4FNQA

Crystal structure of gh36 alpha-galactosidase agab from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
727
structure length
723
Chain Sequence
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGSRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGIELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKARGHVAMSGNFGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaB
total genus 230
structure length 723
sequence length 727
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnqA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnqA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnqA02
4A22A 1OYBA 1FWNA 1HO4A 1K8XA 5EA9A 3WJYA 3DENA 3HO8A 3TDFA 2V5LA 1KGWA 2NX9A 2ZQ0A 1FXQA 4E2BA 3HPSA 2H8XA 2UV8G 3P74A 1JCJA 5CZTA 4WQ6A 1QHOA 5DFAA 2BZNA 3VGDA 2CXGA 5F2GA 5LGZA 2ZWYA 2CLHA 3UD6A 4UNIA 1VRDA 3FA5A 4GQQA 4RLIA 2E68A 2HMCA 1V3LA 1V3JA 4UQCA 1V7YA 1UH3A 3CZKA 2EHHA 2DU2A 4JIPA 2WNZA 1M7XA 1MW2A 1KM4A 3PY2A 5A8GA 1VJSA 4DBEA 5F2IA 1H50A 1MSSA 1XUZA 1LYXA 3G18A 1EB3A 2FPVA 1EUNA 4TMBA 3W37A 3GXFA 1WOAA 3NQEA 1PIGA 4PCFA 5CSRA 1SR9A 1LLZA 3YPIA 3TQVA 1QW9A 1QAPA 3G0SA 3L66A 4FB7A 4EOUA 3LCXA 4L4MA 1B0IA 1G4SA 3TC7A 2RHGA 3VFLA 4JX6A 3B0PA 5A6MA 2DH3A 1QMLA 1DHKA 2Y2WA 4M7TA 2V2CA 3S5YA 1TB3A 2C18A 3TNOA 1DQXA 3IV3A 2ABAA 1OT2A 4ZQOA 1TQXA 1WP6A 3D0CA 3W7RA 3CEPA 3VSTA 4NNAA 5KINA 3STFA 3JR2A 3D52A 4PEKA 4LOCA 5HJLA 3SR7A 1CPUA 2A6NA 2EABA 1SO6A 3IGXA 3I65A 1JQXA 2BY1A 3RU6A 1MZHA 4N9BA 1XCWA 3UZ5A 1TQJA 1JDCA 4LU0A 1WA3A 1OJXA 5LGXA 3OA3A 4LV9A 2EADA 3K1DA 3GVGA 4MY1A 2P1FA 3PG8A 2O7QA 3EWZA 2FQIA 3P60A 1KFEA 3OLIA 1Q6OA 3AO0A 4ZQPA 3BSHA 2E77A 4ZQCA 4DELA 2WKGA 3TUUA 3LHVA 1J0KA 2GVYA 1G67A 3DHUA 2BXZA 2VKZG 4GUHA 2E5BA 1VFMA 3CM4A 4PTNA 3CIWA 2ZZ6A 1J0IA 3G0UA 2XN2A 3CGTA 3ZSSA 1Z42A 1VCFA 3ANYA 1KWGA 4KWWA 4ZVJA 1KM3A 3NM1A 5CSSA 1I2QA 4UZUA 3L2MA 3EDDA 3WK1A 2BWGA 1Z32X 3Q37A 4RZ4A 1SUXA 2Z2UA 3BMVA 5KZEA 1IGSA 4RZ5A 4HOZA 4UC5A 4GBUA 3EJQA 5G2WA 1KTCA 1EH9A 2E09A 3A9IA 1W1ZA 1UD5A 3OG3A 1G4EA 3CZNA 2VEIA 1J4EA 3KWXA 5LHFA 4J3TA 2V2DA 3W7GA 1CXEA 1SO3A 2A5HA 1OFAA 1YTKA 3LCIA 5G2IA 1LDCA 4O8RA 3I7SA 4HNNA 4QM1A 3RLVA 4ZL1A 5FF2A 1H7WA 3WJXA 5KSWA 4PSPA 1K03A 3LCHA 3M47A 1PZ2A 1MWOA 3IVUA 3CZGA 3WNNA 4JFWA 1F74A 1ALDA 3BAWA 3LM7A 1VFOA 1M6JA 4AEOA 2QV4A 1SZNA 1ZCOA 1AVAA 1FWRA 1R75A 5LZLA 3HPZA 1H7RA 5BNKA 1L6YA 3G1XA 1T99A 3PB2A 4M6PA 3PG9A 1HXKA 1NFBA 4O54A 3L67A 1RVGA 4AEEA 4HT3A 1VHNA 1F76A 4AH7A 3BSGA 1W8SA 3EEGA 2VEPA 5HUOA 5CPMA 5F2LA 1LWHA 2B7NA 4FX8A 3L4YA 4C1LA 2QUTA 3L4TA 4GUJA 3NQCA 1KXQA 4YCOA 4JTKA 3HZ3A 4OE7A 2YFNA 4TMCA 3KHJA 2ALWA 4AYSA 1TTJA 2X1UA 4LTSA 3HJZA 1X1OA 3STGA 4BK9A 3BGGA 4AHQA 1WXJA 3B8DA 5F2MA 4GFSA 1BEUA 4Z08A 1RP8A 4EVZA 5A6LA 1PCWA 3EXRA 2V9DA 4ML9A 2B4GA 1G9HA 1MW3A 4IGHA 3W22A 3ATYA 3W1XA 3W83A 3VNDA 3L5AA 1YLVA 4O14A 3JRKA 1V3MA 2FE0A 3OBKA 1JD7A 3NZ1A 4Z1CA 3UXAA 1KB3A 2C3ZA 1OSEA 4Z0SA 2WNWA 3O6YX 2NT0A 3P80A 2GUUA 4PC8A 4JDYA 1HL2A 1RP9A 1W37A 2GQ8A 1DOSA 5IBXA 2PWGA 3AMKA 5LNWA 5BMWA 5CLWA 1T8XA 1IZKA 3BLEA 3FW6A 4HA1A 1RD5A 4IWWA 4UFJA 4HNVA 3EJUA 3MYOA 2QUVA 2TYSA 1EUAA 1R47A 3EX1A 3LHYA 3G8RA 2D3LA 3MHGA 3GDKA 2GUYA 5KZMA 3FOKA 1NF7A 1XC4A 4X22A 4BF9A 1QPQA 1DBTA 2V82A 2D0HA 1SPQA 3DBPA 1HL9A 3QMSA 1JQVA 5E0KA 2TAAA 1UKSA 1H63A 5LNRA 2FJKA 2WOQA 4ONVA 3WDHA 4K39A 1JFHA 4NZFA 3UG3A 1Q6RA 1YPIA 4A2SA 1N7KA 5F4XA 1JCYA 5MHBA 1U30A 4MYXA 4RV8A 3GBDA 4O52A 3NEVA 2ISWA 2R91A 3PF3A 3IVTA 1OVDA 4DO6A 1ZFJA 2RDUA 4XQ6A 4QIUA 1IF2A 4UIOA 3W1TA 2XVGA 3IJ9A 3HGJA 5K9DA 3FAXA 1AL8A 3ZT7A 3LBMA 3TFCA 3HQ1A 4BA0A 2Y88A 3KL0A 4TR9A 3SGZA 2WC7A 3BVUA 1W31A 4MZ8A 3M7WA 3MYPA 1CGVA 1UH2A 1T96A 1XD1A 2DP3A 4MOZA 3NOEA 3LBCA 3VGGA 3O6CA 3LV6A 1P0NA 1NM9A 1TQUA 1LRTA 1DEDA 3FS2A 4K37A 4KFOA 3B04A 3M5VA 2JKAA 1PS9A 3P81A 3UYCA 3AXIA 5AB3A 4WX2A 3SECA 2OT0A 1XI3A 3E02A 4JTGA 2Q8LA 2VC6A 1SQ7A 4L4LA 1E51A 1GVRA 2GVGA 4JXCA 3N14A 1HO1A 3MHUA 3A5VA 4QQ3A 1ONRA 1HUVA 2PC4A 5LKYA 5KZDA 4GIAA 1KA9F 1VAHA 3THQA 4I7UA 1S5TA 1YADA 1L2UA 2CLKA 1O7DC 4JFTA 1JUEA 2A7PA 5I23A 1NOFA 2PWHA 1ML1A 3PUDA 3TAOA 4J7RA 4ATWA 5F7UA 2CW6A 3W2LA 3IRDA 2Y61A 3P62A 4FHAA 3F4NA 1TPWA 1TO3A 2EACA 1OF6A 4LS1A 3UNDA 4JFUA 1XBXA 2H90A 3TSDA 5AFDA 2NUXA 3VSUA 3EKLA 5AHLA 1VQTA 2ZFAA 3BAIA 3LI1A 2OZ0A 4S1FA 5GVJA 1KXTA 2OJPA 4O18A 1C8QA 3HG5A 1UUMA 3CIXA 3TU9A 3P61A 4E2DA 4UTTC 3TONA 3TR2A 3UPWA 3DX2A 3PVFA 8TIMA 3MBDA 4PEEA 4WLCA 4RX0A 1OFPA 3GKAA 2QR6A 3LRMA 3EWBX 2YDAA 4LVFA 4NJJA 2CZ5A 2CLEA 4LVAA 3PSWA 3BK0A 4MUZA 3BUIA 2B7OA 2OSWA 1CDGA 1SZFA 1CXFA 2C6QA 2V30A 4LRSA 3C2EA 3FIGA 1HG3A 5AHMA 3UY7A 1JI1A 2FYVA 4GQRA 4JYEA 5H2ZA 3A4AA 2WNNA 4MPQA 4WSKA 4MJZA 2Y4SA 4UQEA 1AQHA 1W5NA 1B4EA 2BHYA 1DHPA 1AG1O 1JCMP 4BWLA 4CQAA 3MI3A 3BO9A 4N9DA 1WZLA 4S2CA 5CZJA 3W1UA 3WK0A 2O7SA 4CN4A 4U31A 4FX6M 5BRPA 1MEHA 5DO8A 1JRBA 1QO5A 1WZAA 4FLSA 2CLMA 1ZNNA 3O05A 3BVWA 1YXDA 3T7VA 1UD4A 3NM3A 4DF1A 4X9YA 4M6VA 4WY0B 1VZWA 3NO5A 2ZRYA 3C0JA 3WNOA 1TPEA 2CLLA 3CU2A 4H7VA 1AMYA 1MEWA 5D2VA 3UWQA 1W56A 3M9YA 5E1QA 1SSDA 1XDMA 3R8RA 4GUGA 