4FO1A

Crystal structure of lincosamide antibiotic adenylyltransferase lnua, apo
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
b'NNVTEKELFYILDLFEHMKVTYWLDGGWGVDVLTGKQQREHRDIDIDFDAQHTQKVIQKLEDIGYKIEVHWMPSRMELKHEEYGYLDIHPINLNDDGSITQANPEGGNYVFQNDWFSETNYKDRKIPCISKEAQLLFHSGYDLTETDHFDIKNLKSIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide resistance protein
publication title Crystal structure of lincosamide antibiotic adenylyltransferase LnuA, apo
rcsb
source organism Staphylococcus haemolyticus
molecule tags Transferase
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4fo1A00
5CFTA 4WQLA 4WQKA 2EWRA 4HX0A 2FCLA 4WH5A 4XJEA 5CFUA 5CFSA 4FO1A
chains in the Genus database with same CATH superfamily
1ZQYA 9ICGA 4P4OA 4K4HA 5J29A 4F5OA 4LEVA 4MF8A 9ICMA 4I2BA 3UXPA 5CHGA 4WC2A 4R66A 4M5DA 8ICHA 4RQ3A 4MFCA 8ICQA 5J2BA 2GAFD 2ZH7A 2DR8A 3ISCA 4X0AA 5DB6A 1R89A 3C66A 3H3AA 4NXWA 2DRAA 4I2IA 4LT6A 4FH5A 4TURA 3AQMA 4WC6A 5J2AA 5J0XA 4S3NA 1KEJA 1RZTA 2ZH9A 4X4VA 4RQ6A 8ICLA 4K97A 4YMMA 7ICUA 4KLFA 3B0YA 2ZH4A 2DR9A 9ICBA 3K75D 4WC1A 1ZQFA 3C5GA 3AU6A 2Q66A 8ICJA 9ICUA 8ICVA 2BPFA 1GPJA 4P2HA 5J0OA 5CP2A 4AT9A 1ZQPA 2VANA 5HHIA 4PHAA 5DB7A 2PFPA 3RJEA 8ICOA 4FO6A 4X4OA 4UD4A 4PGYA 4RPYA 4FHYA 4N7RA 4M9LA 9ICSA 9ICHA 4EV6A 7ICOA 4X0BA 3TFSA 4I0UA 1UEUA 5CHEA 3OVAA 3WFSC 7ICMA 4NLZA 4RQ7A 3MGIA 2BCSA 4RWNA 9ICLA 5CFTA 2PBEA 1TFYA 2PXIA 4WQKA 2BCVA 3MGHA 9ICPA 1R8AA 2O5AA 7ICPA 2ZH8A 4EBKA 4YCXA 4YMNA 3OUYB 3JPPA 4FH3A 8ICUA 4M2YA 4O69A 5BOLA 4X4PA 3JPOA 5HR9A 4X4NA 5J0RA 5J0SA 5B3PA 4RQ5A 1F5AA 4M9NA 9ICTA 3JPRA 5J2CA 4PH5A 1JQRA 4I29A 4KLSA 3UXNA 4MF2A 4AT8B 3NKUA 1ZQTA 4X4UA 1BPYA 4YMOA 4I2EA 4M9GA 4K9BA 2HHPA 2BCQA 4QZGA 1XSLA 4EGWA 5J0PA 3TFRA 5DKWA 4NKUA 4NXVA 4WH5A 3HIYA 1ZQEA 4YD1A 3AQNA 3C2LA 4KLJA 9ICJA 4I28A 2IHMA 1ZQZA 4DO9A 1ZJMA 4KLOA 4AT7B 7ICGA 5IIOA 3AQLA 5CFUA 8ICIA 4F5NA 1BPBA 4QZHA 1YLQA 1ZQXA 4O9MA 8ICEA 4E8FA 1WOTA 3C2KA 1JMSA 4IQWA 4WC5A 5J2GA 1R8CA 3WFOA 3RJIA 8ICKA 2ISPA 4RWQA 