4FO8A

Pseudomonas aeruginosa metap with met, in mn form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
259
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 83
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo8A00
1R5GA 3CB6A 1YVMA 2EVMA 4IKSA 2P99A 1R5HA 1W2MA 2BH3A 3MR1A 4ZWOA 2GZ5A 1N51A 2B3KA 2GA2A 2Q94A 3FMQA 2GU7A 5FCHA 1KP0A 2Q95A 5CNXA 1B6AA 3PKEA 4IKUA 1QZYA 2BWTA 4FLJA 4U6WA 2B3HA 1R58A 3PKDA 4B28A 3PKAA 3RORA 3IG4A 2GG2A 5FCFA 4HXXA 4RZYA 4IDYA 4IU6A 3TAVA 4FO8A 4FO7A 4U6ZA 5JI6A 4R60A 3TB5A 3CTZA 2GU4A 4U75A 4S2TP 2V6CA 4S2RP 1QXZA 3BIPA 2GG8A 2V3ZA 1QXWA 1M35A 2GG9A 3PKBA 1BOAA 4IKTA 4IPAA 4U70A 1C24A 1A16A 3IU8A 3FMRA 4U76A 2B3LA 2DFIA 3BITA 2GGCA 1WBQA 2BWSA 4U73A 1YW7A 2GGBA 4PNCA 1YJ3A 5CIKA 1YW8A 2GU6A 2P98A 4ZWUA 2BN7A 3BIQA 2GG0A 4A6VA 1MATA 1WN1A 5CLSA 2IW2A 1KQ9A 3Q6DA 1XGOA 1C27A 4FLIA 1O0XA 4ZNGA 1XGSA 1WL6A 2OKNA 2BHCA 4U6JA 4EGEA 4FUKA 2G6PA 2BWXA 1B59A 2OAZA 2ADUA 2BHAA 3CB5A 3MX6A 3D27A 4U69A 5CDLA 2BHDA 2GU5A 4U71A 2BHBA 3L7GA 1PV9A 1XGNA 4QR8A 4RGZ1 3L24A 4FLKA 3S6BA 4RZZA 2BWVA 1BN5A 1WL9A 2GG5A 1C22A 2BWYA 2BWWA 1Y1NA 4KM3A 2GTXA 4MATA 1CHMA 2EVOA 3IU9A 5D6EA 5JFRA 2Q8KA 4ZWPA 4FKCA 2MATA 2Q93A 4A6WA 1C21A 1QXYA 4FLLA 5CDEA 4Z7MA 1XGMA 2V3XA 3IU7A 3PKCA 5D6FA 2Q96A 2ZSGA 1YW9A 4OOKA 4U6CA 2P9AA 1WLRA 3RVAA 5CE6A 4IECA 4PV4A 2EVCA 1WKMA 2NQ6A 1JAWA 1WY2A 5JHUA 2EA4A 4IF7A 4S01A 2HOWA 4IKRA 2NQ7A 1XNZA 2BB7A 2GG3A 3FM3A 4S00A 2BWUA 4U6EA 1W7VA 1KQ0A 5E5BA 3MATA 4U1BA 5CDVA 4JUQA 1C23A 2GG7A 2Q92A 2EA2A 2V3YA
chains in the Genus database with same CATH superfamily