3RFAA 3VMPA 2C8NA 3VGFA 1JVNA 2ZX8A 4ICNA 4DO5A 1TTIA 3W88A 1P1XA 3S0CA 1XL9A 3NGJA 3IK2A 2Y62A 1QX1A 4MIMA 3VGBA 5AC6A 1N8FA 4CQ9A 1A5CA 4J3UA 3BW2A 1B4KA 5DBUA 1FCBA 2VFFA 1QWNA 4BR1A 3QSTA 4CN6A 5L6UA 4Z1DA 1KBIA 4POCA 3NQ7A 4A3UA 2VRKA 2H6RA 4LVGA 2ZRXA 3MP3A 2OYMA 4GI9A 2CZDA 3STEA 4UOQA 5TIMA 1RR2A 2FB2A 1FWTA 4IUOA 5C2XA 5D05A 5U7SA 4NI3A 1KFCA 2ZXQA 1QI4A 2QCDB 4O19A 5SWUA 4MLRA 3BLKA 3PWAA 3GXMA 1H61A 2C19A 2QAFA 1P6WA 4CNNA 2NT1A 1OHLA 3EJTA 3KRUA 1TQVA 3GXPA 4IJBA 2ZZ1A 3E9AA 1R33A 3KVMA 3USBA 2Y24A 5K9CA 1LRQA 3S1VA 4XBSA 1LROA 1J0JA 3GDRA 3AXHA 1BAGA 2XWDA 3GX9A 1G4TA 1QFEA 3HF3A 3LLFA 4AWUA 2CFFA 3S6DA 1EP1A 4OV9A 4YCPA 2WVTA 2WPBA 4UOZA 1KBJA 2QPUA 2BLEA 5EYWA 1K8YA 3W6YA 1PIFA 3K8LA 5K3VA 2J6XA 1EA9C 1H7XA 3KVLA 1KM2A 3B06A 3DC0A 2Z1BA 5CPNA 3KLKA 3QFEA 2X2IA 3L5MA 3LV5A 5CXPA 4NU7A 1VS1A 4CNPA 1PEZA 2EAWA 1LBMA 2ISVA 2B7QA 1S46A 3UWYA 2I14A 1X6UA 1CGUA 4H3DA 4O57A 3FKRA 4JTTA 4ALDA 3DDFA 2RH9A 3GK0A 4WSJA 3PBYA 3IIXA 2VFIA 2V81A 4AB4A 2X16A 1AMKA 3W70A 2DZPA 2C14A 1VYSX 1GT8A 1K8ZA 4BWLC 3CLWA 3VM7A 4UNLA 5KTLA 4LV4A 5I3FA 1J0HA 4UQ9A 1HWWA 3CZLA 5F1UA 3EDEA 3GDTA 2PWEA 1UD2A 1UBSA 5G1TA 2QLYA 3E49A 3EB2A 3R2GA 3VO0A 2V5BA 3WY2A 4DO4A 1X8FA 3VX0A 1JJKA 4K7YA 4O53A 4OWGA 4H8UA 3F4WA 5K4ZA 5HPOA 4N9EA 8CGTA 3VM5A 5F4SA 3GR8A 1MW1A 3OIXA 1SZGA 3GDMA 2C7FA 1ME9A 5D30A 3RMJA 4CVWA 3QYQA 4N9CA 2YW3A 3TAKA 5K2ZA 1GQNA 2WCGA 4XUGA 4IXXA 1WOBA 4HN4A 3C4UA 1WPCA 1G94A 4HNTA 4AMWA 5G4EA 4MLJA 1ICPA 1XBVA 4GE8A 1JI2A 2QCHA 1JCXA 3BC9A 1EPXA 1UH4A 2A0NA 3SI9A 3UQNA 3VGHA 4FF7A 2CHNA 2FGZA 1R2SA 3O63A 2YYTA 4CQ8A 3O1NA 3B03A 5DY3A 1FUYA 1KM0A 3WN6A 4DPPA 3NL5A 4AXKA 3TTYA 3G1VA 1KCKA 3S2CA 3G3MA 3D51A 3HBLA 3FAWA 3NQVA 1QOQA 1OT1A 4YWIA 1V3KA 3FFSA 3OLDA 2YX0A 2QMJA 3LLDA 4KWUA 3MUXA 3QW3A 4TVUA 3STCA 5EBUA 4GI8A 2RKXA 3D50A 4Y96A 1TQTA 4JDBA 3R89A 3HPXA 3LX9A 3PB0A 2FDSA 2Y7EA 1IV8A 1UASA 2NXIA 3GAYA 1H7NA 3QM3A 1GJPA 4JTIA 3DFNA 4UR7A 3LPPA 1BF2A 3M16A 4O10A 1F7BA 2VFDA 2ZUWA 3TV8A 1WAUA 2FH6A 3W2KA 1CW2A 1S5WA 1UD3A 4GC4A 4NZJA 4P61A 4QNWA 3TCEA 1C8VA 3LERA 4UXDA 3P5ZA 4LNYA 2WCSA 1AW1A 4P2VA 3TH6A 3CLMA 2AGKA 2EGZA 5J5RA 1L6SA 2DZWA 2F84A 2P0OA 3A21A 2BXVA 5AOUA 1AW5A 1KBKA 3BLBA 2GVLA 3NQDA 4JTLA 4UTLA 2GJRA 4MAZA 4UTWA 1Q4NX 3M5XA 1IXNA 1LM1A 1JD9A 1BKSA 4LS0A 1IXQA 2NV2A 3CTLA 4UNKA 4ZZ9A 2YR1A 1L6WA 3LCLA 2G95A 1VC4A 1EO7A 5F4WA 1SMDA 4M19A 1RQBA 1NSJA 3PR2A 3GNDA 1OABA 1RQHA 1P4CA 2Y7DA 2YPIA 1VB9A 3W7DA 3ZFHA 2E6AA 4IX2A 1W5MA 2R94A 1QPNA 2WVUA 2CZEA 4KMQA 3TTSA 4UQBA 4IMFA 5DLCA 3QMTA 3DX4A 4UTJA 4FIRA 1F6PA 1VGAA 2DZVA 2BY2A 2TSYA 4N6FA 3II1A 4PL1A 2VUYA 1EWDA 2EKCA 4UZSA 4S2BA 1H7PA 2IGTA 4IMGA 3W1NA 4WOQA 4JTEA 1K3UA 1ADOA 1X1ZA 2XWEA 3F1QA 3I68A 5FEXA 4JTSA 5CGQA 1LOSA 3DHDA 3BAYA 1KXHA 2FHFA 5J5DA 2CLIA 4JN6A 1SSGA 4LT9A 4WOZA 5K7JA 5I3JA 4UQDA 3O15A 2NV1A 2J27A 2YCEA 3KX6A 4NXSA 1KM5A 2NXHA 5KEZA 4FLQA 4JCMA 1DORA 3NQ6A 5C6MA 1H1YA 3NQFA 4OU1A 3LHZA 1ZAJA 3CPUA 2J9ZA 5D2XA 4GINA 2OX1A 2E8YA 1FBAA 4PSRA 3BARA 3SGUA 3EWXA 3DX1A 3LXBA 2QPSA 3WEMA 3IGUA 1JDAA 4LC8A 3PUOA 4DEFA 3ATZA 1R30A 4MZ1A 1BVNP 1PE1A 1OX4A 3HIJA 1FQ0A 3EWWA 3DGRA 2NSXA 1B3OA 1QW8A 2QEZA 4CN1A 3W1MA 2YW4A 3L2IA 3EKZA 3QMRA 3SJ3A 2ZXBA 2G5WA 2G97A 4R7JA 2WV8A 2WO5A 1I2PA 2WKJA 3ZO9A 5E6ZA 3NXFA 4XZ9A 5AHFA 5C5YA 4HPJA 1XH0A 3F03K 1HTIA 4U4MA 1O5XA 1JDDA 1E43A 4GKLA 1THFD 3W1QA 4EIVA 5D33A 2Z1KA 3W2NA 1UKQA 4O13A 3VMNA 3O16A 1MO0A 3IIZA 3QPZA 2FH8A 1DJQA 1BLIA 2QCMA 2DH2A 4NJGA 1QI3A 4FEZA 1ZS2A 3DKJA 3TW7A 3EDKA 2VXNA 1JCLA 1RPXA 4LC6A 1SU5A 1VLWA 3GLCA 3G1SA 3ZQ9A 1TTQA 3EWYA 2VENA 7TIMA 2E5CA 2PRHA 2G3NA 1XBZA 5D2WA 1OB0A 4IPJA 3UWZA 2ZICA 3H53A 2I9EA 1ZAIA 1RPKA 2NUYA 1AW2A 4R34A 2P10A 2WNQA 3FYPA 1UOKA 3UWVA 2YA1A 6TIMA 2OYKA 1Q3NA 1I2OA 5BOOA 2ZX7A 2B0MA 2YJQA 2W79A 2EAEA 3AMLA 4FMVA 3NVTA 2OSYA 3S42A 4XKYA 1HX0A 1XGZA 1CGXA 1XH2A 4E0CA 2WSPA 3L4VA 3I7QA 2Y70A 1EHAA 4J9JA 4XTIA 4AF0B 1PHWA 2GJNA 3WNMA 1JAEA 5FEPA 4GRSA 1LRNA 4JX4A 1DTUA 3FJ6A 3PULA 3HG2A 3LXAA 2WKLA 1OX6A 3MBFA 1WZMA 1F2JA 1U83A 1W5OA 2WVVA 1R2RA 3MW7A 3VNZA 2GVJA 3DH7A 3LTYA 3TSMA 3O07A 4XKYB 3FLUA 5K9XA 1D7FA 1UA3A 2V3FA 3L0NA 3CC1A 3P8JA 1OYCA 1GVFA 1G69A 3QQ1A 1TPDA 5U4NA 1ZJAA 2HS6A 4N4PA 4E2OA 3WFAA 1I45A 1XXXA 3ZOAA 4LUJA 1W5PA 4QISA 2Y5EA 3GIYA 1FCQA 1D3CA 3WNKA 4H6KA 4X2RA 2W6RA 3K8MA 3L9CA 3T55A 3MP5A 1J5TA 1GVOA 2QCFA 3WEOA 1S3HA 3C2OA 2ZZ5A 4J3XA 1EX5A 3PBUA 1C29A 2YIHA 4LY8A 4TIMA 4ZQRA 5LHEA 4O4VA 1PVNA 5TQLA 2FPTA 1TRDA 2QUUA 2AAAA 2D0FA 1SZEA 1DJNA 4ADTA 4HNUA 3TA6A 1TMQA 3W7HA 1CIUA 1XCFA 1Z48A 1QI5A 3DX3A 4GJ1A 1JR1A 1FCUA 1YXYA 2EF9A 1JG9A 2X1TA 5I5RA 4MFDA 3LXCA 4FLOA 5HNRA 4OQVA 4TX9A 1PV8A 2XN0A 1AK5A 3C3NA 3MMTA 1PPIA 3KXQA 4MJMA 3RIKA 3VE7A 1VHCA 3SSJA 4QJ1A 3IIOA 1VYRA 4AW7A 1ME8A 2LLEA 4MB1A 4EF9A 5HUPA 4O15A 2WSQA 4JYDA 2FLIA 2X30A 3LTSA 4N6EA 4PODA 5EL1A 1OK6A 3TOPA 3RK8A 5D32A 4ORMA 1F73A 5DCEA 3EXSA 2DZSA 1ZENA 2CWNA 2ZUUA 3NPVA 1QNVA 3KAOA 5I3KA 1BVZA 2DJLA 2IQTA 3TK7A 2VEMA 4FXSA 3TC6A 3W38A 1FWSA 2EO7A 1M7OA 2QJHA 4GUFA 4R33A 1O94A 4RXGA 2DIEA 4K8HA 