4FO2A

Heat-labile enterotoxin lt-iib-b5(t13i) mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRITASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin IIB, B chain
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 22
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2012-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fo2A00
5G3LF 4FP5D 5G3LD 4FNFA 4FO2A 1TIID 1QCBD 1QB5D
chains in the Genus database with same CATH superfamily
1PRTB 4GKKQ 4JI2Q 3RLFA 1RDPD 2KVMA 4IUPA 2A68C 4IUUA 5EPLA 2NWGA 4X62L 3CQZB 4JV5L 1IL2A 3SVMA 1I4XA 2KQ3A 2UUBL 2EYHA 4C3JB 1GM5A 1I5FA 3GP7A 4JYAL 1S4ZA 3NTKA 4A3MH 4DR2Q 2R6GA 5C3XA 2NVTB 4C3HH 2UXDL 1KXLA 2B39A 4K2LA 1CKNA 1AN8A 5D65A 4A3GH 2A6ED 1TU2B 5LMNQ 1JR0D 3TMEA 2B2UC 4KTAA 3GTMB 3U4ZA 1QNKA 3EN2A 3MXUA 2VS1A 4BY7B 5C5LA 3E0JA 2B2WC 4KI0A 1MGSA 1E1OA 4GNXC 5CGKA 5C4HA 3PO3G 1HTLD 3NE5B 3MTSA 2KHSA 5DEHA 1LTRD 1O80A 4OHJA 3T51B 1J9OA 3ND8A 4WJ4A 1IL8A 2NN6I 4Z9CB 1WTRA 1NMFA 3HZXA 5E1FA 3CCQA 1QG7A 1YHQA 2R92H 4BY1H 3SHLA 3U50C 3S2DH 2JA7G 4HTHA 2ZXOA 1PLFA 4IJLA 5FLXc 3SE0A 4JI6Q 1OO9B 2NVYB 3GTJH 2XVSA 1SROA 4F87A 1B3QA 3HGBA 2PQAB 1JOOA 2MHVA 1V1OA 4RKLA 3GQBA 1NNXA 3H3VH 3SDZA 4MTNA 1B4OA 2A19A 1MBYA 3GTKB 4DV4Q 1B2TA 3T16A 1Y1WB 4PZ8A 2RHQB 4FXDA 2C5CA 1LT6D 5I2YA 3J80c 4WRDA 4LUVA 3VR4A 2LMCB 1HQRD 3CU7A 3K7UC 1Y8OB 3D8GA 4JI0Q 1X32A 3UE0A 1A2UA 2EOTA 1EY0A 3MFGA 3CCJA 3QOLA 4GNXB 3GV3A 3IAYA 3IFDA 4C3HG 1R9TB 2I5LX 3S1RH 5AFWA 2Y0SG 2NTTA 1ENAA 3FVQA 1CFMA 2B2TA 4A3GG 1SNPA 2VQFQ 2F0JA 5DM73 3CPFA 1E7ZA 3K5OA 2AMCB 4ALPA 3GTPB 2L55A 4L5QA 2F0GA 5GROA 1SNMA 5JJLA 1BF4A 2F03A 2NVQH 2KCNA 1YJ9A 3ITPA 4QJFA 3W1GA 1EU3A 1D2BA 3BG3A 3SK4A 2CVRA 4R4CA 1JCKB 1NBWA 5D14A 5FKAC 3OTOQ 2IY5B 1E22A 1HA6A 2H4OA 1A3VA 1EEFD 3G71A 4H0LC 4YWLA 1W6JA 1IYVA 5C6AA 4LF8Q 5M3MB 3LX0A 4NXMQ 5CBAE 2XIWA 1F9PA 1K3RA 4NPSA 4YWMA 4DAMA 3HOUH 2L5TA 5E4WC 1N34L 4GKJQ 3CMEA 1G6ZA 5JPNC 1F77A 3MEFA 1YIJA 4JOIC 4HIKA 3HOVH 2A6HC 3HOZB 2R7ZH 4X3KA 1SR3A 3D4WA 5D3IB 3Q22A 1DONA 2OXPA 2EIFA 4ME3A 4A3FG 2J7ZA 4E6IA 1SE2A 2SNSA 3R2TA 3Q23A 3CC2A 1ENCA 4ZQ3A 3R3OA 4A75A 3PO2G 1FL0A 2DN8A 1AE2A 3NP8A 3VR3A 4ZUJA 2M9VA 1W2BA 1WJJA 5EJWA 1C0AA 4K5WA 2CFMA 1GVPA 4IOCA 2F0OA 2GA4B 2UUAL 2UXBQ 3HOXB 2RDHA 4IFDJ 2BE5D 2K5HA 1XMQQ 3I73A 1ASYA 4O42A 3T56B 3UDGA 1TS2A 2Q8RE 2CQOA 2WV6D 1S72A 3I4OA 1STGA 4XIGS 1KQSA 4N9TA 2NVXH 3DEOA 4C2MB 5ELDA 1IYUA 2PO4A 4LUZA 4K6DA 3STBC 1H9MA 1CKMA 1SYCA 2VB2X 3OSOA 2DUDA 3TP7A 4PMWA 3NUCA 2HD3A 5ELFA 1XYIA 4H13C 5L37A 3MEHA 4DR4Q 2AUKA 2EVBA 3K6OA 4YHHQ 4G7HC 3NEMA 3S15B 4KMUC 3CCSA 1CHPD 2EXZA 5LHY1 3I56A 3I72A 1PTOC 1N8RC 1U4LA 3J81E 3D4RA 1QZGA 3A7AB 5J39A 1GHJA 1BBUA 1JOQA 3V96A 1V8QA 3TRZA 2D2CC 3KLSA 2QA4A 4LF7L 2PZUA 5KYIA 4ULLA 3ER0A 2EJGC 1LTGD 1LYLA 3ICEA 3WDNA 5J22A 4R4OA 4JI4L 2OCEA 4IUVA 4JI5L 2R7ZG 2PPBC 3CD6A 1WTXA 2MQHA 2R92B 1Y1VG 4DV7L 1QUQB 1EIGA 5HGTA 2JA6H 3AQQA 4POFA 4JBWA 5EQ0A 3S2DB 1HA5A 3C1EA 3J80E 2NN6G 4EVOA 1NR2A 3TZUA 2AWNA 3CW2C 1SYDA 1MKHA 2IX1A 5C44H 2VL6A 3BZDB 1F2LA 1JC7A 1ZYRC 2K14A 5HY6A 2FINB 1I4GA 1H9RA 1KRTA 1E2VA 5NUCA 4R8IA 4DUYQ 1EL0A 4A3JH 5EGTA 4Y7NH 4S3SA 1XNRL 2BA1A 5IT9E 1TWAH 3G6JB 3I4LA 1Z6HA 4OEMB 2CH4W 1SSOA 4OELB 1SNCA 4ZUIA 4OIKA 1GO3E 1BKBA 2Q2HA 3A5ZB 5BR8Q 2F0KA 1YNNC 1PTOB 2E8GA 2G9HD 2PQAA 2B2YA 4LFBQ 1VQMA 2IWHA 3M9BA 1SBBB 1WCMG 4I7ZC 2OF1A 1VF7A 1XXGA 2BA0A 1UWVA 4J15A 3HKZE 1CQFA 4TSSA 2B29A 2JN4A 1EZ6A 3ZYYX 4AYBE 3NELA 3E0EA 1OXXK 1SMYC 2IX0A 2X69A 3EFXD 1XTDA 2Q2IA 4EX5A 3PUWA 3K7AB 2WIIB 3TREA 5C4XH 5DM63 5I9OA 3NENA 1D7QA 1KAWA 2NZ1D 4GNXA 4BS9A 1A63A 3ERQA 5IYCH 2ALYB 1YZ6A 3JAML 4OGQC 1ZXTA 3FKIB 5BN5A 1IBLL 4DV1L 2JA5G 4AQYL 2F0HA 4A3EH 3M4QA 1PFMA 5M5YB 1FNUA 2AQ3B 1J6QA 4B3SQ 1TWCH 3I4MB 1I50B 1LV9A 2OQKA 1PH6A 1UUPA 4FXGC 4JCVE 1QVFA 1STEA 4G7ZC 5G3LF 4DAYB 4R1JA 3K5NA 3HOUB 4KHPQ 3BDOA 1FYCA 3J7A5 4IUQA 2LS01 2CW0C 5C44G 4LF4Q 1CKNB 1CKOA 1PH8A 3HOYG 1EQTA 2JJQA 4R9WA 1IBMQ 4C1NI 2F0MA 4P74A 1NR4A 3RR5A 2UUCL 4DF7A 3KLWA 3ULPA 4A3JG 1H9KA 1GUNA 1QVGA 1EYGA 2NVTH 4L5SA 1HNZQ 4JBJA 3PF5A 2WB1E 1XMOL 4DKAC 4LF9Q 2JSOA 4HJ9A 1K8MA 5I2XA 3GTMH 1MSGA 4BY7H 4ID6A 2QW7A 2VQEQ 2EDGA 2K04A 2HCCA 2O5JC 4XYOA 2ZTCA 2B8GA 4K8IA 1HNWQ 1NMGA 2F0DA 2SDFA 2R7DA 4PMCA 1GUTA 1FJGQ 1EUJA 3OWFA 2RCFA 1S3OA 5IGFA 4DK0A 1Y69U 1K8AC 3NK9A 4CJ0B 5I6WA 2ZJRA 4X62Q 1QCBD 1X3GA 4G4KA 2WAQE 1QNUA 2O4XA 4KKSA 2IHFA 2L15A 4FO2A 1FR3A 5A35A 2B8FA 3K81C 1L0WA 4KHZA 4A3EG 4JYAQ 5A2QL 4L63B 1LT5D 3CCUA 1JB3A 2HDMA 3N52A 2K5WA 4QL5A 4NKLA 1E3PA 2MJ8A 3C3LA 2WACA 3M3YB 1RCVD 4HAEA 2JE6I 4TKOB 3GTKH 4NW2A 4X3UA 3PSIA 1Y1WH 2FHTA 3CC7A 3IL8A 1G51A 4PZ7A 4CJ1B 1AW7A 1I3QB 4ILWA 1KNAA 3I91A 3JAME 3FPPA 2K28A 3KOJA 4LFCL 2JA6B 1T5XD 4C3JG 3UDFA 3VYUA 2XN9C 1KHIA 1B50A 3L2PA 1YNJC 3J7YW 4ABNA 3W1BA 3G4SA 4XTCS 2NZOA 4RGNA 4JI8L 5JAVA 1HFNA 2QDBA 3SGIA 4XQNA 1S5DD 1FGBD 3DWAA 2VW9A 1V1PB 1EFWA 1Q90A 1QUQA 3S1MB 1SFOH 1TVXA 4BY7G 2Z6BA 4CHTB 3GTPH 4XT1B 1YVCA 3A7LA 1SE8A 4J1MA 1AP0A 1N9WA 1D8LA 2MO1A 1K73C 1XWEA 4CBVA 1SYBA 3H6MA 4DNIA 1CA6A 5EBCA 3FDTA 4JI3Q 3PUYA 2TSSA 5ELCA 4JI1L 1EQVA 1X56A 3PIPA 4GLVB 5IYBG 2D0OA 3RZOB 2EPBA 1Q1EA 2F0LA 4GOPC 1SXTA 4UDUC 4RG1A 1A3UA 1JOKA 4ZYSA 3GTOB 3HEJA 1EY9A 2KCMA 2LKVA 4OXPA 1KD1C 3H3VI 2N88A 4ZRZA 4EQ5A 2DGYA 1MJEA 2EYLA 4JI7L 2KA7A 5D3DA 4DV0L 4IURA 4A3DB 1HUNA 1QVCA 3HKZB 3CCLA 4GLXA 1EU4A 5IGDA 1WFQA 3DEPA 4DR6L 4AYBB 1N36Q 2MGSA 3HOWB 1PZKD 1X3FA 2RBMA 4LWCA 1L0XB 2N49A 2EE1A 3V2TA 4CKCA 1HZBA 4RH6A 1XTCD 4RCOA 3RLNA 2XWBB 2JP1A 2EJMA 1O7YA 5A2QE 4K2KA 4B3RL 3HOXH 5CV4A 2MUYA 3TBIB 2IPKD 3MHBA 2LFNA 2ZM6L 1LO5D 1HZ9A 4IN3A 4J8QA 5LMUQ 1JQYD 2K5VA 3CXCA 5KNCA 2Q8TA 4O1NA 1VS0A 4RCNA 1S40A 5KGUA 1X3PA 5HURA 2F0WA 1NSNS 1HNXQ 1DJRD 1RJTA 3QIAA 3EQLC 4C2MH 1ZEQX 3R93A 3KDFB 1PYWD 4DAYA 1N34Q 1RTNA 3T1YL 5IP9H 1BOSA 1KABA 2Z4HA 5I4DA 2Y0SE 2EY6A 2PI2E 1A0IA 3P20A 4LF5Q 5JVG3 3S15H 1CUKA 1OXUA 1G91A 3RNUA 4JW0A 5KNDA 3GTGB 1TIID 5M3MG 1VQ8A 4BXXH 2UUAQ 1SE4A 1X3QA 1Y8PB 2NBFA 2WB1B 2YYZA 3LGJA 1PH3A 4B3TL 3HG9A 4DR5L 4Q5VA 1BCPF 2A68D 4A3CH 1KLGD 1M1KC 5C0XH 1STNA 3HOZG 1W6KA 3CCMA 4XYQA 3J81c 2D5DA 2L4NA 3PUZA 1PRTF 2PMZB 5JEAH 2RSNA 1GUWA 1XPRA 1DOMA 2B3GA 5CMDA 4XDXA 3HP3A 5CR3A 3R2IA 1STAA 3QG1A 3KF8B 4P73A 4EQNA 1YHBA 4DV2L 4G57A 3EVQA 1PH7A 2CH4A 2XWJB 1Q81C 2WAQB 2ENBA 2JYOA 4ZLTF 3HOXG 3NBHB 4DPGA 2Q2TA 1HJPA 1VQNA 5IYDH 4K5VA 4DAVA 4DK3C 3I4NB 1KDAA 4JVZA 3VYTA 2K75A 4RKBA 2Z6KA 5AJ3Q 2K7VA 5K5PA 3MFYA 4HJAA 1LLRD 3TQYA 2AQ2B 5CV7A 2WKCA 3Q6SA 4U68A 5EKIA 1GXDC 2MNAA 2ES2A 1PTOH 2KCTA 1PH2A 2HIVA 4C1NK 3LWEA 4XT3B 4A3MG 1XX8A 4JI4Q 2RSOA 4NXNL 1DGSA 4JI5Q 1STHA 4KY6A 3C2PA 4DV7Q 1J8IA 4MHEA 5IT9c 3K0YA 3CKIB 2FFKB 3T4AC 2K32A 1S5BD 5EKLA 1SFOB 2XRQD 1QILA 2EYJA 4IPDA 1U9RA 3K7AH 4HR7B 4N8FA 3DWQA 3KBGA 5CC4A 2XRSD 3TS0A 1N33L 3AMUA 2DNEA 1YI2A 1N32L 1KAAA 5EBDA 1GOZA 5IWAL 3FKIH 1II3A 1V1PA 3S2HB 3VR2A 1G2SA 3M7GA 4F8MA 1IXRA 1D6EC 2G9DA 5T1GA 4X66L 5FLXL 1IBKL 5M5YH 4MZ9A 5C0XG 3LNNA 1TWFB 4CDCC 3GTLB 3I4MH 1I50H 1IW7D 1PFBA 3PV0A 3TS2A 2R92G 1G6PA 1CT1D 1GUGA 2DY7A 3D6CA 4DFAA 4BY1G 4C3IH 3OWEB 1B3AA 1VQEA 4JPBW 2P5ZX 4GN5A 2FJ2A 3G7LA 1C4QA 1IZ6A 5IOCA 1B44D 4OO1H 1LACA 3M85A 1FGUA 4HMIA 4JI2L 2B2VA 3N6RA 5DLQE 3MA2B 3AFPA 3PO3B 3FMCA 1X3EA 5IYDG 1VQIA 2UXCL 1U5KA 2KECA 3ERSX 3DUZA 3PMFA 4R8NA 4QCLA 1VQKA 3LWUA 4HIOA 1XNQL 5CV9A 1B7YB 1IBLQ 3L9AX 1DXMA 4DV1Q 2JK8A 1HXYD 2I5MX 4P71A 2AHOB 2F3VA 5E7NA 2E76C 1VQ6A 3S14B 2XGTA 1A3TA 1SMXA 2Z8LA 2E74C 2IW3A 1QJOA 4FXKC 1Z7TA 1VQOA 5M5XB 1Q8KA 3CF5A 1MD2D 4QQBX 1OTCA 2KEEA 4YY3L 1C9OA 4KLKA 2JQOA 3TP8A 3Q24A 1T5EA 3HFZB 1K9MC 3VR5A 4DK6C 1Q8IA 4DR1Q 5CV6A 2LY7A 2TMPA 3IRBA 1GUSA 2HT1A 5KNBA 3MZ5A 2UUCQ 1ML0D 3DM3A 2F0FA 1BVSA 3FKIG 5HGQA 3MVVA 4PV1C 1PFSA 4P2CB 2F0QA 5JJKA 3H3VC 3KDFA 2HHHL 3I4MG 4MNOA 3M4OB 3H91A 2BH2A 1BUVT 3ZJYC 5C3WA 4K0KQ 4LK1C 3HOUG 3M3YH 3X3MA 3RUZA 