1R5GA 3CB6A 1YVMA 2EVMA 4IKSA 2P99A 1R5HA 1W2MA 2BH3A 3MR1A 4ZWOA 2GZ5A 1N51A 2B3KA 2GA2A 2Q94A 3FMQA 2GU7A 5FCHA 1KP0A 2Q95A 5CNXA 1B6AA 3PKEA 4IKUA 1QZYA 2BWTA 4FLJA 4U6WA 2B3HA 1R58A 3PKDA 4B28A 3PKAA 3RORA 3IG4A 2GG2A 5FCFA 4HXXA 4RZYA 4IDYA 4IU6A 3TAVA 4FO8A 4FO7A 4U6ZA 5JI6A 4R60A 3TB5A 3CTZA 2GU4A 4U75A 4S2TP 2V6CA 4S2RP 1QXZA 3BIPA 2GG8A 2V3ZA 1QXWA 1M35A 2GG9A 3PKBA 1BOAA 4IKTA 4IPAA 4U70A 1C24A 1A16A 3IU8A 3FMRA 4U76A 2B3LA 2DFIA 3BITA 2GGCA 1WBQA 2BWSA 4U73A 1YW7A 2GGBA 4PNCA 1YJ3A 5CIKA 1YW8A 2GU6A 2P98A 4ZWUA 2BN7A 3BIQA 2GG0A 4A6VA 1MATA 1WN1A 5CLSA 2IW2A 1KQ9A 3Q6DA 1XGOA 1C27A 4FLIA 1O0XA 4ZNGA 1XGSA 1WL6A 2OKNA 2BHCA 4U6JA 4EGEA 4FUKA 2G6PA 2BWXA 1B59A 2OAZA 2ADUA 2BHAA 3CB5A 3MX6A 3D27A 4U69A 5CDLA 2BHDA 2GU5A 4U71A 2BHBA 3L7GA 1PV9A 1XGNA 4QR8A 4RGZ1 3L24A 4FLKA 3S6BA 4RZZA 2BWVA 1BN5A 1WL9A 2GG5A 1C22A 2BWYA 2BWWA 1Y1NA 4KM3A 2GTXA 4MATA 1CHMA 2EVOA 3IU9A 5D6EA 5JFRA 2Q8KA 4ZWPA 4FKCA 2MATA 2Q93A 4A6WA 1C21A 1QXYA 4FLLA 5CDEA 4Z7MA 1XGMA 2V3XA 3IU7A 3PKCA 5D6FA 2Q96A 2ZSGA 1YW9A 4OOKA 4U6CA 2P9AA 1WLRA 3RVAA 5CE6A 4IECA 4PV4A 2EVCA 1WKMA 2NQ6A 1JAWA 1WY2A 5JHUA 2EA4A 4IF7A 4S01A 2HOWA 4IKRA 2NQ7A 1XNZA 2BB7A 2GG3A 3FM3A 4S00A 2BWUA 4U6EA 1W7VA 1KQ0A 5E5BA 3MATA 4U1BA 5CDVA 4JUQA 1C23A 2GG7A 2Q92A 2EA2A 2V3YA
chains in the Genus database with same CATH topology
1R5GA 3CB6A 1YVMA 2EVMA 4IKSA 2P99A 1R5HA 1W2MA 2BH3A 3MR1A 4ZWOA 2GZ5A 1N51A 2B3KA 2GA2A 2Q94A 3FMQA 2GU7A 5FCHA 1KP0A 2Q95A 5CNXA 1B6AA 3PKEA 4IKUA 1QZYA 2BWTA 4FLJA 4U6WA 2B3HA 1R58A 3PKDA 4B28A 3PKAA 3RORA 3IG4A 2GG2A 5FCFA 4HXXA 4RZYA 4IDYA 4IU6A 3TAVA 4FO8A 4FO7A 4U6ZA 5JI6A 4R60A 3TB5A 3CTZA 2GU4A 4U75A 4S2TP 2V6CA 4S2RP 1QXZA 3BIPA 2GG8A 2V3ZA 1QXWA 1M35A 2GG9A 3PKBA 1BOAA 4IKTA 4IPAA 4U70A 1C24A 1A16A 3IU8A 3FMRA 4U76A 2B3LA 2DFIA 3BITA 2GGCA 1WBQA 2BWSA 4U73A 1YW7A 2GGBA 4PNCA 1YJ3A 5CIKA 1YW8A 2GU6A 2P98A 4ZWUA 2BN7A 3BIQA 2GG0A 4A6VA 1MATA 1WN1A 5CLSA 2IW2A 1KQ9A 3Q6DA 1XGOA 1C27A 4FLIA 1O0XA 4ZNGA 1XGSA 1WL6A 2OKNA 2BHCA 4U6JA 4EGEA 4FUKA 2G6PA 2BWXA 1B59A 2OAZA 2ADUA 2BHAA 3CB5A 3MX6A 3D27A 