4FO8A

Pseudomonas aeruginosa metap with met, in mn form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
259
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 83
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo8A00
3PKCA 4IKRA 4U6EA 3IU8A 1BN5A 1M35A 4U71A 1KQ9A 4FLJA 1QXZA 2P9AA 3IU7A 5CNXA 1R5HA 1XGMA 3MR1A 4IU6A 4RZYA 5CIKA 2GU6A 4QR8A 4U75A 2GU4A 4OOKA 2BHDA 4U73A 4ZNGA 1YW8A 2Q92A 2IW2A 3RORA 3CTZA 4ZWUA 1R5GA 2HOWA 3IG4A 3S6BA 3CB5A 1R58A 1W7VA 3IU9A 3PKEA 4IPAA 2V6CA 4ZWOA 3FM3A 5JHUA 1YVMA 2BWUA 1QZYA 1WY2A 2ZSGA 1A16A 4PV4A 4IKUA 3PKDA 2G6PA 5FCHA 2P99A 1MATA 1YW7A 1B59A 2GZ5A 2EA4A 2GG9A 2DFIA 4S00A 2GG5A 2V3ZA 1JAWA 4IDYA 2BWVA 1Y1NA 1XGOA 2NQ7A 4IF7A 4FO8A 3PKAA 3PKBA 2GG8A 4U1BA 1XGSA 2EVCA 5D6EA 2Q93A 5CDVA 1C24A 2GGCA 2Q96A 3FMQA 4HXXA 2V3XA 3BIQA 3CB6A 2B3LA 5D6FA 2GU5A 4U6JA 1WLRA 1YW9A 5CDLA 1W2MA 1B6AA 5CLSA 2Q8KA 4B28A 3L24A 4PNCA 4RGZ1 4S2TP 2GU7A 1O0XA 2V3YA 2BB7A 4FLIA 4FKCA 2BWTA 1C22A 3MX6A 1C21A 2B3HA 1PV9A 4KM3A 4IKTA 4U6ZA 1C23A 1XNZA 2EVMA 4U69A 2OAZA 1WL9A 2Q94A 4IECA 4Z7MA 2BHAA 3TB5A 5E5BA 3TAVA 2GG3A 4R60A 1WBQA 1QXYA 2BWXA 4EGEA 1N51A 3FMRA 4ZWPA 1KP0A 3L7GA 1CHMA 2BHBA 4U6CA 4U70A 3MATA 2GTXA 1KQ0A 2MATA 2EA2A 1WKMA 4FO7A 2B3KA 2BN7A 1WN1A 2GGBA 2NQ6A 1BOAA 2GG2A 5CDEA 2GG0A 3Q6DA 5FCFA 2GA2A 4MATA 4IKSA 4JUQA 3RVAA 4A6VA 4S2RP 2Q95A 4U76A 2BHCA 2GG7A 2BWWA 4FLLA 5JI6A 4RZZA 1WL6A 4A6WA 4FUKA 2EVOA 1QXWA 4FLKA 2BH3A 4S01A 3BITA 5JFRA 5CE6A 3BIPA 4U6WA 3D27A 1XGNA 2OKNA 2BWYA 2P98A 2ADUA 1YJ3A 2BWSA 1C27A
chains in the Genus database with same CATH superfamily
3PKCA 4IKRA 4U6EA 3IU8A 1BN5A 1M35A 4U71A 1KQ9A 4FLJA 1QXZA 2P9AA 3IU7A 5CNXA 1R5HA 1XGMA 3MR1A 4IU6A 4RZYA 5CIKA 2GU6A 4QR8A 4U75A 2GU4A 4OOKA 2BHDA 4U73A 4ZNGA 1YW8A 2Q92A 2IW2A 3RORA 3CTZA 4ZWUA 1R5GA 2HOWA 3IG4A 3S6BA 3CB5A 1R58A 1W7VA 3IU9A 3PKEA 4IPAA 2V6CA 4ZWOA 3FM3A 5JHUA 1YVMA 2BWUA 1QZYA 1WY2A 2ZSGA 1A16A 4PV4A 4IKUA 3PKDA 2G6PA 5FCHA 2P99A 1MATA 1YW7A 1B59A 2GZ5A 2EA4A 2GG9A 2DFIA 4S00A 2GG5A 2V3ZA 1JAWA 4IDYA 2BWVA 1Y1NA 1XGOA 2NQ7A 