5FLMH 1EEID 1LTSD 2NZHA 4DV6L 3HOVG 3PUVA 2I46A 2IL8A 3EBEA 4A3LH 1I3QH 1R4PB 4WFN3 4A3KB 3STBD 4QUCA 3SK5A 5EPJA 3K5MA 5FO8B 2KHJA 4X64L 2ZTEA 2F0NA 1M4VA 2EYFA 4QIWE 1EYAA 2UU9L 3R8BA 1XJVA 3VYRA 1EOVA 1LM0A 2Z4IA 2Z1CA 1QOHA 2JA9A 1PTOD 2VQFL 5JVH3 3S1MH 2RHSB 3JAMc 3AB9A 3AFQA 3CMAA 4DU9A 1WI5A 3UI2A 3TP6A 3HKSA 1BXTA 2EYMA 4TRDA 3NPPA 1R4QB 4ZAIA 4Q0FA 4RGMA 4RGTA 1IKLA 3KF8A 2F0SA 4L5RC 2PW7A 4R4TA 1TY2A 3I2ZA 1VQ4A 4K14A 2HQEA 1Q82C 3PGZA 4B9WA 3J7AF 3NBHA 3J7AV 3RZOH 1F9QA 1A6XA 3OTOL 3ND9A 4F88A 2V1CC 4N9PA 3GTOH 3PO2B 4LFCQ 3F2DA 3BU2A 2B2UA 1ICFB 3S1QB 4LF8L 1OXTA 1L2FA 1MI2A 1JJ2A 1I94Q 1ZYRD 2MPMA 4NP5A 3CCVA 2B2WA 1DM0B 5E4XA 4OWTB 3NBIA 4A3DH 1HHVA 1ENFA 2M00A 4GKJL 5C4ZA 4HN7A 4CDEC 1Q46A 5FLMG 1C48A 4KKUA 2QEXA 4HMJA 1J5EL 3NHHA 1U4MA 3MXGA 5C4JB 1CZGA 3HOWH 2EY5A 1PZJD 4KJNA 3FP9A 4QF4A 4X65L 5CORA 4I65A 3I70A 3KLSX 5C5MA 2QKIC 2BOSA 3DMUA 3W5OA 4DGZA 2JA6G 4C3IB 1JE5A 1LTBD 3MWYW 3H0GB 4UY8C 3DHQA 1HCZA 1Q3LA 4TQUS 2SNMA 2PZTA 1SLJA 1F2ZA 2A69C 2D9UA 3E9HA 3K8AA 4OL7A 5IY0A 1SMYD 2FMMA 5IE8A 4A76A 3A8KE 4NB3A 1V9PA 1IYJB 1VDZA 5IODA 3T13A 2EY1A 4JI7Q 3GD7A 4FNFA 4HEDA 2RDFA 2QILA 4IFDH 4DR3L 1ONLA 3OHXC 5BN3A 2K4KA 1YJWA 3E5SA 4DR6Q 3P7JA 4A4IA 2E5LQ 1NCVA 1T9HA 3ULLA 2Z0SA 3KF6B 3SR1A 4DV3L 4L5TA 1PH9A 3OYYA 1VQPA 1EWCA 2VUMB 1U0LA 5M3FB 5DAUA 3GTGH 3MXNB 4J6HA 4FYDA 3K80C 2LXJA 3F2CA 2CW0D 3J81i 4B3RQ 1TWHB 5J3BA 3J81j 4A3IH 1HR0L 1I4PA 1L1OC 2ZM6Q 4HJ7A 3OMGA 5C4XG 1EWHA 4GN4B 2YTYA 1GD7A 4A3DG 3HKZG 5IYCG 5JPMC 3T53B 4JV5Q 4IPHA 2L12A 3RMHA 2EYOA 1Z9FA 4AYBG 2UUBQ 1JJCB 2HIXA 5H1SE 2JXMB 4QMGA 5C3EB 2AKWB 3HOWG 1LABA 2QDLA 3TSSA 2XSCA 5GAGC 1Q7YC 3NWTA 5ELNA 3SK8A 3T1YQ 4RHRA 3GO5A 1VMPA 2UXDQ 3DM1A 4HJ5A 4JBKA 3OMCA 3PIO3 3OW2A 3IKJA 3V05A 2F0VA 3J80i 4RMFA 1SNDA 2R3ZA 1TS4A 3SEBA 3NSWA 3QWNA 1SYGA 2PQEA 4DV5L 3A55A 3A54A 1PHJA 4DUYL 2GN5A 2HDLA 3EA6A 1UE6A 4JOIA 3I4NH 2CWAA 2CCZA 4OWXB 4M8AA 4APVA 3QB3A 5IGBA 1KL9A 2VB3X 2ZJQA 5IP7H 1WTHA 1LTTD 1K83H 4UPAA 4DR5Q 1IKMA 5M5WB 4BBRB 3CRKC 3OIPA 1AZPA 2PI2A 4AH6A 2J0TD 2K01A 4JG2A 4PQXA 1O7LA 4LFBL 4IFDG 3K59A 3B6YA 3KBXA 1YITA 4QY7A 1VQHA 2KENA 2BH8A 1PYBA 1L1OB 2ZT9C 4P75A 1WTVA 1QWYA 4OIJA 3BZCA 2WINB 1I4HA 3KLRA 1E2WA 2WKDA 1Q86C 2NUCA 4OONA 4QIWB 4DV2Q 1WVLA 2E2DC 3I8ZA 4QB4A 3DXJC 2ICEC 4DN4M 5C0XI 1CK1A 5BN4A 4F7XA 2KOLA 2WB1G 3AYHB 3CAMA 2N55A 3OIQA 3K58A 4HSVA 1HFGA 1A8VA 4IJHA 4PG3A 4A93B 2KBNA 3S2HH 1BCPC 1P16A 4HCSA 4UP7A 1F9RA 1X9NA 2OTJA 1TWFH 3M4PA 3GTLH 4IPCA 5FJ8H 3PIP3 1JT8A 1PRTC 1TT2A 1BO0A 1EY6A 1P8LA 2EYPA 2O2LD 4NXNQ 4LAAA 2BCOA 4OX9L 1Z47A 4KHPL 1JJGA 1OXSC 3TEHB 1VQCA 1OXVA 2WAQG 2F0PA 4NDXA 3BS1A 1SNQA 2KEDA 2L0CA 2E2HH 3PO3H 4PMBA 2OWOA 1H9SB 1KDBA 1BDOA 5COYA 1C8CA 3BZKA 1Y1WG 4BBSB 1WOCA 4HIMA 3I4NG 1MJCA 3VDYA 4OWWB 4KD3A 4HIDA 1UEBA 1UE1A 3K0XA 4EGVA 1JORA 3KYHC 5IP7G 1N33Q 4LF6L 1EWIA 1S5ED 1N32Q 4JBMA 3F2UA 1WTOA 1JMCA 2K50A 4GN3B 5IWAQ 2F4VL 1TS3A 1E24A 2JA8B 4X66Q 1W3SA 5GQOA 2KCCA 1SJHD 3S14H 2A6EC 2JA7H 2OQ0A 4JK1C 1K0RA 4ZK9B 2QEJC 5T1IA 5M5XH 4V190 4NMZA 2IHEA 4FF1A 1O78A 2SOBA 5JJZA 1Q12A 1STYA 1HQMC 4GOPB 4IQZA 1AE3A 1K0SA 2H5XA 2EXDA 5CYUA 3RZDH 2B63B 1HNWL 1X6OA 1FJGL 3F8TA 3URYA 1GJXA 1D5ZC 2RVLA 1MHWC 3EROA 2FMCA 5ISRA 3PF4A 4A3BB 2ID0A 4UP9A 3G6EA 3Q0AA 2R61A 4ME5A 2KJXA 1VQ9A 3FHWA 2EZVA 1X65A 1YBYA 2Z9HA 2UXCQ 2B2YC 3NTHA 1PXUA 4ZCKA 1FD7D 4YCVA 5FJ8G 4CJ2C 3M4OH 4OO1I 1RL2A 5IGGA 1XNQQ 2DNCA 3L7ZC 1LT3D 2A73B 4A3IB 2N3SA 4EQOA 2R93B 3BYYB 1HZAA 2PZWA 2G5DA 3KF6A 3FEWX 1K8GA 1VQ7A 5LL6S 1SN8A 3VR6A 2YTXA 3MXNA 4A3KH 4DUZL 1Q1BA 4YY3Q 3U9SA 2LSSA 2XTIA 2ZXPA 3CCRA 4DNTB 4WJ3M 1HR0W 3H09A 4LUOA 4MN3A 3JAMi 2K5DA 3C46A 3TZDA 4B08A 2F52A 5CBEE 2AQ1B 1HPCA 1VMCA 3A8JE 2DJFC 4FF4A 3HS0C 4TVAB 4ZKCB 1EYDA 2LXKA 1LTAD 2HHHQ 4KN4C 2HQLA 1JICA 4KK7A 3CCEA 4PZ6A 1SYEA 4KD4A 1YHAA 4LF7Q 1X55A 1K83B 1UE5A 4B3ML 2CHBD 1BNZA 4KJOA 5F2DA 1WYDA 5IP9G 4A3FH 4JI3L 4DV6Q 2A1AA 3CPWA 1ASZA 3S1NB 1FNWA 2EQSA 1D1IA 3S17B 4YIJA 2NB0A 3VA5A 1RD9D 2RCNA 4LMQD 4RWSC 3AEVA 3PO2H 4LFAL 3I90A 4HCEA 3I7FA 3S1QH 5JOBA 4H44C 4X64Q 1AFPA 3GV6A 5ELOA 1IW7C 1BBWA 3TDQA 3NWSA 2UU9Q 3NQTA 1I4RA 4FF3A 3BDCA 1ILQA 4BXXG 1ESFA 3OW7A 4CDFC 3J81L 1PH1A 3ONAB 4R4IA 1D5XC 1JE4A 4QGUA 1RHPA 4RFBA 3A56A 1L1OA 1HRJA 1F2YA 4A3CG 2XNAC 1N36L 5C4JH 1XNRQ 3QO2A 3M4YA 2A5HA 1HH2P 3BVMA 1VQBA 1LTLA 2YU9H 1TXYA 4A3KG 2PNRC 5FK9C 1PDQA 5JEAG 3UE1A 1M90C 1I6HB 3KJPA 3H0GH 1JWSD 4DR7L 4HJ8A 4IUTA 1JB7A 3RLOA 3J80L 3I55A 3T1HL 4KHVA 1PA6A 2F4IA 5LMUL 4GKKL 4UAIA 2V4DA 4FF2A 2BE5C 1LUZA 2ASBA 1YJNA 2IX3A 4IO9A 2E2HB 2F0IA 3CC4A 4XQJA 4RHSA 3TN2A 4IZ8A 1HNXL 1WD0A 3A0JA 1SDFA 2KUMA 4JC0A 1GUOA 2GVAA 2L1BA 3A8IE 4DR2L 3SXHA 5IT9L 2E75C 1Y14B 1YEZA 1U4RA 4AQYQ 1J5EQ 1Y1VH 3VYSA 3HRZC 5CV5A 4POGA 5LMNL 3U4VA 4LF5L 3KK7A 4UP8A 2VUMH 1IHZA 2C9OA 4X65Q 1H9SA 2JA7B 2NN6H 4DXFA 5M3FH 1B53A 1D5MC 3E6ZX 1KRSA 2WFWA 1QE6A 2I07B 3K57A 2H1EA 2RQXA 2F1MA 3CHBD 4P72A 4WJWA 2YTVA 2BDNA 1EYCA 1TWHH 4YWKA 4I7AA 2A6HD 1KTKA 3RZDB 4L6TB 4AIMA 1L0YB 3NXWA 1FNVA 2EJFC 1DZ1A 1H9JA 3VA7A 2L9HA 3W3AA 2F0UA 4GS3A 2RDGA 5C3EH 2E2IH 1V1QA 1NAPA 3D4DA 2F3IA 3AU7A 2ZTDA 5GADC 4GOPA 1VQJA 4DR3Q 1EIFA 4A3MB 4IPGA 1HZCA 3D0FA 1WCMH 4C3HB 4JI6L 1ESRA 1B8AA 1MIUA 4C3IG 2Y0SB 1XMOQ 1EFID 1EZ8A 2MFIA 3H0GG 4M1UB 4DV3Q 4A3GB 1ILPA 5LL6X 3P1HA 4KY5A 1VQDA 1F2MA 4OO1G 1PV4A 4GZYC 1SE3A 1EY5A 4DV4L 4IFDI 4ZKBB 1GKHA 5AJ3L 4B9XA 1PH4A 3NQIA 4N8X1 1HR0Q 5M5WH 5FLXE 2I5HA 4BBRH 4X3SA 2ICIA 4JI0L 1TQOA 4LNQA 1AZQA 2JA5H 1RIPA 5I9PA 1UAPA 2PCFB 1A2TA 3NTIA 4IUNA 1G2TA 2ZXRA 3WOEA 4BY1B 1EIHA 5KEEA 1B9NA 4CDDC 1S5FD 2A74C 1A15A 1SNOA 2FXQA 4XQQA 5KIXA 2VUMG 5JJIA 1BQQT 3EJIA 3D31A 5G3LD 5M3FG 1WTWA 1SAPA 5K36H 1NUCA 3L0OA 1FVIA 4CGYB 2X6GA 3IFTA 3RN5A 3GTJB 1CQVA 1JWMD 4DNRB 1TY0A 3HOYH 2WP8J 4DV5Q 1PH5A 4FVMA 3MC0B 4PNYA 4LJZC 4IOAA 1G291 3KJOA 5ELBA 4A93H 4A3FB 3BDLA 1XPUA 2ZJPA 4L8JA 5DNFA 3OOCA 2MP1A 2GVBA 3MXPA 5EKKA 1LTID 5TSSA 3Q8DA 2F3WA 2KHIA 2E2JH 5C3EG 4LW1A 1E0BA 2AUJD 1K3BC 3FRPB 4NXML 3S16H 3PQIA 1PVOA 2M2LA 3DWPA 3GTQH 4JI8Q 4BA1I 3S1RB 1GHKA 1E2ZA 3H15A 1BR9A 1QZHA 2JEAI 5M9OA 1WD1A 5FO7B 1UE7A 4CKBA 2NTSA 4BBSH 1KC8C 5EAYA 4R4QA 1YNND 5FO9B 4A3LG 1UEAB 2YU9B 1PMRA 4KN7C 1VQGA 4KKTA 2D62A 2HUGA 2NVQB 2CKZB 1TWGH 3CP0A 1I4QA 4BBRG 4JI1Q 5GAHC 4K5XA 1KLUD 4DAPA 2F0TA 3S9WA 2PNHA 3RD4A 2I0QA 2K5QA 2JA8H 4X3TA 2PYKA 2ATWA 2UXBL 4XXEA 1KIXA 2C35B 1XMQL 2X6LA 4IALA 1PTOF 3ULJA 1CA5A 2OEOA 2Q2UA 1LT4D 4DXGA 1TKWB 5I6YA 2N8NA 1ET9A 4X6AH 1CHQD 3QJYA 1CSPA 3GDEA 5K36G 1CM9A 4OX9Q 4DV0Q 2B63H 1RKNA 1STBA 1NY4A 5ELEA 1KDCA 3HOVB 3I3CA 1QB5D 5KYLA 4BWGB 4DR1L 2R7ZB 4A3BH 2Z6KC 3O13A 2QF7A 4O0AA 2VNUD 3M7NA 2HCIA 1Y1VB 1VCIA 3BVZA 4DR4L 3CQZH 4A93G 2R7FA 3TP5A 3A5UA 3BVGA 2OT2A 3DLLA 4C3JH 4YHHL 2O5IC 3WWVA 3BYTB 1U4PA 4LF6Q 1CZWA 3K5LA 2RKSA 1MSHA 2F4VQ 4RA8A 1EY8A 2B2TC 2A69D 2CWPA 1HTPA 1SEBD 5EPKA 2R93H 4K0KL 5LMNW 1EY7A 4QUFA 2NYZD 4G7OC 4K6LA 4KV6A 4UHVA 4HSPA 3H94A 3KFUA 3UDIA 3SK6A 2PW5A 2E2IB 2NVXB 2VXWA 3BJUA 2PMZE 4BBSG 3C1FA 3W2DA 3F1ZA 1WCMB 1B1ZA 5IYBH 3E3XA 1ET6A 1EY4A 1X54A 3E9IA 1G8ZD 2J4XA 4H7BA 1PYSB 2JA8G 3UDXA 1PFNA 1KNEA 3WOFA 5IGCA 4YCUA 3PIOA 5C0XJ 1JWUD 2K1BA 2Q8IB 1NJIC 1DOKA 4MIUA 3D6WA 1V43A 4CKEA 1K8OA 1TR5A 2NVYH 3D3RA 1VQAA 5JEAJ 4B3TQ 2B2VC 2SEBD 5BR8L 2B63G 3J7ZC 4RGOS 3S1NH 2JA5B 1TS5A 2N78A 2JEBI 3CRLC 1I6VC 2IT1A 3MAQA 1AH9A 1VF5C 3S17H 2YV5A 3KUPA 3PUXA 4RAUC 4A3BG 4DUZQ 3U58A 2VY3A 5KRUA 3JC66 4C56C 1CI3M 1SJED 3U9OA 1DOLA 2VZAA 1DYQA 1CSQA 2K03A 2OTLA 2DY8A 2QCPX 2K5NA 3P75A 3OPOA 1I94L 4WORA 1R9TH 5C44B 2K6AA 4BA2I 3HOYB 1H95A 4O2DA 2MO0A 4A3IG 1RODA 2R93G 2QGQA 2F0EA 4MTKA 5CV8A 1Y8NB 4A3JB 1SRUA 3PCOB 5J1ZA 4DK1A 4Y7NB 2D0PA 2IJ0A 1EIYB 1M8AA 1WTQA 4EQPA 1TWAB 4B3SL 1K28A 2AWOA 1B9MA 2E2JB 4B3MQ 1YNJD 3S16B 1ICWA 1S5CD 1I6HH 1NE3A 1YNXA 1RTOA 3GTQB 3A74A 4GLAC 2L11A 4KY7A 4YCWA 4LF4L 1AEXA 1UNSA 4DA2A 3RN2A 4LFAQ 3X3NA 1VQFA 5IIFA 2RF4A 4ODGA 5M3MH 1IBML 4FP5D 2CQAA 2K33A 4H02A 1D1KA 5GAEC 1DD2A 2DJGC 3L3OC 1O7IA 5E3FA 5C4XB 1B70B 1CTMA 2K05A 1VQ5A 1EQQA 2A8VA 3S24A 4FDBA 1TWGB 2EY2A 1BCPD 3EIVA 5IGEA 1C7YA 3HOZH 1HNZL 1F9SA 1PZID 1BBXC 1IBKQ 5FOBB 2RA4A 4U673 2E5LL 4LF9L 4A3EB 2BDOA 3QOJA 3QR8A 1NTGA 1EOTA 4K8JA 1SYFA 1PRTD 4Y52H 1RF2D 2VQEL 1TWCB 1HUMA 1WTPA 1BCPB 1E1TA 1O7ZA 3G48A 2K52A 1DCZA 3F2BA 4V0BA 4DR7Q 1EQRA 3FPUB 1ZKOA 1VQLA 3T1HQ 1A62A 1XPOA
