4FNQA

Crystal structure of gh36 alpha-galactosidase agab from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
727
structure length
723
Chain Sequence
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGSRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGIELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKARGHVAMSGNFGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaB
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 230
structure length 723
sequence length 727
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnqA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnqA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnqA02
4MAZA 1VPXA 3BCDA 3KLLA 1VZWA 1TQWA 2G95A 1BWLA 4BA0A 1MFUA 4J3VA 1MXDA 1VS1A 3B4UA 1KXHA 3KEHA 4JFTA 3W1PA 1UD8A 3GX9A 3UYCA 4JICA 1OX6A 3QMSA 2RH9A 1TCMA 4PTNA 1WP6A 1EP1A 1BWKA 4LT9A 3GLCA 4GNJA 1WZMA 4PL1A 1AG1O 3IJ9A 4GRSA 2WKJA 4YLWA 3FLUA 1S3HA 3II1A 3IRDA 3BLPX 1LP6A 2D0GA 4IJBA 3ZQ9A 4IXXA 4TX9A 4RX0A 2FHCA 1S46A 4JFWA 3MP5A 1DHKA 2YJQA 1N8FA 3A5VA 2QPUA 5FF3A 2OYKA 2WSKA 3R89A 3Q2DA 1OK6A 4NJKA 2FQIA 5HUPA 1MVYA 1UH2A 2QCFA 3EX1A 1C8VA 1I2NA 3CEPA 3O1NA 2JKPA 5D33A 4MPQA 3ANYA 3IIXA 3MHUA 3MW7A 4TIMA 3EJSA 1P0KA 1C8QA 3S8HA 4HNNA 2ZX9A 3VMPA 3W7JA 3DBPA 1YPIA 3L4WA 4CLMA 1BAGA 3TTSA 1V3MA 4DO4A 2TPSA 4LWWA 4XBKA 3E9AA 1KWGA 3DDGA 1B4EA 1KM6A 3NNTA 2DJXA 4FNUA 4O19A 1JFHA 3DFSA 3G1FA 1C29A 1LOQA 2PWFA 4FEZA 3W7CA 3JS3A 3VNZA 5HDRA 2ATSA 1VYPX 2E6DA 3EWWA 5T26A 3YPIA 2OW7A 1KM2A 2O7QA 3RFAA 2YA0A 2YZRA 4KKXA 4W9TA 2ZA3A 3PUOA 2BWGA 3KXQA 3LDVA 3I6RA 3M5XA 3O15A 4O54A 3GXIA 2Z1BA 4LTSA 4EOUA 3BW4A 2CLLA 3LHYA 1UBSA 4AWSA 2A7PA 1MEWA 3DGRA 4O1BA 2FDSA 3HG4A 3PSWA 3TNOA 3W7GA 5C6MA 1UKQA 2QCLA 3GDKA 3HB9A 4BI5A 2QDGA 5DCBA 1QW8A 3KL0A 3IV3A 3Q94A 4MOZA 2GQ9A 2J24A 2YW4A 3CZGA 2PWEA 1GVOA 1GQNA 3W2JA 5D05A 2VEKA 2CFFA 5E1QA 2ZBTA 5LHEA 4UTMA 1HT6A 1PZ3A 2DZSA 2ALDA 2F7FA 4GUJA 3EWYA 3KAOA 4EF9A 4POCA 3BG9A 4HKPA 4UCGA 2A85A 1ZAHA 5LNUA 4RK8A 3UWYA 3QSTA 2GJNA 3QMRA 3OVQA 2F7RA 2H8XA 1TSIA 2G96A 5KSWA 4ONVA 1W5OA 3BG5A 4PSRA 2VFEA 4LC8A 4FX6M 1WXJA 1P5BA 2B7QA 1YDNA 3GKAA 2Z6IA 3MYPA 3TMQA 4AH7A 4QAIA 5I5RA 4GUFA 4PC8A 1XI3A 4K6AA 4I7VA 1XH1A 4YMZA 4FNPA 4UTKA 4PCFA 2ISWA 1R2TA 3HGOA 1ADOA 2YIHA 1TQSA 2QMKA 1SSDA 3ABOA 5DCDA 2VKZG 2D0FA 4LU0A 4Z1BA 4DXVA 5F2MA 4GINA 1LBLA 2A21A 2CW6A 1HL2A 5F7UA 1J0HA 3FYPA 2CZDA 3ZR5A 3SIZA 5BW6A 1EUAA 4BI6A 2OMAA 3KRZA 1MEHA 3D51A 3EX4A 1O4UA 4JIQA 1WBJA 3VX1A 4XTIA 3DI1A 1VFMA 1S5TA 1UB3A 1W56A 3NQDA 4RJEA 1BPLB 1TPH1 1QWUA 2FJKA 3QRHA 2F7QA 5CG7A 2RDWA 1T0OA 3VO0A 2FH6A 3TH6A 3CGTA 3QW3A 1V3JA 2GJRA 1HWWA 4AMWA 2VXNA 2DH3A 3M0ZA 1J4EA 3UPBA 3W23A 3C2VA 3GXNA 1TPFA 1C9DA 3UG5A 4N4QA 3TUUA 3P7YA 4GO8A 3LHZA 4GKLA 2E8YA 3E49A 4JTUA 3LCXA 5EPDA 3HOJA 3M47A 4MB1A 2AAMA 3LV5A 4YCOA 3OLEA 1ME8A 2WKLA 1OFOA 2PRMA 2OYMA 1RP9A 2ABBA 1KFEA 2E6YA 1VR6A 1WA3A 2EAEA 4AHQA 3KFTA 4IMDA 1UCWA 3CQ0A 4DO5A 3UCQA 5F1VA 3BVXA 1IXQA 3G0UA 1HG3A 2WCGA 2XVGA 4GXMA 3RK8A 3E02A 4UFIA 3LXAA 1OX5A 2QCMA 1FCUA 1WZKA 1I8JA 3T44A 3BUBA 3W73A 4CNPA 1W3IA 2YPIA 3PUDA 1JF5A 2JGYA 5CLWA 2V81A 1MFVA 5AC7A 2Y6ZA 2E9BA 4ZQNA 4FNTA 2ZZ7A 2EJ1A 3S1XA 1CIUA 1M5WA 2A1YA 1JXJA 4N9EA 1CW2A 1XGZA 3ZSTA 2RDTA 1AK5A 3DXIA 1G5AA 1TV5A 1O95A 3BVJA 5I23A 1Z32X 3L4YA 3NGJA 4WY0A 4WY0F 1KFLA 4RKAA 5TQLA 1QPRA 1JL8A 2QAPA 3LV6A 4IX2A 1NF0A 1BVZA 3IJ8A 1T8XA 1OT2A 4RXFA 1X8FA 1M6JA 4NJIA 1KBKA 2Y7EA 3TROA 3WENA 1HNYA 3ATYA 3OVPA 2WQPA 2GUUA 3DHPA 3RLUA 3L2MA 3C4UA 3BAWA 7CGTA 1WOBA 3IEBA 1X1ZA 1BEUA 5HNRA 3PSVA 3MBDA 3TJXA 3CLMA 3KVKA 4RV8A 1SSGA 1J5TA 1XCFA 3LTYA 4GUGA 4LUIA 1W54A 4Z1CA 1G69A 1LOSA 1Z44A 1WOAA 4NNBA 4QNEA 5D09A 4JL1A 2JKAA 4JD4A 4AMAA 2X2JA 4U3CA 5AHEA 2HS8A 3NQEA 3DFQA 3MHGA 2TAAA 4UQDA 4OV9A 4OWGA 1RP8A 2OSWA 3IVTA 2WNWA 4M7TA 4IMCA 1H3GA 3CPRA 4U33A 1W5NA 1UH3A 4MZYA 2FFCA 1CXIA 3P5YA 3U8GA 2NX9A 4AB4A 2GUYA 1PEZA 2XVLA 4A3UA 2QF7A 1CI1A 5FEPA 3M5ZA 2ZZ1A 3QC3A 4IX0A 6ALDA 1NEYA 4GFSA 4FHAA 2VFFA 4O10A 3L4UA 2ZXAA 4WXZA 3W7MA 3TU9A 1PAMA 3WY1A 2ZIDA 1AL8A 2YXGA 3S5YA 1BTMA 2WCSA 3BARA 1I75A 4QITA 4JFSA 3WFZA 3GK0A 3BGJA 3PULA 5D04C 2XWDA 4QNWA 4IPJA 3CLWA 3ABRA 2RDUA 1EP3A 2W0UA 4L4MA 3DU0A 4LVAA 3HGRA 1GEQA 4JYFA 1RQEA 2QKFA 1D9EA 2A7NA 2WNNA 3BMVA 4I7UA 4CQ9A 2ZX7A 4Z08A 2D0HA 3QZEA 4FLRA 1LM1A 3VGBA 2ATMA 4WSJA 1J0IA 3UD6A 1UOKA 4UOQA 3L4TA 4OU1A 5G4WA 2ZWZA 3CZLA 2WVVB 4A2SA 2EADA 3N34A 3ZWSA 5DY3A 2PRHA 2VFIA 1Q6QA 4LV4A 3SGUA 1ZNNA 3INPA 4XZ9A 5CPNA 1G6CA 3MHFA 3BAJA 3EDDA 3PR2A 1FXPA 2FYVA 1XD1A 5F4SA 4KFPA 3L67A 3FYOA 4R53A 4UMCA 2OZ0A 4HT3A 3TQ0A 4TVUA 3ZO9A 1WAUA 3EJRA 3CC1A 3NA8A 3TFXA 3W76A 1OVDA 1JRCA 1N7KA 3BO9A 3TTYA 3UWUA 4NXSA 2DP3A 5CZSA 1QI4A 3L2IA 4XBSA 5CZTA 3PAJA 4J3UA 2D73A 4JTTA 2HSAA 1AQMA 4O0KA 1FCVA 1SMAA 4XWUA 3TIMA 3E0IA 3M41A 4IMEA 4R34A 2PC4A 3A9IA 3OLGA 1K03A 3LHUA 3NG3A 1GWJA 4YCPA 1JDAA 1QWGA 4O11A 4LS1A 1JUBA 3SR7A 3N14A 1Z41A 4IGHA 1JG9A 5FEXA 3W1XA 1CX9A 3NQ7A 3EWXA 5HWJA 3S42A 3RLVA 3NAVA 2V82A 4UTLA 2J9YA 2Y61A 3G8RA 4GI6A 1K8ZA 3P60A 4IOTA 3N2MA 