3WENA 1GWJA 3TJXA 2VR5A 1YYAA 4IMCA 3W85A 3C56A 5HWJA 3KVKA 3W2JA 2E0PA 5AC7A 4DQWA 3BV4A 2QJIA 1NAL1 1Z41A 3EX4A 3G1FA 4G1KA 4UMAA 1VJIA 4K7VA 4JICA 3SW6A 2QDGA 5TD4A 1VH7A 1BTMA 1BWKA 1CXKA 4UTMA 4Y6GA 3WMSA 2PRMA 3UWUA 2RDTA 1JUKA 4IXHA 1I4NA 5AYYA 5K4XA 3UWWA 1SO5A 3VGEA 1CXLA 1ZJIA 3BUBA 3U6WA 3ZR5A 3DHPA 5FEWA 3TROA 4OKDA 2QMKA 2PRLA 5AHEA 2ZRZA 1FCVA 5LNUA 3G0XA 3KL3A 1XUUA 3G24A 1TTPA 3VKJA 1CGWA 3ZWSA 3N9SA 4JTFA 3HGOA 1ICQA 3MHFA 4Y8FA 1ZHAA 2GQAA 1MEIA 3HB9A 4AEFA 2NX3A 1TYGA 2YOCA 1O5KA 1GG1A 3CZSA 2WANA 1M53A 4J3VA 1WDWA 5IM51 1KM1A 1XFBA 3LRLA 4FNRA 4IQLA 2E5DA 9CGTA 3L4XA 4M8UA 1TREA 4DF2A 5E70A 4K8EA 2F7PA 4XWUA 4Q4KA 3EWUA 3NPUA 3A47A 4K38A 2NLIA 3M6YA 3IJ7A 4R53A 4HIBA 4RXFA 4WY0A 2X2HA 1KV5A 1UB3A 4QAWA 3KRSA 3LOTA 2NZLA 4O0ZA 1JXJA 2TPSA 1U2YA 4O1DA 3W7NA 1WE5A 4W93A 4MY8A 3G3DA 3A22A 1FY6A 4HP5A 4WXYA 4O11A 5CGMA 1G6CA 2E6FA 4J27A 3UZJA 1KFLA 3ZS4A 3S5NA 1D3GA 3BCDA 4XB3A 1SFLA 4GNJA 1UD8A 5G4WA 3W73A 4UFHA 2A7RA 2GJPA 3ECQA 2A21A 2DZUA 2YGYA 4NX5A 5HWNA 4FLRA 4J3SA 4N02A 3RLUA 3EDJA 1QWGA 1GVQA 2ZYFA 1KW1A 1SFJA 3W7QA 2JKPA 4I7VA 2EQDA 3MP4A 3C2FA 1WYIA 2ABBA 3WY1A 3HG4A 4U33A 1KTNA 1TIMA 3MI2A 4JTUA 5HWMA 1C9DA 2FFCA 2ZZ2A 3W72A 1KTBA 3T40A 1H3GA 2BHUA 3BH4A 3IIPA 3M44A 1YTDA 3CWNA 1E40A 1ME7A 3N34A 3ELFA 3UXDA 4I7WA 1W3TA 2XIBA 3W75A 3CQ0A 4FXRA 4BI5A 3LRKA 4NJKA 5TBOA 2G96A 2Y6ZA 2OMAA 4Z1BA 3TE9A 4OGZA 2YA0A 5FF3A 5KMYA 2E4TA 3QEZA 1KV8A 2QJGA 1F6KA 5DCDA 1UD6A 2XN1A 1KBBA 2ZUTA 2YXGA 1OFOA 1TPH1 1HVXA 1K7XA 4BZYA 1WQ5A 3LHTA 1KXVA 4OIFA 5I3IA 2ZUVA 3VE9A 2BY3A 1NF0A 2R8WA 2I1OA 1XD0A 1WX0A 3CPRA 4KFPA 1W54A 3OLGA 2XVLA 3NQ2A 4GXMA 4O1AA 5I24A 3BLPX 2ZRWA 3GXTA 2BHZA 3LCGA 1GCYA 2Y7GA 3NDOA 1I75A 1GEQA 5D2TA 4UFKA 5A2CA 2D73A 1PS3A 1WBHA 2AQWA 4Z0JA 4KKXA 1O60A 3W1PA 3CHVA 3WDJA 3CV5A 4LVDA 3GKFA 2Z6JA 5CGTA 1SW0A 3NZRA 1P0KA 2W0UA 1UCWA 3UCQA 1VFUA 2E8ZA 4WD0A 4UTHA 1PCKA 2NUWA 3S1UA 2FPYA 2YKKA 1QHPA 3TQKA 5HULA 1QPKA 3QGVA 4QITA 1GYNA 1OFDA 1JGIA 1YXCA 2ZBTA 2QDHA 4LS2A 4IPIA 5D37A 5A5WA 3SIZA 2WVSA 1M7PA 3N9RA 1LBLA 4JL2A 4ADUA 2CPUA 3GXNA 2ZA1A 4HOWA 4NQ1A 2GJLA 5EMYA 1DQWA 1ICSA 2HS8A 3QC3A 4WZHA 5FESA 3TQ0A 2V3EA 1OGSA 3VU2A 3NL6A 4YMZA 4CGTA 6ALDA 4OBTA 5AYXA 2Z0IA 1PIIA 3W1RA 5I0DA 1B9BA 1MW0A 2YZRA 3IVSA 3NQAA 4JNMA 1Q6LA 1UA7A 4AWSA 4CLMA 4BFAA 1G4PA 1TV7A 3M1ZA 3P8IA 4DXVA 3W7PA 1PJ9A 2ZRUA 2J9XA 3ABOA 1RV8A 2Y7FA 5DBTA 3TFXA 2H3BA 3VMOA 5E93A 3TMLA 4RR4A 5LSMA 2HSAA 3B0UX 3RILA 4N4QA 3BPWA 1OFBA 3EJSA 3QQ0A 2X1RA 3HGSA 3VI2A 4U3CA 2YSWA 3R12A 1HT6A 3E12A 1E3ZA 3D4YA 1B57A 3W7LA 3GNNA 3JS3A 2C16A 3S5ZA 2A85A 3DX0A 1JXKA 4PCTA 1KLZA 1CGTA 1Z44A 2VFHA 2WPGA 1TPVA 2DZXA 1RQEA 1GJUA 5L9FA 3NNTA 3GDLA 3O06A 1FDYA 4IX0A 1TQWA 5ABTA 4ZMGA 5D09A 1XM3A 3R5EA 1TPFA 4JY8A 3VX1A 5A2AA 3LHUA 1H62A 1UJPA 1ZALA 1EA0A 1GG0A 2XVKA 2ZXAA 4UTUA 2JK2A 4JY9A 5G5IA 3LB0A 4PL2A 4D2JA 1EP2A 4WJEA 4EWND 3C2VA 4HOXA 2ZTJA 2ZZ4A 4HSNA 1OYAA 4JTHA 2ZX6A 4NNBA 4AHPA 2V3DA 3BVVA 1QDSA 1BWLA 3P5YA 2F2HA 3NL3A 5DY2A 1WV2A 3W84A 2F61A 1QPRA 1ZAHA 4C1KA 4JD4A 2NX1A 3ZWTA 1LLWA 3M41A 2E9BA 3W7KA 3QSRA 5HR6A 4GO8A 1TCMA 3LDVA 2J88A 2ZXDA 2ISSA 2NWSA 1TJRA 5FF7A 4HPHA 1HFBA 3CWOX 4GO9A 2PCQA 4ZQNA 1H51A 1MFUA 1YTEA 1JF6A 2HTMA 3M0ZA 3GYEA 3C61A 3L4UA 3SFKA 3BUPA 1PL9A 1A50A 3TW6A 3W1LA 1VLIA 3HGRA 3GB6A 3W7MA 4LPCA 2Y85A 4B9YA 3CT7A 4J3WA 3PBVA 2ZWZA 4WF7A 2Q3RA 1EIXA 3TXZA 3BGJA 4A29A 1U33A 2FHCA 5CZSA 1KFKA 3IIVA 3KOFA 1GJWA 4JL1A 5I3GA 1V5XA 4UTWC 5D04C 4HSOA 3L5LA 1GVSA 4K36A 5CZ0A 1O95A 2ALDA 1K02A 4IOTA 4AVFA 5BMXA 1TPB1 4JTJA 4M5PA 2B7PA 1JIBA 4QSHA 1W3IA 3W1AA 3W71A 1GZGA 4M6QA 3BUQA 3I6RA 4JYFA 5G2HA 3ABRA 1TV8A 3ZSTA 4UQAA 5CKSA 2J24A 4UFIA 3DFTA 3W23A 3KL5A 1K7EA 1F5ZA 2FIQA 2H3DA 1T0OA 1IIGA 4UR8A 3BAJA 3MJYA 3HJEA 1R34A 2PWDA 1LTDA 2YA2A 3KLLA 3P82A 1B2YA 2BSLA 2NWRA 1H60A 2YFOA 3Q2DA 4UUIA 4JX5A 3VCRA 4UMCA 2Z6IA 3T78A 3P7YA 1G7UA 3N3MA 1N55A 3S5OA 3W74A 5E0FA 3MWAA 2C0AA 3NG3A 2CLFA 4A2RA 2WQPA 1QPOA 2PE4A 1QR7A 2PWFA 3M43A 3DXIA 1H5YA 3MI6A 2CLOA 4Y9AA 1PZ3A 2ZDRA 2NXGA 1TV5A 1IXPA 5IBXC 3LCWA 1RZMA 1PHQA 5EMUA 3EDFA 1R2TA 3W7CA 3ZR4A 4ORIA 3C8FA 1D3HA 3OVRA 3QJAA 1PAMA 4JCLA 3GXDA 1L9WA 4UMBA 2ZX9A 1LBFA 2DJXA 4JR5A 1Q6QA 3K30A 1DKWA 1XSIA 4NX0A 4WY0F 3C52A 3LCFA 3DHFA 4GWEA 1GYLA 3L21A 1XCXA 4FNTA 4FNUA 4CNOA 3BCFA 1VCVA 3ABSA 5E9AA 3ZT6A 4HPXA 3DZ1A 1ZJBA 1BSIA 1D9EA 2V0TA 3CTTA 3PUEA 1F05A 1JF5A 2A1YA 5G1YA 3TXVA 5FF4A 4WXZA 5DCBA 5HINA 1JULA 3QZEA 2AAMA 4X0NA 1E3XA 3G1DA 4KFNA 1LCOA 2ZTKA 3KE0A 3IGSA 1VIWA 3GTNA 4JFVA 4QNEA 5T26A 2JBMA 2J25A 4MKNA 2ZX5A 1CGYA 3G8EA 1J2WA 3CZEA 1SO4A 1GOXA 1CXHA 4MVAA 2C13A 1W5QA 4X3ZA 3I7RA 3SZ8A 4O1BA 2AMGA 1G1YA 4MFEA 1OF8A 1TMHA 1P5BA 2ATSA 3A23A 5EKYA 2ZCGA 1IXOA 3INPA 2QKFA 4PCSA 3WJWA 1ODUA 2ZIDA 3NQ8A 4AMAA 1XDLA 1OX4B 5CPLA 2D2OA 4YLWA 1VCGA 1VPXA 4ZQMA 4CCEA 2WVVB 3L0GA 2WSRA 4WUIA 2ZZ7A 2GOUA 3NAVA 2FTPA 5AHIA 6TAAA 3BAXA 4OJYA 2CU0A 1MFVA 4B9ZA 1H7OA 3TKFA 2FHBA 2OCZA 2DZTA 3BW3A 1WZKA 1BG9A 5E6YA 3M07A 3WK3A 3RF9A 3K8KA 3DI0A 1LZOA 4UTTA 2FB3A 3BAKA 3WY3A 5BRQA 3TX9A 1A5BA 