2ZHAA 1ZQOA 4KLLA 4RPZA 9ICNA 9ICFA 1ZQMA 4LZDA 3MCRA 4UBBA 4WBZA 1NOMA 1VFGA 3K7DA 3V72A 1HUZA 2ID1A 9ICIA 1ZQWA 2FMSA 3PMLA 3WFPA 4PHEA 5J2HA 5DDYA 4TUSA 1TFWA 3H37A 1RPLA 5EOZA 3JCFA 3B0XA 4TUPA 1ZQDA 3H39A 1UETA 4I2JA 5J0UA 3HX0A 2FMPA 5IIMA 9ICRA 4FHXA 1ZQAA 4FHWA 3UPSA 4ATBB 5D61A 4PHPA 2ZHBA 4O6AA 4RQ1A 4Z6CA 5DECA 2FMQA 5DBCA 3PMNA 3UQ2A 8ICTA 4NXXA 3AUOA 1KDHA 1ZQVA 4RT2A 4XQ7A 4JWMA 8ICRA 4R64A 9ICVA 7ICHA 2BBHA 3RH6A 4R63A 4FHVA 3GDXA 4AT9B 4XUSA 5D49A 1Q79A 3OVSA 2B56A 4WBYA 5DB8A 4KLMA 2IHOA 4EEBA 4NKTA 3ER8C 4DOCA 3H38A 1ZQHA 3RH4A 4IQUA 1ZQBA 4UD5A 3JPSA 4QZFA 5HRDA 4K98A 1ZQCA 8ICPA 5J0QA 4JLZA 4QZ9A 8ICAA 4I2FA 3NVOA 5J0TA 3WFRE 1V4AA 3V7KA 4OAHA 1JAJA 1VJ7A 4RQ2A 4GXKA 4UB2A 3ER9B 3RJGA 4EBJA 1PX5A 2HN2A 1MQ3A 5HREA 5BPCA 2GWSA 4RT3A 2ZH5A 8ICSA 4IG8A 4MKPA 5HRIA 4GXJA 1Q78A 5D4BA 8ICZA 5CWRA 4QZEA 2BCUA 2P66A 2I9GA 2PFNA 3C2MA 4AT8A 4K4GA 2BPCA 4OAGA 5HRBA 5IILA 4OAFA 3JYYA 3JZ0A 4XJEA 4EP7A 4KLGA 4QZAA 5HRHA 5DDMA 4PPXA 1ZQNA 4UB5A 5IINA 4DOAA 4MFAA 4KM5A 4KLTA 4M9HA 4O67A 5HRLA 5J2DA 1MIYA 7ICTA 4WC3A 5IIIA 4P4PA 9ICWA 4AT7A 2DR5A 2IUBA 3WFQE 5B3QA 5CR0A 3V7JA 4KLHA 7ICNA 3EF2A 4RWPA 4NLKA 2W9MA 3RJFA 3JPNA 4X5VA 4KLUA 4NM1A 4LEWA 4WC7A 2ISOA 5J2JA 5DBBA 5D63A 1XSNA 1MQ2A 4JWNA 2FCLA 4WC4A 2NRKA 4X4RA 1JN3A 1MIVA 1ZJNA 4MFFA 1BPXA 4M47A 9ICEA 4NXTA 4NXUA 4WOYA 3JPQA 3MDCA 4QZDA 2BPGA 7ICRA 8ICBA 4K8VA 4K96A 1FA0A 4Z6DA 5J2EA 9ICKA 3MDAA 4F5QA 2DRBA 4RQ0A 4KLQA 2RFFA 3JPTA 3C5FA 4NXZA 7ICFA 7ICVA 7ICKA 3UPQA 1R8BA 8ICGA 4NLNA 2ZH6A 5CJ7A 4R65A 8ICXA 4IQVA 2GA9D 2ZH1A 4KLDA 3LQCB 5DBAA 4OAIZ 9ICOA 4IQTA 3OWGA 4ATBA 2M2TA 4LVSA 5CFSA 3RJJA 4KB6A 4K9AA 4KLEA 5TZVA 5CA7A 2ZH2A 2ZH3A 1NO5A 4NM2A 3L9DA 4UBCA 4O5CA 7ICLA 1ZQKA 3OGUA 7ICJA 4WQLA 4PGXA 2B4VA 3C18A 3RJKA 3ERCC 4Z6FA 2BBJA 5CB1A 2BE3A 2M2UA 4K4IA 9ICAA 3LK9A 4K99A 4RWOA 4LEZA 4HX0A 2M2VA 4Z6EA 4UB1A 4FO1A 7ICEA 1ZQLA 3RH5A 3AQKA 4WC0A 4P4MA 1BPZA 4E7XA 3OVBA 5BOMA 5J2KA 4QZ8A 4PGQA 4PHDA 4NY8A 4M0AA 4YN4A 8ICWA 2B51A 5J0YA 4YD2A 