chains in the Genus database with same CATH topology
1PRTB 3RLFA 1RDPD 2KVMA 4IUPA 2A68C 4IUUA 5EPLA 2NWGA 3CQZB 3SVMA 1I4XA 2KQ3A 2EYHA 4C3JB 3GP7A 1S4ZA 3NTKA 2R6GA 5C3XA 2NVTB 2B39A 4K2LA 1AN8A 5D65A 2A6ED 1TU2B 1JR0D 3TMEA 2B2UC 4KTAA 3GTMB 1QNKA 3MXUA 4BY7B 5C5LA 3E0JA 2B2WC 4KI0A 1MGSA 5CGKA 5C4HA 1HTLD 3NE5B 3MTSA 2KHSA 5DEHA 1LTRD 1O80A 4OHJA 3T51B 1J9OA 3ND8A 1IL8A 2NN6I 4Z9CB 1WTRA 3HZXA 5E1FA 1QG7A 3SHLA 4HTHA 2ZXOA 1PLFA 3SE0A 1OO9B 2NVYB 2XVSA 4F87A 3HGBA 1JOOA 2MHVA 1V1OA 4RKLA 3GQBA 3SDZA 1B4OA 1MBYA 3GTKB 1B2TA 3T16A 1Y1WB 4FXDA 2C5CA 1LT6D 5I2YA 4WRDA 3VR4A 2LMCB 1HQRD 3CU7A 1Y8OB 3D8GA 1X32A 1A2UA 2EOTA 1EY0A 3MFGA 3QOLA 3GV3A 3IAYA 3IFDA 4C3HG 1R9TB 5AFWA 2NTTA 1ENAA 3FVQA 1CFMA 2B2TA 1SNPA 2F0JA 5DM73 3K5OA 3GTPB 2L55A 2F0GA 1SNMA 1BF4A 2F03A 2KCNA 3ITPA 1EU3A 1D2BA 3BG3A 3SK4A 2CVRA 1JCKB 5D14A 5FKAC 1HA6A 2H4OA 1A3VA 1EEFD 4H0LC 1W6JA 1IYVA 5C6AA 5M3MB 3LX0A 5CBAE 2XIWA 1F9PA 2L5TA 5E4WC 1G6ZA 5JPNC 1F77A 2A6HC 3HOZB 4X3KA 3D4WA 5D3IB 3Q22A 1DONA 2OXPA 2J7ZA 4E6IA 1SE2A 2SNSA 3R2TA 3Q23A 1ENCA 4ZQ3A 3R3OA 2DN8A 3NP8A 3VR3A 4ZUJA 2M9VA 5EJWA 4K5WA 2F0OA 2GA4B 3HOXB 2RDHA 4IFDJ 2BE5D 3I73A 4O42A 3T56B 1TS2A 2Q8RE 2WV6D 1STGA 4XIGS 4N9TA 3DEOA 4C2MB 5ELDA 1IYUA 2PO4A 4K6DA 1H9MA 1SYCA 2VB2X 3OSOA 3TP7A 4PMWA 3NUCA 5ELFA 1XYIA 4H13C 3MEHA 2AUKA 2EVBA 3K6OA 4G7HC 3S15B 4KMUC 1CHPD 2EXZA 5LHY1 3I72A 1PTOC 1U4LA 3J81E 3D4RA 3A7AB 5J39A 1GHJA 1JOQA 3V96A 1V8QA 2D2CC 3KLSA 2PZUA 5KYIA 4ULLA 2EJGC 1LTGD 3WDNA 5J22A 4IUVA 2PPBC 1WTXA 2R92B 1EIGA 5HGTA 4JBWA 5EQ0A 3S2DB 1HA5A 3C1EA 3J80E 2NN6G 4EVOA 1NR2A 3TZUA 2AWNA 1SYDA 2IX1A 3BZDB 1F2LA 1JC7A 1ZYRC 2FINB 1I4GA 1H9RA 1E2VA 5NUCA 4R8IA 1EL0A 5EGTA 4S3SA 2BA1A 5IT9E 3G6JB 3I4LA 1Z6HA 1SSOA 1SNCA 4ZUIA 4OIKA 2F0KA 1YNNC 1PTOB 2G9HD 2B2YA 2IWHA 1SBBB 4I7ZC 2OF1A 1VF7A 1XXGA 2BA0A 1CQFA 4TSSA 1EZ6A 3ZYYX 1OXXK 1SMYC 2IX0A 2X69A 3EFXD 3PUWA 3K7AB 2WIIB 5DM63 5I9OA 2NZ1D 4BS9A 3ERQA 3JAML 4OGQC 1ZXTA 3FKIB 5BN5A 2F0HA 1PFMA 5M5YB 1FNUA 2AQ3B 3I4MB 1I50B 1LV9A 1UUPA 4FXGC 1STEA 4G7ZC 5G3LF 3K5NA 3HOUB 3BDOA 1FYCA 4IUQA 2LS01 2CW0C 1EQTA 4R9WA 4C1NI 2F0MA 1NR4A 4DF7A 1H9KA 1GUNA 2JSOA 1K8MA 5I2XA 1MSGA 4ID6A 2EDGA 2K04A 2HCCA 2O5JC 4XYOA 2B8GA 4K8IA 2F0DA 2SDFA 4PMCA 1GUTA 3OWFA 5IGFA 4DK0A 1Y69U 3NK9A 4CJ0B 5I6WA 1QCBD 4G4KA 1QNUA 2O4XA 4KKSA 4FO2A 1FR3A 5A35A 2B8FA 4KHZA 5A2QL 4L63B 1LT5D 1JB3A 2HDMA 3N52A 2K5WA 4NKLA 2MJ8A 3C3LA 2WACA 3M3YB 1RCVD 4HAEA 2JE6I 4TKOB 4NW2A 4X3UA 2FHTA 3IL8A 4CJ1B 1AW7A 1I3QB 4ILWA 1KNAA 3I91A 3JAME 3FPPA 2K28A 2JA6B 1T5XD 4C3JG 3VYUA 2XN9C 1B50A 1YNJC 3J7YW 4ABNA 4XTCS 4RGNA 5JAVA 1HFNA 2QDBA 4XQNA 1S5DD 1FGBD 3DWAA 1V1PB 1Q90A 3S1MB 1TVXA 4CHTB 4XT1B 3A7LA 4J1MA 1AP0A 1XWEA 4CBVA 1SYBA 3H6MA 1CA6A 5EBCA 3FDTA 3PUYA 2TSSA 5ELCA 1EQVA 3RZOB 2EPBA 1Q1EA 2F0LA 1SXTA 4UDUC 1A3UA 1JOKA 4ZYSA 3GTOB 3HEJA 1EY9A 2LKVA 2N88A 4ZRZA 2EYLA 2KA7A 5D3DA 4IURA 4A3DB 1HUNA 3HKZB 1EU4A 5IGDA 3DEPA 4AYBB 2MGSA 3HOWB 1PZKD 2RBMA 1L0XB 2EE1A 3V2TA 4CKCA 4RH6A 1XTCD 4RCOA 2XWBB 2JP1A 2EJMA 1O7YA 5A2QE 4K2KA 5CV4A 2MUYA 3TBIB 2IPKD 3MHBA 2LFNA 1LO5D 4IN3A 4J8QA 1JQYD 5KNCA 2Q8TA 4O1NA 4RCNA 5KGUA 1X3PA 5HURA 2F0WA 1NSNS 1DJRD 1RJTA 3QIAA 3EQLC 1ZEQX 3R93A 1PYWD 4DAYA 1RTNA 1BOSA 1KABA 2Z4HA 5I4DA 2EY6A 3P20A 5JVG3 1OXUA 1G91A 5KNDA 3GTGB 1TIID 1SE4A 1X3QA 1Y8PB 2NBFA 2WB1B 2YYZA 3HG9A 4Q5VA 1BCPF 2A68D 1KLGD 5C0XH 1STNA 1W6KA 4XYQA 2D5DA 2L4NA 3PUZA 1PRTF 2PMZB 5JEAH 2RSNA 1GUWA 1DOMA 5CMDA 4XDXA 3HP3A 5CR3A 3R2IA 1STAA 3QG1A 4EQNA 4G57A 3EVQA 2XWJB 2WAQB 2ENBA 2JYOA 4ZLTF 4K5VA 4DAVA 3I4NB 1KDAA 3VYTA 4RKBA 5K5PA 2K7VA 3MFYA 1LLRD 2AQ2B 5CV7A 2WKCA 3Q6SA 4U68A 5EKIA 1GXDC 1PTOH 4C1NK 3LWEA 4XT3B 1XX8A 2RSOA 1STHA 4KY6A 3C2PA 1J8IA 4MHEA 3K0YA 3CKIB 2FFKB 3T4AC 2K32A 1S5BD 5EKLA 1SFOB 2XRQD 1QILA 2EYJA 1U9RA 4HR7B 3DWQA 3KBGA 5CC4A 2XRSD 3AMUA 2DNEA 1KAAA 5EBDA 1GOZA 1II3A 1V1PA 3S2HB 3VR2A 1G2SA 3M7GA 4F8MA 5T1GA 1D6EC 2G9DA 5FLXL 5C0XG 3LNNA 1TWFB 3GTLB 1IW7D 1PFBA 3PV0A 1CT1D 1GUGA 2DY7A 3D6CA 4DFAA 3OWEB 1B3AA 2FJ2A 3G7LA 1C4QA 5IOCA 1B44D 4OO1H 1LACA 3M85A 4HMIA 2B2VA 3N6RA 3MA2B 3PO3B 3FMCA 2KECA 3DUZA 3PMFA 4R8NA 4QCLA 3LWUA 5CV9A 3L9AX 1DXMA 1HXYD 2F3VA 2E76C 3S14B 1A3TA 2Z8LA 2E74C 2IW3A 1QJOA 4FXKC 1Z7TA 5M5XB 1MD2D 2KEEA 3TP8A 3Q24A 1T5EA 3VR5A 1Q8IA 5CV6A 2LY7A 2TMPA 1GUSA 5KNBA 3MZ5A 1ML0D 2F0FA 3MVVA 4PV1C 4P2CB 2F0QA 3H3VC 3M4OB 3H91A 1BUVT 5C3WA 4LK1C 3X3MA 3RUZA 1EEID 1LTSD 3PUVA 2I46A 2IL8A 1R4PB 4WFN3 4A3KB 4QUCA 3SK5A 5EPJA 3K5MA 5FO8B 2F0NA 1M4VA 2EYFA 1EYAA 3R8BA 3VYRA 2Z4IA 2Z1CA 1QOHA 1PTOD 5JVH3 3AB9A 4DU9A 3UI2A 3TP6A 4TRDA 1BXTA 2EYMA 3NPPA 1R4QB 4ZAIA 4Q0FA 4RGMA 4RGTA 1IKLA 3KF8A 2F0SA 2PW7A 1TY2A 4K14A 2HQEA 4B9WA 3J7AF 3NBHA 3J7AV 1F9QA 1A6XA 3ND9A 4F88A 4N9PA 3PO2B 2B2UA 3S1QB 1OXTA 1MI2A 1ZYRD 2MPMA 4NP5A 2B2WA 1DM0B 5E4XA 3NBIA 1HHVA 1ENFA 2M00A 5C4ZA 4HN7A 1C48A 4KKUA 4HMJA 3NHHA 1U4MA 3MXGA 5C4JB 1CZGA 2EY5A 1PZJD 4KJNA 4QF4A 5CORA 4I65A 3I70A 3KLSX 5C5MA 2QKIC 2BOSA 3DMUA 4DGZA 4C3IB 1LTBD 3MWYW 3H0GB 3DHQA 1HCZA 1Q3LA 4TQUS 2SNMA 2PZTA 1F2ZA 2A69C 2D9UA 4OL7A 1SMYD 2FMMA 3A8KE 1VDZA 5IODA 3T13A 2EY1A 3GD7A 4FNFA 4HEDA 2RDFA 2QILA 4IFDH 1ONLA 3OHXC 5BN3A 3E5SA 3P7JA 1NCVA 3SR1A 1EWCA 2VUMB 5M3FB 5DAUA 4J6HA 4FYDA 2CW0D 1TWHB 1I4PA 3OMGA 1EWHA 5JPMC 3T53B 2L12A 3RMHA 2EYOA 5C3EB 2JXMB 4QMGA 1LABA 3TSSA 2XSCA 3NWTA 3SK8A 4RHRA 3GO5A 1VMPA 3DM1A 3OMCA 3PIO3 3IKJA 3V05A 2F0VA 1SNDA 2R3ZA 1TS4A 3SEBA 3NSWA 3QWNA 1SYGA 2PQEA 3A55A 3A54A 3EA6A 2HDLA 4M8AA 3QB3A 5IGBA 2VB3X 1LTTD 1IKMA 5M5WB 4BBRB 3CRKC 3OIPA 1AZPA 2J0TD 2K01A 4PQXA 1O7LA 4IFDG 3K59A 3KBXA 2ZT9C 1WTVA 1QWYA 4OIJA 2WINB 1I4HA 3KLRA 1E2WA 2WKDA 2NUCA 4QIWB 1WVLA 2E2DC 3I8ZA 4QB4A 3DXJC 2ICEC 4DN4M 5C0XI 1CK1A 5BN4A 4F7XA 2KOLA 2N55A 3OIQA 3K58A 4HSVA 1HFGA 4A93B 1BCPC 4HCSA 1F9RA 3PIP3 1PRTC 1TT2A 1BO0A 1EY6A 2EYPA 2O2LD 4LAAA 2BCOA 1Z47A 1OXSC 1OXVA 2F0PA 4NDXA 3BS1A 1SNQA 2KEDA 2L0CA 4PMBA 1H9SB 1KDBA 1BDOA 5COYA 1C8CA 4BBSB 4KD3A 4EGVA 1JORA 1S5ED 3F2UA 1WTOA 1TS3A 2JA8B 2KCCA 1SJHD 2A6EC 4JK1C 4ZK9B 2QEJC 5T1IA 4V190 4NMZA 4FF1A 1O78A 2SOBA 5JJZA 1Q12A 1STYA 1HQMC 4IQZA 5CYUA 2B63B 3URYA 1GJXA 1D5ZC 2RVLA 3EROA 5ISRA 2FMCA 4A3BB 2ID0A 3Q0AA 2R61A 4ME5A 2KJXA 2EZVA 2B2YC 3NTHA 1PXUA 1FD7D 4CJ2C 4OO1I 5IGGA 2DNCA 3L7ZC 1LT3D 2A73B 4A3IB 4EQOA 2R93B 3BYYB 2PZWA 3FEWX 5LL6S 3VR6A 3MXNA 1Q1BA 3U9SA 2ZXPA 4DNTB 3H09A 4MN3A 2K5DA 3C46A 3TZDA 4B08A 5CBEE 2AQ1B 1HPCA 1VMCA 3A8JE 4FF4A 3HS0C 4ZKCB 1EYDA 1LTAD 4KN4C 1JICA 4KK7A 1SYEA 4KD4A 1K83B 2CHBD 1BNZA 4KJOA 5F2DA 3S1NB 1FNWA 1D1IA 3S17B 4YIJA 2NB0A 3VA5A 1RD9D 4LMQD 4RWSC 3I90A 4HCEA 5JOBA 4H44C 1AFPA 3GV6A 1IW7C 3TDQA 3NWSA 3NQTA 1I4RA 4FF3A 3BDCA 1ILQA 1ESFA 3OW7A 3J81L 3ONAB 1D5XC 1JE4A 1RHPA 4RFBA 3A56A 1HRJA 1F2YA 2XNAC 3QO2A 3M4YA 2A5HA 3BVMA 2PNRC 5FK9C 1PDQA 5JEAG 1I6HB 1JWSD 4IUTA 3J80L 4KHVA 2F4IA 4UAIA 2V4DA 4FF2A 2BE5C 2IX3A 2E2HB 2F0IA 4XQJA 4RHSA 3TN2A 4IZ8A 1WD0A 1SDFA 2KUMA 1GUOA 2L1BA 3A8IE 3SXHA 5IT9L 2E75C 1U4RA 3VYSA 3HRZC 5CV5A 3KK7A 1IHZA 2C9OA 2JA7B 1H9SA 2NN6H 4DXFA 1B53A 1D5MC 3E6ZX 1QE6A 2I07B 3K57A 2H1EA 2RQXA 2F1MA 3CHBD 4WJWA 2BDNA 1EYCA 2A6HD 1KTKA 3RZDB 4L6TB 1L0YB 3NXWA 1FNVA 2EJFC 1DZ1A 1H9JA 3VA7A 2L9HA 3W3AA 2F0UA 2RDGA 1NAPA 3D4DA 3AU7A 4A3MB 4C3HB 1ESRA 4C3IG 2Y0SB 1EFID 1EZ8A 4M1UB 4A3GB 1ILPA 5LL6X 3P1HA 4KY5A 1F2MA 4OO1G 4GZYC 1SE3A 1EY5A 4IFDI 4ZKBB 4B9XA 