1GVQA 5HPOA 4JTJA 3TSBA 3EB2A 2VNCA 2DIJA 4KWWA 2NV1A 2BZNA 3DKLA 1GJWA 3WY2A 3WJWA 2V8ZA 4FIRA 4O4VA 3WNNA 1D3CA 3TCEA 2ZXDA 4Y6GA 1E3XA 5LNWA 3UZJA 2X1RA 2HMCA 2Z2UA 3LXCA 1G4PA 1FUYA 3I7SA 3QQ0A 1EB3A 3P5ZA 3C56A 2I1OA 1R34A 5IM51 3CIWA 1LWHA 3MBFA 5HWNA 2YYUA 1QOQA 1ZJIA 3P61A 3GAYA 1KM4A 2A5HA 3NQ6A 4FX7A 1O94A 2PWHA 1T96A 3HPZA 2YR1A 3EDJA 4FF7A 4S1FA 3GDLA 3S1WA 1BSIA 2AQWA 1LRTA 2C16A 4HNTA 4K39A 1JQVA 2GVLA 2NT0A 3PG9A 3T40A 1JCXA 1VCGA 4K8EA 6CGTA 4WF7A 1L0PA 2FPVA 5CPMA 3VI2A 2C3ZA 2NXIA 3TA6A 2GVGA 4UQAA 1TQUA 2C1HA 4CVWA 4GBUA 4GQQA 1X7FA 2NX1A 1RVGA 2QJGA 3BLIA 2BHYA 3LOTA 5HR6A 2ZRVA 1W8SA 1UA7A 2I14A 3TW6A 2NT1A 1JR1A 4MYAA 3WJYA 1JCLA 3RF9A 4KWVA 5G1YA 1VJIA 4U2YA 3NQ8A 2VR5A 5EBUA 5TD4A 3W38A 2J9XA 1XDMA 3W1AA 1G4SA 3FFSA 1Y7VA 3WEOA 1XH2A 1CGXA 5DCEA 4NNAA 4O13A 4DF1A 4ZVJA 3WMSA 2QCHA 1AMKA 3BW2A 4H3DA 3BAXA 4X9SA 4FXSA 3AMKA 4MY1A 1TPC1 2WSQA 2ISVA 4DELA 1CXHA 1RPKA 2VT0A 2BSLA 4JGDA 4O0ZA 5E93A 2WNQA 2E5CA 3W83A 2DZWA 2F7OA 5D2WA 1FX6A 5DBTA 3WNOA 1HFBA 3N3MA 1TPUA 3QSRA 3C0JA 4X2RA 3DDFA 3WJXA 1K8YA 5H91A 3W07A 4PEEA 1HTYA 2G5WA 4XQ6A 5DXYA 4NJHA 2Z0IA 1NOFA 1ZHAA 3FA5A 4Y9AA 1MXSA 1LOLA 3D52A 2OT1A 4LW7A 1LBMA 4HNUA 5BRBA 1W5MA 2H6RA 2Y2WA 3F4WA 3CZSA 3NEVA 1XDLA 4O50A 1KGWA 3EJQA 2V30A 4NXKA 1L6YA 1QR7A 2EHHA 2G97A 5L9FA 1SO5A 2Y89A 1D7FA 1TQTA 1OFDA 3P80A 3EX3A 5I3FA 2OX1A 4ADTA 2FTPA 3ABQA 5CKSA 4UIOA 3BLEA 4PCSA 2QCDA 2CLFA 2EO7A 1SZGA 3H54A 1Y0EA 1YXCA 1A5SA 1W3NA 3W7QA 2Y24A 5FF4A 5HJLA 2EABA 3UWZA 5AHNA 1QNVA 3TFCA 3P82A 1PL9A 5LNSA 1KM3A 3KOFA 2Y5EA 1IXOA 2YKKA 3T4CA 4H8HA 4PH6A 3DAQA 3FOKA 3GDRA 3KVJA 1TPVA 1SW0A 4E38A 3W2MA 1SZEA 4QSHA 4J27A 1K7FA 4BK9A 4DPPA 3B0PA 2V5LA 3A22A 1GYNA 4E2DA 1VCVA 2ZRWA 5I3KA 3PF3A 1OFBA 3HG3A 1MW3A 3B0VC 4AWTA 5U4NA 4WLCA 3C2RA 4M8UA 4UR8A 5LHFA 2CLHA 4I7WA 5AC8A 3DX4A 3HJEA 4K7YA 4JX6A 1H51A 1PIGA 1AQHA 4A29A 3HGSA 3LI1A 3O16A 4N9BA 3NZ1A 2ZA2A 1HX0A 1X1OA 2QDHA 1JUKA 3BH4A 4ALDA 4RXGA 2PWGA 4AHPA 2FH8A 2GJPA 1CGVA 2OW6A 2FGZA 4X22A 2NZLA 3G1HA 4P2VA 1IF2A 4JYEA 1LZOA 2VFDA 3NQGA 5AOUA 3HIJA 4NX0A 3PG8A 2Y7FA 2LLEA 1K3UA 5AHLA 1DKWA 1B9BA 4QAWA 5A2CA 1JUEA 2QV4A 3V1PA 2B0MA 1OB0A 1ZFJA 3GZ3A 1WZLA 1P0NA 3HPSA 4NX5A 5AB3A 3EDEA 3DFTA 1FWSA 1ICSA 4L4LA 1YADA 2Y62A 2YSWA 2ALWA 1P1XA 4DEFA 3NVTA 5KEZA 3UWVA 1IGSA 1R2RA 4ML9A 1VFUA 5FF0A 3VE7A 3O6YX 2E6AA 3UWQA 2PURA 4JX5A 3PBWA 1FWRA 1JULA 1TREA 3FJ6A 2YX0A 3WNKA 3L66A 3HG2A 2WPBA 2WV8A 1HUVA 1LCOA 3EX6A 3KHJA 3P81A 3R5EA 1TJRA 2C13A 2YW3A 2YOCA 1QFEA 3UERA 1MZHA 3W2UA 3S5ZA 3OA3A 3LTPA 2AAAA 4H8VA 3SFKA 3DFNA 4MIMA 3KWXA 1K7XA 1WO2A 2J27A 2EEXA 4JR5A 1THFD 3I68A 1W3TA 4MZ8A 3SZ8A 1YYAA 4UUIA 1UD6A 3EX2A 3PS7A 4FXRA 4WY0B 2E68A 4NNCA 1AL7A 1KWKA 4IMGA 5AHIA 2ZFAA 4UQBA 1HXKA 4WQ6A 5FF7A 4UC5A 5KZEA 5D03A 3NQFA 5CXPA 4N9DA 1TPWA 1V5XA 3KL3A 3TDFA 2DZTA 4MFEA 1XC4A 3MI6A 3L21A 3TC7A 3RU6A 2BLEA 2ZXQA 1VCFA 2FB2A 2QUUA 1WQ5A 3GR8A 4CNNA 4KWUA 4UR7A 2YYTA 4JL2A 5F2IA 5C5YA 3DH7A 1FCBA 1F7BA 3E96A 3QYQA 4HPXA 4TR9A 3VKJA 3LX9A 5DO8A 1XBYA 3AXIA 5E6ZA 2ZX8A 2BTMA 4HNVA 4M5PA 1G7UA 3W2LA 5I3JA 5D37A 3BAYA 3D0CA 3SECA 2J6XA 1M7XA 3CIXA 4UQ9A 3HGJA 2NWRA 4J3TA 5I24A 1H7PA 3F1QA 2VRKA 1LRNA 3T7VA 3L2LA 2OJPA 3GNNA 3O63A 1Z42A 4AIOA 5IBXA 8CGTA 3O6DA 4QIUA 2WOQA 1QDSA 1YDVA 3NQCA 5E9AA 3UG4A 5CGQA 1OGSA 2XFWA 2BHUA 4NJGA 5D2VA 3ELFA 5IBXC 1FBAA 3L4VA 1I4NA 4AEOA 3ZFHA 1PVNA 4JIPA 1KTCA 5HINA 1ZAIA 2ZCGA 1QO2A 4GC4A 4WXYA 2VEMA 3W74A 1JVNA 2GVYA 4OT7A 4WOQA 2PE4A 3W22A 4IPIA 1MWOA 2ZQ0A 1LYXA 3I7QA 4JTEA 1ZJAA 3GDMA 1RQHA 4FNQA 1LLWA 4Z0SA 2WSRA 5K4ZA 1JQXA 4WX2A 2A2IA 5EA9A 1JI2A 2JBMA 1KGXA 4HPJA 2BY1A 4HOZA 3W85A 1L9WA 3K1DA 5AN7A 4U4MA 2X2GA 3LPOA 3GYEA 3G1DA 5LKYA 1WE5A 3EJUA 3W6YA 4UFLA 1OF8A 3WY4A 2F84A 2F18A 1CXEA 5D2YA 2X1TA 2I9EA 1F6PA 4A22A 1A47A 4PL2A 1PPIA 4CQ8A 3GIYA 4X9YA 2Z1KA 3ZR4A 1VIWA 4PSPA 3W2NA 1VFOA 4MLRA 1GVSA 1VYSX 3VGGA 1QWNA 3KL5A 1KLZA 4GI9A 5C2XA 1TYGA 4N6FA 1NFBA 4O1CA 3LPPA 1K02A 3QF0A 2W79A 3IGXA 3LBMA 2CHNA 4YL2A 1P4CA 1G94A 1DQXA 4K37A 4ZQOA 3GVGA 3EDFA 1R2SA 3WN6A 5CZJA 5CGTA 1H7RA 4HSOA 3VGHA 2D3LA 2V2HA 4WD0A 3W70A 1KXVA 2FHFA 1S5WA 1KFBA 7TIMA 1I2PA 2ZRUA 4O4WA 2X1SA 5LNVA 3VSTA 1XFBA 4BFAA 1EA9C 3UWWA 3B06A 5I3IA 5J5RA 4GIAA 1CDGA 2V3DA 3N9SA 4JNMA 1KXTA 4IWWA 1OFPA 4UNKA 4ZQRA 1KCKA 2YDAA 3HJZA 5G5IA 3TX9A 1R33A 4ORIA 4J9JA 3PUEA 4NJJA 5K4XA 4X0NA 2C14A 4JY9A 3AJ7A 4Q33A 5C55A 1RV8A 1LTDA 4O12A 2A0NA 1TTJA 4DBEA 1LORA 1XV8A 4BWLC 4K38A 1HVXA 3CEUA 3K8MA 3LRMA 2WSYA 3DC0A 3M44A 3DHDA 2QAFA 2EKCA 3BVTA 4CN1A 1TV7A 3THAA 1PS3A 1EP2A 3EKZA 3GKFA 4I9AA 3WNLA 2F2HA 3Q58A 1GG0A 3UZ5A 3SI9A 3P62A 3BLKA 3N73A 4GO9A 2PRLA 1YDOA 1OF6A 3PWAA 1XBZA 1D3HA 2ZUVA 4LOCA 3GB6A 5K2ZA 1TPDA 3G24A 4J28A 1OYAA 2TSYA 1K7EA 3CPUA 4UTWC 1Z48A 3KX6A 1FWTA 3AJXA 3G3MA 2DIEA 3BSHA 1OT1A 1AW2A 2WNZA 1UA3A 2CWNA 2TRSA 1JI1A 5D2TA 1KGUA 3VMNA 3ZT6A 3TQKA 4JFVA 4ZQMA 3AMLA 5FEZA 1QPKA 3A23A 2ZUTA 1R46A 4JY8A 3IIPA 3W1MA 1BVNP 3OLIA 3GXFA 1QI3A 4A21A 3C61A 3VCRA 2XVKA 3O07A 4O1DA 3G3DA 5KITA 4MZ1A 1JDCA 4X3ZA 1PZ2A 1NSJA 3G0SA 3JR2A 4UTUA 