1ZQJA 8ICMA 3MBYA 4UB3A 4XA5A 4X4SA 4EEDA 5D46A 3HWTA 4O5KA 7ICIA 5HRKA 3OUYA 9ICXA 4QZBA 4TUQA 5F2VO 8ICCA 5J2FA 3PNCA 3ISBA 1ZQSA 4E80A 5DEDA 2BCRA 4O68A 9ICQA 3RJHA 3OV7A 4O5EA 1TVAA 4X4QA 5HRFA 3UXOA 1XSPA 4UB4A 4RQ8A 3NWIA 3CK6A 4QZIA 5J0WA 5J2IA 1ZQGA 7ICSA 3HJ4A 4XQ8A 4I2AA 4FHPA 1ZQQA 4RPXA 5HRGA 2EWRA 3ISDA 1OU5A 2HN1A 3PHZA 4I2GA 1UEVA 4LZGA 5IIKA 4RQ4A 8ICNA 4QZCA 4F5PA 4I2CA 2DR7A 3NYBA 3UQ0A 1BPDA 4DOBA 2M2WA 7ICQA 4X4TA 4JLXA 5JTGA 2PFOA 4M04A 3HJ1A 2PFQA 3AU2A 1ZQUA 4I2HA 4M9JA 4UAWA 1MIWA 3HW8A 4WCWA 2O1PA 4UAZA 2DVIA 4KLIA 1ZQRA 5HHHA 5HC9A 1BPEA 4GXIA 5DB9A 4I2DA 1KNYA 8ICYA 4I27A 4UAYA 4LEYA 4XRHA 1HUOA 5D62A 9ICCA 3V7LA 8ICFA 1ZQIA 4F5RA 1TV9A 5IIJA
chains in the Genus database with same CATH topology
4OAGA 4N7RA 5B3PA 4K97A 2B51A 4LEVA 4K8VA 5B3QA 4OAFA 5CFSA 2B56A 3EF2A 4XJEA 3MCRA 5CHEA 4K96A 4OAHA 4WQLA 5D61A 2EWRA 2B4VA 2IHOA 3K7DA 4O6AA 4KM5A 3ERCC 3PHZA 5CFUA 3ER9B 3NKUA 2GAFD 4LEWA 3ER8C 4O67A 5CFTA 4NXUA 4NXXA 5D63A 4WQKA 4K99A 4LEZA 1GPJA 4HX0A 4K9BA 2FCLA 4LEYA 2GA9D 4MKPA 4NXWA 4O68A 5D62A 4K9AA 4FO1A 4K98A 4JLZA 4OAIZ 4NXVA 3OWGA 4JLXA 4WH5A 4O69A 4NXTA 4WOYA 4KB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFT A;  4WQL A;  4WQK A;  2EWR A;  4HX0 A;  2FCL A;  4WH5 A;  4XJE A;  5CFU A;  5CFS A;  4FO1 A; 
#chains in the Genus database with same CATH topology
 1ZQY A;  9ICG A;  4P4O A;  4K4H A;  5J29 A;  4F5O A;  4LEV A;  4MF8 A;  9ICM A;  4I2B A;  3UXP A;  5CHG A;  4WC2 A;  4R66 A;  4M5D A;  8ICH A;  4RQ3 A;  4MFC A;  8ICQ A;  5J2B A;  2GAF D;  2ZH7 A;  2DR8 A;  3ISC A;  4X0A A;  5DB6 A;  1R89 A;  3C66 A;  3H3A A;  4NXW A;  2DRA A;  4I2I A;  4LT6 A;  4FH5 A;  4TUR A;  3AQM A;  4WC6 A;  5J2A A;  5J0X A;  4S3N A;  1KEJ A;  1RZT A;  2ZH9 A;  4X4V A;  4RQ6 A;  8ICL A;  4K97 A;  4YMM A;  7ICU A;  4KLF A;  3B0Y A;  2ZH4 A;  2DR9 A;  9ICB A;  3K75 D;  4WC1 A;  1ZQF A;  3C5G A;  3AU6 A;  2Q66 A;  8ICJ A;  9ICU A;  8ICV A;  2BPF A;  1GPJ A;  4P2H A;  5J0O A;  5CP2 A;  4AT9 A;  