4IF7A 4FO8A 3PKAA 3PKBA 2GG8A 4U1BA 1XGSA 2EVCA 5D6EA 2Q93A 5CDVA 1C24A 2GGCA 2Q96A 3FMQA 4HXXA 2V3XA 3BIQA 3CB6A 2B3LA 5D6FA 2GU5A 4U6JA 1WLRA 1YW9A 5CDLA 1W2MA 1B6AA 5CLSA 2Q8KA 4B28A 3L24A 4PNCA 4RGZ1 4S2TP 2GU7A 1O0XA 2V3YA 2BB7A 4FLIA 4FKCA 2BWTA 1C22A 3MX6A 1C21A 2B3HA 1PV9A 4KM3A 4IKTA 4U6ZA 1C23A 1XNZA 2EVMA 4U69A 2OAZA 1WL9A 2Q94A 4IECA 4Z7MA 2BHAA 3TB5A 5E5BA 3TAVA 2GG3A 4R60A 1WBQA 1QXYA 2BWXA 4EGEA 1N51A 3FMRA 4ZWPA 1KP0A 3L7GA 1CHMA 2BHBA 4U6CA 4U70A 3MATA 2GTXA 1KQ0A 2MATA 2EA2A 1WKMA 4FO7A 2B3KA 2BN7A 1WN1A 2GGBA 2NQ6A 1BOAA 2GG2A 5CDEA 2GG0A 3Q6DA 5FCFA 2GA2A 4MATA 4IKSA 4JUQA 3RVAA 4A6VA 4S2RP 2Q95A 4U76A 2BHCA 2GG7A 2BWWA 4FLLA 5JI6A 4RZZA 1WL6A 4A6WA 4FUKA 2EVOA 1QXWA 4FLKA 2BH3A 4S01A 3BITA 5JFRA 5CE6A 3BIPA 4U6WA 3D27A 1XGNA 2OKNA 2BWYA 2P98A 2ADUA 1YJ3A 2BWSA 1C27A
chains in the Genus database with same CATH topology
3PKCA 4IKRA 4U6EA 3IU8A 1BN5A 1M35A 4U71A 1KQ9A 4FLJA 1QXZA 2P9AA 3IU7A 5CNXA 1R5HA 1XGMA 3MR1A 4IU6A 4RZYA 5CIKA 2GU6A 4QR8A 4U75A 2GU4A 4OOKA 2BHDA 4U73A 4ZNGA 1YW8A 2Q92A 2IW2A 3RORA 3CTZA 4ZWUA 1R5GA 2HOWA 3IG4A 3S6BA 3CB5A 1R58A 1W7VA 3IU9A 3PKEA 4IPAA 2V6CA 4ZWOA 3FM3A 5JHUA 1YVMA 2BWUA 1QZYA 1WY2A 2ZSGA 1A16A 4PV4A 4IKUA 3PKDA 2G6PA 5FCHA 2P99A 1MATA 1YW7A 1B59A 2GZ5A 2EA4A 2GG9A 2DFIA 4S00A 2GG5A 2V3ZA 1JAWA 4IDYA 2BWVA 1Y1NA 1XGOA 2NQ7A 4IF7A 4FO8A 3PKAA 3PKBA 2GG8A 4U1BA 1XGSA 2EVCA 5D6EA 2Q93A 5CDVA 1C24A 2GGCA 2Q96A 3FMQA 4HXXA 2V3XA 3BIQA 3CB6A 2B3LA 5D6FA 2GU5A 4U6JA 1WLRA 1YW9A 5CDLA 1W2MA 1B6AA 5CLSA 2Q8KA 4B28A 3L24A 4PNCA 4RGZ1 4S2TP 2GU7A 1O0XA 2V3YA 2BB7A 4FLIA 4FKCA 2BWTA 1C22A 3MX6A 1C21A 2B3HA 1PV9A 4KM3A 4IKTA 4U6ZA 1C23A 1XNZA 2EVMA 4U69A 2OAZA 1WL9A 2Q94A 4IECA 4Z7MA 2BHAA 3TB5A 5E5BA 3TAVA 2GG3A 4R60A 1WBQA 1QXYA 2BWXA 4EGEA 1N51A 3FMRA 4ZWPA 1KP0A 3L7GA 1CHMA 2BHBA 4U6CA 4U70A 3MATA 2GTXA 1KQ0A 2MATA 2EA2A 1WKMA 4FO7A 2B3KA 2BN7A 1WN1A 2GGBA 2NQ6A 1BOAA 2GG2A 5CDEA 2GG0A 3Q6DA 5FCFA 2GA2A 4MATA 4IKSA 4JUQA 3RVAA 4A6VA 4S2RP 2Q95A 4U76A 2BHCA 2GG7A 2BWWA 4FLLA 5JI6A 4RZZA 1WL6A 4A6WA 