3N2MA 2WSKA 3OLEA 1VR6A 2DIJA 1DV7A 2V2HA 1FDZA 3MO7A 3QF0A 2KZHA 4NJIA 1TRIA 2ZA3A 1EO5A 2QCEA 3Q58A 5CPOA 4Z1AA 4JIQA 3UERA 4YXGA 5FI8A 4U2YA 3BUDA 4NUWA 4O4WA 1IZJA 3O8AA 3W3OA 3GXIA 1HL8A 2QAPA 3BW4A 2F1AA 3DU0A 2Q8ZA 3VSVA 3W76A 1MXGA 3W7EA 4UFMA 4Q32A 4B5NA 1GPWA 4FO4A 4I9AA 2QCDA 3WFZA 3WK2A 4O50A 1LOQA 2QCCA 1KWKA 1QCWA 3BLIA 3PC0A 4TO8A 3KVJA 5D02A 3BLFA 3SY5A 3D4ZA 2E1DA 1R46A 1G7VA 2VRQA 2J9YA 3G22A 2F7QA 4AAJA 3L4ZA 4NVTA 3KEHA 4IMEA 4MYAA 3TJLA 2ATMA 5EPDA 2D0GA 1OK4A 1IIHA 1KFBA 4AWTA 2EJ1A 3DAQA 4RCXA 1GVIA 1LP6A 3L68A 3W9ZA 2VFGA 3P67A 3G1YA 3RNDA 2F7RA 5EY5A 3BMWA 3HMJG 3WY4A 1NEYA 2VOMA 4AF0A 2A2IA 1TCDA 2C1HA 4N2YA 4IMDA 3N2XA 1FXPA 4Y90A 2BX7A 2A4AA 2XIIA 1KGXA 3H54A 4AHOA 3OVQA 3C2RA 3PS7A 4PA8A 3QRHA 4LQ1A 4LXFA 4UFLA 1M5WA 1A47A 5DXYA 4DF0A 5AC8A 3UEQA 7TAAA 2E6DA 2OW6A 2PURA 4NJHA 1WBJA 3G1HA 4ADSA 3U2OA 5H91A 4FX7A 2QCNA 5CG7A 4LUIA 2ZZ3A 4NNCA 3LPOA 1ZY9A 3S8HA 3NR0A 2F7OA 1I2RA 3DFOA 3NL2A 3WJZA 4O17A 3GZ3A 4OT7A 3W7JA 1LWJA 2G3MA 5A2BA 3UG4A 1GTHA 3GR7A 3NQMA 1MXSA 4Q33A 2YYUA 3N73A 4JS3A 2Q3OA 1YPFA 4MY9A 1O4UA 5HR7A 3NYZA 1KCLA 3NPWA 3QH2A 1TQSA 3W2UA 3VNYA 1X7FA 2DORA 2E6YA 1Y7VA 2F7FA 3R13A 1YDOA 2X1SA 3EJRA 4W9TA 1K7FA 1TPUA 3IJ8A 3M5ZA 1XSJA 1HNYA 1XKYA 3BVJA 4NT0A 2BXYA 4LWWA 1EEPA 1XSKA 4H8VA 3A24A 2OYLA 1SW7A 4PFMA 1I8JA 1LORA 4TU1A 2C15A 3PAJA 3H55A 4JEQA 3EX6A 1AQMA 1QO2A 3CEUA 3KFTA 3BVXA 4K6AA 3Q94A 3ZR6A 1H1ZA 2OT1A 2WSYA 4BI7A 3V1PA 1KGUA 2XFWA 2JGYA 4YL2A 3EJPA 3LGEA 1LOLA 2VELA 5I3HA 1MVYA 3DDGA 4OHQA 3HG3A 4X9SA 2A7NA 3A6OA 5D2YA 2CZFA 1I2NA 1W3NA 3EX2A 5HMSA 3M5YA 1A5SA 4CKQA 1OFQA 3NQGA 3L65A 3T44A 1W0MA 4HHPA 3C6CA 3UPBA 3FKKA 3UG5A 3PSVA 3V75A 5DXXA 5LNVA 2VNCA 5HDRA 1L0PA 3L0KA 1SMAA 4JFSA 3B4UA 1KLYA 4XTDA 1JUBA 4AIEA 3NPXA 4UCGA 3B0VC 1UUOA 3DFQA 1QOPA 4GI6A 2F1BA 3WNPA 3BG9A 1CI1A 4H8HA 5HQEA 2A6LA 1CX9A 3L2LA 2VFEA 3DKLA 1WO2A 2V8ZA 3QW4B 4O16A 4A21A 3B05A 3QPYA 5DN1A 1MXDA 1EWEA 1TPC1 3W07A 3BG5A 1JCNA 1JRCA 3S1WA 3PM6A 2Y63A 2OSXA 1CLVA 3LI0A 3NA8A 3W2MA 4UTIA 5BW6A 4HKPA 3DFPA 4LRTA 3EXTA 3OEXA 1CYGA 2F18A 4GUIA 4FNSA 4O28A 3BVTA 1DVJA 4DPQA 1QWUA 2ZUSA 2H8ZA 1BPLB 4O0KA 3GBEA 3S1XA 1UKTA 2GPTA 3W86A 1A53A 4U28A 5HXMA 1GTEA 4H2CA 5AHNA 5D03A 1Y0EA 4LVBA 4U2ZA 3DFSA 4H4IA 1SW3A 5AYZA 4E38A 2VEKA 2ZRVA 3G1AA 4O1CA 3PBWA 4RKAA 5FF0A 1HTYA 4MZYA 3WJSA 3TIMA 2TRSA 1YDNA 3N19B 4AYGA 4KWVA 3W7OA 2X2JA 1FDJA 1XBYA 4RZ6A 5C54A 6CGTA 2VT0A 1OX5A 1FWWA 4J28A 3OVPA 3KRZA 3CB8A 3O6DA 4JGDA 4M56A 3DI1A 4QAIA 1S5VA 5AN7A 2JKEA 2TMDA 3E0IA 2BY0A 2ZA2A 1FX6A 4CCDA 4NXKA 1Q45A 4UTKA 3TSBA 1NVMA 5LNSA 4FNPA 3WELA 4RK8A 3ABQA 3LTPA 1YDVA 4O12A 3T4CA 1G5AA 4LW7A 1OFRA 2QF7A 3HOJA 4M7SA 5CLTA 7CGTA 2BTMA 5D38A 3P84A 3W7IA 2QCGA 3GAKA 2ZE0A 3UY8A 1CXIA 4UCFA 4RJEA 1A5AA 4EF8A 5BRBA 2EPHA 2RFGA 1U5JA 2EEXA 3A5FA 5C55A 5DELA 3FYOA 1KFJA 2X2GA 3BG3A 2WJZA 3EX3A 3L4WA 1VYPX 3W87A 4AMXA 4OV4A 2QCLA 4CCCA 5KITA 1TJPA 4XBKA 2Y89A 3U8GA 3TMQA 1AL7A 3S9YA 5F1VA 1TSIA 2JGQA 3LHWA 3AJXA 5FEZA 3THAA 1W9XA 1EP3A 3FJLA 1DL3A 4FNQA 1KM6A 3IEBA 4BI6A 4PH6A 3AJ7A 2R14A 1OFEA 4FIQA 4DBDA 3FEMA 1JL8A 1XH1A 3WNLA 3OHIA 3E96A 1XV8A 2D3NA 2GQ9A 3ZT5A 2OW7A 1OG0A 2RDWA 4AIOA 3WDIA
chains in the Genus database with same CATH superfamily
3QS3A 2VWEC 2CRYA 4ZZFA 1OYBA 1CF8L 2VO5A 1FWNA 1HO4A 3LD5A 5GNYA 4J3OH 3TDFA 1N8ZB 2K45A 3L3KB 1KGWA 2ZQ0A 2NX9A 1EAJA 4MUPA 2C9UA 4B3ZA 3OGCA 4EDWL 5ETUB 2C3HA 3BZEA 1NDYA 3W9DA 1A64A 3VWKA 1PZ5B 3N3EA 2XPYA 3OZLA 5DRZB 1Z9MA 3S4SG 3SZKC 5AAWA 2C4FU 5BPPA 1FP9A 5GGRB 1I3GH 3SQOH 3UJSA 1PKQA 1HILA 1OCWH 2I85A 3T8MA 1RBAA 4B5NA 2ZWYA 5F2GA 1U8IA 3QXDB 1XIHA 2H9AB 3BWZA 3FA5A 2J5LC 4GQQA 4PJAA 2VDPB 3T4AB 2QPFA 3JVFC 4F8LA 5C0AB 3CSYB 1V7ML 1V3JA 4EI5C 5FO9B 4L8CA 1N82A 4W9KC 3ALFA 3UC0H 1MELA 2IWKA 1PKLA 5L8KB 1KM4A 4DLMA 2YXXA 2Z4TA 4TLSA 4FQ1L 4XMLL 5F7EL 1XUZA 4CDGC 4O4YL 1UOLA 1QO3A 2HFFB 4WFHE 1N6VA 1U0QA 1I7UB 5T1MB 2GJXA 1IEWA 4BIKA 3X14A 4NIKB 1RWFA 1O4UA 3WLOA 1RAKA 5CSRA 2NNCA 4N25A 3S36L 1MEXH 4NZRL 1LLZA 4IHCA 1AGEB 5DC0A 5EMKA 3YPIA 4Y9NA 3QJXA 2Y22A 4D6CA 4LCCA 2BW5A 3BQUB 1B0IA 1YC7A 1P9MC 2X38A 2EYRB 3OR7B 4KGJA 4BZ1A 1SXZA 5KSAB 4RDBA 4HA0A 3SCNA 3Q9QA 1J5DA 2P5WD 2Y2WA 3ESNA 4Q4RA 4DJFA 1J2BA 4FD0A 3LEXA 4FQXD 3NTCL 1DCEA 3OZPA 2BOLA 2VUOA 4M7TA 5L6UA 4KTEH 1KBLA 1HGYA 3JTTA 3Q5OA 1DQXA 3WEXB 5AW5B 2QR0B 4HB7A 4KX7A 2B1HH 3ZL4L 1EZVX 9XIMA 3I9IA 3UJFA 1ZB5A 1N6UA 4M8RA 4QHUB 1T6VN 4XO3A 3N4EA 3UA4A 1YMMD 1IM3D 4GUCA 4N2LA 1WP6A 4PBXA 1HP5A 4PGBA 1N7QA 4CNIA 3CEPA 3VFWB 1BD0A 3CL8A 1NP2A 4NNAA 4NJ9H 5IB5B 1X6LA 5L8LB 5B39G 4FULA 3D52A 5FAAA 3B40A 4HG4K 4H4NA 5DZPA 1G7PA 2R4RH 1PDKA 3SR7A 2NW2A 2NY2B 2EABA 5KSAA 2EH8L 1SO6A 3K2MC 3OAZH 3IGXA 1UT2A 5EIIB 4TV5A 1D9KB 5GS0L 3LG3A 4PJ9A 2W5FA 5C08B 2BY1A 4MS8D 5JTWA 4KXZI 5FKYA 3RU6A 4FTDA 1XCWA 4FQHB 3UJRA 1A3RL 3PHSA 5I0YA 5LGXA 2QYGA 1UR8A 4LESA 1A0DA 4O02B 4H2AA 3P4OA 4R5TA 1DLHB 4NEHB 1IE7C 1OY0A 2CCVA 3L7EA 3QQ3B 1W9VA 5EULV 2FQIA 4H8PA 2F54E 1Q6OA 4YBQD 3AO0A 4ZQPA 2NNAB 4DKTA 1SF3A 2XFYA 4Z7WE 4X2PA 5KSBB 2JKSA 1IBHA 4WUUE 