3NQIA 5FLXE 4X3SA 2ICIA 1TQOA 1AZQA 5I9PA 1UAPA 2PCFB 1A2TA 3NTIA 4IUNA 1G2TA 2ZXRA 3WOEA 4BY1B 1EIHA 5KEEA 1B9NA 1S5FD 2A74C 1A15A 1SNOA 5KIXA 4XQQA 1BQQT 3EJIA 3D31A 5G3LD 1WTWA 5K36H 1SAPA 1NUCA 4CGYB 2X6GA 3IFTA 3GTJB 1CQVA 1JWMD 4DNRB 1TY0A 2WP8J 4FVMA 3MC0B 4PNYA 4LJZC 1G291 5ELBA 4A3FB 3BDLA 4L8JA 5DNFA 3OOCA 2MP1A 3MXPA 5EKKA 1LTID 5TSSA 2F3WA 1E0BA 2AUJD 3FRPB 2M2LA 3DWPA 4BA1I 1GHKA 3S1RB 1E2ZA 1BR9A 2JEAI 5M9OA 1WD1A 5FO7B 4CKBA 2NTSA 1YNND 5FO9B 1UEAB 2YU9B 1PMRA 4KN7C 4KKTA 2D62A 2HUGA 2NVQB 1I4QA 4K5XA 1KLUD 4DAPA 2F0TA 3S9WA 3RD4A 2K5QA 4X3TA 2PYKA 4XXEA 2X6LA 4IALA 1PTOF 1CA5A 2OEOA 1LT4D 4DXGA 1TKWB 5I6YA 1ET9A 1CHQD 3QJYA 5K36G 1CM9A 1RKNA 1STBA 5ELEA 1KDCA 3HOVB 3I3CA 1QB5D 5KYLA 4BWGB 2R7ZB 3O13A 2QF7A 2VNUD 3M7NA 2HCIA 1Y1VB 1VCIA 3BVZA 3TP5A 3BVGA 2OT2A 2O5IC 3BYTB 1U4PA 1CZWA 3K5LA 2RKSA 1MSHA 4RA8A 1EY8A 2B2TC 2A69D 1HTPA 1SEBD 5EPKA 1EY7A 4QUFA 2NYZD 4G7OC 4K6LA 4KV6A 4HSPA 3H94A 3SK6A 2PW5A 2E2IB 2NVXB 2VXWA 3W2DA 3C1FA 1WCMB 1B1ZA 1ET6A 1EY4A 1G8ZD 2J4XA 4H7BA 1PFNA 1KNEA 3WOFA 5IGCA 5C0XJ 1JWUD 2K1BA 2Q8IB 1DOKA 4MIUA 3D6WA 1V43A 4CKEA 1K8OA 1TR5A 3D3RA 5JEAJ 2B2VC 2SEBD 4RGOS 2JA5B 1TS5A 2JEBI 3CRLC 1I6VC 2IT1A 3MAQA 1VF5C 3KUPA 3PUXA 4RAUC 5KRUA 4C56C 1CI3M 1SJED 3U9OA 1DOLA 1DYQA 2K03A 2DY8A 2QCPX 3P75A 3OPOA 4WORA 5C44B 2K6AA 4BA2I 3HOYB 1RODA 2F0EA 5CV8A 1Y8NB 4A3JB 5J1ZA 4DK1A 4Y7NB 2IJ0A 1M8AA 1WTQA 4EQPA 1TWAB 2AWOA 1B9MA 2E2JB 1YNJD 3S16B 1ICWA 1S5CD 1RTOA 3GTQB 2L11A 4KY7A 1AEXA 1UNSA 4DA2A 3X3NA 5IIFA 4ODGA 4FP5D 2CQAA 2K33A 1D1KA 1DD2A 3L3OC 5E3FA 5C4XB 1CTMA 2K05A 1TWGB 2EY2A 1BCPD 5IGEA 1F9SA 1PZID 1BBXC 5FOBB 2RA4A 4U673 4A3EB 2BDOA 3QOJA 4K8JA 1EOTA 1SYFA 1PRTD 1RF2D 1TWCB 1HUMA 1WTPA 1BCPB 1O7ZA 1DCZA 4V0BA 3FPUB 1ZKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G3L F;  4FP5 D;  5G3L D;  4FNF A;  4FO2 A;  1TII D;  1QCB D;  1QB5 D; 
#chains in the Genus database with same CATH topology
 1PRT B;  4GKK Q;  4JI2 Q;  3RLF A;  1RDP D;  2KVM A;  4IUP A;  2A68 C;  4IUU A;  5EPL A;  2NWG A;  4X62 L;  3CQZ B;  4JV5 L;  1IL2 A;  3SVM A;  1I4X A;  2KQ3 A;  2UUB L;  2EYH A;  4C3J B;  1GM5 A;  1I5F A;  3GP7 A;  4JYA L;  1S4Z A;  3NTK A;  4A3M H;  4DR2 Q;  2R6G A;  5C3X A;  2NVT B;  4C3H H;  2UXD L;  1KXL A;  2B39 A;  4K2L A;  1CKN A;  1AN8 A;  5D65 A;  4A3G H;  2A6E D;  1TU2 B;  5LMN Q;  1JR0 D;  3TME A;  2B2U C;  4KTA A;  3GTM B;  3U4Z A;  1QNK A;  3EN2 A;  3MXU A;  2VS1 A;  4BY7 B;  5C5L A;  3E0J A;  2B2W C;  4KI0 A;  1MGS A;  1E1O A;  4GNX C;  5CGK A;  5C4H A;  3PO3 G;  1HTL D;  3NE5 B;  3MTS A;  2KHS A;  5DEH A;  1LTR D;  1O80 A;  4OHJ A;  3T51 B;  1J9O A;  3ND8 A;  4WJ4 A;  1IL8 A;  2NN6 I;  4Z9C B;  1WTR A;  1NMF A;  3HZX A;  5E1F A;  3CCQ A;  1QG7 A;  1YHQ A;  2R92 H;  4BY1 H;  3SHL A;  3U50 C;  3S2D H;  2JA7 G;  4HTH A;  2ZXO A;  1PLF A;  4IJL A;  5FLX c;  3SE0 A;  4JI6 Q;  1OO9 B;  2NVY B;  3GTJ H;  2XVS A;  1SRO A;  4F87 A;  1B3Q A;  3HGB A;  2PQA B;  1JOO A;  2MHV A;  1V1O A;  4RKL A;  3GQB A;  1NNX A;  3H3V H;  3SDZ A;  4MTN A;  1B4O A;  2A19 A;  1MBY A;  3GTK B;  4DV4 Q;  1B2T A;  3T16 A;  1Y1W B;  4PZ8 A;  2RHQ B;  4FXD A;  2C5C A;  1LT6 D;  5I2Y A;  3J80 c;  4WRD A;  4LUV A;  3VR4 A;  2LMC B;  1HQR D;  3CU7 A;  3K7U C;  1Y8O B;  3D8G A;  4JI0 Q;  1X32 A;  3UE0 A;  1A2U A;  2EOT A;  1EY0 A;  3MFG A;  3CCJ A;  3QOL A;  4GNX B;  3GV3 A;  3IAY A;  3IFD A;  4C3H G;  1R9T B;  2I5L X;  3S1R H;  5AFW A;  2Y0S G;  2NTT A;  1ENA A;  3FVQ A;  1CFM A;  2B2T A;  4A3G G;  1SNP A;  2VQF Q;  2F0J A;  5DM7 3;  3CPF A;  1E7Z A;  3K5O A;  2AMC B;  4ALP A;  3GTP B;  2L55 A;  4L5Q A;  2F0G A;  5GRO A;  1SNM A;  5JJL A;  1BF4 A;  2F03 A;  2NVQ H;  2KCN A;  1YJ9 A;  3ITP A;  4QJF A;  3W1G A;  1EU3 A;  1D2B A;  3BG3 A;  3SK4 A;  2CVR A;  4R4C A;  1JCK B;  1NBW A;  5D14 A;  5FKA C;  3OTO Q;  2IY5 B;  1E22 A;  1HA6 A;  2H4O A;  1A3V A;  1EEF D;  3G71 A;  4H0L C;  4YWL A;  1W6J A;  1IYV A;  5C6A A;  4LF8 Q;  5M3M B;  3LX0 A;  4NXM Q;  5CBA E;  2XIW A;  1F9P A;  1K3R A;  4NPS A;  4YWM A;  4DAM A;  3HOU H;  2L5T A;  5E4W C;  1N34 L;  4GKJ Q;  3CME A;  1G6Z A;  5JPN C;  1F77 A;  3MEF A;  1YIJ A;  4JOI C;  4HIK A;  3HOV H;  2A6H C;  3HOZ B;  2R7Z H;  4X3K A;  1SR3 A;  3D4W A;  5D3I B;  3Q22 A;  1DON A;  2OXP A;  2EIF A;  4ME3 A;  4A3F G;  2J7Z A;  4E6I A;  1SE2 A;  2SNS A;  3R2T A;  3Q23 A;  3CC2 A;  1ENC A;  4ZQ3 A;  3R3O A;  4A75 A;  3PO2 G;  1FL0 A;  2DN8 A;  1AE2 A;  3NP8 A;  3VR3 A;  4ZUJ A;  2M9V A;  1W2B A;  1WJJ A;  5EJW A;  1C0A A;  4K5W A;  2CFM A;  1GVP A;  4IOC A;  2F0O A;  2GA4 B;  2UUA L;  2UXB Q;  3HOX B;  2RDH A;  4IFD J;  2BE5 D;  2K5H A;  1XMQ Q;  3I73 A;  1ASY A;  4O42 A;  3T56 B;  3UDG A;  1TS2 A;  2Q8R E;  2CQO A;  2WV6 D;  1S72 A;  3I4O A;  1STG A;  4XIG S;  1KQS A;  4N9T A;  2NVX H;  3DEO A;  4C2M B;  5ELD A;  1IYU A;  2PO4 A;  4LUZ A;  4K6D A;  3STB C;  1H9M A;  1CKM A;  1SYC A;  2VB2 X;  3OSO A;  2DUD A;  3TP7 A;  4PMW A;  3NUC A;  2HD3 A;  5ELF A;  1XYI A;  4H13 C;  5L37 A;  3MEH A;  4DR4 Q;  2AUK A;  2EVB A;  3K6O A;  4YHH Q;  4G7H C;  3NEM A;  3S15 B;  4KMU C;  3CCS A;  1CHP D;  2EXZ A;  5LHY 1;  3I56 A;  3I72 A;  1PTO C;  1N8R C;  1U4L A;  3J81 E;  3D4R A;  1QZG A;  3A7A B;  5J39 A;  1GHJ A;  1BBU A;  1JOQ A;  3V96 A;  1V8Q A;  3TRZ A;  2D2C C;  3KLS A;  2QA4 A;  4LF7 L;  2PZU A;  5KYI A;  4ULL A;  3ER0 A;  2EJG C;  1LTG D;  1LYL A;  3ICE A;  3WDN A;  5J22 A;  4R4O A;  4JI4 L;  2OCE A;  4IUV A;  4JI5 L;  2R7Z G;  2PPB C;  3CD6 A;  1WTX A;  2MQH A;  2R92 B;  1Y1V G;  4DV7 L;  1QUQ B;  1EIG A;  5HGT A;  2JA6 H;  3AQQ A;  4POF A;  4JBW A;  5EQ0 A;  3S2D B;  1HA5 A;  3C1E A;  3J80 E;  2NN6 G;  4EVO A;  1NR2 A;  3TZU A;  2AWN A;  3CW2 C;  1SYD A;  1MKH A;  2IX1 A;  5C44 H;  2VL6 A;  3BZD B;  1F2L A;  1JC7 A;  1ZYR C;  2K14 A;  5HY6 A;  2FIN B;  1I4G A;  1H9R A;  1KRT A;  1E2V A;  5NUC A;  4R8I A;  4DUY Q;  1EL0 A;  4A3J H;  5EGT A;  4Y7N H;  4S3S A;  1XNR L;  2BA1 A;  5IT9 E;  1TWA H;  3G6J B;  3I4L A;  1Z6H A;  4OEM B;  2CH4 W;  1SSO A;  4OEL B;  1SNC A;  4ZUI A;  4OIK A;  1GO3 E;  1BKB A;  2Q2H A;  3A5Z B;  5BR8 Q;  2F0K A;  1YNN C;  1PTO B;  2E8G A;  2G9H D;  2PQA A;  2B2Y A;  4LFB Q;  1VQM A;  2IWH A;  3M9B A;  1SBB B;  1WCM G;  4I7Z C;  2OF1 A;  1VF7 A;  1XXG A;  2BA0 A;  1UWV A;  4J15 A;  3HKZ E;  1CQF A;  4TSS A;  2B29 A;  2JN4 A;  1EZ6 A;  3ZYY X;  4AYB E;  3NEL A;  3E0E A;  1OXX K;  1SMY C;  2IX0 A;  2X69 A;  3EFX D;  1XTD A;  2Q2I A;  4EX5 A;  3PUW A;  3K7A B;  2WII B;  3TRE A;  5C4X H;  5DM6 3;  5I9O A;  3NEN A;  1D7Q A;  1KAW A;  2NZ1 D;  4GNX A;  4BS9 A;  1A63 A;  3ERQ A;  5IYC H;  2ALY B;  1YZ6 A;  3JAM L;  4OGQ C;  1ZXT A;  3FKI B;  5BN5 A;  1IBL L;  4DV1 L;  2JA5 G;  4AQY L;  2F0H A;  4A3E H;  3M4Q A;  1PFM A;  5M5Y B;  1FNU A;  2AQ3 B;  1J6Q A;  4B3S Q;  1TWC H;  3I4M B;  1I50 B;  1LV9 A;  2OQK A;  1PH6 A;  1UUP A;  4FXG C;  4JCV E;  1QVF A;  1STE A;  4G7Z C;  5G3L F;  4DAY B;  4R1J A;  3K5N A;  3HOU B;  4KHP Q;  3BDO A;  1FYC A;  3J7A 5;  4IUQ A;  2LS0 1;  2CW0 C;  5C44 G;  4LF4 Q;  1CKN B;  1CKO A;  1PH8 A;  3HOY G;  1EQT A;  2JJQ A;  4R9W A;  1IBM Q;  4C1N I;  2F0M A;  4P74 A;  1NR4 A;  3RR5 A;  2UUC L;  4DF7 A;  3KLW A;  3ULP A;  4A3J G;  1H9K A;  1GUN A;  1QVG A;  1EYG A;  2NVT H;  4L5S A;  1HNZ Q;  4JBJ A;  3PF5 A;  2WB1 E;  1XMO L;  4DKA C;  4LF9 Q;  2JSO A;  4HJ9 A;  1K8M A;  5I2X A;  3GTM H;  1MSG A;  4BY7 H;  4ID6 A;  2QW7 A;  2VQE Q;  2EDG A;  2K04 A;  2HCC A;  2O5J C;  4XYO A;  2ZTC A;  2B8G A;  4K8I A;  1HNW Q;  1NMG A;  2F0D A;  2SDF A;  2R7D A;  4PMC A;  1GUT A;  1FJG Q;  1EUJ A;  3OWF A;  2RCF A;  1S3O A;  5IGF A;  4DK0 A;  1Y69 U;  1K8A C;  3NK9 A;  4CJ0 B;  5I6W A;  2ZJR A;  4X62 Q;  1QCB D;  1X3G A;  4G4K A;  2WAQ E;  1QNU A;  2O4X A;  4KKS A;  2IHF A;  2L15 A;  4FO2 A;  1FR3 