4FUKA 2EVOA 1QXWA 4FLKA 2BH3A 4S01A 3BITA 5JFRA 5CE6A 3BIPA 4U6WA 3D27A 1XGNA 2OKNA 2BWYA 2P98A 2ADUA 1YJ3A 2BWSA 1C27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKC A;  4IKR A;  4U6E A;  3IU8 A;  1BN5 A;  1M35 A;  4U71 A;  1KQ9 A;  4FLJ A;  1QXZ A;  2P9A A;  3IU7 A;  5CNX A;  1R5H A;  1XGM A;  3MR1 A;  4IU6 A;  4RZY A;  5CIK A;  2GU6 A;  4QR8 A;  4U75 A;  2GU4 A;  4OOK A;  2BHD A;  4U73 A;  4ZNG A;  1YW8 A;  2Q92 A;  2IW2 A;  3ROR A;  3CTZ A;  4ZWU A;  1R5G A;  2HOW A;  3IG4 A;  3S6B A;  3CB5 A;  1R58 A;  1W7V A;  3IU9 A;  3PKE A;  4IPA A;  2V6C A;  4ZWO A;  3FM3 A;  5JHU A;  1YVM A;  2BWU A;  1QZY A;  1WY2 A;  2ZSG A;  1A16 A;  4PV4 A;  4IKU A;  3PKD A;  2G6P A;  5FCH A;  2P99 A;  1MAT A;  1YW7 A;  1B59 A;  2GZ5 A;  2EA4 A;  2GG9 A;  2DFI A;  4S00 A;  2GG5 A;  2V3Z A;  1JAW A;  4IDY A;  2BWV A;  1Y1N A;  1XGO A;  2NQ7 A;  4IF7 A;  4FO8 A;  3PKA A;  3PKB A;  2GG8 A;  4U1B A;  1XGS A;  2EVC A;  5D6E A;  2Q93 A;  5CDV A;  1C24 A;  2GGC A;  2Q96 A;  3FMQ A;  4HXX A;  2V3X A;  3BIQ A;  3CB6 A;  2B3L A;  5D6F A;  2GU5 A;  4U6J A;  1WLR A;  1YW9 A;  5CDL A;  1W2M A;  1B6A A;  5CLS A;  2Q8K A;  4B28 A;  3L24 A;  4PNC A;  4RGZ 1;  4S2T P;  2GU7 A;  1O0X A;  2V3Y A;  2BB7 A;  4FLI A;  4FKC A;  2BWT A;  1C22 A;  3MX6 A;  1C21 A;  2B3H A;  1PV9 A;  4KM3 A;  4IKT A;  4U6Z A;  1C23 A;  1XNZ A;  2EVM A;  4U69 A;  2OAZ A;  1WL9 A;  2Q94 A;  4IEC A;  4Z7M A;  2BHA A;  3TB5 A;  5E5B A;  3TAV A;  2GG3 A;  4R60 A;  1WBQ A;  1QXY A;  2BWX A;  4EGE A;  1N51 A;  3FMR A;  4ZWP A;  1KP0 A;  3L7G A;  1CHM A;  2BHB A;  4U6C A;  4U70 A;  3MAT A;  2GTX A;  1KQ0 A;  2MAT A;  2EA2 A;  1WKM A;  4FO7 A;  2B3K A;  2BN7 A;  1WN1 A;  2GGB A;  2NQ6 A;  1BOA A;  2GG2 A;  5CDE A;  2GG0 A;  3Q6D A;  5FCF A;  2GA2 A;  4MAT A;  4IKS A;  4JUQ A;  3RVA A;  4A6V A;  4S2R P;  2Q95 A;  4U76 A;  2BHC A;  2GG7 A;  2BWW A;  4FLL A;  5JI6 A;  4RZZ A;  1WL6 A;  4A6W A;  4FUK A;  2EVO A;  1QXW A;  4FLK A;  2BH3 A;  4S01 A;  3BIT A;  5JFR A;  5CE6 A;  3BIP A;  4U6W A;  3D27 A;  1XGN A;  2OKN A;  2BWY A;  2P98 A;  2ADU A;  1YJ3 A;  2BWS A;  1C27 A; 