2CLEA 5G2WA 3THQA 3C8FA 3NZRA 2G3MA 3FJLA 3CM4A 3TONA 5FI8A 2YFNA 1JXKA 3W7HA 2GOUA 4AAJA 3RNDA 1GPWA 1VRDA 2CPUA 1BLIA 3L68A 2BXVA 1ZY9A 3L4ZA 1WYIA 1JD9A 3K8KA 4ZL1A 3VMOA 4DF0A 2YGYA 1EHAA 3S1UA 1U2YA 5H2ZA 3NXFA 4KFNA 4LPCA 3R2GA 2DORA 3M1ZA 1JCYA 1L6WA 3UQNA 1E43A 4FLSA 1WBHA 2XN0A 3WNPA 4XKYA 4LVGA 3CV5A 1OYCA 1ICPA 3WELA 1VB9A 2FPTA 1U83A 2R14A 3LBCA 4E2BA 3W7LA 3DHUA 1KM0A 1DBTA 3N19B 5GVJA 1XUUA 3BC9A 2ZX6A 3FS2A 5HMSA 2CU0A 3C6CA 1HO1A 2HS6A 4O8RA 2V2CA 2B7PA 1DHPA 3NL2A 9CGTA 2V0TA 2ZXBA 2WJZA 4TU1A 3C2FA 2EAWA 2AMGA 1SW3A 3ABSA 3W75A 4TMCA 1B3OA 5LSMA 1F2JA 2WVSA 3W7PA 5KZDA 3NQVA 4N02A 4ATWA 2BXZA 1DEDA 3M07A 3L0KA 4LRSA 2TMDA 3NDOA 3UXDA 3R12A 3KE0A 3NPWA 5AHMA 4O57A 2QCDB 1KA9F 2H90A 1CXKA 3HZ3A 3TSDA 4OQVA 1OSEA 2V3FA 1ZAJA 3LTSA 2E09A 2JGQA 1CLVA 3O06A 5KZMA 1SQ7A 1MW2A 4MYXA 1TMHA 4CCEA 3W7EA 8TIMA 1AW1A 4D2JA 2NUXA 3OIXA 2E77A 1FDJA 1UJPA 5A6LA 3ECQA 1RZMA 3QJAA 2ZUSA 3VNYA 1JIBA 4WJEA 3QEZA 4UTTC 3W87A 1QI5A 5HWMA 2CLMA 1DTUA 3MJYA 4N2YA 5LGZA 2CLIA 3WJZA 1CGWA 1EWEA 2B7OA 4AEEA 1TRIA 2V3EA 3LLDA 1Q3NA 5BMWA 1NF7A 1XSIA 3G8EA 3QMTA 2VRQA 1B2YA 4O52A 2ZZ4A 1X6UA 1MW1A 2PWDA 1W0MA 3AO0A 2ZA1A 3N2XA 4HSNA 1KXQA 5I3HA 2OSYA 3GBEA 3ZT5A 1ZCOA 3S0CA 4UFMA 3WNMA 1LDCA 3CZNA 2QCEA 4GI8A 3NOEA 5D2XA 2C18A 2P1FA 4NUWA 5E70A 3HPXA 3NPXA 3WK0A 1XH0A 1OFRA 2VEPA 1WX0A 3HG5A 1IV8A 6TAAA 3B05A 5HULA 3B03A 2IGTA 4JDBA 1D3GA 2CLKA 1GVFA 5MHBA 4JTKA 1A50A 4AF0A 2J25A 3IGSA 2YA1A 3LCLA 3OG3A 3ZR6A 5BOOA 3T78A 5FEWA 1VGAA 2ZDRA 3WK1A 4PFMA 3A6OA 1KW1A 3RMJA 1TPB1 4MVAA 3LHWA 3A4AA 5HUOA 3IIVA 3NL6A 1DORA 2G3NA 4WUIA 5A2AA 3B04A 1HO4A 3G0XA 3A21A 5LGXA 3W72A 3M5VA 4PEKA 3OVRA 4JS3A 4MY9A 2GVJA 2P10A 3PY2A 2Y85A 2DJLA 3D4ZA 5HXMA 2ZTJA 2F61A 1GTHA 3KRSA 2R8WA 3A5FA 3DX2A 3SY5A 4O18A 1QO5A 5D38A 2E4TA 2UV8G 4JCMA 2GQ8A 3BK0A 1W5PA 5F2LA 4WOZA 3PBVA 2CZEA 1BKSA 1VJSA 3LI0A 3W7RA 1MO0A 3R13A 3VFLA 1P6WA 4EIVA 1SMDA 3CZKA 2VENA 2R94A 3EXTA 3GXDA 1G4EA 3W1RA 3EJTA 3DX1A 4WSKA 3EDKA 4A2RA 5AHFA 2BHZA 1OG0A 4HOXA 1R30A 4H6KA 4KFOA 2XN2A 4N4PA 4FNRA 3LXBA 2DZXA 3TC6A 4P61A 1DJQA 1XBVA 3WDHA 3ZOAA 5AFDA 1YLVA 4ICNA 1J0JA 4Y90A 3WEMA 4M56A 1AVAA 4OJYA 1H7OA 5F2GA 1FWWA 3VSUA 2W6RA 4AW7A 1H60A 1O5KA 4UMAA 2X2IA 5HR7A 1A5BA 4BI7A 4OBTA 1H7NA 1TTQA 4ZMGA 4DF2A 2RHGA 1SUXA 1TO3A 3EXSA 1PJ9A 5EY5A 4CGTA 2CXGA 5K7JA 1OFAA 4G1KA 4U2ZA 1I2QA 2X16A 1CPUA 3TSMA 1VHNA 5EMYA 3EXRA 4CQAA 3VM7A 2WVUA 5A6MA 3PB2A 5E0FA 3JRKA 2Y7DA 2E1DA 2TYSA 4OGZA 2QCCA 3BVVA 1K8XA 2ZUUA 5AYYA 2F1BA 4IQLA 1IIHA 2EGZA 4E0CA 3LCFA 1J0KA 3D4YA 4K36A 1E3ZA 3P67A 3MYOA 3ZWTA 2EQDA 5CLTA 1Q6RA 2DH2A 2NSXA 2VELA 1EWDA 1FDZA 3NR0A 3FAXA 1JRBA 3TE9A 3QW4B 1JDDA 2WSPA 3L0NA 5DFAA 4E2OA 4NU7A 5A5WA 2NLIA 4MUZA 4O53A 3W3OA 4JTIA 2QMJA 1CGYA 4KMQA 1EA0A 3L5MA 1KFKA 1SFLA 1OFEA 2Y4SA 5F1UA 2NWSA 1GVRA 5CSRA 3CT7A 5G2IA 1VQTA 4N9CA 1SFJA 2E5DA 3B8DA 1F05A 3EEGA 3TW7A 4GQRA 1G7VA 1QHPA 2RKXA 3D50A 2WANA 1Q6OA 4H7VA 3IGUA 5BRPA 1KLYA 2H3DA 2Z6JA 2NXHA 3LHTA 4XTDA 1Q4NX 3TQVA 1KTBA 1TJPA 5FESA 5BRQA 1JF6A 1TTIA 4LVBA 3P8IA 1XCWA 5G1TA 3USBA 4UTJA 2C19A 2XWEA 3UG3A 1H7XA 1FXQA 4MLJA 3I7RA 3PBYA 4DO6A 3ATZA 4UCFA 4UFKA 3BUPA 1KV5A 4NT0A 4HIBA 1KTNA 3IVSA 1RR2A 1WPCA 1F6KA 4UNIA 2XIIA 2FLIA 3LB0A 2ZRZA 2Y70A 3ZS4A 3TAOA 3QM3A 4O16A 2QR6A 3O6CA 4JTLA 5C54A 1EPXA 1PE1A 2NX3A 5K9DA 3E12A 2HTMA 2ZTKA 5A2BA 4BR1A 2ISSA 3LHVA 1AW5A 3BAIA 2DZPA 3S6DA 2ZZ2A 1EEPA 1KV8A 1OX4A 3ZSSA 1W9XA 4LVDA 4ZQCA 5E0KA 2VC6A 1M53A 5CPOA 1KB3A 5BNKA 1V3LA 1T99A 1XD0A 2EPHA 4UZUA 4H4IA 5CPLA 3GXPA 1ZJBA 1FY6A 5AC6A 3H53A 2FB3A 1H61A 3WK3A 3LCIA 3QGVA 1MSSA 4AHOA 3W1LA 2PCQA 5D02A 4MFDA 4BZYA 3CTLA 2VFGA 4JEQA 1U33A 4AMXA 5J5DA 1ZS2A 3WDJA 1TQVA 1FQ0A 2QUTA 3M16A 4RZ5A 3C2OA 1JCNA 3VX0A 4AVFA 3DX0A 2ZE0A 1RPXA 3TJLA 4HN4A 3W1TA 3CWOX 2QLYA 1IZKA 3SSJA 3L9CA 3L0GA 3W1NA 1QOPA 1JCMP 1TPEA 1EO7A 3G1XA 2QCNA 1HL8A 3W2KA 1TQJA 4YWIA 4ZZ9A 1H63A 2DZUA 3CZEA 1XCXA 2JKEA 2F1AA 1GJPA 1KFCA 1EX5A 1CGTA 1YTEA 1SO3A 5CGMA 3CWNA 1ONRA 3IIOA 2Y63A 4M6VA 2YA2A 4JYDA 5LZLA 3NO5A 1S5VA 3NQMA 3BUDA 1UUOA 3F4NA 3FW6A 1WDWA 3BVWA 2XIBA 3KVLA 2X2HA 3MO7A 4GE8A 3W1QA 4NZFA 1UD2A 4R7JA 1ME7A 4U28A 3MMTA 1JAEA 1IXNA 1ALDA 3MP4A 3T55A 3QFEA 4O28A 1TV8A 1IZJA 1RQBA 1W1ZA 1JCJA 4K8HA 4NVTA 4UFJA 5DBUA 1R75A 5K9XA 5KINA 4JTFA 3BG3A 1SR9A 1TMQA 1W31A 3W7NA 4JN6A 1VHCA 1SO4A 3VNDA 3AXHA 3DKJA 3TMLA 4AEFA 2Q3OA 5A8GA 1LLZA 3LLFA 4Y8FA 5AYZA 5HQEA 1I45A 1LRQA 1KM1A 1E40A 3NM1A 3FIGA 5KTLA 4AYSA 1GCYA 1GOXA 1EIXA 1RD5A 4NZJA 5TBOA 4ZQPA 2FIQA 4RZ4A 3U6WA 5EMUA 4UTIA 5D32A 1GVIA 1G9HA 1PV8A 3GDTA 3LGEA 3DHFA 1NVMA 3WY3A 3TR2A 3M6YA 3W71A 3IVUA 3UY7A 3B0UX 2D3NA 4UFHA 4LS0A 3SGZA 3U2OA 2OCZA 1QCWA 2E0PA 2H3BA 1H62A 1QPQA 2X1UA 1XXXA 2E6FA 1I2RA 2C7FA 3W88A 3GTNA 1MW0A 3PC0A 5DLCA 3L4XA 4J3WA 4O17A 1B4KA 3P74A 2QJIA 1G67A 2WC7A 4XKYB 3BPWA 3STFA 4JTHA 4LQ1A 5CZ0A 1XSJA 3G22A 1FDYA 3HMJG 1QX1A 3NQ2A 2BX7A 4MJZA 1QHOA 5LNRA 4QM1A 1CXFA 4RLIA 3L5LA 4YXGA 3EJPA 4BWLA 3L5AA 4O15A 2DU2A 2BXYA 1DV7A 1IIGA 1GJUA 1OHLA 1SO6A 1CXLA 1DJNA 4N6EA 2GQAA 2A6LA 4XB3A 4EVZA 4UQCA 