A;  5A35 A;  2B8F A;  3K81 C;  1L0W A;  4KHZ A;  4A3E G;  4JYA Q;  5A2Q L;  4L63 B;  1LT5 D;  3CCU A;  1JB3 A;  2HDM A;  3N52 A;  2K5W A;  4QL5 A;  4NKL A;  1E3P A;  2MJ8 A;  3C3L A;  2WAC A;  3M3Y B;  1RCV D;  4HAE A;  2JE6 I;  4TKO B;  3GTK H;  4NW2 A;  4X3U A;  3PSI A;  1Y1W H;  2FHT A;  3CC7 A;  3IL8 A;  1G51 A;  4PZ7 A;  4CJ1 B;  1AW7 A;  1I3Q B;  4ILW A;  1KNA A;  3I91 A;  3JAM E;  3FPP A;  2K28 A;  3KOJ A;  4LFC L;  2JA6 B;  1T5X D;  4C3J G;  3UDF A;  3VYU A;  2XN9 C;  1KHI A;  1B50 A;  3L2P A;  1YNJ C;  3J7Y W;  4ABN A;  3W1B A;  3G4S A;  4XTC S;  2NZO A;  4RGN A;  4JI8 L;  5JAV A;  1HFN A;  2QDB A;  3SGI A;  4XQN A;  1S5D D;  1FGB D;  3DWA A;  2VW9 A;  1V1P B;  1EFW A;  1Q90 A;  1QUQ A;  3S1M B;  1SFO H;  1TVX A;  4BY7 G;  2Z6B A;  4CHT B;  3GTP H;  4XT1 B;  1YVC A;  3A7L A;  1SE8 A;  4J1M A;  1AP0 A;  1N9W A;  1D8L A;  2MO1 A;  1K73 C;  1XWE A;  4CBV A;  1SYB A;  3H6M A;  4DNI A;  1CA6 A;  5EBC A;  3FDT A;  4JI3 Q;  3PUY A;  2TSS A;  5ELC A;  4JI1 L;  1EQV A;  1X56 A;  3PIP A;  4GLV B;  5IYB G;  2D0O A;  3RZO B;  2EPB A;  1Q1E A;  2F0L A;  4GOP C;  1SXT A;  4UDU C;  4RG1 A;  1A3U A;  1JOK A;  4ZYS A;  3GTO B;  3HEJ A;  1EY9 A;  2KCM A;  2LKV A;  4OXP A;  1KD1 C;  3H3V I;  2N88 A;  4ZRZ A;  4EQ5 A;  2DGY A;  1MJE A;  2EYL A;  4JI7 L;  2KA7 A;  5D3D A;  4DV0 L;  4IUR A;  4A3D B;  1HUN A;  1QVC A;  3HKZ B;  3CCL A;  4GLX A;  1EU4 A;  5IGD A;  1WFQ A;  3DEP A;  4DR6 L;  4AYB B;  1N36 Q;  2MGS A;  3HOW B;  1PZK D;  1X3F A;  2RBM A;  4LWC A;  1L0X B;  2N49 A;  2EE1 A;  3V2T A;  4CKC A;  1HZB A;  4RH6 A;  1XTC D;  4RCO A;  3RLN A;  2XWB B;  2JP1 A;  2EJM A;  1O7Y A;  5A2Q E;  4K2K A;  4B3R L;  3HOX H;  5CV4 A;  2MUY A;  3TBI B;  2IPK D;  3MHB A;  2LFN A;  2ZM6 L;  1LO5 D;  1HZ9 A;  4IN3 A;  4J8Q A;  5LMU Q;  1JQY D;  2K5V A;  3CXC A;  5KNC A;  2Q8T A;  4O1N A;  1VS0 A;  4RCN A;  1S40 A;  5KGU A;  1X3P A;  5HUR A;  2F0W A;  1NSN S;  1HNX Q;  1DJR D;  1RJT A;  3QIA A;  3EQL C;  4C2M H;  1ZEQ X;  3R93 A;  3KDF B;  1PYW D;  4DAY A;  1N34 Q;  1RTN A;  3T1Y L;  5IP9 H;  1BOS A;  1KAB A;  2Z4H A;  5I4D A;  2Y0S E;  2EY6 A;  2PI2 E;  1A0I A;  3P20 A;  4LF5 Q;  5JVG 3;  3S15 H;  1CUK A;  1OXU A;  1G91 A;  3RNU A;  4JW0 A;  5KND A;  3GTG B;  1TII D;  5M3M G;  1VQ8 A;  4BXX H;  2UUA Q;  1SE4 A;  1X3Q A;  1Y8P B;  2NBF A;  2WB1 B;  2YYZ A;  3LGJ A;  1PH3 A;  4B3T L;  3HG9 A;  4DR5 L;  4Q5V A;  1BCP F;  2A68 D;  4A3C H;  1KLG D;  1M1K C;  5C0X H;  1STN A;  3HOZ G;  1W6K A;  3CCM A;  4XYQ A;  3J81 c;  2D5D A;  2L4N A;  3PUZ A;  1PRT F;  2PMZ B;  5JEA H;  2RSN A;  1GUW A;  1XPR A;  1DOM A;  2B3G A;  5CMD A;  4XDX A;  3HP3 A;  5CR3 A;  3R2I A;  1STA A;  3QG1 A;  3KF8 B;  4P73 A;  4EQN A;  1YHB A;  4DV2 L;  4G57 A;  3EVQ A;  1PH7 A;  2CH4 A;  2XWJ B;  1Q81 C;  2WAQ B;  2ENB A;  2JYO A;  4ZLT F;  3HOX G;  3NBH B;  4DPG A;  2Q2T A;  1HJP A;  1VQN A;  5IYD H;  4K5V A;  4DAV A;  4DK3 C;  3I4N B;  1KDA A;  4JVZ A;  3VYT A;  2K75 A;  4RKB A;  2Z6K A;  5AJ3 Q;  2K7V A;  5K5P A;  3MFY A;  4HJA A;  1LLR D;  3TQY A;  2AQ2 B;  5CV7 A;  2WKC A;  3Q6S A;  4U68 A;  5EKI A;  1GXD C;  2MNA A;  2ES2 A;  1PTO H;  2KCT A;  1PH2 A;  2HIV A;  4C1N K;  3LWE A;  4XT3 B;  4A3M G;  1XX8 A;  4JI4 Q;  2RSO A;  4NXN L;  1DGS A;  4JI5 Q;  1STH A;  4KY6 A;  3C2P A;  4DV7 Q;  1J8I A;  4MHE A;  5IT9 c;  3K0Y A;  3CKI B;  2FFK B;  3T4A C;  2K32 A;  1S5B D;  5EKL A;  1SFO B;  2XRQ D;  1QIL A;  2EYJ A;  4IPD A;  1U9R A;  3K7A H;  4HR7 B;  4N8F A;  3DWQ A;  3KBG A;  5CC4 A;  2XRS D;  3TS0 A;  1N33 L;  3AMU A;  2DNE A;  1YI2 A;  1N32 L;  1KAA A;  5EBD A;  1GOZ A;  5IWA L;  3FKI H;  1II3 A;  1V1P A;  3S2H B;  3VR2 A;  1G2S A;  3M7G A;  4F8M A;  1IXR A;  1D6E C;  2G9D A;  5T1G A;  4X66 L;  5FLX L;  1IBK L;  5M5Y H;  4MZ9 A;  5C0X G;  3LNN A;  1TWF B;  4CDC C;  3GTL B;  3I4M H;  1I50 H;  1IW7 D;  1PFB A;  3PV0 A;  3TS2 A;  2R92 G;  1G6P A;  1CT1 D;  1GUG A;  2DY7 A;  3D6C A;  4DFA A;  4BY1 G;  4C3I H;  3OWE B;  1B3A A;  1VQE A;  4JPB W;  2P5Z X;  4GN5 A;  2FJ2 A;  3G7L A;  1C4Q A;  1IZ6 A;  5IOC A;  1B44 D;  4OO1 H;  1LAC A;  3M85 A;  1FGU A;  4HMI A;  4JI2 L;  2B2V A;  3N6R A;  5DLQ E;  3MA2 B;  3AFP A;  3PO3 B;  3FMC A;  1X3E A;  5IYD G;  1VQI A;  2UXC L;  1U5K A;  2KEC A;  3ERS X;  3DUZ A;  3PMF A;  4R8N A;  4QCL A;  1VQK A;  3LWU A;  4HIO A;  1XNQ L;  5CV9 A;  1B7Y B;  1IBL Q;  3L9A X;  1DXM A;  4DV1 Q;  2JK8 A;  1HXY D;  2I5M X;  4P71 A;  2AHO B;  2F3V A;  5E7N A;  2E76 C;  1VQ6 A;  3S14 B;  2XGT A;  1A3T A;  1SMX A;  2Z8L A;  2E74 C;  2IW3 A;  1QJO A;  4FXK C;  1Z7T A;  1VQO A;  5M5X B;  1Q8K A;  3CF5 A;  1MD2 D;  4QQB X;  1OTC A;  2KEE A;  4YY3 L;  1C9O A;  4KLK A;  2JQO A;  3TP8 A;  3Q24 A;  1T5E A;  3HFZ B;  1K9M C;  3VR5 A;  4DK6 C;  1Q8I A;  4DR1 Q;  5CV6 A;  2LY7 A;  2TMP A;  3IRB A;  1GUS A;  2HT1 A;  5KNB A;  3MZ5 A;  2UUC Q;  1ML0 D;  3DM3 A;  2F0F A;  1BVS A;  3FKI G;  5HGQ A;  3MVV A;  4PV1 C;  1PFS A;  4P2C B;  2F0Q A;  5JJK A;  3H3V C;  3KDF A;  2HHH L;  3I4M G;  4MNO A;  3M4O B;  3H91 A;  2BH2 A;  1BUV T;  3ZJY C;  5C3W A;  4K0K Q;  4LK1 C;  3HOU G;  3M3Y H;  3X3M A;  3RUZ A;  5FLM H;  1EEI D;  1LTS D;  2NZH A;  4DV6 L;  3HOV G;  3PUV A;  2I46 A;  2IL8 A;  3EBE A;  4A3L H;  1I3Q H;  1R4P B;  4WFN 3;  4A3K B;  3STB D;  4QUC A;  3SK5 A;  5EPJ A;  3K5M A;  5FO8 B;  2KHJ A;  4X64 L;  2ZTE A;  2F0N A;  1M4V A;  2EYF A;  4QIW E;  1EYA A;  2UU9 L;  3R8B A;  1XJV A;  3VYR A;  1EOV A;  1LM0 A;  2Z4I A;  2Z1C A;  1QOH A;  2JA9 A;  1PTO D;  2VQF L;  5JVH 3;  3S1M H;  2RHS B;  3JAM c;  3AB9 A;  3AFQ A;  3CMA A;  4DU9 A;  1WI5 A;  3UI2 A;  3TP6 A;  3HKS A;  1BXT A;  2EYM A;  4TRD A;  3NPP A;  1R4Q B;  4ZAI A;  4Q0F A;  4RGM A;  4RGT A;  1IKL A;  3KF8 A;  2F0S A;  4L5R C;  2PW7 A;  4R4T A;  1TY2 A;  3I2Z A;  1VQ4 A;  4K14 A;  2HQE A;  1Q82 C;  3PGZ A;  4B9W A;  3J7A F;  3NBH A;  3J7A V;  3RZO H;  1F9Q A;  1A6X A;  3OTO L;  3ND9 A;  4F88 A;  2V1C C;  4N9P A;  3GTO H;  3PO2 B;  4LFC Q;  3F2D A;  3BU2 A;  2B2U A;  1ICF B;  3S1Q B;  4LF8 L;  1OXT A;  1L2F A;  1MI2 A;  1JJ2 A;  1I94 Q;  1ZYR D;  2MPM A;  4NP5 A;  3CCV A;  2B2W A;  1DM0 B;  5E4X A;  4OWT B;  3NBI A;  4A3D H;  1HHV A;  1ENF A;  2M00 A;  4GKJ L;  5C4Z A;  4HN7 A;  4CDE C;  1Q46 A;  5FLM G;  1C48 A;  4KKU A;  2QEX A;  4HMJ A;  1J5E L;  3NHH A;  1U4M A;  3MXG A;  5C4J B;  1CZG A;  3HOW H;  2EY5 A;  1PZJ D;  4KJN A;  3FP9 A;  4QF4 A;  4X65 L;  5COR A;  4I65 A;  3I70 A;  3KLS X;  5C5M A;  2QKI C;  2BOS A;  3DMU A;  3W5O A;  4DGZ A;  2JA6 G;  4C3I B;  1JE5 A;  1LTB D;  3MWY W;  3H0G B;  4UY8 C;  3DHQ A;  1HCZ A;  1Q3L A;  4TQU S;  2SNM A;  2PZT A;  1SLJ A;  1F2Z A;  2A69 C;  2D9U A;  3E9H A;  3K8A A;  4OL7 A;  5IY0 A;  1SMY D;  2FMM A;  5IE8 A;  4A76 A;  3A8K E;  4NB3 A;  1V9P A;  1IYJ B;  1VDZ A;  5IOD A;  3T13 A;  2EY1 A;  4JI7 Q;  3GD7 A;  4FNF A;  4HED A;  2RDF A;  2QIL A;  4IFD H;  4DR3 L;  1ONL A;  3OHX C;  5BN3 A;  2K4K A;  1YJW A;  3E5S A;  4DR6 Q;  3P7J A;  4A4I A;  2E5L Q;  1NCV A;  1T9H A;  3ULL A;  2Z0S A;  3KF6 B;  3SR1 A;  4DV3 L;  4L5T A;  1PH9 A;  3OYY A;  1VQP A;  1EWC A;  2VUM B;  1U0L A;  5M3F B;  5DAU A;  3GTG H;  3MXN B;  4J6H A;  4FYD A;  3K80 C;  2LXJ A;  3F2C A;  2CW0 D;  3J81 i;  4B3R Q;  1TWH B;  5J3B A;  3J81 j;  4A3I H;  1HR0 L;  1I4P A;  1L1O C;  2ZM6 Q;  4HJ7 A;  3OMG A;  5C4X G;  1EWH A;  4GN4 B;  2YTY A;  1GD7 A;  4A3D G;  3HKZ G;  5IYC G;  5JPM C;  3T53 B;  4JV5 Q;  4IPH A;  2L12 A;  3RMH A;  2EYO A;  1Z9F A;  4AYB G;  2UUB Q;  1JJC B;  2HIX A;  5H1S E;  2JXM B;  4QMG A;  5C3E B;  2AKW B;  3HOW G;  1LAB A;  2QDL A;  3TSS A;  2XSC A;  5GAG C;  1Q7Y C;  3NWT A;  5ELN A;  3SK8 A;  3T1Y Q;  4RHR A;  3GO5 A;  1VMP A;  2UXD Q;  3DM1 A;  4HJ5 A;  4JBK A;  3OMC A;  3PIO 3;  3OW2 A;  3IKJ A;  3V05 A;  2F0V A;  3J80 i;  4RMF A;  