5EPDA 5JW3L 3TEUA 1OJMA 3APCA 3GSUB 5CP7A 4ZDHB 4DSYA 4ZNEE 4IIQB 2YDRA 4LLAA 5L4MA 1YSOA 3FXYA 3ELQA 2K7QA 1IE4A 2BNRB 3C08L 4U3SA 4WK0B 4LSSH 1G67A 4C6BA 2CGYA 4XMXA 3BPLC 4MJIB 3ZJAA 4UDTB 3S5LB 4GUHA 2ZTBA 3UVIA 3GK8L 3CM4A 3GBMH 3NZPA 1JWMB 5CZKA 3CIWA 3NK4A 4KTDH 3O6MH 3G0UA 1RVFH 2NZ1A 4ZUUB 3UMNA 3UJ2A 4KWWA 3DXAB 1Z42A 3VXSD 4ZVJA 1CDCA 2WXMA 2M8XA 1U8MA 1HE8A 1VA9A 2EDJA 4WK2B 3NM1A 2PO6D 3H3PL 4HUUA 3IMWA 1QNPA 3EDDA 5LJYH 4N2MA 5BZWB 4EIZC 1K5NB 4E4UA 5F0JB 4YDIH 2JV6A 3ESUF 5F0PB 3EOEA 1FG2B 4HGKC 2Z1WA 4KRLB 1KTCA 1EH9A 3GMRB 4PWFA 1ZRQA 4XOCA 1FL3A 4YL4A 2FNBA 4KGLA 3SKNB 2VERN 3OG3A 4YVVA 4QRFA 5BOEA 1WTGT 4PBFA 4JTRA 3EFFA 5G4HC 4W9ZA 4QXGL 3W0WE 5GS2D 4BH7A 2V2DA 3KJ6L 3MO1A 1QZNA 4NO3A 5SWSB 4R4ND 1E70M 4QPEA 4X5LA 5HHME 2IUZA 2E7DA 4BGDA 4EAYA 3B9KD 5E5RB 2CJTA 4PJDB 5C70A 4ZCWA 5FF6B 1GOKA 1P4BL 3LD8B 2CZVA 4ZOBA 2PGRA 4ZL1A 3CZFB 3BP7A 4KKPA 2XTSA 1SOSA 2K8QA 3LZQA 4FQLH 3IVUA 1A1MA 1RXLA 2CJSA 4L8DB 3T3PE 4H19A 1W17A 4R83A 3QQXA 2VVNA 1GC1C 5IROA 3LUTA 4D6IA 1ALDA 3BAWA 2DWDB 5E94A 3EYVA 2YDSA 3R7MA 1PLGL 1VFOA 3LKQB 3S34H 3Q6FA 4MNKA 5JHLH 5CG0A 1Q5MA 1FWRA 3FQRA 3AU6A 1FE8L 1L9PA 1IFRA 4HT1L 3SDXA 1U91B 3V5KA 2YQ3A 3MJ9A 4HJGA 1I1XA 3B8UA 4M6PA 1HK6A 1J5OL 3PG9A 4A2EA 3BJTA 4G9DB 3QIBB 4KBPA 1NFBA 3G77A 4XMLH 3UAAA 4Q0XH 1F76A 4D6HA 3JWOC 1UZ4A 3ACTA 1MUWA 3EEGA 2R2CA 4DJMA 5F2LA 2ZUQC 3T0EB 1LWHA 4FI7A 2EG6A 4FX8A 3NJ3A 1BZ7B 3ARFB 4W9EC 3L4TA 5KBKA 4W89A 1KIPA 3NQCA 5H8DA 3K4ZA 4JTKA 2IOIA 5LIKX 1AGCA 4C54A 1BM7A 4L9DA 4JX4A 3P9LB 3MYJB 5C0AD 3OX8B 4AYSA 3S8FB 1SQ2N 2X1UA 3RX7A 2HUEA 4XBEH 3HJZA 4HWZA 1FL5A 2E9JA 5EOQL 3G6MA 3W7XA 3QDGA 3STGA 5JW4R 1SNZA 2IWGA 4KMTL 3ARYA 1TJIL 4AHQA 4ZFZB 4LSUH 1WXJA 5BQ7B 5EEXA 3B8DA 4Q8UA 1WA2X 4AX3A 3EXRA 3LV6A 1O5RA 4Z7VE 3DHMA 4OV5A 1EHLH 1GAFH 4JFDE 2G75A 4HVXA 4LYRA 3IJEB 3WV0A 1G9HA 5DC4B 3VFMB 3KCOA 1HEJC 5LCVL 4IGHA 1S7XA 3GD1C 5A6TC 3W22A 3KJ4B 3N44F 3W1XA 3H9HB 3LZPA 3BH8A 2GFBA 5C07A 3B5GA 3QRLA 4N5UA 3L5AA 4XI5C 4X6DE 4JZJC 3JRKA 3VNDA 4JRYE 4M03A 2INFA 3CLFH 4K94H 3UBXI 1PUDA 1DQJA 2UY7A 2C71A 3SKMB 1RKYA 1M9HA 3E6HA 3KBMA 4S1SH 1UA6L 3E8UH 3EYOB 3R06B 3VWJB 1C16B 2BFVH 3IS1X 4W6YB 1RW9A 2PZ0A 3U3HA 3S9ZA 2AS5M 5IGXL 1E5AA 2IMRA 2IAND 3SZ6A 4H88L 4A7TA 3O6YX 2NT0A 3P80A 2AK4D 4C6LA 5AVVB 2BP8B 1EDYA 4L8BB 4JDYA 3QV7A 3BESR 1HL2A 1JZ4A 3W6LA 1O75A 4ESKA 1CFBA 5JXED 3AMKA 2ADFL 3GSXA 3PWNB 4M62L 5C0BD 4R4BA 2YLKA 1UMYA 2CETA 5BMWA 1AC0A 1I9IL 5E6IC 1U22A 5JU6A 1TU2A 1K72A 2APTA 4HNVA 3WD5H 3EX1A 5D72H 4PTUB 3WDRA 3G8RA 4FTVB 5FYJE 4JY5L 3FQUA 4KKBC 2H6PA 3HMXL 1PB0A 3ZZ1A 1NF7A 3FOKA 4FABH 3TS8A 3VC5A 5KZMA 4Q6YA 5TE7L 1AXSA 4K3GA 4UTBA 1QPQA 4NKMA 1DR9A 2V82A 4P3WA 4ZNCD 2J5WA 4XZ9A 5AKQA 3VFOB 1CGSL 3RXZA 4N26A 2QDDA 1TWSA 1IU1A 4CW1B 1U8LB 3CZ8A 2TAAA 5E0KA 4DY1A 5D6CB 2FJKA 1YPZA 2CFKA 1JFHA 4QUOA 4FHKA 1Q6RA 3TN0B 1N7KA 2AZUA 3DRQA 5MHBA 1W8OA 2D31A 1U30A 3QUXD 1FAIH 4PJ7E 4MYXA 3BN9C 1HAUA 5I1JL 3GBDA 4F0MA 1L9SA 3NEVA 5FJPA 4WI0A 4NAEB 2WTOA 2CWVA 1BM3L 3TYEA 3OAYH 1B0GB 3S48A 2NY0D 3MQIA 4NKOA 1US3A 5IFHL 3FQ2A 1XGRA 5HOSA 4RPQA 1R5IA 5F1IB 1Y6MR 4P2OB 4YSAA 3N41B 4XQ6A 4WHTB 4B0MM 4QIUA 5E2VL 4UIOA 2WZAA 4S2SB 5A6BD 3QY8A 1AL8A 2Z8RA 4B41A 1W3KA 2EPLX 4PJ5E 2XKUA 1W80A 2CRMA 3AIBA 3DIFB 1ZVYA 1N7RA 1IM3A 4YPGA 4OIAA 3KS0J 3SO5A 5HGDB 1KDIA 2K3HA 3MA9L 3MYPA 1TJHH 4QTGA 3KVQA 2YD1A 3OKOB 2W88A 3E2HB 3TM6A 3VQLA 1D8CA 3IJQA 4ZBJA 2JVUA 4YSEA 1GEHA 3LBCA 2X5PA 3MLXL 1NM9A 3GU9A 1DEDA 1Q1JL 1V4YA 4K37A 2DQIH 2XU9A 5DR5L 3O6FB 5FYJD 3P81A 5KTEL 4JHZA 1NC4A 3ZHNA 1GYAA 4HK3N 4K8RC 3MUCA 1YVLA 3U57A 5AB3A 1ITBB 1QBBA 4GQBA 3MRLA 3SECA 1UR9A 3UA3A 2P8BA 3E02A 3WKNA 2Q8LA 4L4LA 1JK8A 2WGXA 5T3XL 5M3WA 1KY7A 4Z3EA 4JXCA 3S4TA 3ZIZA 1ULVA 3N14A 5DS2A 3MHUA 4ZG1A 5CJQL 2QGHA 1MFDL 2R51A 3PGBA 1W1B1 1JXGA 5L7XL 2AJYL 4EE9A 2VOTA 1XIDA 3IPBA 3K2KA 2F9BT 4FR6A 4P4KB 4OZIA 2WHVA 2E7BA 2PFHA 4JTAA 2Y9RT 2W27A 4QISA 2VUNA 3EMZA 2CLKA 2XFFA 1IR1A 1O7DC 4JFTA 4G7FA 2A7PA 1ZLSH 3TJEH 5LNUA 4Q4EA 1EDQA 2IPFA 1FVEB 3WKQA 3TAOA 1SLWA 1IAIL 1U8MB 3QR3A 1OL0A 5F7UA 4HJSA 3AQXA 3W2LA 1RA5A 4NBYB 2Y61A 1AGBA 4FHAA 4X5RA 4U6HA 4UMSA 5FOOA 4YIQB 3PZNA 1RIUH 4Q6IA 3CT2A 2EACA 3LZ3A 5FS5A 4LS1A 1PCSA 1OGPA 5F6HJ 3IFOB 4PMYA 3QEHB 4HK0A 2YPLB 3N13A 1OAKL 3V79C 4TYUA 1MI5B 3VSUA 3EKLA 4PRHE 4FJZA 3S88H 1VQTA 4B5WA 2DUXA 1MAML 1U58B 2ADGB 5TH2B 4TRPL 4ZMWA 3BAIA 1XHGA 1OQXA 3WE6B 2Q8AL 5CSZB 3ZMNA 1ITQA 1KFWA 5CJBA 2VRAA 2OZ0A 2OJPA 5BO1L 3ITOA 1OW0A 3HG5A 1UUMA 1KO0A 3QGKC 3TU9A 3P61A 3NG5A 4XX1G 4UTTC 2VDOL 3OKNA 4HJTA 2LU7A 3DX2A 3UBXA 3DX6A 2RD0A 4XNUL 3ZZQA 3QTGA 4KY1H 5KSAC 4N0UB 1CL7L 2JCCB 3AQZA 3QPQD 3MBDA 8TIMA 4PEEA 4YHPB 1SPUA 2VR2A 2MNRA 5FAGA 3S1GA 3EWBX 4PJ7F 5KW9H 2YDAA 4GH7B 4NJJA 2YSSB 1WSST 5C3IA 2CZ5A 4M9OA 5CJNA 2Q2LA 5FYJH 3NPSB 5GIRB 4WUUD 4G7QB 2E7FA 2OSWA 4XZHA 3VG9C 4HKXB 1JRQA 2Y5TA 4DI9A 2X88A 4ATWA 5EU5A 1K70A 3C2EA 3IJYB 4Y2DA 2Y0FA 3FIGA 3RX5A 1CGSH 4LHQB 1KLGB 1T1XA 4MJ6A 3V0FA 3LQGA 5AHMA 3UZVA 2FYVA 4LFHG 1WAWA 3VFSB 2DSWA 4HK5A 4O2EB 5AECA 2Y36L 3R0NA 3A4AA 