#chains in the Genus database with same CATH topology
 3PKC A;  4IKR A;  4U6E A;  3IU8 A;  1BN5 A;  1M35 A;  4U71 A;  1KQ9 A;  4FLJ A;  1QXZ A;  2P9A A;  3IU7 A;  5CNX A;  1R5H A;  1XGM A;  3MR1 A;  4IU6 A;  4RZY A;  5CIK A;  2GU6 A;  4QR8 A;  4U75 A;  2GU4 A;  4OOK A;  2BHD A;  4U73 A;  4ZNG A;  1YW8 A;  2Q92 A;  2IW2 A;  3ROR A;  3CTZ A;  4ZWU A;  1R5G A;  2HOW A;  3IG4 A;  3S6B A;  3CB5 A;  1R58 A;  1W7V A;  3IU9 A;  3PKE A;  4IPA A;  2V6C A;  4ZWO A;  3FM3 A;  5JHU A;  1YVM A;  2BWU A;  1QZY A;  1WY2 A;  2ZSG A;  1A16 A;  4PV4 A;  4IKU A;  3PKD A;  2G6P A;  5FCH A;  2P99 A;  1MAT A;  1YW7 A;  1B59 A;  2GZ5 A;  2EA4 A;  2GG9 A;  2DFI A;  4S00 A;  2GG5 A;  2V3Z A;  1JAW A;  4IDY A;  2BWV A;  1Y1N A;  1XGO A;  2NQ7 A;  4IF7 A;  4FO8 A;  3PKA A;  3PKB A;  2GG8 A;  4U1B A;  1XGS A;  2EVC A;  5D6E A;  2Q93 A;  5CDV A;  1C24 A;  2GGC A;  2Q96 A;  3FMQ A;  4HXX A;  2V3X A;  3BIQ A;  3CB6 A;  2B3L A;  5D6F A;  2GU5 A;  4U6J A;  1WLR A;  1YW9 A;  5CDL A;  1W2M A;  1B6A A;  5CLS A;  2Q8K A;  4B28 A;  3L24 A;  4PNC A;  4RGZ 1;  4S2T P;  2GU7 A;  1O0X A;  2V3Y A;  2BB7 A;  4FLI A;  4FKC A;  2BWT A;  1C22 A;  3MX6 A;  1C21 A;  2B3H A;  1PV9 A;  4KM3 A;  4IKT A;  4U6Z A;  1C23 A;  1XNZ A;  2EVM A;  4U69 A;  2OAZ A;  1WL9 A;  2Q94 A;  4IEC A;  4Z7M A;  2BHA A;  3TB5 A;  5E5B A;  3TAV A;  2GG3 A;  4R60 A;  1WBQ A;  1QXY A;  2BWX A;  4EGE A;  1N51 A;  3FMR A;  4ZWP A;  1KP0 A;  3L7G A;  1CHM A;  2BHB A;  4U6C A;  4U70 A;  3MAT A;  2GTX A;  1KQ0 A;  2MAT A;  2EA2 A;  1WKM A;  4FO7 A;  2B3K A;  2BN7 A;  1WN1 A;  2GGB A;  2NQ6 A;  1BOA A;  2GG2 A;  5CDE A;  2GG0 A;  3Q6D A;  5FCF A;  2GA2 A;  4MAT A;  4IKS A;  4JUQ A;  3RVA A;  4A6V A;  4S2R P;  2Q95 A;  4U76 A;  2BHC A;  2GG7 A;  2BWW A;  4FLL A;  5JI6 A;  4RZZ A;  1WL6 A;  4A6W A;  4FUK A;  2EVO A;  1QXW A;  4FLK A;  2BH3 A;  4S01 A;  3BIT A;  5JFR A;  5CE6 A;  3BIP A;  4U6W A;  3D27 A;  1XGN A;  2OKN A;  2BWY A;  2P98 A;  2ADU A;  1YJ3 A;  2BWS A;  1C27 A; 