1SND A;  2R3Z A;  1TS4 A;  3SEB A;  3NSW A;  3QWN A;  1SYG A;  2PQE A;  4DV5 L;  3A55 A;  3A54 A;  1PHJ A;  4DUY L;  2GN5 A;  2HDL A;  3EA6 A;  1UE6 A;  4JOI A;  3I4N H;  2CWA A;  2CCZ A;  4OWX B;  4M8A A;  4APV A;  3QB3 A;  5IGB A;  1KL9 A;  2VB3 X;  2ZJQ A;  5IP7 H;  1WTH A;  1LTT D;  1K83 H;  4UPA A;  4DR5 Q;  1IKM A;  5M5W B;  4BBR B;  3CRK C;  3OIP A;  1AZP A;  2PI2 A;  4AH6 A;  2J0T D;  2K01 A;  4JG2 A;  4PQX A;  1O7L A;  4LFB L;  4IFD G;  3K59 A;  3B6Y A;  3KBX A;  1YIT A;  4QY7 A;  1VQH A;  2KEN A;  2BH8 A;  1PYB A;  1L1O B;  2ZT9 C;  4P75 A;  1WTV A;  1QWY A;  4OIJ A;  3BZC A;  2WIN B;  1I4H A;  3KLR A;  1E2W A;  2WKD A;  1Q86 C;  2NUC A;  4OON A;  4QIW B;  4DV2 Q;  1WVL A;  2E2D C;  3I8Z A;  4QB4 A;  3DXJ C;  2ICE C;  4DN4 M;  5C0X I;  1CK1 A;  5BN4 A;  4F7X A;  2KOL A;  2WB1 G;  3AYH B;  3CAM A;  2N55 A;  3OIQ A;  3K58 A;  4HSV A;  1HFG A;  1A8V A;  4IJH A;  4PG3 A;  4A93 B;  2KBN A;  3S2H H;  1BCP C;  1P16 A;  4HCS A;  4UP7 A;  1F9R A;  1X9N A;  2OTJ A;  1TWF H;  3M4P A;  3GTL H;  4IPC A;  5FJ8 H;  3PIP 3;  1JT8 A;  1PRT C;  1TT2 A;  1BO0 A;  1EY6 A;  1P8L A;  2EYP A;  2O2L D;  4NXN Q;  4LAA A;  2BCO A;  4OX9 L;  1Z47 A;  4KHP L;  1JJG A;  1OXS C;  3TEH B;  1VQC A;  1OXV A;  2WAQ G;  2F0P A;  4NDX A;  3BS1 A;  1SNQ A;  2KED A;  2L0C A;  2E2H H;  3PO3 H;  4PMB A;  2OWO A;  1H9S B;  1KDB A;  1BDO A;  5COY A;  1C8C A;  3BZK A;  1Y1W G;  4BBS B;  1WOC A;  4HIM A;  3I4N G;  1MJC A;  3VDY A;  4OWW B;  4KD3 A;  4HID A;  1UEB A;  1UE1 A;  3K0X A;  4EGV A;  1JOR A;  3KYH C;  5IP7 G;  1N33 Q;  4LF6 L;  1EWI A;  1S5E D;  1N32 Q;  4JBM A;  3F2U A;  1WTO A;  1JMC A;  2K50 A;  4GN3 B;  5IWA Q;  2F4V L;  1TS3 A;  1E24 A;  2JA8 B;  4X66 Q;  1W3S A;  5GQO A;  2KCC A;  1SJH D;  3S14 H;  2A6E C;  2JA7 H;  2OQ0 A;  4JK1 C;  1K0R A;  4ZK9 B;  2QEJ C;  5T1I A;  5M5X H;  4V19 0;  4NMZ A;  2IHE A;  4FF1 A;  1O78 A;  2SOB A;  5JJZ A;  1Q12 A;  1STY A;  1HQM C;  4GOP B;  4IQZ A;  1AE3 A;  1K0S A;  2H5X A;  2EXD A;  5CYU A;  3RZD H;  2B63 B;  1HNW L;  1X6O A;  1FJG L;  3F8T A;  3URY A;  1GJX A;  1D5Z C;  2RVL A;  1MHW C;  3ERO A;  2FMC A;  5ISR A;  3PF4 A;  4A3B B;  2ID0 A;  4UP9 A;  3G6E A;  3Q0A A;  2R61 A;  4ME5 A;  2KJX A;  1VQ9 A;  3FHW A;  2EZV A;  1X65 A;  1YBY A;  2Z9H A;  2UXC Q;  2B2Y C;  3NTH A;  1PXU A;  4ZCK A;  1FD7 D;  4YCV A;  5FJ8 G;  4CJ2 C;  3M4O H;  4OO1 I;  1RL2 A;  5IGG A;  1XNQ Q;  2DNC A;  3L7Z C;  1LT3 D;  2A73 B;  4A3I B;  2N3S A;  4EQO A;  2R93 B;  3BYY B;  1HZA A;  2PZW A;  2G5D A;  3KF6 A;  3FEW X;  1K8G A;  1VQ7 A;  5LL6 S;  1SN8 A;  3VR6 A;  2YTX A;  3MXN A;  4A3K H;  4DUZ L;  1Q1B A;  4YY3 Q;  3U9S A;  2LSS A;  2XTI A;  2ZXP A;  3CCR A;  4DNT B;  4WJ3 M;  1HR0 W;  3H09 A;  4LUO A;  4MN3 A;  3JAM i;  2K5D A;  3C46 A;  3TZD A;  4B08 A;  2F52 A;  5CBE E;  2AQ1 B;  1HPC A;  1VMC A;  3A8J E;  2DJF C;  4FF4 A;  3HS0 C;  4TVA B;  4ZKC B;  1EYD A;  2LXK A;  1LTA D;  2HHH Q;  4KN4 C;  2HQL A;  1JIC A;  4KK7 A;  3CCE A;  4PZ6 A;  1SYE A;  4KD4 A;  1YHA A;  4LF7 Q;  1X55 A;  1K83 B;  1UE5 A;  4B3M L;  2CHB D;  1BNZ A;  4KJO A;  5F2D A;  1WYD A;  5IP9 G;  4A3F H;  4JI3 L;  4DV6 Q;  2A1A A;  3CPW A;  1ASZ A;  3S1N B;  1FNW A;  2EQS A;  1D1I A;  3S17 B;  4YIJ A;  2NB0 A;  3VA5 A;  1RD9 D;  2RCN A;  4LMQ D;  4RWS C;  3AEV A;  3PO2 H;  4LFA L;  3I90 A;  4HCE A;  3I7F A;  3S1Q H;  5JOB A;  4H44 C;  4X64 Q;  1AFP A;  3GV6 A;  5ELO A;  1IW7 C;  1BBW A;  3TDQ A;  3NWS A;  2UU9 Q;  3NQT A;  1I4R A;  4FF3 A;  3BDC A;  1ILQ A;  4BXX G;  1ESF A;  3OW7 A;  4CDF C;  3J81 L;  1PH1 A;  3ONA B;  4R4I A;  1D5X C;  1JE4 A;  4QGU A;  1RHP A;  4RFB A;  3A56 A;  1L1O A;  1HRJ A;  1F2Y A;  4A3C G;  2XNA C;  1N36 L;  5C4J H;  1XNR Q;  3QO2 A;  3M4Y A;  2A5H A;  1HH2 P;  3BVM A;  1VQB A;  1LTL A;  2YU9 H;  1TXY A;  4A3K G;  2PNR C;  5FK9 C;  1PDQ A;  5JEA G;  3UE1 A;  1M90 C;  1I6H B;  3KJP A;  3H0G H;  1JWS D;  4DR7 L;  4HJ8 A;  4IUT A;  1JB7 A;  3RLO A;  3J80 L;  3I55 A;  3T1H L;  4KHV A;  1PA6 A;  2F4I A;  5LMU L;  4GKK L;  4UAI A;  2V4D A;  4FF2 A;  2BE5 C;  1LUZ A;  2ASB A;  1YJN A;  2IX3 A;  4IO9 A;  2E2H B;  2F0I A;  3CC4 A;  4XQJ A;  4RHS A;  3TN2 A;  4IZ8 A;  1HNX L;  1WD0 A;  3A0J A;  1SDF A;  2KUM A;  4JC0 A;  1GUO A;  2GVA A;  2L1B A;  3A8I E;  4DR2 L;  3SXH A;  5IT9 L;  2E75 C;  1Y14 B;  1YEZ A;  1U4R A;  4AQY Q;  1J5E Q;  1Y1V H;  3VYS A;  3HRZ C;  5CV5 A;  4POG A;  5LMN L;  3U4V A;  4LF5 L;  3KK7 A;  4UP8 A;  2VUM H;  1IHZ A;  2C9O A;  4X65 Q;  1H9S A;  2JA7 B;  2NN6 H;  4DXF A;  5M3F H;  1B53 A;  1D5M C;  3E6Z X;  1KRS A;  2WFW A;  1QE6 A;  2I07 B;  3K57 A;  2H1E A;  2RQX A;  2F1M A;  3CHB D;  4P72 A;  4WJW A;  2YTV A;  2BDN A;  1EYC A;  1TWH H;  4YWK A;  4I7A A;  2A6H D;  1KTK A;  3RZD B;  4L6T B;  4AIM A;  1L0Y B;  3NXW A;  1FNV A;  2EJF C;  1DZ1 A;  1H9J A;  3VA7 A;  2L9H A;  3W3A A;  2F0U A;  4GS3 A;  2RDG A;  5C3E H;  2E2I H;  1V1Q A;  1NAP A;  3D4D A;  2F3I A;  3AU7 A;  2ZTD A;  5GAD C;  4GOP A;  1VQJ A;  4DR3 Q;  1EIF A;  4A3M B;  4IPG A;  1HZC A;  3D0F A;  1WCM H;  4C3H B;  4JI6 L;  1ESR A;  1B8A A;  1MIU A;  4C3I G;  2Y0S B;  1XMO Q;  1EFI D;  1EZ8 A;  2MFI A;  3H0G G;  4M1U B;  4DV3 Q;  4A3G B;  1ILP A;  5LL6 X;  3P1H A;  4KY5 A;  1VQD A;  1F2M A;  4OO1 G;  1PV4 A;  4GZY C;  1SE3 A;  1EY5 A;  4DV4 L;  4IFD I;  4ZKB B;  1GKH A;  5AJ3 L;  4B9X A;  1PH4 A;  3NQI A;  4N8X 1;  1HR0 Q;  5M5W H;  5FLX E;  2I5H A;  4BBR H;  4X3S A;  2ICI A;  4JI0 L;  1TQO A;  4LNQ A;  1AZQ A;  2JA5 H;  1RIP A;  5I9P A;  1UAP A;  2PCF B;  1A2T A;  3NTI A;  4IUN A;  1G2T A;  2ZXR A;  3WOE A;  4BY1 B;  1EIH A;  5KEE A;  1B9N A;  4CDD C;  1S5F D;  2A74 C;  1A15 A;  1SNO A;  2FXQ A;  4XQQ A;  5KIX A;  2VUM G;  5JJI A;  1BQQ T;  3EJI A;  3D31 A;  5G3L D;  5M3F G;  1WTW A;  1SAP A;  5K36 H;  1NUC A;  3L0O A;  1FVI A;  4CGY B;  2X6G A;  3IFT A;  3RN5 A;  3GTJ B;  1CQV A;  1JWM D;  4DNR B;  1TY0 A;  3HOY H;  2WP8 J;  4DV5 Q;  1PH5 A;  4FVM A;  3MC0 B;  4PNY A;  4LJZ C;  4IOA A;  1G29 1;  3KJO A;  5ELB A;  4A93 H;  4A3F B;  3BDL A;  1XPU A;  2ZJP A;  4L8J A;  5DNF A;  3OOC A;  2MP1 A;  2GVB A;  3MXP A;  5EKK A;  1LTI D;  5TSS A;  3Q8D A;  2F3W A;  2KHI A;  2E2J H;  5C3E G;  4LW1 A;  1E0B A;  2AUJ D;  1K3B C;  3FRP B;  4NXM L;  3S16 H;  3PQI A;  1PVO A;  2M2L A;  3DWP A;  3GTQ H;  4JI8 Q;  4BA1 I;  3S1R B;  1GHK A;  1E2Z A;  3H15 A;  1BR9 A;  1QZH A;  2JEA I;  5M9O A;  1WD1 A;  5FO7 B;  1UE7 A;  4CKB A;  2NTS A;  4BBS H;  1KC8 C;  5EAY A;  4R4Q A;  1YNN D;  5FO9 B;  4A3L G;  1UEA B;  2YU9 B;  1PMR A;  4KN7 C;  1VQG A;  4KKT A;  2D62 A;  2HUG A;  2NVQ B;  2CKZ B;  1TWG H;  3CP0 A;  1I4Q A;  4BBR G;  4JI1 Q;  5GAH C;  4K5X A;  1KLU D;  4DAP A;  2F0T A;  3S9W A;  2PNH A;  3RD4 A;  2I0Q A;  2K5Q A;  2JA8 H;  4X3T A;  2PYK A;  2ATW A;  2UXB L;  4XXE A;  1KIX A;  2C35 B;  1XMQ L;  2X6L A;  4IAL A;  1PTO F;  3ULJ A;  1CA5 A;  2OEO A;  2Q2U A;  1LT4 D;  4DXG A;  1TKW B;  5I6Y A;  2N8N A;  1ET9 A;  4X6A H;  1CHQ D;  3QJY A;  1CSP A;  3GDE A;  5K36 G;  1CM9 A;  4OX9 Q;  4DV0 Q;  2B63 H;  1RKN A;  1STB A;  1NY4 A;  5ELE A;  1KDC A;  3HOV B;  3I3C A;  1QB5 D;  5KYL A;  4BWG B;  4DR1 L;  2R7Z B;  4A3B H;  2Z6K C;  3O13 A;  2QF7 A;  4O0A A;  2VNU D;  3M7N A;  2HCI A;  1Y1V B;  1VCI A;  3BVZ A;  4DR4 L;  3CQZ H;  4A93 G;  2R7F A;  3TP5 A;  3A5U A;  3BVG A;  2OT2 A;  3DLL A;  4C3J H;  4YHH L;  2O5I C;  3WWV A;  3BYT B;  1U4P A;  4LF6 Q;  1CZW A;  3K5L A;  2RKS A;  1MSH A;  2F4V Q;  4RA8 A;  1EY8 A;  2B2T C;  2A69 D;  2CWP A;  1HTP A;  1SEB D;  5EPK A;  2R93 H;  4K0K L;  5LMN W;  1EY7 A;  4QUF A;  2NYZ D;  4G7O C;  4K6L A;  4KV6 A;  4UHV A;  4HSP A;  3H94 A;  3KFU A;  3UDI A;  3SK6 A;  2PW5 A;  2E2I B;  2NVX B;  2VXW A;  3BJU A;  2PMZ E;  4BBS G;  3C1F A;  3W2D A;  3F1Z A;  1WCM B;  1B1Z A;  5IYB H;  