5FYKH 2PR4L 4QRRA 4IS6A 3CH1A 2XG4A 5GGTH 4MJZA 1WA0X 2VXUH 5CFAA 1AYRA 1A7NL 4G6CA 3GJEA 3BYYA 4PB0L 4WQOA 1EC7A 4CQAA 3PPSA 4N2IA 2EYRA 2VHLA 3PDOA 4U1GC 4Z0BH 3CLEH 5AOIA 4JIHA 4HD5A 1XPGA 3UZQB 3VSMA 3ZXWA 2JKRM 3FC8A 1YX1A 5DI8B 5J8LA 3WK0A 2O26U 1GKRA 1A3LL 4YJZL 4LHUB 1QO5A 4LVNB 4YBLC 3QSKB 4K35A 2CLMA 2DDQH 2R9RA 1MN4A 3X42A 5C86A 1J8HA 3U7VA 4XO8A 2DUAA 4W8AA 3V0UA 1RUQH 4G59C 1RUAL 4J1UA 3BVWA 1NIDA 3RVTD 4DIXA 1TELA 3KGSA 4ZXBD 5HVGB 2QV2A 4IRZA 2OOFA 3MP3A 5IR1B 4YK4C 3TIEB 4WY0B 2DWTA 2HWGA 3C0JA 5HBBA 4WWNA 4ODWB 3RFRA 3BPNC 3CU2A 1LO5B 5A8QA 1I4FB 3P0VL 2OX4A 3CMFA 3M9YA 2D2CC 1P1ZB 3LY6A 2V2TB 2OXNA 3MLWL 2PDNA 1SOXA 4RGNE 1WAAE 4APXA 5DJ0B 3TWCL 3N2OA 2C8NA 1QEWA 3FQWA 1OM3H 3ZMRA 2E3ZA 3THUA 4F8PA 3R6IA 3VIMA 4OM0L 3N43B 2HVMA 3AB0B 2ARJB 4PJDE 1PZSA 3AG4B 1C9WA 4AD2A 1JDEA 5I1LB 5EUOF 2TSAA 5I1CL 4ICNA 2MHAB 3W88A 2VC2H 5CCGE 5EEYA 4XE5B 3Q6GL 2VDRH 1KCZA 2EVIA 4MZ8A 4YSDA 3VGBA 3RVUD 4NLAA 3AXXA 2VLLB 3WFDL 3DNKA 1K4GA 4KJYA 1NJ9A 3TN3A 4CQ9A 1E65A 1HZLA 4J3UA 2O5YL 1TZ9A 3O2DL 5T9CE 4N3TA 1BEYL 1OWWA 5B1CA 1OK0A 3VRJB 3RDJA 1E50A 4FG4A 3QSTA 4ZTOH 4CN6A 3Q8BA 5EO9A 1DVSA 2FSDA 3QH3A 3LIZA 3PPEA 4GOSA 5FYKD 3WNJA 1PBGA 1EZLA 4HUMB 4ZSOA 3U9UB 4AQLA 4POCA 3NQ7A 3R0KA 3CVIH 2DQCL 1WGOA 1YC8A 1YNLH 1U8OA 2MOQA 1TO4A 1TZHA 1FTXA 2ZRXA 2OZ4L 4JNXA 2OYMA 4GI9A 4JKKA 1AXSB 4HISA 4PRRA 5ABDE 3WTTA 4IUOA 4LGSB 4WEEA 1ESOA 2ZOLB 1KFCA 2DLEA 1T03H 3I9AA 3Q13A 4NWUH 3HFTA 4R5EA 5SWUA 5JR1H 1N5AA 1Z5YD 2Y6TE 3NFPB 4JFQB 4DQOL 2C19A 3PWAA 4N9GA 4MLRA 1P6WA 3CN2A 6XIMA 1V54B 1AZZC 1WMNA 3CH9A 3CDCA 1VD6A 2DBLH 2PBOA 3CN0A 2QDEA 1TQVA 2UZIL 4BK8A 2H45A 1R33A 2IPUG 4HIJA 4ICMA 4L8DA 2IS7A 2YKLL 3KPSB 1XFPA 1LROA 1J0JA 1ODZA 2WQRA 4TNGA 4PY7B 3AXHA 5GIRA 1J8SA 5DFVC 1WS7A 3V8CA 4IBZA 4DGVH 3ES8A 5HNNA 4OD1H 2ANUA 3T0WA 3A67H 4AWUA 1I3RB 1EP1A 3LEXB 3Q8CA 4R85A 1IBBA 3QW9A 4OV9A 4YCPA 2OR8A 1FGVH 1A6UH 1FH7A 3PLYA 2QPUA 2CFWA 5EYWA 5F89B 1I8LA 3VFSA 1HL4A 3NEEA 5IBLD 2PMQA 5DSCA 4N8CL 5C8JB 2BSRB 3A4DA 2HTLD 3BWAB 4JFXB 4NN6B 4PBGA 1EA9C 1RZIA 3QG6A 4LRIC 1IJ9A 4YN3A 1RY0A 3CV2A 3D2UA 4HKBA 2REQB 2IDCA 2J1YA 1G1CA 3KVLA 1OP5K 1IT9L 1D2PA 1KEML 4U1SB 1YBQB 4GY4A 5FKAB 3DC0A 5GS3A 1H0IA 4JG0H 1P1MA 3KLKA 1TTCA 1P7QB 4XISA 5EU3A 1ZL1A 4PRPD 3L5MA 2JJSC 3F5LA 1QUMA 1Y8BA 2CQTA 4ELDA 5AAMC 2WM1A 2EYSB 3GSOA 3F01A 2EH7L 3QNFA 1VFFA 1RCYA 4TUKH 2ICWA 3Q2WA 1TE1A 3V4PH 1NICA 2F6AA 3CZUB 3L17A 2J21A 2K6YA 3PABB 5AWNL 3OZ9H 5HDBE 5MEPA 1F3WA 1BREA 1S46A 4ATDA 3RUGE 3JV6A 3UWYA 1YNPA 3BPCB 2FJFA 5CZXD 4P5MA 4NCDA 4TSBL 5I16A 1BFNA 1X6UA 3FKRA 8RUCA 2CZNA 4IRSB 5MHSE 4RMBA 3GK0A 5TFSL 3ZRSA 3H4HA 2ICES 3IIXA 1ED3B 5HHOD 2VFIA 5DGQA 4LU5L 2V81A 4R4FL 4FKKA 2CIIB 2HFEA 4HZ6A 2DMHA 1KB5L 1AMKA 3VDBA 3QN3A 3W70A 4CD5A 5IF0B 2DZPA 1M2VB 1MFBH 4GBXA 2K8MA 1K8ZA 1SEQL 2G3XA 1E15A 4IP4A 5SWZD 2ZYSA 4GD0A 4MDJA 1J0HA 3KNBA 1T0MB 1A49A 1M4KA 2RFXB 4Y1TA 2I9LA 2K9FB 1XFCA 1YW1A 4Y7MA 3E2RA 2EE2A 3GDTA 4OFYA 1U8JB 3GC3A 3EB3A 4I0KA 3E49A 1JPDX 5CGYC 1DBJH 4OLUL 4AV5A 3VNKA 1TU2B 1X8FA 3GG8A 3QJUB 4O53A 4OZOA 4OWGA 5FB8A 2NTSP 2V5TA 5HGBA 3F4WA 3G6AB 3QE5A 5K4ZA 4RIRA 1E9IA 4BFJA 5KVEL 4FYTA 3ARXA 4XGZB 3CAWA 5F4SA 2J66A 2F6XA 2IMMA 4G8GE 3Q6GH 5AEAA 3KYOA 5GISL 3RWJA 4PJXE 5CBJA 3LZRA 1DJGA 2WWMD 2PXYD 2FT6A 5DHYA 1IQYA 1ZLWH 1WCBB 1RUKH 3SE8H 1UZDA 1R19A 5DUPH 3K7UA 5CJ5A 4QHLB 3HR5A 3WG7B 4J6RL 1CENA 3FMGH 4JE0A 3RMJA 1XGUA 1AZNA 4L3FA 5CILL 4CVWA 4N9CA 2Z92A 3OWEA 2JCCF 3IYLW 3RLHA 1GGCH 3TAKA 4YNGA 3LAFA 3D25B 4FE9A 4OQTA 3ECBB 4N5ED 1P0EA 1WPCA 4UYQA 2VQ4A 4ODSH 2V6AA 4HNTA 3Q2CA 3CQIA 4OCSH 4MLJA 4PVMA 5ILTH 1XLGA 3PWUA 1YNLL 1XBVA 4PMXA 4ZUVB 4GG6B 3VXNB 4NKOB 1DE6A 4ZQKA 1M7DB 3B9KB 3W56A 5AVSB 3D0AA 1UH4A 2OMVA 2DB8A 2Q86B 3LSOB 2CHNA 3O6FC 4M5YH 2FGZA 2R56L 4MA3A 5EV7A 4Z0XA 5KBDA 2YYTA 3K5XA 3SFWA 5DY3A 4XI5D 3GGWB 1Z9OA 1FORH 3AREA 4C55A 2JCWA 1CR9L 1P0BA 1LILA 4K7FA 3NL5A 1XP3A 4JHAH 4PRNB 2R23A 1KCKA 4HIJB 3QWOA 1NELA 3PAUA 1V3KA 1N68A 1TZOA 3OLDA 1JEZA 2CHOA 3F4VA 1DXFA 3FFSA 2H7WA 3ALPA 4ASTA 4NSBA 1PGRB 4OH2A 4K3AA 4XNYH 3OYZA 4QE1A 4WDXA 4ZMOA 4U10A 3QYSA 2DY2A 1CDHA 2AI0H 2IANB 2VGFA 2HVKA 4XPAL 3U9PL 1HYSD 5DHVA 2QJJA 2WJ5A 4QXUH 3K91A 3LYEA 5EF1A 3LKRA 1RZGB 2DQIL 3VVVA 1AD1A 1NBYB 3H4GA 1AHMA 4JIIX 3CQPA 2CFDA 4U3AA 5DS8B 4JRFA 4OZFB 2NCMA 4NAMA 3VI4F 4L3EA 4JQIL 2NMSA 2ERJB 1ZBVA 2V5JA 4ICXA 5B7ZA 5FO7A 3LPPA 3UYPB 1RI8A 4J2PA 4F0SA 5G4MA 1WWCA 5CMAA 3TN0C 3L7RA 3M16A 4O10A 5JMUA 2VFDA 3TV8A 3HI6L 1IT9H 2P1YA 3E6FB 4FHJA 3VAEA 1WAUA 2Z27A 3WUGA 2PCEA 1AD0B 3TCEA 4P61A 3SQSA 2JELH 3TBCA 1AZ1A 3F7QA 4DVRL 3KOWA 2XWTA 5E9NA 1NDWA 3MV8D 1KT2B 3U4EB 3WQDA 5EH1A 1UIPA 1BVKA 1IAKB 1XZWA 1UCBH 3KCPA 5EZJB 1RUML 3BN9D 5E0CA 3WTYA 1QSFE 3CLMA 2GJJA 2ZVRA 3Q1EA 2JJVA 4XOBA 2EGZA 3MDWA 2DQWA 4ZX5A 4ZR8A 1X5GA 4RDQG 43C9A 3C6LC 5TDPA 3RAJL 1N7PA 1P7TB 7FABH 1VF8A 2F84A 1MRCH 1P7HL 1UQYA 2P0OA 1KJ3L 2V2XB 2JE8A 5I1LA 1BYOA 2BXVA 5AOUA 1R0MA 1JN6B 1UM5L 2A1WL 2EKJA 2DZEA 3HS0C 5IQLA 1AOHA 4AOFA 5JPMC 3W7WA 4JX6A 2BJML 5IF0A 3WQ6A 4GKSB 2N01B 3BLBA 