSA 4HNNA 4EACA 2HV5A 4OZIF 2OZ4H 3EOBA 2BNJA 1ACZA 3I74A 1KCWA 1P4CA 2PYFA 5D38A 2BFVH 1IGFL 3BKYL 1T5KA 1H49A 3K3QA 4JZ5A 5K4ZA 4ICNA 3US0A 4I2XB 4S0TD 1HAWA 1FL6A 3LS5L 1ADQH 4APQD 3BH9B 3LPFA 2VENA 1KJVA 2XGIA 3W7NA 5L4FA 3SUSA 3W73A 2EEXA 2FIQA 4XUYA 2J7EA 3V4VA 3H9ZA 4GG6F 2WLLA 4LEOA 4MJZA 4KXCA 4HSCX 1WKFA 6TIMA 2J8UB 4YHKH 4N9DA 1F8TL 2HVBA 3FRUA 4RMRA 3RGVC 4NZFA 1OHQA 4DJMA 1AK5A 3AHYA 2NR6D 1J11A 1F6FB 1XB3A 1SHWA 3ETBJ 4KNSA 3HGJA 5G1YA 5DU7A 2DORA 4D6FA 5GGSA 4NP4L 2KDGA 1OGAD 1IVUA 1G5AA 1L6FA 1YYML 2R1LA 2QQKH 5DCEA 2CHRA 4FNPA 3GGWA 3WDQA 2B7NA 5HUPA 2R69A 4NRZB 3SUTA 3TQ0A 1Z9OA 4ONOA 3Q13A 4K2UL 1V0KA 3GYEA 4PJCF 2PSNA 3WLHA 4K37A 1UZ6E 2FT7A 4Z76A 1P0KA 2PU1A 3GSOA 2G3JA 4GSDL 2VLRA 2RUSA 3UA4A 3KFTA 4GO6B 4MAYB 4WWKB 4XN7A 1V5XA 3QNXB 5E9NA 2WW0A 3P77A 5J12B 2B1AL 4D8OA 1JHLL 1PLGH 2NQZA 2JF1A 3HA1A 1E8ZA 4LOUD 3MVTA 2BRPA 1QFHA 4AQLA 1CX9A 5AN7A 4Z77A 2CERA 1KB9K 3PVFA 1US2A 4J4PA 2O30A 2HK1A 4O16A 1DVSA 2PMZA 2A85A 4IS6A 1FOBA 3RPDA 3K5XA 3IIPA 4Z1CA 1TWSA 4AM0A 5F9JB 2E3VA 4C6DA 4WZHA 2GIYA 3OXSB 4YVXA 4TR9A 1V5JA 1R5YA 4N3UA 3N11A 1GL4B 4MKTA 2Y85A 4QRQB 1BFSA 3BKJL 3WH7A 1A5NC 3L3GB 1TZAA 4WFFD 4OI8A 3T8QA 3SDDB 1NGYA 4NUJA 1ZLVH 1KRCC 3HZMA 2JIXB 1ZEAH 4XBMA 2PUZA 3BW2A 4V15A 2PCPA 2J57A 2J1XA 4UYQA 3LTYA 1F45A 3S83A 1I3RA 4KI1A 3P84A 4CD5A 4RWYL 4HG4K 1B6UA 3GHUA 4I7UA 2JFEX 4NNPH 1DJGA 3PWGA 4ZZ9A 4Q22A 4LHUD 3KPLB 1UQZA 2YXWA 4N2DA 3ZDXF 1BVLA 1NGZB 4N8VG 1KGJA 4KKQA 5L4MA 1MFBH 4DWDA 5HULA 2AOSA 1J9SA 5DEGA 3R7RA 5E23A 3QG7L 3RQ3A 2PO6C 3T6XA 2W6RA 4JIHA 3NCXA 4F79A 4U1KA 1XLEA 3B8TA 2K8MA 3UBXB 2HFEA 4NPYA 5ISZA 5IMLA 1B5TA 4LF2A 2AI0L 4LSBA 5E8PB 3M8OL 1F86A 5HDBF 1A4JA 2D69A 3RDTB 4PJCA 1KTBA 3ZZLA 1G6RA 4NAFA 2J12B 1GOOA 3VFWB 1C7SA 4QKXB 1OJOA 2J5LC 3BK0A 2ZAIA 1URLA 1N8FA 1A3LL 4RV8A 4F7EA 1A65A 4X4MA 1Q0YL 5DO2C 2L4OA 4OVUA 3QPYA 3KJ6L 3OPZH 3LZLA 3MWXA 1LOQA 5BZDA 4L4VA 1JHKL 3MGTB 1TJHL 3O2DH 4LLQB 4XHJC 3SDXF 1F9GA 5DJ2B 3HMCA 2WOBA 3O8XB 5IBUB 1E0WA 3IACA 2R56L 1RY0A 1BQHA 2QQNL 2ZXCA 3IIOA 3W26A 3L1EA 1Q2RA 2ZG3A 2WQWA 1SHMA 5C07B 1CVSC 4XCNA 1N70A 2P7TB 3BPLC 4JJ5B 5T1KB 3V2AR 3X40A 5CU9A 2GJLA 5C0CB 2HZGA 4HSHA 5EULV 2PLKA 3WNMA 2DWSA 2DZSA 1MOEA 1NCHA 1QI5A 2VN4A 5E70A 5EMYA 3TIDB 1JNNL 3BAEH 3WIAA 3W2MA 1LWJA 3VDBA 2R91A 3SCMA 3RM8A 2VDGA 4Y9FA 3WJMB 5BZWB 3ABSA 3NOEA 3NIGF 1G7PA 3DHUA 3L5WA 3FVMA 4P46C 5EZIH 5I73C 5DCBA 3RFRA 3IGAB 1AY1L 1C12A 3TNBA 3FTVA 3GDKA 2APTA 3GI9L 5AZ2L 4CC4A 3B0VC 2XH4A 4DGYH 3KPSE 3ABQA 3NG3A 1W1B1 5J6SA 2XZQH 2GUYA 4NAEA 3VYOA 5GS1C 4EPKA 1ZLDA 4GRSA 4EWND 1F4HA 1NSNL 1LO5A