3E3X A;  1ET6 A;  1EY4 A;  1X54 A;  3E9I A;  1G8Z D;  2J4X A;  4H7B A;  1PYS B;  2JA8 G;  3UDX A;  1PFN A;  1KNE A;  3WOF A;  5IGC A;  4YCU A;  3PIO A;  5C0X J;  1JWU D;  2K1B A;  2Q8I B;  1NJI C;  1DOK A;  4MIU A;  3D6W A;  1V43 A;  4CKE A;  1K8O A;  1TR5 A;  2NVY H;  3D3R A;  1VQA A;  5JEA J;  4B3T Q;  2B2V C;  2SEB D;  5BR8 L;  2B63 G;  3J7Z C;  4RGO S;  3S1N H;  2JA5 B;  1TS5 A;  2N78 A;  2JEB I;  3CRL C;  1I6V C;  2IT1 A;  3MAQ A;  1AH9 A;  1VF5 C;  3S17 H;  2YV5 A;  3KUP A;  3PUX A;  4RAU C;  4A3B G;  4DUZ Q;  3U58 A;  2VY3 A;  5KRU A;  3JC6 6;  4C56 C;  1CI3 M;  1SJE D;  3U9O A;  1DOL A;  2VZA A;  1DYQ A;  1CSQ A;  2K03 A;  2OTL A;  2DY8 A;  2QCP X;  2K5N A;  3P75 A;  3OPO A;  1I94 L;  4WOR A;  1R9T H;  5C44 B;  2K6A A;  4BA2 I;  3HOY B;  1H95 A;  4O2D A;  2MO0 A;  4A3I G;  1ROD A;  2R93 G;  2QGQ A;  2F0E A;  4MTK A;  5CV8 A;  1Y8N B;  4A3J B;  1SRU A;  3PCO B;  5J1Z A;  4DK1 A;  4Y7N B;  2D0P A;  2IJ0 A;  1EIY B;  1M8A A;  1WTQ A;  4EQP A;  1TWA B;  4B3S L;  1K28 A;  2AWO A;  1B9M A;  2E2J B;  4B3M Q;  1YNJ D;  3S16 B;  1ICW A;  1S5C D;  1I6H H;  1NE3 A;  1YNX A;  1RTO A;  3GTQ B;  3A74 A;  4GLA C;  2L11 A;  4KY7 A;  4YCW A;  4LF4 L;  1AEX A;  1UNS A;  4DA2 A;  3RN2 A;  4LFA Q;  3X3N A;  1VQF A;  5IIF A;  2RF4 A;  4ODG A;  5M3M H;  1IBM L;  4FP5 D;  2CQA A;  2K33 A;  4H02 A;  1D1K A;  5GAE C;  1DD2 A;  2DJG C;  3L3O C;  1O7I A;  5E3F A;  5C4X B;  1B70 B;  1CTM A;  2K05 A;  1VQ5 A;  1EQQ A;  2A8V A;  3S24 A;  4FDB A;  1TWG B;  2EY2 A;  1BCP D;  3EIV A;  5IGE A;  1C7Y A;  3HOZ H;  1HNZ L;  1F9S A;  1PZI D;  1BBX C;  1IBK Q;  5FOB B;  2RA4 A;  4U67 3;  2E5L L;  4LF9 L;  4A3E B;  2BDO A;  3QOJ A;  3QR8 A;  1NTG A;  1EOT A;  4K8J A;  1SYF A;  1PRT D;  4Y52 H;  1RF2 D;  2VQE L;  1TWC B;  1HUM A;  1WTP A;  1BCP B;  1E1T A;  1O7Z A;  3G48 A;  2K52 A;  1DCZ A;  3F2B A;  4V0B A;  4DR7 Q;  1EQR A;  3FPU B;  1ZKO A;  1VQL A;  3T1H Q;  1A62 A;  1XPO A; 
#chains in the Genus database with same CATH homology
 1PRT B;  3RLF A;  1RDP D;  2KVM A;  4IUP A;  2A68 C;  4IUU A;  5EPL A;  2NWG A;  3CQZ B;  3SVM A;  1I4X A;  2KQ3 A;  2EYH A;  4C3J B;  3GP7 A;  1S4Z A;  3NTK A;  2R6G A;  5C3X A;  2NVT B;  2B39 A;  4K2L A;  1AN8 A;  5D65 A;  2A6E D;  1TU2 B;  1JR0 D;  3TME A;  2B2U C;  4KTA A;  3GTM B;  1QNK A;  3MXU A;  4BY7 B;  5C5L A;  3E0J A;  2B2W C;  4KI0 A;  1MGS A;  5CGK A;  5C4H A;  1HTL D;  3NE5 B;  3MTS A;  2KHS A;  5DEH A;  1LTR D;  1O80 A;  4OHJ A;  3T51 B;  1J9O A;  3ND8 A;  1IL8 A;  2NN6 I;  4Z9C B;  1WTR A;  3HZX A;  5E1F A;  1QG7 A;  3SHL A;  4HTH A;  2ZXO A;  1PLF A;  3SE0 A;  1OO9 B;  2NVY B;  2XVS A;  4F87 A;  3HGB A;  1JOO A;  2MHV A;  1V1O A;  4RKL A;  3GQB A;  3SDZ A;  1B4O A;  1MBY A;  3GTK B;  1B2T A;  3T16 A;  1Y1W B;  4FXD A;  2C5C A;  1LT6 D;  5I2Y A;  4WRD A;  3VR4 A;  2LMC B;  1HQR D;  3CU7 A;  1Y8O B;  3D8G A;  1X32 A;  1A2U A;  2EOT A;  1EY0 A;  3MFG A;  3QOL A;  3GV3 A;  3IAY A;  3IFD A;  4C3H G;  1R9T B;  5AFW A;  2NTT A;  1ENA A;  3FVQ A;  1CFM A;  2B2T A;  1SNP A;  2F0J A;  5DM7 3;  3K5O A;  3GTP B;  2L55 A;  2F0G A;  1SNM A;  1BF4 A;  2F03 A;  2KCN A;  3ITP A;  1EU3 A;  1D2B A;  3BG3 A;  3SK4 A;  2CVR A;  1JCK B;  5D14 A;  5FKA C;  1HA6 A;  2H4O A;  1A3V A;  1EEF D;  4H0L C;  1W6J A;  1IYV A;  5C6A A;  5M3M B;  3LX0 A;  5CBA E;  2XIW A;  1F9P A;  2L5T A;  5E4W C;  1G6Z A;  5JPN C;  1F77 A;  2A6H C;  3HOZ B;  4X3K A;  3D4W A;  5D3I B;  3Q22 A;  1DON A;  2OXP A;  2J7Z A;  4E6I A;  1SE2 A;  2SNS A;  3R2T A;  3Q23 A;  1ENC A;  4ZQ3 A;  3R3O A;  2DN8 A;  3NP8 A;  3VR3 A;  4ZUJ A;  2M9V A;  5EJW A;  4K5W A;  2F0O A;  2GA4 B;  3HOX B;  2RDH A;  4IFD J;  2BE5 D;  3I73 A;  4O42 A;  3T56 B;  1TS2 A;  2Q8R E;  2WV6 D;  1STG A;  4XIG S;  4N9T A;  3DEO A;  4C2M B;  5ELD A;  1IYU A;  2PO4 A;  4K6D A;  1H9M A;  1SYC A;  2VB2 X;  3OSO A;  3TP7 A;  4PMW A;  3NUC A;  5ELF A;  1XYI A;  4H13 C;  3MEH A;  2AUK A;  2EVB A;  3K6O A;  4G7H C;  3S15 B;  4KMU C;  1CHP D;  2EXZ A;  5LHY 1;  3I72 A;  1PTO C;  1U4L A;  3J81 E;  3D4R A;  3A7A B;  5J39 A;  1GHJ A;  1JOQ A;  3V96 A;  1V8Q A;  2D2C C;  3KLS A;  2PZU A;  5KYI A;  4ULL A;  2EJG C;  1LTG D;  3WDN A;  5J22 A;  4IUV A;  2PPB C;  1WTX A;  2R92 B;  1EIG A;  5HGT A;  4JBW A;  5EQ0 A;  3S2D B;  1HA5 A;  3C1E A;  3J80 E;  2NN6 G;  4EVO A;  1NR2 A;  3TZU A;  2AWN A;  1SYD A;  2IX1 A;  3BZD B;  1F2L A;  1JC7 A;  1ZYR C;  2FIN B;  1I4G A;  1H9R A;  1E2V A;  5NUC A;  4R8I A;  1EL0 A;  5EGT A;  4S3S A;  2BA1 A;  5IT9 E;  3G6J B;  3I4L A;  1Z6H A;  1SSO A;  1SNC A;  4ZUI A;  4OIK A;  2F0K A;  1YNN C;  1PTO B;  2G9H D;  2B2Y A;  2IWH A;  1SBB B;  4I7Z C;  2OF1 A;  1VF7 A;  1XXG A;  2BA0 A;  1CQF A;  4TSS A;  1EZ6 A;  3ZYY X;  1OXX K;  1SMY C;  2IX0 A;  2X69 A;  3EFX D;  3PUW A;  3K7A B;  2WII B;  5DM6 3;  5I9O A;  2NZ1 D;  4BS9 A;  3ERQ A;  3JAM L;  4OGQ C;  1ZXT A;  3FKI B;  5BN5 A;  2F0H A;  1PFM A;  5M5Y B;  1FNU A;  2AQ3 B;  3I4M B;  1I50 B;  1LV9 A;  1UUP A;  4FXG C;  1STE A;  4G7Z C;  5G3L F;  3K5N A;  3HOU B;  3BDO A;  1FYC A;  4IUQ A;  2LS0 1;  2CW0 C;  1EQT A;  4R9W A;  4C1N I;  2F0M A;  1NR4 A;  4DF7 A;  1H9K A;  1GUN A;  2JSO A;  1K8M A;  5I2X A;  1MSG A;  4ID6 A;  2EDG A;  2K04 A;  2HCC A;  2O5J C;  4XYO A;  2B8G A;  4K8I A;  2F0D A;  2SDF A;  4PMC A;  1GUT A;  3OWF A;  5IGF A;  4DK0 A;  1Y69 U;  3NK9 A;  4CJ0 B;  5I6W A;  1QCB D;  4G4K A;  1QNU A;  2O4X A;  4KKS A;  4FO2 A;  1FR3 A;  5A35 A;  2B8F A;  4KHZ A;  5A2Q L;  4L63 B;  1LT5 D;  1JB3 A;  2HDM A;  3N52 A;  2K5W A;  4NKL A;  2MJ8 A;  3C3L A;  2WAC A;  3M3Y B;  1RCV D;  4HAE A;  2JE6 I;  4TKO B;  4NW2 A;  4X3U A;  2FHT A;  3IL8 A;  4CJ1 B;  1AW7 A;  1I3Q B;  4ILW A;  1KNA A;  3I91 A;  3JAM E;  3FPP A;  2K28 A;  2JA6 B;  1T5X D;  4C3J G;  3VYU A;  2XN9 C;  1B50 A;  1YNJ C;  3J7Y W;  4ABN A;  4XTC S;  4RGN A;  5JAV A;  1HFN A;  2QDB A;  4XQN A;  1S5D D;  1FGB D;  3DWA A;  1V1P B;  1Q90 A;  3S1M B;  1TVX A;  4CHT B;  4XT1 B;  3A7L A;  4J1M A;  1AP0 A;  1XWE A;  4CBV A;  1SYB A;  3H6M A;  1CA6 A;  5EBC A;  3FDT A;  3PUY A;  2TSS A;  5ELC A;  1EQV A;  3RZO B;  2EPB A;  1Q1E A;  2F0L A;  1SXT A;  4UDU C;  1A3U A;  1JOK A;  4ZYS A;  3GTO B;  3HEJ A;  1EY9 A;  2LKV A;  2N88 A;  4ZRZ A;  2EYL A;  2KA7 A;  5D3D A;  4IUR A;  4A3D B;  1HUN A;  3HKZ B;  1EU4 A;  5IGD A;  3DEP A;  4AYB B;  2MGS A;  3HOW B;  1PZK D;  2RBM A;  1L0X B;  2EE1 A;  3V2T A;  4CKC A;  4RH6 A;  1XTC D;  4RCO A;  2XWB B;  2JP1 A;  2EJM A;  1O7Y A;  5A2Q E;  4K2K A;  5CV4 A;  2MUY A;  3TBI B;  2IPK D;  3MHB A;  2LFN A;  1LO5 D;  4IN3 A;  4J8Q A;  1JQY D;  5KNC A;  2Q8T A;  4O1N A;  4RCN A;  5KGU A;  1X3P A;  5HUR A;  2F0W A;  1NSN S;  1DJR D;  1RJT A;  3QIA A;  3EQL C;  1ZEQ X;  3R93 A;  1PYW D;  4DAY A;  1RTN A;  1BOS A;  1KAB A;  2Z4H A;  5I4D A;  2EY6 A;  3P20 A;  5JVG 3;  1OXU A;  1G91 A;  5KND A;  3GTG B;  1TII D;  1SE4 A;  1X3Q A;  1Y8P B;  2NBF A;  2WB1 B;  2YYZ A;  3HG9 A;  4Q5V A;  1BCP F;  2A68 D;  1KLG D;  5C0X H;  1STN A;  1W6K A;  4XYQ A;  2D5D A;  2L4N A;  3PUZ A;  1PRT F;  2PMZ B;  5JEA H;  2RSN A;  1GUW A;  1DOM A;  5CMD A;  4XDX A;  3HP3 A;  5CR3 A;  3R2I A;  1STA A;  3QG1 A;  4EQN A;  4G57 A;  3EVQ A;  2XWJ B;  2WAQ B;  2ENB A;  2JYO A;  4ZLT F;  4K5V A;  4DAV A;  3I4N B;  1KDA A;  3VYT A;  4RKB A;  5K5P A;  2K7V A;  3MFY A;  1LLR D;  2AQ2 B;  5CV7 A;  2WKC A;  3Q6S A;  4U68 A;  5EKI A;  1GXD C;  1PTO H;  4C1N K;  3LWE A;  4XT3 B;  1XX8 A;  2RSO A;  1STH A;  4KY6 A;  3C2P A;  1J8I A;  4MHE A;  3K0Y A;  3CKI B;  2FFK B;  3T4A C;  2K32 A;  1S5B D;  5EKL A;  1SFO B;  2XRQ D;  1QIL A;  2EYJ A;  1U9R A;  4HR7 B;  3DWQ A;  3KBG A;  5CC4 A;  2XRS D;  3AMU A;  2DNE A;  1KAA A;  5EBD A;  1GOZ A;  1II3 A;  1V1P A;  3S2H B;  3VR2 A;  1G2S A;  3M7G A;  4F8M A;  5T1G A;  1D6E C;  2G9D A;  5FLX L;  5C0X G;  3LNN A;  1TWF B;  3GTL B;  1IW7 D;  1PFB A;  3PV0 A;  1CT1 D;  1GUG A;  2DY7 A;  3D6C A;  4DFA A;  3OWE B;  1B3A A;  2FJ2 A;  3G7L A;  1C4Q A;  5IOC A;  1B44 D;  4OO1 H;  1LAC A;  3M85 A;  4HMI A;  2B2V A;  3N6R A;  3MA2 B;  3PO3 B;  3FMC A;  2KEC A;  3DUZ A;  3PMF A;  4R8N A;  4QCL A;  3LWU A;  5CV9 A;  3L9A X;  1DXM A;  1HXY D;  2F3V A;  2E76 C;  3S14 B;  1A3T A;  2Z8L A;  2E74 C;  2IW3 A;  1QJO A;  4FXK C;  1Z7T A;  5M5X B;  1MD2 D;  2KEE A;  3TP8 A;  3Q24 A;  1T5E A;  3VR5 A;  1Q8I A;  5CV6 A;  2LY7 A;  2TMP A;  1GUS A;  5KNB A;  3MZ5 A;  1ML0 D;  2F0F A;  3MVV A;  4PV1 C;  4P2C B;  2F0Q A;  3H3V C;  3M4O B;  3H91 A;  1BUV T;  5C3W A;  4LK1 C;  3X3M A;  3RUZ A;  1EEI D;  1LTS D;  3PUV A;  2I46 A;  2IL8 A;  1R4P B;  4WFN 3;  4A3K B;  4QUC A;  3SK5 A;  5EPJ A;  3K5M A;  5FO8 B;  2F0N A;  1M4V A;  2EYF A;  1EYA A;  3R8B A;  3VYR A;  2Z4I A;  2Z1C A;  1QOH A;  1PTO D;  5JVH 3;  3AB9 A;  4DU9 A;  3UI2 A;  3TP6 A;  4TRD A;  1BXT A;  2EYM A;  3NPP A;  1R4Q B;  4ZAI A;  4Q0F A;  4RGM A;  4RGT A;  1IKL A;  3KF8 A;  2F0S A;  2PW7 A;  1TY2 A;  4K14 A;  2HQE A;  4B9W A;  3J7A F;  3NBH A;  3J7A V;  1F9Q A;  1A6X A;  3ND9 A;  4F88 A;  4N9P A;  3PO2 B;  2B2U A;  3S1Q B;  1OXT A;  1MI2 A;  1ZYR D;  2MPM A;  4NP5 A;  2B2W A;  1DM0 B;  5E4X A;  3NBI A;  1HHV A;  1ENF A;  2M00 A;  5C4Z A;  4HN7 A;  1C48 A;  4KKU A;  4HMJ A;  3NHH A;  1U4M A;  3MXG A;  5C4J B;  1CZG A;  2EY5 A;  1PZJ D;  4KJN A;  4QF4 A;  5COR A;  4I65 A;  3I70 A;  3KLS X;  5C5M A;  2QKI C;  2BOS A;  3DMU A;  4DGZ A;  4C3I B;  1LTB D;  3MWY W;  3H0G B;  3DHQ A;  1HCZ A;  1Q3L A;  4TQU S;  2SNM A;  2PZT A;  1F2Z A;  2A69 C;  2D9U A;  4OL7 A;  1SMY D;  2FMM A;  3A8K E;  1VDZ A;  5IOD A;  3T13 A;  2EY1 A;  3GD7 A;  4FNF A;  4HED A;  2RDF A;  2QIL A;  4IFD H;  1ONL A;  3OHX C;  5BN3 A;  3E5S A;  3P7J A;  1NCV A;  3SR1 A;  1EWC A;  2VUM B;  5M3F B;  5DAU A;  4J6H A;  4FYD A;  2CW0 D;  1TWH B;  1I4P A;  3OMG A;  1EWH A;  5JPM C;  3T53 B;  2L12 A;  3RMH A;  2EYO A;  5C3E B;  2JXM B;  4QMG A;  1LAB A;  3TSS A;  2XSC A;  3NWT A;  3SK8 A;  4RHR A;  3GO5 A;  1VMP A;  3DM1 A;  3OMC A;  3PIO 3;  3IKJ A;  3V05 A;  2F0V A;  1SND A;  2R3Z A;  1TS4 A;  3SEB A;  3NSW A;  3QWN A;  1SYG A;  2PQE A;  3A55 A;  3A54 A;  3EA6 A;  2HDL A;  4M8A A;  3QB3 A;  5IGB A;  2VB3 X;  1LTT D;  1IKM A;  5M5W B;  4BBR B;  3CRK C;  3OIP A;  1AZP A;  2J0T D;  2K01 A;  4PQX A;  1O7L A;  4IFD G;  3K59 A;  3KBX A;  2ZT9 C;  1WTV A;  1QWY A;  4OIJ A;  2WIN B;  1I4H A;  3KLR A;  1E2W A;  2WKD A;  2NUC A;  4QIW B;  1WVL A;  2E2D C;  3I8Z A;  4QB4 A;  3DXJ C;  2ICE C;  4DN4 M;  5C0X I;  1CK1 A;  5BN4 A;  4F7X A;  2KOL A;  2N55 A;  3OIQ A;  3K58 A;  4HSV A;  1HFG A;  4A93 B;  1BCP C;  4HCS A;  1F9R A;  3PIP 3;  1PRT C;  1TT2 A;  1BO0 A;  1EY6 A;  2EYP A;  2O2L D;  4LAA A;  2BCO A;  1Z47 A;  1OXS C;  1OXV A;  2F0P A;  4NDX A;  3BS1 A;  1SNQ A;  2KED A;  2L0C A;  4PMB A;  1H9S B;  1KDB A;  1BDO A;  5COY A;  1C8C A;  4BBS B;  4KD3 A;  4EGV A;  1JOR A;  1S5E D;  3F2U A;  1WTO A;  1TS3 A;  2JA8 B;  2KCC A;  1SJH D;  2A6E C;  4JK1 C;  4ZK9 B;  2QEJ C;  5T1I A;  4V19 0;  4NMZ A;  4FF1 A;  1O78 A;  2SOB A;  5JJZ A;  1Q12 A;  1STY A;  1HQM C;  4IQZ A;  5CYU A;  2B63 B;  3URY A;  1GJX A;  1D5Z C;  2RVL A;  3ERO A;  5ISR A;  2FMC A;  4A3B B;  2ID0 A;  3Q0A A;  2R61 A;  4ME5 A;  2KJX A;  2EZV A;  2B2Y C;  3NTH A;  1PXU A;  1FD7 D;  4CJ2 C;  4OO1 I;  5IGG A;  2DNC A;  3L7Z C;  1LT3 D;  2A73 B;  4A3I B;  4EQO A;  2R93 B;  3BYY B;  2PZW A;  3FEW X;  5LL6 S;  3VR6 A;  3MXN A;  1Q1B A;  3U9S A;  2ZXP A;  4DNT B;  3H09 A;  4MN3 A;  2K5D A;  3C46 A;  3TZD A;  4B08 A;  5CBE E;  2AQ1 B;  1HPC A;  1VMC A;  3A8J E;  4FF4 A;  3HS0 C;  4ZKC B;  1EYD A;  1LTA D;  4KN4 C;  1JIC A;  4KK7 A;  1SYE A;  4KD4 A;  1K83 B;  2CHB D;  1BNZ A;  4KJO A;  5F2D A;  3S1N B;  1FNW A;  1D1I A;  3S17 B;  4YIJ A;  2NB0 A;  3VA5 A;  1RD9 D;  4LMQ D;  4RWS C;  3I90 A;  4HCE A;  5JOB A;  4H44 C;  1AFP A;  3GV6 A;  1IW7 C;  3TDQ A;  3NWS A;  3NQT A;  1I4R A;  4FF3 A;  3BDC A;  1ILQ A;  1ESF A;  3OW7 A;  3J81 L;  3ONA B;  1D5X C;  1JE4 A;  1RHP A;  4RFB A;  3A56 A;  1HRJ A;  1F2Y A;  2XNA C;  3QO2 A;  3M4Y A;  2A5H A;  3BVM A;  2PNR C;  5FK9 C;  1PDQ A;  5JEA G;  1I6H B;  1JWS D;  4IUT A;  3J80 L;  4KHV A;  2F4I A;  4UAI A;  2V4D A;  4FF2 A;  2BE5 C;  2IX3 A;  2E2H B;  2F0I A;  4XQJ A;  4RHS A;  3TN2 A;  4IZ8 A;  1WD0 A;  1SDF A;  2KUM A;  1GUO A;  2L1B A;  3A8I E;  3SXH A;  5IT9 L;  2E75 C;  1U4R A;  3VYS A;  3HRZ C;  5CV5 A;  3KK7 A;  1IHZ A;  2C9O A;  2JA7 B;  1H9S A;  2NN6 H;  4DXF A;  1B53 A;  1D5M C;  3E6Z X;  1QE6 A;  2I07 B;  3K57 A;  2H1E A;  2RQX A;  2F1M A;  3CHB D;  4WJW A;  2BDN A;  1EYC A;  2A6H D;  1KTK A;  3RZD B;  4L6T B;  1L0Y B;  3NXW A;  1FNV A;  2EJF C;  1DZ1 A;  1H9J A;  3VA7 A;  2L9H A;  3W3A A;  2F0U A;  2RDG A;  1NAP A;  3D4D A;  3AU7 A;  4A3M B;  4C3H B;  1ESR A;  4C3I G;  2Y0S B;  1EFI D;  1EZ8 A;  4M1U B;  4A3G B;  1ILP A;  5LL6 X;  3P1H A;  4KY5 A;  1F2M A;  4OO1 G;  4GZY C;  1SE3 A;  1EY5 A;  4IFD I;  4ZKB B;  4B9X A;  3NQI A;  5FLX E;  4X3S A;  2ICI A;  1TQO A;  1AZQ A;  5I9P A;  1UAP A;  2PCF B;  1A2T A;  3NTI A;  4IUN A;  1G2T A;  2ZXR A;  3WOE A;  4BY1 B;  1EIH A;  5KEE A;  1B9N A;  1S5F D;  2A74 C;  1A15 A;  1SNO A;  5KIX A;  4XQQ A;  1BQQ T;  3EJI A;  3D31 A;  5G3L D;  1WTW A;  5K36 H;  1SAP A;  1NUC A;  4CGY B;  2X6G A;  3IFT A;  3GTJ B;  1CQV A;  1JWM D;  4DNR B;  1TY0 A;  2WP8 J;  4FVM A;  3MC0 B;  4PNY A;  4LJZ C;  1G29 1;  5ELB A;  4A3F B;  3BDL A;  4L8J A;  5DNF A;  3OOC A;  2MP1 A;  3MXP A;  5EKK A;  1LTI D;  5TSS A;  2F3W A;  1E0B A;  2AUJ D;  3FRP B;  2M2L A;  3DWP A;  4BA1 I;  1GHK A;  3S1R B;  1E2Z A;  1BR9 A;  2JEA I;  5M9O A;  1WD1 A;  5FO7 B;  4CKB A;  2NTS A;  1YNN D;  5FO9 B;  1UEA B;  2YU9 B;  1PMR A;  4KN7 C;  4KKT A;  2D62 A;  2HUG A;  2NVQ B;  1I4Q A;  4K5X A;  1KLU D;  4DAP A;  2F0T A;  3S9W A;  3RD4 A;  2K5Q A;  4X3T A;  2PYK A;  4XXE A;  2X6L A;  4IAL A;  1PTO F;  1CA5 A;  2OEO A;  1LT4 D;  4DXG A;  1TKW B;  5I6Y A;  1ET9 A;  1CHQ D;  3QJY A;  5K36 G;  1CM9 A;  1RKN A;  1STB A;  5ELE A;  1KDC A;  3HOV B;  3I3C A;  1QB5 D;  5KYL A;  4BWG B;  2R7Z B;  3O13 A;  2QF7 A;  2VNU D;  3M7N A;  2HCI A;  1Y1V B;  1VCI A;  3BVZ A;  3TP5 A;  3BVG A;  2OT2 A;  2O5I C;  3BYT B;  1U4P A;  1CZW A;  3K5L A;  2RKS A;  1MSH A;  4RA8 A;  1EY8 A;  2B2T C;  2A69 D;  1HTP A;  1SEB D;  5EPK A;  1EY7 A;  4QUF A;  2NYZ D;  4G7O C;  4K6L A;  4KV6 A;  4HSP A;  3H94 A;  3SK6 A;  2PW5 A;  2E2I B;  2NVX B;  2VXW A;  3W2D A;  3C1F A;  1WCM B;  1B1Z A;  1ET6 A;  1EY4 A;  1G8Z D;  2J4X A;  4H7B A;  1PFN A;  1KNE A;  3WOF A;  5IGC A;  5C0X J;  1JWU D;  2K1B A;  2Q8I B;  1DOK A;  4MIU A;  3D6W A;  1V43 A;  4CKE A;  1K8O A;  1TR5 A;  3D3R A;  5JEA J;  2B2V C;  2SEB D;  4RGO S;  2JA5 B;  1TS5 A;  2JEB I;  3CRL C;  1I6V C;  2IT1 A;  3MAQ A;  1VF5 C;  3KUP A;  3PUX A;  4RAU C;  5KRU A;  4C56 C;  1CI3 M;  1SJE D;  3U9O A;  1DOL A;  1DYQ A;  2K03 A;  2DY8 A;  2QCP X;  3P75 A;  3OPO A;  4WOR A;  5C44 B;  2K6A A;  4BA2 I;  3HOY B;  1ROD A;  2F0E A;  5CV8 A;  1Y8N B;  4A3J B;  5J1Z A;  4DK1 A;  4Y7N B;  2IJ0 A;  1M8A A;  1WTQ A;  4EQP A;  1TWA B;  2AWO A;  1B9M A;  2E2J B;  1YNJ D;  3S16 B;  1ICW A;  1S5C D;  1RTO A;  3GTQ B;  2L11 A;  4KY7 A;  1AEX A;  1UNS A;  4DA2 A;  3X3N A;  5IIF A;  4ODG A;  4FP5 D;  2CQA A;  2K33 A;  1D1K A;  1DD2 A;  3L3O C;  5E3F A;  5C4X B;  1CTM A;  2K05 A;  1TWG B;  2EY2 A;  1BCP D;  5IGE A;  1F9S A;  1PZI D;  1BBX C;  5FOB B;  2RA4 A;  4U67 3;  4A3E B;  2BDO A;  3QOJ A;  4K8J A;  1EOT A;  1SYF A;  1PRT D;  1RF2 D;  1TWC B;  1HUM A;  1WTP A;  1BCP B;  1O7Z A;  1DCZ A;  4V0B A;  3FPU B;  1ZKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...