1ZQP A;  2VAN A;  5HHI A;  4PHA A;  5DB7 A;  2PFP A;  3RJE A;  8ICO A;  4FO6 A;  4X4O A;  4UD4 A;  4PGY A;  4RPY A;  4FHY A;  4N7R A;  4M9L A;  9ICS A;  9ICH A;  4EV6 A;  7ICO A;  4X0B A;  3TFS A;  4I0U A;  1UEU A;  5CHE A;  3OVA A;  3WFS C;  7ICM A;  4NLZ A;  4RQ7 A;  3MGI A;  2BCS A;  4RWN A;  9ICL A;  5CFT A;  2PBE A;  1TFY A;  2PXI A;  4WQK A;  2BCV A;  3MGH A;  9ICP A;  1R8A A;  2O5A A;  7ICP A;  2ZH8 A;  4EBK A;  4YCX A;  4YMN A;  3OUY B;  3JPP A;  4FH3 A;  8ICU A;  4M2Y A;  4O69 A;  5BOL A;  4X4P A;  3JPO A;  5HR9 A;  4X4N A;  5J0R A;  5J0S A;  5B3P A;  4RQ5 A;  1F5A A;  4M9N A;  9ICT A;  3JPR A;  5J2C A;  4PH5 A;  1JQR A;  4I29 A;  4KLS A;  3UXN A;  4MF2 A;  4AT8 B;  3NKU A;  1ZQT A;  4X4U A;  1BPY A;  4YMO A;  4I2E A;  4M9G A;  4K9B A;  2HHP A;  2BCQ A;  4QZG A;  1XSL A;  4EGW A;  5J0P A;  3TFR A;  5DKW A;  4NKU A;  4NXV A;  4WH5 A;  3HIY A;  1ZQE A;  4YD1 A;  3AQN A;  3C2L A;  4KLJ A;  9ICJ A;  4I28 A;  2IHM A;  1ZQZ A;  4DO9 A;  1ZJM A;  4KLO A;  4AT7 B;  7ICG A;  5IIO A;  3AQL A;  5CFU A;  8ICI A;  4F5N A;  1BPB A;  4QZH A;  1YLQ A;  1ZQX A;  4O9M A;  8ICE A;  4E8F A;  1WOT A;  3C2K A;  1JMS A;  4IQW A;  4WC5 A;  5J2G A;  1R8C A;  3WFO A;  3RJI A;  8ICK A;  2ISP A;  4RWQ A;  2ZHA A;  1ZQO A;  4KLL A;  4RPZ A;  9ICN A;  9ICF A;  1ZQM A;  4LZD A;  3MCR A;  4UBB A;  4WBZ A;  1NOM A;  1VFG A;  3K7D A;  3V72 A;  1HUZ A;  2ID1 A;  9ICI A;  1ZQW A;  2FMS A;  3PML A;  3WFP A;  4PHE A;  5J2H A;  5DDY A;  4TUS A;  1TFW A;  3H37 A;  1RPL A;  5EOZ A;  3JCF A;  3B0X A;  4TUP A;  1ZQD A;  3H39 A;  1UET A;  4I2J A;  5J0U A;  3HX0 A;  2FMP A;  5IIM A;  9ICR A;  4FHX A;  1ZQA A;  4FHW A;  3UPS A;  4ATB B;  5D61 A;  4PHP A;  2ZHB A;  4O6A A;  4RQ1 A;  4Z6C A;  5DEC A;  2FMQ A;  5DBC A;  3PMN A;  3UQ2 A;  8ICT A;  4NXX A;  3AUO A;  1KDH A;  1ZQV A;  4RT2 A;  4XQ7 A;  4JWM A;  8ICR A;  4R64 A;  9ICV A;  7ICH A;  2BBH A;  3RH6 A;  4R63 A;  4FHV A;  3GDX A;  4AT9 B;  4XUS A;  5D49 A;  1Q79 A;  3OVS A;  2B56 A;  