2EF9A 3BUQA 3W7KA 5CSSA 4HHPA 5D30A 5BMXA 1L6SA 1DOSA 3TV8A 2A4AA 3SJ3A 4FX8A 4UOZA 3MI2A 4IMFA 2P0OA 3BUIA 2OSXA 1H7WA 1PIFA 4JCLA 2NUYA 1TTPA 3NPVA 2Q8LA 2GPTA 3DI0A 1KFJA 1BF2A 2Y88A 3F03K 5EL1A 4H2CA 1E51A 3PB0A 5ABTA 2ZYFA 4UTWA 1LWJA 4HP5A 4AWUA 2C8NA 1UKTA 1BG9A 1VLIA 3BAKA 1V7YA 5F4WA 1UH4A 4AXKA 1F76A 1ODUA 1TRDA 1IXPA 3UNDA 2QPSA 4RZ6A 1SZFA 2ZX5A 1OABA 1KCLA 3P84A 3RILA 3KLKA 3V75A 3LERA 3LRKA 3NQAA 1R47A 1H5YA 4B9ZA 1PHWA 5F4XA 1A53A 2NV2A 2R91A 1KBJA 4GJ1A 2JK2A 3VGFA 1LROA 4ADSA 1XUZA 3GXMA 2BY2A 2EACA 4CN4A 3NPUA 2AGKA 2DZVA 1OYBA 3WFAA 2VFHA 1JD7A 1B0IA 4LXFA 1CYGA 1PIIA 2NXGA 4PCTA 4M7SA 5I3GA 4LV9A 1SW7A 5EYWA 4LVFA 3DZ1A 3PM6A 4Z1AA 5G2HA 2VUYA 3N9RA 3R8RA 3W37A 4J3XA 4QQ3A 3A24A 1LBFA 3BLBA 5EKYA 4FLQA 3UY8A 4LC6A 4BF9A 1W37A 2ZRYA 4OE7A 1VH7A 4UNLA 3UEQA 2YCEA 1DVJA 1YPFA 2FE0A 2C6QA 1PS9A 4CCCA 3OBKA 3IIZA 3NYZA 4LUJA 3LRLA 1YTDA 2B4GA 1B57A 5K3VA 3LCWA 1VAHA 2V9DA 3OLDA 4PODA 4NQ1A 3W9ZA 3W7DA 3S5OA 3GNDA 3BMWA 2ZICA 4Z0JA 4AF0B 2QJHA 3RIKA 4OIFA 4R33A 4FB7A 1OFQA 3HF3A 1HL9A 3FAWA 3TXVA 4JFUA 5SWUA 1A5AA 4UTHA 3VE9A 3BW3A 3CB8A 1M7OA 1QAPA 3HBLA 4DPQA 1VYRA 1I2OA 4GWEA 4JDYA 1FCQA 3ZT7A 4JTSA 4LY8A 1QMLA 1SU5A 1OK4A 3BSGA 3BLFA 1PCWA 1JJKA 3LCHA 3QPZA 3FKKA 1KM5A 3G1SA 3G1YA 1ZENA 5TIMA 1UKSA 1XL9A 4U31A 3TXZA 2J9ZA 2IQTA 1DL3A 1DQWA 2Q3RA 4S2CA 4UMBA 5U7SA 3PBUA 1TIMA 1NM9A 4FIQA 3S1VA 1G4TA 1GG1A 3IK2A 1L2UA 4JX4A 3DFOA 1O7DC 2C15A 5E6YA 4GUHA 4LRTA 2ZWYA 4OV4A 3G1AA 1H1ZA 1UUMA 1PCKA 2A7RA 4LNYA 1KBBA 1XBXA 3EWUA 3M7WA 3S9YA 2BY0A 1CGUA 4MKNA 2KZHA 3DFPA 1U30A 1N55A 2H8ZA 3GXTA 1F73A 3EWBX 1NAL1 3VSVA 2C0AA 4M6QA 3EWZA 2OYLA 4CKQA 2CZ5A 1MEIA 3W7OA 3VM5A 1J2WA 4PA8A 3P8JA 3MI3A 3BVUA 2CZFA 2B7NA 1H1YA 4UTTA 4AIEA 4M6PA 1W5QA 1EH9A 2ZRXA 1YXYA 2ZZ6A 2ZZ5A 2ABAA 3FEMA 3M43A 1ICQA 1OJXA 2Q8ZA 4CN6A 3OEXA 5K9CA 4WZHA 4ADUA 1TCDA 2V2DA 1VLWA 4EWND 4FNSA 1QPOA 3MWAA 3NM3A 4O1AA 4HOWA 3M5YA 4CNOA 1JGIA 2FHBA 3CU2A 2J88A 2VEIA 4W93A 3VU2A 1QW9A 2XN1A 5FF2A 4RCXA 1H50A 3NL5A 4IUOA 2V5BA 4K7VA 3O05A 3W7IA 3GAKA 1V3KA 3W84A 2YFOA 4JTGA 1FWNA 3I65A 1XSKA 2X30A 4B5NA 1WV2A 4NI3A 1GZGA 3GR7A 3DX3A 3HO8A 4C1LA 3H55A 4Y96A 4M19A 3TOPA 1A5CA 2ZUWA 3UPWA 2RFGA 3STEA 3TKFA 1M7PA 1F74A 1HTIA 2WVTA 1O60A 4ORMA 3EKLA 3QQ1A 2VOMA 1ML1A 3M9YA 2WVVA 2WKGA 3A47A 1F5ZA 2QCGA 2BY3A 5DELA 1AMYA 3STGA 3UXAA 4Q32A 2OT0A 2WO5A 5I0DA 2E8ZA 3BCFA 1UD4A 3BV4A 5AYXA 4MJMA 1GT8A 3S2CA 3VGEA 1VC4A 3KRUA 3HQ1A 4DBDA 5G4EA 3WDIA 2QUVA 3KVMA 3Q37A 3MP3A 3TK7A 3C52A 4CCDA 4XUGA 2F7PA 3LM7A 3G1VA 4EF8A 1PHQA 3W1UA 4OKDA 3IJ7A 1XM3A 1Q45A 4Z1DA 4H8UA 2FPYA 2GJLA 1UASA 3TAKA 4C1KA 5DY2A 3GBDA 1EUNA 3SW6A 4RR4A 4AYGA 3FKRA 3BGGA 4O14A 3MUXA 4UQEA 3CTTA 7TAAA 3G18A 4FMVA 3VGDA 3K30A 4S2BA 1SPQA 1QPNA 5DXXA 2O7SA 4DQWA 4HPHA 5DN1A 2Y7GA 4TO8A 3K8LA 4IXHA 3QH2A 2D2OA 1WZAA 2QEZA 2ZZ3A 3NL3A 2E5BA 3PVFA 3O8AA 4Q4KA 4JXCA 3OHIA 1UD5A 4QISA 4TMBA 5KMYA 4B9YA 2WPGA 1ZALA 1YTKA 1GTEA 5L6UA 2CLOA 1ME9A 3C3NA 4UZSA 4LS2A 3WK2A 4FO4A 2NUWA 1UD3A 3STCA 3WJSA 4FLOA 4GUIA 4UXDA 3W86A 4MY8A 3CHVA 1SZNA 1GYLA 1O5XA 1OX4B 6TIMA 1Q6LA 1U5JA 1MXGA 3QPYA 3S5NA 1G1YA 1EO5A 4J7RA 3DENA 4HA1A 3L65A 4QJ1A 4J3SA 1TB3A 3C2EA 1KBIA 3LCGA 4OHQA 1XKYA 1TQXA 2A6NA 1YXDA
chains in the Genus database with same CATH superfamily
5A8OA 3X12B 1IL1A 2IPTL 2OX5A 4V1XA 2TSAA 4FSAA 4L4VB 3QMSA 1A21A 2ZOKA 2XG9A 1WZMA 1AQFA 4PL1A 5D9OA 4OLVL 3BLPX 3SN6N 1F3DJ 1S46A 3C0QA 1CDHA 1HSBB 5TH2B 4G70B 4XAWH 4NJKA 3FO9A 1UH2A 2QCFA 3L6FB 3JZEA 3GIPA 1FFTB 4BZ2H 5HDQH 4GH3A 1CICB 2G41A 1NCTA 1SJEB 5HD8D 3DBPA 4LDEB 1WT5C 1LDSA 3F7YA 3AYVA 3HBQA 3U0HA 2BRVX 2PW1B 3SN0A 3YPIA 4F7MA 2W65B 3B8YA 1RJZA 3SBWA 3P4NA 2VH5L 4ABUA 3HFYA 4EOUA 4M3JA 1XLKA 4UF7C 4YIQB 1A49A 2J66A 1M7DB 5AVHA 3IPFA 4H25B 2CBPA 3AG4B 3PNZA 4DNLA 3CZGA 3L9RA 3WSQL 1M41A 4BKSC 3PWGA 1DFXA 1E4KA 4UV4H 2ICWI 4R2GC 1SOKA 1WC7A 4RZCB 2HMID 5KSWA 3LZNA 5CBIA 4Q4MA 1T5KA 4NKDB 1HP4A 5DO2D 1YDNA 1R9ZA 1CDIA 2OZNA 3ABGA 2FZ8A 2ISWA 1BVKA 5IB4B 2VKZG 1Y6MR 2VDHA 5ES4B 4FG6C 4NO3B 5FM5O 3CAVA 1VF8A 2JB6A 4UV7L 1WBJA 1KN4L 3NQDA 3QUKB 4AQ8A 2O72A 4JIRA 4NENB 4WFFE 2FIKB 4N0CD 4NN5C 3FT0A 3GXNA 3UG5A 2WXKA 4DWSA 2BNRE 4C55A 4XB7A 4LVNB 1O1ZA 3VSQA 4N87A 3F4DA 1J5OH 1CDUA 2IQ9H 5GS0L 1V3HA 3E02A 1YIXA 3U9PL 5IQMA 3AREB 3T44A 3V4BA 1YN7B 3BP6A 2WJFA 1VFBB 2Y6ZA 1C16B 1XGRA 2ZZ7A 4OI8A 3ABKB 3DXIA 1M6OB 4ZS7H 2ITDB 1NBCA 3BPOB 5AY7A 3KXFB 1JL8A 2ZWLT 4IX2A 3IJ8A 4AUBA 1LP9F 3PGDA 2XN9E 4NSBA 4ANVA 3D07A 2GSEA 1PFCA 4CU8A 4JTQA 1E27B 5CSGA 3P30H 4KJYA 3KWTA 3VIGA 1X1ZA 5IJVB 3PSVA 1XCFA 5HHNA 1BQHA 1T0PB 1YAZA 4QQUA 5SX4I 1H3GA 2CHDA 3E9UA 1ZB5A 2IQ0A 4BCYA 4KC3B 2GUYA 4ORGA 4P46C 4IISA 4V1DE 1US3A 1NEYA 1NQKA 4G6FB 4GFSA 2N1TE 4FQXA 2EUXA 3TEZA 1BSLA 1F3TA 2OCJA 5I66B 1T7XA 3BARA 2FBOJ 1Z7AA 4IPJA 3SY0A 1GOGA 3V6ZB 1E50A 3TCLA 1RJYA 5JH1A 1ZVHA 1CL7L 2I7GA 2DOCA 4EI6B 4QG9A 2A7NA 4JO1L 3QDJB 2ZX7A 3CUHA 5I0VA 4E9QA 5F8RC 1U22A 7A3HA 3M86A 5I9QC 5C0AD 2WNXA 4UDTB 1TG8A 3GBLA 2VFIA 3B7TA 3TNMA 4G6ML 3EDDA 5I0YA 1XR2A 4HT3A 2BNQD 5FYJE 3N1FC 3TIDB 4N2OA 1CI3M 3BO9A 