#chains in the Genus database with same CATH homology
 3PKC A;  4IKR A;  4U6E A;  3IU8 A;  1BN5 A;  1M35 A;  4U71 A;  1KQ9 A;  4FLJ A;  1QXZ A;  2P9A A;  3IU7 A;  5CNX A;  1R5H A;  1XGM A;  3MR1 A;  4IU6 A;  4RZY A;  5CIK A;  2GU6 A;  4QR8 A;  4U75 A;  2GU4 A;  4OOK A;  2BHD A;  4U73 A;  4ZNG A;  1YW8 A;  2Q92 A;  2IW2 A;  3ROR A;  3CTZ A;  4ZWU A;  1R5G A;  2HOW A;  3IG4 A;  3S6B A;  3CB5 A;  1R58 A;  1W7V A;  3IU9 A;  3PKE A;  4IPA A;  2V6C A;  4ZWO A;  3FM3 A;  5JHU A;  1YVM A;  2BWU A;  1QZY A;  1WY2 A;  2ZSG A;  1A16 A;  4PV4 A;  4IKU A;  3PKD A;  2G6P A;  5FCH A;  2P99 A;  1MAT A;  1YW7 A;  1B59 A;  2GZ5 A;  2EA4 A;  2GG9 A;  2DFI A;  4S00 A;  2GG5 A;  2V3Z A;  1JAW A;  4IDY A;  2BWV A;  1Y1N A;  1XGO A;  2NQ7 A;  4IF7 A;  4FO8 A;  3PKA A;  3PKB A;  2GG8 A;  4U1B A;  1XGS A;  2EVC A;  5D6E A;  2Q93 A;  5CDV A;  1C24 A;  2GGC A;  2Q96 A;  3FMQ A;  4HXX A;  2V3X A;  3BIQ A;  3CB6 A;  2B3L A;  5D6F A;  2GU5 A;  4U6J A;  1WLR A;  1YW9 A;  5CDL A;  1W2M A;  1B6A A;  5CLS A;  2Q8K A;  4B28 A;  3L24 A;  4PNC A;  4RGZ 1;  4S2T P;  2GU7 A;  1O0X A;  2V3Y A;  2BB7 A;  4FLI A;  4FKC A;  2BWT A;  1C22 A;  3MX6 A;  1C21 A;  2B3H A;  1PV9 A;  4KM3 A;  4IKT A;  4U6Z A;  1C23 A;  1XNZ A;  2EVM A;  4U69 A;  2OAZ A;  1WL9 A;  2Q94 A;  4IEC A;  4Z7M A;  2BHA A;  3TB5 A;  5E5B A;  3TAV A;  2GG3 A;  4R60 A;  1WBQ A;  1QXY A;  2BWX A;  4EGE A;  1N51 A;  3FMR A;  4ZWP A;  1KP0 A;  3L7G A;  1CHM A;  2BHB A;  4U6C A;  4U70 A;  3MAT A;  2GTX A;  1KQ0 A;  2MAT A;  2EA2 A;  1WKM A;  4FO7 A;  2B3K A;  2BN7 A;  1WN1 A;  2GGB A;  2NQ6 A;  1BOA A;  2GG2 A;  5CDE A;  2GG0 A;  3Q6D A;  5FCF A;  2GA2 A;  4MAT A;  4IKS A;  4JUQ A;  3RVA A;  4A6V A;  4S2R P;  2Q95 A;  4U76 A;  2BHC A;  2GG7 A;  2BWW A;  4FLL A;  5JI6 A;  4RZZ A;  1WL6 A;  4A6W A;  4FUK A;  2EVO A;  1QXW A;  4FLK A;  2BH3 A;  4S01 A;  3BIT A;  5JFR A;  5CE6 A;  3BIP A;  4U6W A;  3D27 A;  1XGN A;  2OKN A;  2BWY A;  2P98 A;  2ADU A;  1YJ3 A;  2BWS A;  1C27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...