4WBY A;  5DB8 A;  4KLM A;  2IHO A;  4EEB A;  4NKT A;  3ER8 C;  4DOC A;  3H38 A;  1ZQH A;  3RH4 A;  4IQU A;  1ZQB A;  4UD5 A;  3JPS A;  4QZF A;  5HRD A;  4K98 A;  1ZQC A;  8ICP A;  5J0Q A;  4JLZ A;  4QZ9 A;  8ICA A;  4I2F A;  3NVO A;  5J0T A;  3WFR E;  1V4A A;  3V7K A;  4OAH A;  1JAJ A;  1VJ7 A;  4RQ2 A;  4GXK A;  4UB2 A;  3ER9 B;  3RJG A;  4EBJ A;  1PX5 A;  2HN2 A;  1MQ3 A;  5HRE A;  5BPC A;  2GWS A;  4RT3 A;  2ZH5 A;  8ICS A;  4IG8 A;  4MKP A;  5HRI A;  4GXJ A;  1Q78 A;  5D4B A;  8ICZ A;  5CWR A;  4QZE A;  2BCU A;  2P66 A;  2I9G A;  2PFN A;  3C2M A;  4AT8 A;  4K4G A;  2BPC A;  4OAG A;  5HRB A;  5IIL A;  4OAF A;  3JYY A;  3JZ0 A;  4XJE A;  4EP7 A;  4KLG A;  4QZA A;  5HRH A;  5DDM A;  4PPX A;  1ZQN A;  4UB5 A;  5IIN A;  4DOA A;  4MFA A;  4KM5 A;  4KLT A;  4M9H A;  4O67 A;  5HRL A;  5J2D A;  1MIY A;  7ICT A;  4WC3 A;  5III A;  4P4P A;  9ICW A;  4AT7 A;  2DR5 A;  2IUB A;  3WFQ E;  5B3Q A;  5CR0 A;  3V7J A;  4KLH A;  7ICN A;  3EF2 A;  4RWP A;  4NLK A;  2W9M A;  3RJF A;  3JPN A;  4X5V A;  4KLU A;  4NM1 A;  4LEW A;  4WC7 A;  2ISO A;  5J2J A;  5DBB A;  5D63 A;  1XSN A;  1MQ2 A;  4JWN A;  2FCL A;  4WC4 A;  2NRK A;  4X4R A;  1JN3 A;  1MIV A;  1ZJN A;  4MFF A;  1BPX A;  4M47 A;  9ICE A;  4NXT A;  4NXU A;  4WOY A;  3JPQ A;  3MDC A;  4QZD A;  2BPG A;  7ICR A;  8ICB A;  4K8V A;  4K96 A;  1FA0 A;  4Z6D A;  5J2E A;  9ICK A;  3MDA A;  4F5Q A;  2DRB A;  4RQ0 A;  4KLQ A;  2RFF A;  3JPT A;  3C5F A;  4NXZ A;  7ICF A;  7ICV A;  7ICK A;  3UPQ A;  1R8B A;  8ICG A;  4NLN A;  2ZH6 A;  5CJ7 A;  4R65 A;  8ICX A;  4IQV A;  2GA9 D;  2ZH1 A;  4KLD A;  3LQC B;  5DBA A;  4OAI Z;  9ICO A;  4IQT A;  3OWG A;  4ATB A;  2M2T A;  4LVS A;  5CFS A;  3RJJ A;  4KB6 A;  4K9A A;  4KLE A;  5TZV A;  5CA7 A;  2ZH2 A;  2ZH3 A;  1NO5 A;  4NM2 A;  3L9D A;  4UBC A;  4O5C A;  7ICL A;  1ZQK A;  3OGU A;  7ICJ A;  4WQL A;  4PGX A;  2B4V A;  3C18 A;  3RJK A;  3ERC C;  4Z6F A;  2BBJ A;  5CB1 A;  2BE3 A;  2M2U A;  4K4I A;  9ICA A;  3LK9 A;  4K99 A;  4RWO A;  4LEZ A;  4HX0 A;  2M2V A;  4Z6E A;  4UB1 A;  4FO1 A;  7ICE A;  1ZQL A;  3RH5 A;  3AQK A;  4WC0 A;  4P4M A;  1BPZ A;  4E7X A;  3OVB A;  5BOM A;  5J2K A;  4QZ8 A;  4PGQ A;  4PHD A;  4NY8 A;  4M0A A;  4YN4 A;  8ICW A;  2B51 A;  5J0Y A;  4YD2 A;  1ZQJ A;  8ICM A;  3MBY A;  4UB3 A;  4XA5 A;  4X4S A;  4EED A;  5D46 A;  3HWT A;  4O5K A;  7ICI A;  5HRK A;  3OUY A;  9ICX A;  4QZB A;  4TUQ A;  5F2V O;  8ICC A;  5J2F A;  3PNC A;  3ISB A;  1ZQS A;  4E80 A;  5DED A;  2BCR A;  4O68 A;  9ICQ A;  3RJH A;  3OV7 A;  4O5E A;  1TVA A;  4X4Q A;  5HRF A;  3UXO A;  1XSP A;  4UB4 A;  4RQ8 A;  3NWI A;  3CK6 A;  4QZI A;  5J0W A;  5J2I A;  1ZQG A;  7ICS A;  3HJ4 A;  4XQ8 A;  4I2A A;  4FHP A;  1ZQQ A;  4RPX A;  5HRG A;  2EWR A;  3ISD A;  1OU5 A;  2HN1 A;  3PHZ A;  4I2G A;  1UEV A;  4LZG A;  5IIK A;  4RQ4 A;  8ICN A;  4QZC A;  4F5P A;  4I2C A;  2DR7 A;  3NYB A;  3UQ0 A;  1BPD A;  4DOB A;  2M2W A;  7ICQ A;  4X4T A;  4JLX A;  5JTG A;  2PFO A;  4M04 A;  3HJ1 A;  2PFQ A;  3AU2 A;  1ZQU A;  4I2H A;  4M9J A;  4UAW A;  1MIW A;  3HW8 A;  4WCW A;  2O1P A;  4UAZ A;  2DVI A;  4KLI A;  1ZQR A;  5HHH A;  5HC9 A;  1BPE A;  4GXI A;  5DB9 A;  4I2D A;  1KNY A;  8ICY A;  4I27 A;  4UAY A;  4LEY A;  4XRH A;  1HUO A;  5D62 A;  9ICC A;  3V7L A;  8ICF A;  1ZQI A;  4F5R A;  1TV9 A;  5IIJ A; 
#chains in the Genus database with same CATH homology
 4OAG A;  4N7R A;  5B3P A;  4K97 A;  2B51 A;  4LEV A;  4K8V A;  5B3Q A;  4OAF A;  5CFS A;  2B56 A;  3EF2 A;  4XJE A;  3MCR A;  5CHE A;  4K96 A;  4OAH A;  4WQL A;  5D61 A;  2EWR A;  2B4V A;  2IHO A;  3K7D A;  4O6A A;  4KM5 A;  3ERC C;  3PHZ A;  5CFU A;  3ER9 B;  3NKU A;  2GAF D;  4LEW A;  3ER8 C;  4O67 A;  5CFT A;  4NXU A;  4NXX A;  5D63 A;  4WQK A;  4K99 A;  4LEZ A;  1GPJ A;  4HX0 A;  4K9B A;  2FCL A;  4LEY A;  2GA9 D;  4MKP A;  4NXW A;  4O68 A;  5D62 A;  4K9A A;  4FO1 A;  4K98 A;  4JLZ A;  4OAI Z;  4NXV A;  3OWG A;  4JLX A;  4WH5 A;  4O69 A;  4NXT A;  4WOY A;  4KB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...