3AIQA 3RZWA 3NAAH 1XDTT 2JIEA 5ANMB 5K93A 2AV1B 4JR9L 4R34A 4Y2DD 3DUHA 5F6IB 1S2AA 4AD3A 1N18A 2WMIA 3QORC 3RWHA 5I06A 3MBXL 4K3EH 2VNCA 5EOTA 2QQLL 3CN1A 1XLFA 3O3EB 4R96B 1VBGA 2XFYA 2XXFA 2OFJA 4OI7A 3M8OL 2YYUA 3LN3A 4GZEA 2GWNA 2JKSA 1S2CA 1FYTB 5EEZA 3IJIA 3AB0B 3GLZA 5I30H 4P9HH 3S1WA 3OKLB 2WXFA 3D39D 2DQDL 3WD4A 5M5DA 3RM8A 4PUBL 2MEJB 5EZOL 2AF2A 1ADQL 1XAKA 4UQAA 1IFRA 4Y7OC 3U6RA 4R7WA 1DZBA 4OF7A 5HGAA 4IFKA 5KSVA 1RVGA 2H2PC 2GFBB 2EDQA 3RF9A 3S9IA 4EPDC 2X4SA 4A2LA 3WEOA 1DBKH 4DF1A 2QCHA 4IUGA 5CEXB 3RY5A 2DQ6A 2HWZL 2BSLA 2E5CA 1BPVA 2R9HC 2CLPA 1CD1A 4MCZB 5B1JA 1TV4A 5DXYA 9RUBA 3V16A 4FKEA 3Q6FA 4EVNA 4LW7A 4A3RA 1HH9B 2PCYA 2DYPD 3EHBD 4IGMA 1QR7A 3GJFB 1HIMH 2HPTA 2VN3A 1DIEA 1WSST 2GGJA 1YXCA 5CC5A 4JQXC 5AHNA 1QNVA 5GGSA 3HZYB 3I9IA 2OCCB 3BZFB 1U8HB 2X89D 2ZUXA 2YEQA 3ZKNC 2XFXB 1ZHNA 5KVMC 4B90A 3B0PA 3A22A 4Z78A 4U05A 3PF3A 3UESA 3NBNA 4S3BA 1IGML 4U6VL 1YY9D 3ARBD 4OK2A 2Q1FA 4DUVA 1AHWC 4Y2WA 4FEMA 3HS0A 4FG2A 1N5AA 3IJSA 1AGBB 2QV4A 3FQWA 5EA0L 1P0NA 2UV3A 3R79A 4V1YA 1FZKB 2D2CC 5EFIB 1BD2A 3UWVA 1R2RA 1A1MB 1YBQB 3O6YX 1RBAA 3UJJL 4MMWA 2AOSA 1JULA 2MCAA 1IQWL 5C9JA 1HKVA 5B1KA 2Y1VA 3LKPB 2WV8A 1LCOA 3P81A 3LKRA 1ORQA 3GHBL 1U3JA 1NAKL 4P2RE 4AUUA 3UACA 1S39A 1EHLH 2CEQA 3FVMA 2BWIA 1WO2A 4L4TE 2XKNA 4GXUN 1E5CA 3EX2A 4WY0B 4G8EB 1ZLUK 1A02N 3NFNA 3PJLA 3LKQB 1JWSA 1NGWA 3REWB 2YPVA 1QUPA 2VR7A 1BAFH 4MKTA 4ELMF 2OKMA 1NCAL 3MOBH 1RHCA 3QQ4B 1HAUA 2JALA 1MNUH 4M5PA 1E6SM 1TWSA 1U8LB 4NYYA 3G6JB 2CBJA 3QPKA 1WUFA 1QFHA 5DHVB 5CBAB 5IHSA 5I24A 1KBGH 3L3HA 3U7YH 1OB1B 2IQAA 1E9IA 3C5XA 1J1OH 5HINA 4GC4A 3MLUH 1NWTA 2HJFB 4JY4A 3SFWA 2CWXA 5IG7B 4JPIA 5I15H 3NJLA 3SCNA 2B15A 3QC6X 2BY1A 2NY1C 3LPOA 3CH9A 3JXAA 1NZRA 4RQQA 4JVWA 3N0AA 4CNUA 1XF4A 4C56E 5D2YA 4IDJL 1XZ0A 2R0LL 2B4CC 1JXGA 2D69A 4MLRA 1F97A 2DQTL 4JFEE 4GAJH 2Z4TA 3LZQA 2YGPA 2EDNA 4IIQC 1SYSB 3T4AC 4GI9A 2VDNL 4Y4KA 1NFBA 2E47A 1FWDC 1W1A1 4X2PA 3TJ4A 3RGBA 3KCOA 1UFUA 2QIWA 4DQAA 3VXRD 4QRFA 4DW2L 2AVGA 4XCNB 1HJUA 5C07D 2FK9A 4QHMA 3HZMA 4V1DA 3TBWB 3VW3H 3GHTA 2J3SA 1TZIB 5H37G 5HD8C 3CFTA 5DEZA 2FZ3A 4PWGA 4Q74A 3H2EA 1AMXA 3IRZA 1A1OB 4EACA 2UZIH 2WOBA 5DC0A 5XINA 2D4DA 3KJ6L 4HEME 1B3XA 2DVUA 1R3JB 1FNLA 4CN1A 2RA1A 3UYOD 2IGFH 4NHUA 2X3CA 3FPXA 4NAEB 4QTHA 3NGBB 1AZ1A 2IDCA 4D8OA 2TSYA 2DSWA 5IFHH 3GVVA 2I27N 3B9KD 4YDKH 4H1LA 1EEUA 3SDCA 3LNHA 4L9DA 4XCFL 3T07A 3ZZ1A 1SLWA 4F15B 3U2ZA 2NXYB 5IK3B 3ID7A 2PBOA 5KITA 4OUEA 1RI8A 2E6JA 3IK4A 3G0SA 5DO2C 5FA5A 4CW1A 3UGRA 3VJ6B 1JFQL 3W7HA 4UOJA 1B3YA 4R85A 1ZY9A 1TETH 3T0WA 2CJUH 1H41A 5H2ZA 1JPHA 4N9OB 3N55A 1N4XL 5C08D 4LVGA 3ZHLA 3E0LA 1BYAA 2I07B 3ML9A 2NVDA 1XLHA 1AR1C 2VJXA 4PJHB 4OM1H 2V2CA 4JQVA 1SN2A 2ZXBA 4DFHA 4WHTA 1SW3A 2YCIX 4N8PA 2XZ9A 3NJ3A 4Z7OF 5EORH 2Q7YB 2NY4B 4NUJB 4FGMA 5KZMA 5DXWA 2CQTA 3RIAF 4AQAB 1GKPA 3VXUE 2NNRA 4Q4EA 4UTTC 3BRGC 5CIPA 4PJGF 5EEVA 3RLHA 3FFCD 3WFDL 1EWEA 3QUYA 1RIHL 1H54A 1FC1A 4HSCX 1B2YA 2XH2A 4ZMZA 3BE1L 5I3HA 5JDSA 1RZFH 4UFMA 2JELL 3WK0A 2CUMA 1V0NA 3GU2A 3QCUH 5FV2A 2G9HA 1BD0A 5HULA 3ARGD 2MKLC 2VLLB 5B3NA 2R1WA 3OG3A 1L7JA 4Q4QA 3A6OA 1MJJA 1EDGA 1LO2L 3DTXB 2OM5A 2WW8A 1HINH 3NL6A 9PCYA 1ZHBA 5I78A 4U49A 4CKVX 4X9HA 2IALB 4L3EB 5FHBH 3T0EB 4N2KA 2OG9A 1EZVX 2B59A 1FVEB 1GTHA 1A3HA 1QO5A 4OVXA 5AB1A 4FQLH 4U1KA 5IEHB 4FXGC 4AT6A 5C0CB 4LLYB 1UXLA 4X5QA 3H3KA 3S35H 3DX1A 1MAMH 2P8PB 1MZZA 1ENUA 4HC1L 4XZUB 7PAZA 3D18B 2G3FA 1XBVA 4FOMA 3ZOAA 5T3XH 4JNXA 3BUYA 4PB0L 1H7OA 3WLLA 3EADA 1QSEE 3CQIA 1SUXA 4B6ZA 5DWPA 4MBRA 3WJLC 3TSMA 3GNRA 2WVUA 4CC1A 1DJZA 5B3SB 1N3NB 3C5SB 3SJNA 4I90A 5CN2A 1MDLA 2WM0A 4OAWB 1A5FH 1F8TH 3DA0A 3SURA 1F2QA 1I7TA 3NSFA 1UZHA 2XX0A 2Z1PA 2P80D 2PZNA 1FDLL 4PJ8D 2H6PA 3CT7A 1DLHB 1CE6A 3TPKA 3TT3L 4ATTA 1SHMA 1MRFH 1DVFD 4NNPL 3KS0J 5I17A 3N41F 3I7RA 1E4XL 2ZG2A 3PBYA 3RPDA 3I75A 1J8KA 1G7IB 4NT0A 3RPTA 1BV8A 4KZEL 2DJMA 5DRWB 3LB0A 5CH9A 2DTSA 1SBSL 3E12A 2FTAA 3AAZA 3C60B 5AG9A 5DD5H 5DHYB 4YR6A 3UFYA 4P59H 4LVDA 1ZT1A 2ILLA 4AEIH 2KDYA 3FY1A 4OBRA 4Q9BA 3SDDD 2Y7NA 1WK0A 4AX6A 2HPIA 1E28A 2DWXA 1NSUA 4PV8B 4B7IA 1OY0A 1DUYB 4A35A 3M16A 1LLAA 3QDHA 4C56A 1NICA 4QNPE 1KZQA 1Z8AA 3L9CA 3T2PA 1X7IA 4NZ4A 2L7EA 4JFEA 1AVKA 4KH9A 3KPOB 2BP0A 4AG4L 4XC1H 1YTEA 4J1UA 3IIOA 4UDUB 1FE8L 1HP5A 2XIBA 4QAMB 2CG0A 5BZZA 1S7UB 3D12B 1KLUB 4DZAA 2UUDH 3MP4A 3EH3B 3M17B 3S9DB 3V7PA 2HH0L 2J1ZA 4JTFA 2DMBA 2VQ1A 4W7WA 3AZRA 2IKIA 4WJ5A 1SO4A 1OWQA 4LUTB 3PP3H 3JV4B 3CBRA 3TMLA 4Y9NA 1UPPA 5HDOA 5E5CA 1GYMA 2JK5A 1PD1A 3KCLA 1MHPL 4F4RA 3O4LE 3RTQD 4YSAA 3LN4B 2SEBA 3W0WE 1UYQA 1GVIA 2HJLA 1Q7QA 1NM4A 4HEMA 4ZB2A 3C5ZC 5D7JD 3KZPA 3ZKMD 2I85A 1XIWA 4NHVA 3W88A 3ARBC 4J3OG 1R8LA 3G22A 1SNZA 1N0XH 4MJZA 4RDWA 3AXMA 4QM1A 4YXGA 4L9XA 3QJUB 1N5YL 3AADB 2DU2A 1IJ9A 3SKMA 1TJIL 3MRKB 1OJNA 1EEXA 1FH7A 4MXWH 5JO5A 4B5UA 1ORSB 4C83B 3OQEA 1BZ7B 3IMRA 1YNLH 2RCSH 4WI0A 2OSXA 3MLYL 2EE2A 2AEIT 2EP6A 4FAAB 2GPTA 1KFJA 1CI5A 4WWNA 2DKSA 4KBPA 4UTWA 4MVBC 5HGGS 1XX9C 3NPSB 4EQ2A 1Q8AA 1JYVA 1S8DA 4KEVA 1IGIH 3KLKA 3V75A 1S7TB 4OCRL 3OMIB 4XO5A 