2GVLA 2DN7A 4NQVA 3NQDA 4GPNA 3W29A 4LRIA 4HMDA 5HYJD 2PLJA 2Z4GA 3M5XA 3OYXA 1LM1A 4PCYA 3RPIB 1ETZB 4F58H 3EMCA 3KNBB 4ZZ9A 3MXVH 2Q3AA 3U1SL 5T3XE 5CD5C 1Q65A 3FQYA 1EO7A 1X5LA 3GTFA 4GYJA 2CHZA 3HNVH 4PGLA 3WS6A 1KULA 2CKRA 5AZUA 1H8SA 2YMXH 1RQBA 2PLKA 1RQHA 3DRTA 2YPIA 3AMDA 4D71A 2UYLB 5TDOA 4A68A 4AZ8B 2E6AA 3Q45A 4E5XB 4ZS6C 3B7RL 1HEZB 2WVUA 4MNGB 2I7GA 4KMQA 4MF4A 2VDPL 1VBRA 3QFJA 3F2CA 3RYMA 1TQBB 3D6NA 3KYMB 4P8WA 4PCPA 2DZVA 1YEKH 3E0GA 4IU2B 2VLJB 3AZUA 5EU9A 1EAPB 4QY8B 4DJFC 4EIUA 2H32H 3AT8A 1EWDA 4S2BA 4I9XA 3AHTA 3QUZC 4KKLC 3E5PA 3KWSA 2X1QA 3BWUC 4IMGA 4WOQA 3DV4A 4F9DA 5IHLB 4C6EA 5E2TH 3TN0D 1RZKL 5KOMC 3C2AL 1PVHA 4IPNB 3BAYA 3GUGA 4RGNB 4NZ3A 2EE9A 2FHFA 3QDAA 2QVNA 4HUCA 2EC9U 3F00A 4N0FB 4LT9A 3QUML 1NMBL 4OZGB 3BHBB 4WOZA 1JPGA 2DPKA 2LAAA 4UQDA 4YHYB 1ZLEA 4BELD 5IJCC 3KW3A 4N0YL 1FH9A 3T07A 4NGHL 1LK3L 3TBYA 3I02B 4Z23A 2NXHA 4INFA 1SM9A 2VN7A 2D7TL 3MLRH 4J2QA 3NIGE 1P4IH 4H0IA 4XWGH 4QEGA 4Q9RH 2DEWX 4O1EA 2VO8A 4PWEA 4GINA 4RMQA 5D2XA 2X3AA 5CU5A 2YGOA 5CC5A 4HPGA 1JV5B 4PSRA 3SPCA 1D7DA 3JWDL 3ROOA 3SGUA 3LNIA 2Y25A 5BVJB 3WEMA 4MWFA 4LC8A 3PL6D 5A1AA 2EDEA 3CUGA 4DEFA 3SB3A 3WXVL 3ATZA 1LE5B 4TNVK 3QG7L 3FV9A 4B4HA 5IBUB 2I5GA 5GRZA 2AL2A 4AHOA 2H5UA 1BVNP 3HIJA 5F7NC 5KVGE 1FQ0A 1QSED 1CFTB 2AQ1A 1XWYA 3KYAA 4F3FB 5GS2H 2QEZA 4CN1A 3W1MA 2IQ0A 3IUDA 1MLBB 3OQEA 3EKZA 3N0PB 3EYPA 5KAQG 5DHVH 4HBQA 4OVXA 5EA0L 3MFGB 3L5JA 1ONXA 1OAZH 2WW2A 4LANA 5AVZB 2VW6A 2DW5A 4LOEA 4OFYD 5E6ZA 1PMYA 4ZAKD 5JHLL 2WKJA 2AQ3A 2X4QA 4LL4A 2OZNA 3ANUA 1AANA 5AHFA 2Z4QA 2KL6A 4M1RA 1HTIA 4U4MA 1CN4A 1CDIA 1JDDA 4P5TA 1QBMH 2IQDA 3QXWA 5CLYA 4KQ4H 3MJ7B 4GRWE 4OLYH 3W2NA 1VADA 5EZLB 1MRQA 2VZTA 1H8LA 3P11L 3P30H 1J05A 4K5OA 4A8NA 1OTUC 3O16A 3KBPA 3OKLB 3IIZA 3I2CH 3QPZA 1BLIA 3VIPA 2QCMA 2PXYA 2GK2A 1VEOA 1XZ0A 3BH9B 3HCVA 1G9EA 1NDVA 4YVXA 5IRPA 4FEZA 1KR1A 7PCYA 1RH9A 2VXNA 3U79A 3GO1H 2GHZA 3I75B 5DC2A 1JCLA 2HLFC 3Q5TA 3F7VB 4JR9L 3MCMA 3STLB 4LC6A 3THDA 2VL5A 3G1SA 3S35X 1JZ7A 1BG4A 2KERA 4P0DA 4XNDA 3EBHA 5KBNC 1S3RA 1ZP4A 3CVCA 1XBZA 1E30A 3G6AA 4LMQI 2O6DA 1OB0A 4W6XB 4D9PA 1BJ1J 5D8ZA 1CECA 1AC6A 2ZICA 5ABEA 2J8HA 4M6AA 3BMXA 2JIXA 1INEH 2KS0A 5BVPH 3FCPA 3GUWA 1AW2A 2DWEB 2QKIB 3RZCB 5LBSL 3LNEA 2BSTB 5E4EC 2WNQA 4NHUA 4Y8DC 1UOKA 3DV4B 4G7VL 3CC5B 4PU2A 3WFBH 3FU0A 4M61A 3RP1A 2K70A 5C07E 4CILA 3IPEA 1PQZB 4WCYL 2ZX7A 3BP5B 3IKKA 3X14B 5D4IA 3AROA 5D6CA 5C7XH 4NI6A 2O9PA 3P2DA 2YUVA 3K72A 4FQPA 1T03L 1E5YA 2I5IA 3F7VA 3DCDA 4WVXA 2YJQA 3UAJC 2EAEA 2H26B 1E0TA 3AMLA 3LVTA 3MCKA 3NIFB 4DGIL 4G82A 3HC4L 1UUQA 1X98A 3FO2B 3NVTA 4Q3MA 4ZX3A 4AC1X 5HHMD 4NM4H 3MRFB 5KSBE 5FO9A 2B0SL 4XNXL 5LWYL 1CGXA 3PHOB 1XH2A 4NO5B 2WSPA 3L4VA 1MPAH 5IROC 4E4FA 2ED8A 2IGLA 3KBFA 3OL2A 5T1LB 1R1CA 4QIRA 4ZX6A 4MJIE 2WXJA 1KRCC 1IGCL 2EE0A 2VUKA 1NFDA 3ISYA 5HYIA 2GJNA 2XIMA 3KWUA 4AF0B 5A8OA 1GYMA 3VCCA 1DQDH 5L0QC 4X4ME 1DIKA 4GRSA 3NIGF 5B80A 4XP5H 1W3YA 2Y8KA 4X2UA 2F53D 4APQB 2WZ5A 4Z7OE 2EUVA 3FJ6A 3AFBA 1OX6A 3PHQA 1KC5L 4MQXD 2R0LH 3CLFL 4LEXH 4OGQC 4XZUB 3MBFA 2CUAA 2WVVA 5DQJA 1P7QA 2GVJA 4QTFA 1E4XI 1Q0YL 3ZE0E 5KYNA 3D3VD 5ACZB 3O07A 4OGXL 4ENLA 4PMDA 2XETA 4BFEA 1U6AH 1UA3A 2V3FA 3L0NA 4LAZA 1AACA 4IOFC 1GVFA 1OYCA 3RM4A 1DLFH 3MUGB 2X12A 2NNXA 5D7SL 4F2MA 1T3FB 4E2OA 4N4PA 4RAVA 2WDAA 2QHLA 4EUPG 2YXWA 1XXXA 5DHMC 3MCOA 4LUJA 4WDIB 3UFIA 3MLRL 3WLHA 4F7PA 1T6BX 4EDWH 4F37K 1W5PA 2AERT 1YQVH 4HJ1A 4OCXL 3GIYA 1XLIA 4DESA 4PJGA 1D3CA 3IUIA 1KCSH 5D4YA 1RSCA 1X4ZA 3ATDA 4DM2A 4ZMTA 2G3FA 2IBGA 1NOLA 4A7SA 1GKEA 1ZHLA 4X2RA 4OLXL 2W6RA 2HH0H 1FBIL 3MMWA 3G9VA 3WEOA 3SD5A 3C2OA 4DKAA 3CX5J 4J3XA 2JNZA 2K4AA 2CBTA 2CU9A 1HINH 2YIHA 1C29A 5B1BB 1J6OA 3HURA 3W9EB 1PVNA 5CLXA 3PUDA 3GMPA 4GG6E 4K68A 2HVOA 3H7RA 3VVGA 4Q2ZA 1DJNA 3Q7JA 4WIQA 4YO0B 5DF0A 4X8JA 2VC7A 4QSFA 5GS0D 4HNUA 3KLSA 3OQ3B 3CSPA 1MFMA 3C8KB 2JXMA 4PP1C 1DN0A 4G6AD 5D2LB 4EF3A 1QI5A 5IOPA 2UV3A 1G7IA 3QORB 4L3EE 4G71B 4R3SB 1ZLUH 2EF9A 3H2FA 2O92A 4MFDA 3SCVA 1LP9B 2BWDA 3ETBJ 4L37A 4UV4H 3ESPA 4JN1H 4DGYL 1TZHB 3B8YA 3C3NA 4QYOA 3MMTA 3GBML 3WDPP 1UT1A 5BU9A 4MJMA 3KXQA 3VE7A 4WI4A 5FX3A 1F4YL 3DETD 3MNVB 3EWCA 4AW7A 4D0BB 4XC1L 1XLHA 4HSHA 3LKNB 3CC5A 1F4HA 2Q7YB 2DQTH 2ZYIA 4X4XA 2AANA 3H4FA 5DMJB 2ZF9A 1A6WH 3W7UA 2X30A 3LTSA 4O1FA 4ROPA 4X8JB 5GJPA 1QVOA 2BW4A 1ZP3A 3HC3L 1AZCA 5JXQA 4F37F 4Y16C 3GSRB 1MH5A 1IAOB 2VDKB 4LNRA 5DUPL 2OTDA 3I50L 3KOYA 3T71A 1OOAA 2AEPH 4PJ8D 2G30A 4S3FA 3O2VL 4NT6B 1UQSA 5E1GA 1PKYA 4IISA 3EFFB 4MLIA 2EDMA 1EGJH 2P45B 5DJ8A 5EZOH 1ZENA 2CWNA 5GS0C 4UB9A 5CBAA 5E5MA 3MOQA 2IQTA 3NDYE 2BSTA 4LASL 4P2OD 2V9QA 2C11A 1M7OA 1DWAM 2H6OA 5K69A 4I6KA 4RXGA 2DIEA 1NH6A 2JI1A 3LSOA 3IFNL 3STZB 3B8SA 3NACL 3PBGA 2VR5A 2VZ3A 4FLHA 1UXWA 3ULAB 4KXCA 3ZX1A 2PTVA 4WFFE 1ND0B 2Q8AH 3T2PA 1QSFB 2QZRA 3V5CA 3W00A 3FFCE 3W2JA 1UUNA 4FFVD 4LGPB 5AC7A 3CS2A 1CLOH 1PZCA 2YD6A 3P2TA 4JRXE 3L12A 1FNSH 3NEHA 3QG0A 3QUKA 4HUKB 4CC4A 5I1AA 4IP7A 4K7VA 3GS7A 1MUMA 1VH7A 3SE9L 3VXRE 1V8EA 3FO1B 1BWKA 3EMQA 3HV9A 2C9QA 3O3DA 3HN5A 1MLCB 3V0SA 3WMSA 3EYFA 