4F9DA 3WIHL 4YSUA 4QY8A 3HAEG 3GXMA 2F74A 1B0IA 4LV9A 5AKQA 5I18H 3HMWL 4GQ9L 3UADA 3W37A 1JHTA 4BF9A 2XSBA 1A80A 1R86A 4MJIE 1K1YA 5C6TH 2A4CA 3PWVA 1WMPA 2B4GA 5B7FA 4Z0JA 2K70A 4FB7A 1OFQA 3B7RL 4DZ8B 3FAWA 3RFRA 1GHFL 3T1WA 3O6KH 1VGKA 4DPQA 5DC4B 1T66D 2AQ1A 5A2IH 3UGXA 1HHHA 3K1GA 3EPNA 3P4OA 5CN1A 5LIUX 3GEFA 2R0WH 3G1SA 1U21A 1UKSA 4M1GL 2J9ZA 3VXUA 2PXYD 2IAMA 4XX5A 2ZOLB 4NO0B 3G6DL 3J8F7 4U3SA 2A1WH 5EOCH 1KLFB 2GDQA 3DUSB 1H0IA 3GXTA 4NQDA 5FM4A 4WK9A 5DJ8B 5DJCA 3HG1D 3WKQA 3EYOA 2APXA 2VLJE 4LDLB 3OR6B 3M43A 4Q9RL 3BPLC 3MJ6A 1WCGA 4LLUB 1NUNB 2VEIA 4NWTL 2WW2A 1RZIA 4NSKA 5D7LE 3BT2H 2CBOA 4NC0B 5I1KL 4H13C 3NL5A 4QEEA 2IANB 4K7VA 4MMZA 2J43A 3EFOB 5BXFA 3GAKA 3W84A 2YFOA 3RPMA 5KVEH 4X80L 1W0VB 2GL5A 4WGKA 5DJXA 3MBEC 3VFSB 4N2BA 2V5CA 4TNVF 5DELA 5DK2B 4NQEA 4AZCA 4KKLC 2CK0H 1GT8A 3KRUA 2VC2H 3AMDA 3SY1A 2EVJA 5H35B 3T42A 1QSEA 2FPYA 5I6LA 4XP6L 4KI5F 1LE5B 1AQKL 1SDYA 1C9SA 2HN7A 3IDXL 3OTTA 4G7QB 3TA3D 2VXVH 5DXXA 3K8LA 5AQ0A 1FI8C 1JDFA 3Q1EA 4DUXA 2WPGA 3NPZB 4IM8A 5TF1L 3B9KC 4MWAC 3FBQA 4FO4A 1BX2A 1SYVB 4G8GB 3TN0C 4JDZA 1U1JA 4XX6A 3WKPA 4WI6A 4YIWA 4QJ1A 1TB3A 1KBIA 2Q76A 2BNRB 4E9SA 1AUSL 1WEJL 3KCPB 3AWGA 4LCIL 4WV1C 1O5PA 2PPFA 1WP6A 1UJ3C 4HKZA 2CR0A 3OOQA 3CQFA 1CNVA 4PJFA 3GGWA 4NP4L 3AT0A 2D0GA 2RUSA 1MEXH 3NVDA 5LJYH 3QUMA 4KMTH 1INQB 1K6WA 3C6LD 3MKCA 4AYEC 3CUGA 5HUPA 5AALA 2VCBA 1FWBC 4KIEA 5IHZA 2AEPL 1F42A 4WW2C 1ZLSL 3MW7A 3L9EA 3DVNB 2ZX9A 3N11A 4E68A 3ZO0A 3WD3A 2XN9B 3L2NA 4EE2A 3ZYJA 3POCA 3W7CA 2CKNA 4TQ8A 1AIFB 2BDNH 4KNSA 3WD0A 3QFYA 4WNQA 3PNWA 4LTSA 3MNZB 3FU5A 2FMOA 4U7MA 3KGRA 1XF2B 2VEFA 3RWJB 4OCXH 2NY6B 1I1FB 2W5PA 2XY2A 2QCLA 1QLFB 1FLRL 3IV3A 2GQ9A 4KK8D 2XV0A 3U7WL 1ES0B 2PO6D 2GJ6E 4TUOA 2XWRA 4LASH 4IHOA 2ALDA 3VXPB 3KAAA 2NX5D 4N8CL 1PYWA 3PWLA 1HWGB 1NAMH 3WAJA 1YEJH 2VGFA 4UTBL 4LQFL 3ZL1A 5IWLA 2YWZA 4P2YA 3GKAA 3E2VA 3P3RA 4K6AA 3H4GA 4UTKA 3H6OA 1EZVY 4JPSA 3V0AC 1ZZMA 5IESH 5F2MA 2BP8B 1JZIA 4A6YL 2GK1A 3A6BH 3QW9A 2CZDA 1BXXA 1F61A 3O6LL 1JVLA 2VW4A 5IOPB 7PCYA 1O4UA 1FHGA 4ZAKB 1DBMH 5GRZA 4H00A 1FFOB 4MTMA 4L3CA 2ESVE 3QEHA 5E0QA 4JFPB 3UPBA 1OACA 3H3PL 4MMHA 2OI9B 3C2AL 5I1AB 4NIRA 3WHE1 2F2KA 1MQKH 3LV5A 5CJNA 2SFPA 5I74C 1B3JA 2V2XA 4HF5H 4OIAA 4E9LA 3B0XA 3GS0A 3LRSB 2KPWA 1JPFA 2DQCH 4ACTA 1JK8B 2P5ED 1DFBH 2GBAA 5CCJA 5DEGA 1CIUA 3G9AB 4I1RA 4OZHE 3Q5TA 3PP7A 5FKPA 5RUBA 1HKLL 4B2DD 4QPEA 1RSCA 3FO1B 1AO7B 3ZX1A 2IOMA 3V5DB 1HNYA 3L7FA 1KF9B 4B9CA 2GUUA 3DHPA 2QEJA 3OF6A 3L2MA 3T0BA 4L9LB 1I3GH 5DMKA 2EE3A 2VLRD 4DPAX 4Z1CA 1LOSA 1AOHA 3U36A 1P5UA 2NY5L 3MRBB 3IARA 5DUPH 1N8IA 4D9LL 5DR5L 1EFXD 2E7MA 2X1PA 4A7TA 5BZWB 3PWPE 3U8GA 4AB4A 1PX8A 2R69L 4MJIA 2VYOA 4R5XA 4G6AC 3BI9X 3H2QA 3RN6A 1TR7A 1BQKA 1QKZL 3FQXA 3WY1A 5B8CA 2WJDA 1OD0A 1DANT 1T0NA 2EKJA 1PZDA 3CLWA 1GC1L 2RDUA 1EP3A 5I73C 5GNYA 4JYFA 2I56A 5IQLA 1RQEA 1JOIA 1FV1B 4AV4A 2X4OA 4APXB 4Q6YA 5DWUL 2DEYX 1XLMA 5SWZD 2YBVA 2VIRB 2J6EA 3EEZA 3UG8A 3U1SH 5HYSA 3ZWSA 4ELDA 2WLZA 3ZRCC 4X99A 3GSQA 2HVOA 5CPNA 3GBML 2EUWA 1WIOA 3WJMB 1EJSC 2E67A 5EO0B 5E51A 4R53A 2H9AB 5FOJA 3MLVL 3DJTA 3W76A 2R2HA 1MNNA 1C3FA 3QUXA 3D30A 3T2NL 4J3UA 4RV3A 2JH2A 2FEDC 4AVNA 3E0IA 3M41A 2ADGB 1GWJA 4LS1A 4OZOA 1JUBA 5B1CA 2Q02A 1XRTA 1F4HA 2VR8A 1CX9A 1PLCA 3EWXA 3RLVA 4UTLA 1K8ZA 3VYNA 3VFNA 3ROLB 5JHDD 2BZNA 3GMPB 1FSKB 4AMKL 3TWAA 5IV2A 2LFGA 1FORH 3PWUB 5EZJB 1QOQA 4K94H 4ODSH 3U9WA 5D7JC 3RX8A 5HJYA 4WFHE 4WUUD 3V9EA 3UBHA 3ETBJ 1SHXA 3RIFF 5JBEA 5DDHA 6CGTA 3D4GA 4P2RB 5FC9A 4N90D 4PP1D 4D7BA 2XZQH 3IACA 4QYOB 3T8XA 3PQYD 5GGVY 1QSFB 4Y4HA 2GVGA 4L4TB 5MEQB 2QJGA 5HYQB 4YX2L 3TW6A 1C9WA 2PDCA 5AB2A 5LGYA 2VR5A 2ZT9C 3FZUC 1XX1A 3WKZA 1R3HB 4F93B 4MCYB 4HW6A 5FW7A 5AZUA 2VGBA 3T8VA 3AHVA 4M4RB 4NKCA 2EDKA 3N50A 2XPYA 4ZUWA 2J1KA 4AYFA 1DVSA 1BQRA 2BHFA 2VI0A 5DBTA 5IVXA 5A8PA 5H91A 3AU6A 4AD5A 4OKVB 1E0XA 3U1QA 4JFOB 3BPCB 1LE9B 1NKRA 1SO5A 3PDOB 4PCSA 1AJ0A 1Y0EA 2KMWA 5FF4A 2EABA 1LQ2A 3DAQA 2Z1XA 4ZXOA 4C6DA 4MD5A 3GMQA 3FUNA 3Q8BA 2PTDA 5H6HA 2X2YA 1E9PB 3WCYA 1E6JL 4ZK8A 4G3YH 1UI8A 4MHBA 1JHKL 1TX0A 4IBWA 3X41A 4XO7A 4OCNC 4AEHH 3NQGA 1CVSC 3UL4A 4HUCA 3Q48A 4XAGA 2GJ6A 2IPUK 4XPBL 3NVTA 5BRZB 2WZSA 1TZGH 2YBTA 4M8VA 1ZLWK 2XIQA 5E2WH 4KFEA 5EZIH 1TJRA 4YO0B 3FBKA 4G8FB 4WU5A 4TQHA 2YAQA 2RFXB 3C09B 2E25A 4IS6A 3MDJA 1CO1A 4ZOEA 3GE7A 4W8LA 4MHHI 3WLWD 2LLGA 2MCG1 4BF5A 1XCTA 1A4MA 1AHKA 5F2IA 3TNNA 3DH7A 2Q6WB 2CLRB 4DY1A 3MCOA 2M83A 4Z17A 1ZK9A 3SECA 4RGMC 2JKJA 2MPAL 4GLEA 3OGCA 4HLZH 4P5TC 2CRYA 3FTVA 3AW5A 1A2YA 1QDSA 3N85L 3FQ4A 3MBWA 1D6UA 5KJ4A 4ZFOA 2YL6A 1IT9H 3D4CA 4OZHA 1LYXA 3V0IA 2YZ5A 2G60H 4P2AA 5IJKC 3GK8L 2GUBA 4YDLC 2X2GA 4PVMA 3JTSB 1H6UA 1A7PH 3NCJH 2X1TA 1VIWA 4MNKA 1RIUL 3ZE1E 3KL5A 2G4FA 2YD1A 4O1CA 2DV6A 3IGXA 3V0TA 1B3ZA 2X7LB 3TCSA 5K9JL 4WI8A 4LRIC 2YRPA 3BH8B 3UWEA 3C6LC 5EN3A 4JK0D 2XWTA 3NEXA 4TUFA 4LU5H 3QPXH 3AFJA 4Q33A 1O6SA 1TTUA 3OB8A 4MX7A 3CZ8A 3TVMD 4H8QA 2YHGA 4JN2B 4DYKA 4QE4A 1SXNA 2VDIA 1LQAA 1D5ZA 4LAZA 1AXIB 2OMYB 1OF6A 2YCLB 4KI5D 1KG0B 1WV7T 5IMKA 5T3ZE 4J2XA 4JN1H 1TPDA 1E4WH 2VABA 5T1KB 3D48R 3BW9B 5F88B 4S23A 1OT1A 4X7SL 1EEZB 3ZT6A 3TQKA 3WE6B 3CH0A 3WIIL 4YC2C 1R46A 3UAFA 4IT1A 1Q85A 1IAMA 3FQTB 4XVJL 4JO2H 4O1DA 4HBKA 2JKNA 4EZLA 2CLEA 3THQA 1FN4B 4KVCL 3ENLA 4I48A 1GPWA 1VRDA 3CWGA 3KJ4B 4RMSA 4LKXA 2BZDA 4I4WB 1JD9A 2QTEA 3VMOA 3WS6A 3M1ZA 2C1PA 4IL2A 3B8VA 2PBGA 2Z31A 3IDJA 4WDIB 1E65A 4L80A 4O4YH 4ZXBC 3FFDA 4JQAA 1VB9A 2Y3AA 1J5SA 1VPOL 5FECA 4XP1H 1KB5H 1UKOA 1R3RA 3SCMD 4IK6A 2EG8A 4KFFA 5L4IA 4QR6A 4FQJL 4XOAA 5CPQA 4C6FA 3W75A 4K3JL 1F2JA 4OW6A 4N02A 1FAIL 4XP5H 2PDUA 1NLDL 2CZNA 3L0KA 1B0RA 5GRUL 5HMDA 3RGVA 1P0EA 4XVEA 4GP4B 1VBHA 4N8VA 1OINA 1FNGA 2WZTA 2QQNL 2EPNA 1AW1A 2NUXA 5EBAA 2CPCA 4IU3B 3ZE2F 2H3NA 4PMOA 4E41D 4NC1E 2EXYD 4GW1A 2NNXA 1MRDH 3UIYA 2GC4C 1Q3NA 3V8OA 1FTXA 2FB4H 1TJ2A 3STZB 1KXQA 2GJZB 3RB7A 5C71A 5DK0A 2APTA 2UZXA 4IFRA 3OKOA 2XG5B 4AQ1B 2MQCA 3B03A 5I8CB 2BOGX 1GVFA 3KCWA 3LCLA 2ZDRA 1SVBA 5C9WA 4YDJA 3CFEB 3MRGB 4PGLA 1GKRA 2F38A 2FQGA 15C8L 5I6NA 3TO4A 3W72A 1H2JA 4GG9A 3RGHA 4QRPE 1FP9A 4RRPG 4I5RA 1S9YB 2LAGB 4HLEA 3VTAA 2EH8L 1QPXA 1SMDA 1HHKB 3T2QA 2HKHL 4PG9A 4HA4A 5HANA 4DGIH 4ZMGA 1GSKA 4DF2A 2AV7B 3CU1A 1OFAA 12E8H 1UYWH 3V36A 2B2XL 4B3VA 4AKQA 5LDUA 3DSNA 5FUOL 4E0CA 3LCFA 3C0SA 4MGXA 1IVUA 2BPBA 2ICEA 1N9PA 3O4LB 1FDZA 1BIHA 5DFAA 5A5WA 1K9DA 2VR2A 3W0WB 4NC2B 4YNGA 4M81A 1FIGL 3IF1B 2LU7A 4BKNA 1TNMA 3FYEB 1LK3H 3QJRB 3C75A 4N9CA 4PN6A 1IU7A 1RQ5A 4U6HB 1IBFA 4GQRA 3FONA 5L2KA 1XF1A 4K8RH 1XWYA 2GIYA 1FVDA 2APSA 4MAYD 1I9EA 4DGVL 5DSCB 4F9JA 2A6IA 1GOMA 1IQDB 1H9DA 3FMGH 3KBFA 1BZ9B 3IXAB 2VAAB 4NAFA 3QM3A 4WKZA 2Q86B 4P4RB 3LZ5A 1EJTC 4HJJL 4QTFA 2AXGB 2V8LA 2GTWA 5LUMA 5ABGA 4FQHB 3MDUA 4QRTA 1BD2E 4PP1C 3IJ6A 1YNPA 5FB8A 4LF3A 2JKWA 5CPLA 3LUTA 2OLAA 5H94A 2PCQA 1XC6A 5D02A 2XBTA 1J6PA 5SX5H 3V8CA 4FPSA 1JCNA 5F6HJ 3TJLA 2XWJA 4TF4A 2QLYA 5I28A 2GHWB 2HTAA 1HKKA 5BMFH 1I1AB 1TQJA 3ULSB 4UYQA 2F1AA 1S3KH 1UR0A 1CGTA 3JV0A 1SO3A 2UY7A 2I7SA 5LZLA 1IBYA 3NQMA 3M6DA 3JWOH 5KS9F 5ICXB 5C3LD 3EJZD 2Z4GA 3FS9A 2IPUG 1TV8A 5DBUA 2UXGA 2QSTA 5F7EL 2ZKMX 1DVUA 5IFPA 1KRBC 1BXNA 4HJIA 2CSPA 3BGFB 3PNRB 2R29L 1O7AA 1EXGA 5TBOA 3PHOB 4KTDL 4UTIA 1PV8A 3TR2A 3UY7A 4XNMA 3WFLA 3D46A 3MV01 4D0BB 3SGZA 1QCWA 2X1UA 3CJJA 4PD4J 2E6FA 3RQ3A 4F57H 1OCOB 2VLJB 4BUHA 1A4AA 3MCKA 2NUTA 4I3RL 4Y4FB 3V55A 4RLIA 3P54A 4K5NA 3VUPA 4PUMA 5D7LB 4P8WA 2CISA 3ECUA 5GGQL 3I84A 3EKCA 3ROOB 4ERGA 2A4AA 4ERSL 4NG3A 1KY7A 3U0WL 5CU5A 3A67L 5LA2A 4GFXA 4AWUA 2BVUA 2C8NA 4KRLB 2BC4A 1I4FB 1V7YA 3QJTB 1TJHH 2M1KA 3EKGA 2ENSA 2J6WA 3NQAA 1R47A 3ZTJG 3H3BC 2DJSA 1EXUA 4IEFB 2NV2A 4LHUA 4E8DA 2OR2A 2YEZA 3N9HA 1F11A 2QSCH 4HK0A 1KJVA 2EACA 3WLWC 3BGMA 2WXNA 3IBOA 4MXQC 3VD4A 2E28A 4LVFA 4ONFL 1LURA 3L1GA 3BP7A 2P43B 3ECBA 4AQZA 4Y8AA 5TDNA 1RCQA 3Q3GA 3VWJB 2PETA 3W9ZA 5CC6A 4OIFA 1G7LB 4R33A 1DL7H 3CUPB 1RSFA 4OFIA 1QAPA 5L7XH 2N0KA 3ZT7A 5ALBL 1GAFL 1XVSA 1PCWA 5E1IA 1RALA 2P3YA 3AT8A 4KBXA 2X4PB 3QZMA 4L9YA 1ADQA 2H8PB 3EF4A 1EJOH 2Q3RA 3N43B 1MCPH 1O7DC 1AODA 5L8JB 1QBAA 2H32B 3EWBX 4M6QA 2Z28A 4XV0A 3BVUA 1IKNA 3N4FA 1ESOA 5I76B 4U1HB 4HVXA 5CLYA 4WWKA 1KQYA 3J07A 3NM3A 3POHA 2YQBA 3HE6A 4LB3A 5IBUG 1JWUA 3CLFL 4HISA 3DGGB 2JSFA 3DNKA 2O61A 3NYKA 4G7EB 2Q6ZA 2V5BA 4QRPA 5IQ9A 4XD3A 1JN6A 4LOFA 3RWCA 1O6IA 3MODL 3GR7A 2BVPB 3VKKA 3FRUB 5T5NF 5BV7H 1KELH 5CJMA 4MMXB 3QI9A 2VXQH 1CFVL 4FERA 4OZIE 1H6TA 2PC8A 3MP3A 3TK7A 1NCBH 3OG6B 3LM7A 3G1VA 4QDMA 1PHQA 3LDBB 2ACRA 1EHKB 3QFGA 4DKFL 2YMXH 4HCHA 4Q9QH 2ZSVA 2X8RA 1N7OA 3SSGA 1WCBA 3H9YA 4KI5C 4QOKB 3WIAA 1FH9A 2EIJB 4GISA 2WLJA 2QEZA 1A4CA 3L81A 3PTQA 2ZE3A 1DJIA 5DUBA 5DD1L 3IPEA 1IGCL 1KFGA 1SZNA 2EKGA 3OL2A 3QPYA 4J3SA 5F1OB 2ESVB 3CZJA 5IGXH 4L6DA 3FXGA 2XYLA 4BHUA 3B0YA 1YX1A 1NIBA 4N3TA 3WLHA 1C8YA 4PTNA 1TJGL 3QTPA 2OMBA 2LQRA 3SKOA 1ZXQA 4PVLA 5AW2B 5MEND 3OXRA 2JWYA 4I2XA 2PYFA 4IXXA 1DHKA 1MREH 3RWDB 4PJAB 4AQEA 5KYWA 2DY2A 4BQ3A 4XPTL 1GONA 3DX8A 3GUFA 4HTYA 1ZBCA 3MZTA 4RWYH 3ARTA 4IRJD 4YHGA 1P9MA 1R24B 3OGVA 1C29A 1A0QL 3HI1A 4MA7H 1QNZL 4I0PC 1RAMA 4XI5D 4W9KC 2OW7A 4L8BB 1S2TA 3TBYA 1TVHB 3N4EA 2BGSA 2FEJA 2J72A 4CVZA 3BW4A 2AW2A 4LNRB 4K71C 3TNOA 1Z66A 1C92A 1A7NH 3KL0A 3NIGE 2J24A 4DJDA 1IB5A 3DUUA 1MLBA 1TLKA 3PWPB 1RHHB 3BQUA 5I8KH 4HKPA 2A85A 1AQ0A 4D3CL 2F7RA 3WIJA 4PTDA 1R5YA 3FA3A 4QT5A 1JXDA 3QIBB 2AABL 3B9EA 4KKAC 4ZNEA 1IC4H 4I3SL 1PLBA 2BSSA 5T8GA 1ZTXL 3MV7B 1RUKL 3DMMB 3LXUX 3X3FH 2GSMB 3VXSE 2R1LA 2Z35B 1UA6H 4Z3HA 3FYPA 2Z4QA 3SIZA 2OMAA 3OPSA 4KXCA 3ASNB 4XVUD 4FZEL 3V0HA 1W1YA 2W4XA 1GSMA 3ZYZA 4ISVA 2AJVL 3TH6A 2X0VA 2VXNA 4WY7L 4DJEC 2WYTA 3UO1H 4IQHA 3ARWA 3OLEA 2C4XA 1P4BH 2ABBA 3RX9A 3QCVH 2ZCHH 4ODTL 3UGUA 4ZODA 1CF8L 3BVXA 4BH8B 3KPSA 4QI3A 4CAGA 1OX5A 5FW6A 3LNEA 2R2CA 4PV9B 1R3LB 2AGJH 3KPTA 5A2FA 1OAQH 1YN6A 1H8SA 1HEHC 2MHAB 1OPGH 2X0SA 3VXNA 2MSPA 4EAYA 3N6HA 2RDTA 1O95A 3NGJA 3GMRB 1JPST 4A7VA 4IYKA 1JZ5A 4S3GA 1KBKA 2MQ0A 1THAA 1JCKA 4F1SA 2Y7EA 2VUNA 3UCDA 5D2NC 1BQLH 2WBXA 3CSTA 3P0YL 1KXVC 2XQBL 4GUPA 3NEEA 5AVYB 4ALAC 3MA9H 1UHVA 1MCOL 3BFWA 4MAYC 4NLHA 5TNVA 2WWNA 3O2WH 1PEZA 2XVLA 4U1LB 3BOLA 