2WLYA 3W1ZA 1NFPA 2RDTA 1JUKA 1DIDA 4IXHA 3ME3A 3S5LG 5AYYA 3KWVA 1V79A 3FNKA 4TL4A 2YEQA 4KOBA 3SQRA 3UWWA 1J0NA 4WGVB 1EJXC 3GRWA 4ZAKA 2J7FA 3AUVA 3DTXA 3IDXH 1HJCA 4HXBL 2QT3A 3DHPA 4D8LA 3FCTB 4OKDA 4TOYL 1XIBA 2Z1SA 4H41A 5BOOA 1YNQA 2ZRZA 1MWAA 3O45A 1R3TA 3G0XA 1P2CA 2V33A 1ED3A 1MMZA 2PDHA 2B3RA 4FG0A 1RUPL 4OB5H 3PP4L 4OU3A 3ZWSA 1AG6A 2XWRA 3EO0B 4DPAX 4KS0A 3QZWA 1UXMA 2A38A 4R27A 4M4PA 1ZHAA 5LXEA 2NX3A 4U0RC 3SDCA 1XR2A 1QLFA 2NDFA 2WANA 2C10A 1BXNA 5KVFH 5AB0A 2F53B 2VDKH 4J3VA 4XSMA 3LQZB 3U1PA 5EFFA 1OP5H 2YCLB 1RD6A 4EWJA 4H2HA 4PTUA 2PD5A 2PI6A 5B8CB 1CICD 3B2UD 3SKMA 1XR9B 2AKRA 3MNDA 4GG8A 1XCTA 1BJ8A 1ZE3C 2WZTA 3FVDA 4FZEH 1ROWA 5DXWA 2AQQA 4F7TB 1EXUB 2ZSWA 4EV5A 3AU1B 1BYPA 1D5MB 1TV3A 3WQFA 2YRPA 4NDMB 3C9NB 1BD2D 5DT1H 1VZIA 5IJKA 3NPUA 3ABXA 4G7RB 5H35A 3M6YA 3V36A 4C56B 2IDQA 4R53A 1YEHL 2XA8L 4HIBA 5DRWB 4PGDB 4L4PA 4AD5A 4OUIA 4ZMNA 3EYSL 3KRSA 4PLOB 3U6XS 3QPXH 1JXJA 3LVEA 4O1DA 3W7NA 2VGBA 3FDKA 3ULUF 2EECA 4P5RA 2B31A 4C6JA 3QEHA 3R1GH 4AGQA 4YZWA 4PFHA 3KPPB 5F1IA 1JGEA 1NY1A 3EGSB 1G6CA 4QHKJ 1B9ZA 3UGUA 4N87A 3GIQA 4J27A 4B5VA 4HA3A 2BIPA 3SKJL 4G8TA 1I8UA 4JFFB 4I13B 3BCDA 1J1PL 2P8PA 1SFLA 4XHQA 4H44C 4WJG3 2GBTA 2HTKD 4NO0D 4UILL 4XNZB 1JWSB 4K1WA 2A7RA 1JDFA 2GJPA 3B9OA 3EAUA 1ACYH 4JHBA 4FQ2H 4NX5A 1NCHA 4J3SA 2O5YH 3AIQA 4AZGA 3TYUA 4QHMB 4APQA 1SFJA 2FO4A 5JIDA 3PJXA 1H3VA 1PY0A 2R2EA 4OCWL 1F3TA 1XTMA 1PTDA 4I7VA 1H6FA 4DAFA 5ALCH 3U0TB 1WYIA 5HHNB 2DWDA 3HG4A 5E94B 5IOKA 2PYEA 3SIKA 1TIMA 4OF8A 1IIKA 4AH2B 3B0XA 3Q2NA 5HWMA 4P9HC 3HAEH 2ZZ2A 1H3GA 3IIPA 4PJDF 1CUOA 1MI5E 2UX6A 4KROC 5ADOL 1E40A 2FD6L 3MRQB 3M44A 5EDSA 3V6OC 3N34A 4S3GA 1E6QM 3CQ0A 3K13A 1U2HA 4BQ6A 5J4MA 2YLLA 2B81A 2V2WA 3DX7B 5EU6A 3UAEA 4IMLA 2J4WL 2ZOUA 5EMLA 4LCWA 2E4TA 2ADIB 2ZYRA 3N40P 1IGFH 4LFHD 5EC2B 1RZQA 5EC1B 4YR6A 3JXAA 1F6KA 4KCTA 5DCDA 5C0DB 2FK9A 3O2LA 4UBDC 1HSAB 3CFMA 2IPUK 4DN4H 2YXGA 4LB8A 1K7XA 7REQA 1QSVA 2IXVA 3LHTA 1HHKA 4JJHA 5JHDE 4IM4A 1KXVA 4JN2A 5I3IA 1AZRA 3LN4B 3MRLB 3U4EA 3FOMB 5AVNA 1G7LB 2BY3A 2DJMA 1NF0A 3QNYA 5DD6B 2R8WA 4A6YA 5DK2B 3SCRA 1NL0L 4F7PB 1SJVA 3AACA 4MFHA 4NILA 2CK2A 5E4EB 1GOMA 4LPVA 1QNSA 3B2VH 4OUEA 4HEME 2ZRWA 4J8RA 2OI9B 4WU7A 1UXSB 3CNKA 2O4EA 5C0GB 4DP6X 2CK0L 3NDOA 2O1AA 4I7ZC 3UJTH 3QYMA 4C6FA 2G8ZA 2D73A 4WEBL 1WEJL 5DLML 2HRPL 4WVRA 2J71A 4H9YA 2AQWA 5CEWA 1DVFA 3WO4B 3BWSA 4FPSA 3U0PA 4RPPA 4XD4A 4WKZB 3CHVA 3W1PA 2NX5A 5C09A 3THMH 5BV7B 2XVBA 4M7LH 5ESAA 5IMMA 5DJ2A 3N6QA 4AENA 5GZOC 2UBPC 5T3ZE 1QPPA 3PQYD 4KKLD 3H2AA 1DLHA 4M6MH 2D2HA 1H4PA 2L3BA 2W0UA 4Y9EA 1T2QH 4YHEA 3QJZA 4K8RH 1NPJA 1E9OB 1GGYA 3OKYA 4Z7QF 4GUOA 4XWOD 2AVGA 1OCWL 5F9DC 3BPOC 4GMTL 4DGVL 4MNLA 4HNCA 1ZGDA 2F19H 2WLIA 2WIIB 1GYNA 2OXGA 3PGCA 2XRAL 4M29A 4PQXA 2R8SH 2G5BB 4IPIA 4LS2A 5BU6A 3FT3B 3ML8A 4KJQC 4LZKA 4NQTA 5A5WA 4OFIA 1OJOA 3ARRA 3NQIA 2VDNL 3IJIA 3N9RA 4WRHA 3GXNA 2ZA1A 3T2LA 2MKWA 2VDQH 1MREL 1KCBA 1KLGA 3MCG1 2VDOH 4K07A 4Q52A 4HSAC 3ZZLA 4HOWA 2POTA 4Y2WA 3N5AA 4FQ1H 4BQCA 4M1CC 4NQ1A 4HH8A 3BP5A 1DQWA 3B0YA 2BVPB 4JIEA 4H9UA 1SY6H 4KK9D 4NS0A 1S5HA 3BP7B 3VU2A 1S2EA 4YMZA 2WGQA 3G6LA 3LKOA 4N0FA 1TUXA 5J11C 2DTSA 4ZFFA 1P5VB 3DK0A 4NC1C 1PIIA 5I0DA 4Z1DA 1B9BA 4JNMA 3E2QA 3IVSA 4CLMA 4WHCA 1Q6LA 1R3RA 4WENB 1JP5A 4GYBA 4KDTC 4GG6A 1E6ZA 1G4PA 2MPAL 3AQDA 4IBLT 5F1OB 4YPJA 3CK0H 5T5NF 5I1IL 3IJYA 4JY6B 2J4GA 3RUBL 1L7IH 1A80A 3VOIA 2ZRUA 1KGIA 1QWHA 4P3DA 4UTAA 1RV8A 3RGVD 3SKJH 4MNHB 2DFAA 4NRXA 4LP4A 3U6RB 3N40F 4Y0GA 1DQLH 3RILA 3FUKA 5AVHA 1JMZA 5DEGB 3RCYA 3VB9A 3LS9A 3D07A 2BC4A 1P4LA 1K9FA 3QEQA 4ZI8A 4V2BA 2X1RA 3HGSA 4FF5A 3VI2A 3S37L 4E9SA 1HSAA 4YVUA 2JKJA 4Y2OA 5ALCL 2GUBA 4G8EA 3CSGA 1WFJA 1DEEB 4ZUSA 1QA9A 2F8QA 3WQPA 4JMNA 4ZJ9A 4DW2H 3MLZL 3IGLA 3W7LA 8A3HA 2BNQB 4JKWA 3BJSA 4GFIA 1KELH 5BQ7A 3TFKD 3BEVA 5F7BA 1HOCA 3P77A 1KLZA 4AT6A 1ISWA 3GGWA 2O9OA 1CGTA 2BOCB 3AQUA 2X6AA 2VFHA 1TPVA 4CNUA 4C4UA 4YHZL 3NNTA 3E2HC 4L5ZA 2XZQH 5F7LB 1P9MA 5J3HD 3RHGA 2DYPD 4FG2A 5I75C 4RMVA 3IU3B 4CD4A 3BFQG 1G7HB 5F97E 4B5EA 4MWAC 4X6EA 1CFSA 4GBXB 3VX1A 5A2AA 1CEOA 2I07B 3UTTB 3ARBD 4NRYB 1EA0A 2I7OA 4GAGL 4KZ0A 1GG0A 1Y5WA 4Y2OB 5HJGA 5F9OL 5FV1L 5HP5A 2ZXAA 3SBWC 3WIFA 4W7WA 4UTUA 3NCWA 2DQDH 1Q9KA 2EYSA 4G7EB 4TVPD 1BVKB 1YQ2A 5A16B 4NQSB 4POZC 1A9BB 4TV6A 4D2JA 4HOXA 4DX3A 5GRVK 5LO7A 3GG1A 1OYAA 4HSNA 3IRCA 3WBAA 4KIRA 3KLAB 2FJFB 4L48A 4TVPE 4R7VA 4Y16D 3VFWA 1POKA 1NCAL 3O6LL 3HV8A 4C60A 1FRGL 2VQ1B 4FP8H 4GAJL 1WV2A 3TV3H 4PS8A 2NZ9C 3W84A 3SGJC 2FL5A 2F61A 1QPRA 4C1KA 2A6KB 4JD4A 4DN3L 1LLWA 4NCC2 4WW2A 3WXWH 3L3OA 2IH3A 4JRXB 2Y06H 3HS0B 1HXMB 3U2SA 4G72B 4XP1L 4AXWB 1FHNA 1WFUA 3QVAA 5KYYA 4FR1A 1TCMA 3MLSH 1Q8AA 4H6QA 3TVAA 1FWEC 2R0KH 1U1HA 3FH7A 1TJRA 3WMPA 4HPHA 5BMFL 5AVRB 1HFBA 4GO9A 5GZNA 5AW3B 2MH4A 1Q9KB 4L5FE 5BS0B 1H51A 1NTHA 1JF6A 1O5PA 3UW6A 4IGMA 2HTMA 1M71B 1WC7B 2NY6D 3HS8A 3L4UA 1E6XM 3QBUA 3ITYA 2Z0BA 5HDBB 3BUPA 3BLCA 4LYPA 1ZPUA 4NKDB 3RUGB 1L0QA 4IK7A 1KRBC 1Y0LA 4BGLA 4JNZA 1VLIA 1LYQA 4YLQT 3SKOB 3AMCA 4RE4A 3GB6A 3ZVHA 5E9DB 4LPCA 1J0ZA 3NFSH