5I8EB 5I2IA 2XYBA 4C1NB 2A9MH 2QGYA 2QGEA 5GGUB 1R85A 2OJ1A 4N9GB 3RRSA 2WCSA 3Q5YA 2YR3A 2YD2A 1BOGA 1SUJA 5H4YA 1VLXA 3MRIA 3E80A 3IXTA 1XGDA 3Q2LA 3LOYA 2CNCA 4GP8B 4AH2B 3B1TA 1LO3L 2IPJA 4CQ9A 1A7OL 3EYUH 2HMIC 1P7TB 2L5HA 4FNVA 5AAPA 3FO0H 1RZ7H 2YAPA 1KGJA 5HI4D 4D71A 2KH2B 2FWUA 3KPQA 1FXPA 4GKTA 3TO2B 2OMUA 2L0DA 3MGAA 3B4NA 3RA7L 3FFOA 1T1WA 2LABA 4PJBB 2CFWA 2FO4B 4YHYB 1XBRA 4YJ5A 4KI1A 2PC4A 4N0CC 8FABA 3UYRH 5J4MA 1SZRA 2ZDSA 3LBOA 5BO1H 3DX5A 1UZ6F 2YL8A 4N8UA 1PYMA 4R5VA 3P60A 3OHXA 1A14L 2DI9A 2NV1A 4JREC 4WTZG 5D7KD 3CN4A 5IROA 1TKWB 1UOLA 4KVNL 4MA8H 1S7VA 3VRLE 4F33A 1BIIA 1IAIH 3MRJA 4XMXA 1PWMA 5LGHH 1PKQE 3A0OA 1IL1B 3MBFA 2OX5B 4OZIA 4HCDA 1JPIA 3TBBA 2XSKA 2ZOKB 3OA5A 4ADGA 3U46B 4HC1A 3MSYA 4OGQC 1A3LL 4Y16A 2NXIA 4NQDE 1L9QA 3FO9B 4JRXD 1X7FA 4OFYD 3BLIA 3BAEH 2NT1A 4JPVH 1JCLA 4DZ5A 4UUJA 4B5EA 2E7FA 2Q10A 4QTIH 3B3BA 2XX1A 5CR8A 3F7YB 4PMQA 4X9SA 4F7MB 2WQXA 2IOOA 2VLMD 1RJZB 1BQUA 3BOXA 5D2WA 1LL1A 1HTYA 3VVGA 4XQ6A 2Z0IA 4JO3H 2BM3A 5EH1A 3CZSA 4NXKA 3TOYA 3HVNA 4K9EC 4JY5H 5CAHA 4NQEE 5FD0A 4NN7B 3K0YA 4LCWE 2EIKB 3V4UH 1HKJA 4DOHB 4RVBA 5CKSA 3BLEA 1Y5XA 3LSBA 1JV5A 1HZLA 5IDZA 1AI1H 5LNSA 1WC7B 3VXOA 1VRXA 3IS1X 2IAAC 3IPBA 3W2MA 1NWPA 4JANA 3PJNA 1XYAA 3QIUA 3V2AR 1DQVA 4AX7A 3OG4B 4HCIA 4DVRH 1BVKB 1RURL 3HJEA 3T65B 3ZE1B 3O6AA 3VG9B 1PIGA 1JPEA 3CXHJ 2JB6B 3PZNA 2J44A 3ULAB 4GBDA 4NM8H 4A38A 3MLXL 5EZLB 1MMUA 4JFXA 4NX0A 4JBSA 3I6LD 1Q4WA 2Z7UA 3KH3A 1ADDA 4DWSB 1QLRA 4Y2DC 4GXPA 2VD8A 2EEDA 4DEFA 3UWQA 1IO4C 3H9ZA 3PBWA 1B4RA 1ELSA 3OMAB 3L66A 4PJFE 2PI6A 4OZFH 3BP6B 2NZ9D 3RZCD 4ZTXA 4GAGL 3O7UA 1DVXA 1XGRB 3DFNA 1F18A 4HFUL 3VXSA 2PCPA 4RBPK 4FXRA 1SXBA 5EU5A 4Z7QF 2IFFL 2QSQA 5JR1H 3OWRA 3PGDB 2C11A 1BGXH 1IYXA 1AD4A 1J1PL 3X3YA 3VABA 4C8XA 2J6XA 1P48A 3FUJA 3NXLA 5HHNB 1BQHB 4J3TA 2JE8A 2O4QA 4O9HL 2VRKA 2OQJA 2YKLH 1NIFA 4S3JA 4Z7UF 4HU4A 5D2VA 3ELFA 4TTUA 3JV5A 3Q2NA 4OLXH 1RJPA 1ULVA 1XGUA 4ORGB 1CCWB 1MWOA 4R9XA 4NO5A 3Q44A 3HHSA 2QKIC 4WX2A 5EA9A 5FYKE 4FQXB 4J4PA 2L7JA 5DJ0A 3G1DA 3C3UA 4KAQL 3EHBC 2V9TA 2ZCZA 3SY0B 2WXJA 1I1RA 2W07A 1A1NA 3GIYA 3SO3C 3TCLB 1RJYB 3RTLA 3SQOL 5DD6A 1NSSA 3UT0A 2POTA 1S78D 3UPMA 4AIUA 4G9FE 4DPCX 2G2PA 4E4FA 1Q38A 3W27A 3U0PB 2NLYA 1MCEA 1NEZA 1QNIA 3EDFA 3TNMB 5C2UB 3WIHA 2VX6A 3ZLQC 3N17A 1P84K 5HBFA 3CVHL 1YY9C 2E7LC 2YL5A 7TIMA 5LNVA 5MEPA 2ZYRA 1R19A 4Z76A 3PUEA 1DXIA 4QLRA 3NP3A 1KGCD 5ACMA 1WS7A 3P2VA 2FVLA 2WMIB 5FM5M 3OGOE 1T7YA 3F64A 2Z93A 3RWHB 4XI5C 4V27A 2P26A 4J5VA 5EOTB 3C08H 1BWWA 2Q3ZA 4GQBA 4ZUSA 2NY7H 4J28A 2V5MA 4A2DA 3CFQA 1QO3A 3BSHA 4AM0A 1RJOA 2CWNA 1L9NA 3BSZL 4EKXA 2QHRL 1BVNP 1KTDA 3GXFA 3V6BR 1EO8L 3O07A 2F19L 5D96B 3U6RB 3PE9A 4IFKB 1KJ2H 5HGAB 3C8FA 3MACL 4LAUA 4QJ4B 4EF3A 5G4MA 2QIIA 2FQDA 4AAJA 3RG6A 1RLCL 5FIPA 2VHLA 5A16A 2QW5A 2X4SB 4DF0A 3SD5A 5T3XD 3TBTA 3NXFA 4KFNA 1ECQA 3SGDH 5GS3A 4WQOA 5CA3A 4YHML 3K2GA 1PKQA 3AS1A 4G7VH 1CD1B 1XUUA 5AOMA 3Q6FB 4EVNB 2E27L 5ADOL 4AKOA 4P5KA 4YK4C 1EK3A 1ONWA 3NQVA 3PZIA 1W2ZA 2TMDA 2H90A 4KX8A 3VA6A 2VX7A 1OSEA 3FHAA 5GGSB 3O06A 4XSLA 2ZC8A 3TWCL 3ZKXB 4CCEA 1VBJA 4P57A 1ZHNB 5GRYA 5A6LA 2X7VA 4F8OA 4M48L 1AGFB 4Z78B 4IJTA 3QV8A 3CPGA 3NZPA 2JJTC 3LLDA 4B96A 1GJIA 2WMPA 1HM2A 3QG0A 3VCLA 3VNLA 1BEYH 2MRYA 1KNOA 1ZRQA 1GTNA 4JO5A 4M8QA 3DECA 1H5BA 1D3GA 1N5AB 3IJSB 4KOCA 5MHBA 4JTKA 1WFOA 4AF0A 3LZFH 2J25A 4XGZA 3BIBX 3DSFH 3IAGC 3AUWB 4LCWA 1BD2B 4GKZA 1WRFA 3C86A 2YXOA 1E8WA 3INUL 5A2AA 2QVTA 4F2BA 5LGXA 3DCPA 4PUKA 3RDTA 2TSBA 5C9JB 4DLMA 3LKRB 2ZTJA 2F61A 4Y0GA 2R8WA 1ORQB 4FMFA 3QIWA 4BFFA 4LCYA 3A6CH 2WO3B 2ZF8A 4XX1G 3RL1A 3E6HA 5E5RB 2GBVA 2FL5A 2XKNB 1OLLA 4RE3A 2ARJA 1BZEA 4XVTL 4WSKA 4ZMPA 3NFNB 3GS6A 1NGWB 2VWEC 4ZX4A 4TVPH 1FWWA 2HCZX 2RHGA 1TO3A 2NPLX 3UYPA 5HDBE 4G1KA 1JZFA 5I1LA 3OB0K 3JRKA 5IVXE 4OGZA 5FAAA 1K8XA 3EW3B 3TW9A 3WBDA 1ZGLA 3L3HB 4DQOL 2IQAB 3I50H 1TE1A 1EFQA 1RJLA 4CSZA 2VR3A 1UI7A 1NFKA 5ID1A 5GJSL 3QXAA 5D1ZD 3MQTA 2QMJA 4JY4B 4KMQA 1D6YA 1EA0A 4UTBA 5T1LD 1OFEA 5F1UA 2NWSA 2WUCH 4JPIB 1X9UA 4PLNC 4LBSA 4W9DC 2BASA 1UP2A 4ES8A 3PAVA 4RQQB 3TQVA 1XF4B 4A6YA 1XZ0B 2EEAA 3KDNA 3P8IA 2JIWA 5BW7A 4UFKA 1IT0A 2IADA 2VL4A 3I6TA 4Y4KB 1MUMA 3ZS4A 3RX4A 4W5ZA 2J78A 2HTMA 2WZHA 4BR1A 3T3ME 4AYID 1EEPA 1OX4A 2BBFA 4ZQCA 4QHMB 4KDWA 4J2MA 1ZGLM 3HZMB 2DM4A 3NDZA 4V1DB 4LAJH 2KZWA 5DLML 4XMTA 3BKMH 4F8QA 2SODB 4D6DA 2VFGA 3GG1A 5HVWA 3IKKA 4BELD 3WDJA 1FQ0A 3ARGC 4U1MB 4XNZC 3RY4A 1XIFA 2FZ3B 4HN4A 4X6DF 5AVSB 1IZKA 2GUOA 5I07A 25C8L 3MVSA 5DTFA 3MXWH 2HWGA 3LV3A 3HNSH 4G9FA 4NHUB 5AUMA 4GKNA 4PUWA 2JEPA 1DDTA 4QTHB 5FA4A 1VDGA 3R8QA 4PMVA 3CD4A 4Q7IA 4UMSA 3ITGA 1RUPL 3VQ2C 2RDYA 2WWCA 3QFEA 4H6EA 2CIPA 4H1LB 3SDCB 1I9CB 3FJNA 1MI5D 5EDSA 3HKFA 1RZKL 1L7IH 3HE7A 2R69A 4FP8H 3KR3H 3SX1A 2I9UA 4X7CC 5KSAD 4CW1B 2ZXEB 5E4AA 1DCLA 1FH2A 1GCYA 1EPVA 5B3JF 4NZJA 5EPMA 2OMVA 4HCRH 1VF5C 3RO6A 2WQDA 3WFHA 1HOCA 4B3KA 4GGBA 2C7FA 3GTNA 4DKEH 3L4XA 4O17A 4JTHA 2QFPA 1DJXA 1Y65A 2BX7A 3MRRA 1TG7A 2WN3A 4M6OH 3NTCH 3QYCA 4PJ8C 2PDJA 2A9AA 4WHTB 2Q8BH 5CJBA 4MAVA 1H7WA 4PUDA 4ZTPL 1MWAL