4U69A 5CDLA 2BHDA 2GU5A 4U71A 2BHBA 3L7GA 1PV9A 1XGNA 4QR8A 4RGZ1 3L24A 4FLKA 3S6BA 4RZZA 2BWVA 1BN5A 1WL9A 2GG5A 1C22A 2BWYA 2BWWA 1Y1NA 4KM3A 2GTXA 4MATA 1CHMA 2EVOA 3IU9A 5D6EA 5JFRA 2Q8KA 4ZWPA 4FKCA 2MATA 2Q93A 4A6WA 1C21A 1QXYA 4FLLA 5CDEA 4Z7MA 1XGMA 2V3XA 3IU7A 3PKCA 5D6FA 2Q96A 2ZSGA 1YW9A 4OOKA 4U6CA 2P9AA 1WLRA 3RVAA 5CE6A 4IECA 4PV4A 2EVCA 1WKMA 2NQ6A 1JAWA 1WY2A 5JHUA 2EA4A 4IF7A 4S01A 2HOWA 4IKRA 2NQ7A 1XNZA 2BB7A 2GG3A 3FM3A 4S00A 2BWUA 4U6EA 1W7VA 1KQ0A 5E5BA 3MATA 4U1BA 5CDVA 4JUQA 1C23A 2GG7A 2Q92A 2EA2A 2V3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5G A;  3CB6 A;  1YVM A;  2EVM A;  4IKS A;  2P99 A;  1R5H A;  1W2M A;  2BH3 A;  3MR1 A;  4ZWO A;  2GZ5 A;  1N51 A;  2B3K A;  2GA2 A;  2Q94 A;  3FMQ A;  2GU7 A;  5FCH A;  1KP0 A;  2Q95 A;  5CNX A;  1B6A A;  3PKE A;  4IKU A;  1QZY A;  2BWT A;  4FLJ A;  4U6W A;  2B3H A;  1R58 A;  3PKD A;  4B28 A;  3PKA A;  3ROR A;  3IG4 A;  2GG2 A;  5FCF A;  4HXX A;  4RZY A;  4IDY A;  4IU6 A;  3TAV A;  4FO8 A;  4FO7 A;  4U6Z A;  5JI6 A;  4R60 A;  3TB5 A;  3CTZ A;  2GU4 A;  4U75 A;  4S2T P;  2V6C A;  4S2R P;  1QXZ A;  3BIP A;  2GG8 A;  2V3Z A;  1QXW A;  1M35 A;  2GG9 A;  3PKB A;  1BOA A;  4IKT A;  4IPA A;  4U70 A;  1C24 A;  1A16 A;  3IU8 A;  3FMR A;  4U76 A;  2B3L A;  2DFI A;  3BIT A;  2GGC A;  1WBQ A;  2BWS A;  4U73 A;  1YW7 A;  2GGB A;  4PNC A;  1YJ3 A;  5CIK A;  1YW8 A;  2GU6 A;  2P98 A;  4ZWU A;  2BN7 A;  3BIQ A;  2GG0 A;  4A6V A;  1MAT A;  1WN1 A;  5CLS A;  2IW2 A;  1KQ9 A;  3Q6D A;  1XGO A;  1C27 A;  4FLI A;  1O0X A;  4ZNG A;  1XGS A;  1WL6 A;  2OKN A;  2BHC A;  4U6J A;  4EGE A;  4FUK A;  2G6P A;  2BWX A;  1B59 A;  2OAZ A;  2ADU A;  2BHA A;  3CB5 A;  3MX6 A;  3D27 A;  4U69 A;  5CDL A;  2BHD A;  2GU5 A;  4U71 A;  2BHB A;  3L7G A;  1PV9 A;  1XGN A;  4QR8 A;  4RGZ 1;  3L24 A;  4FLK A;  3S6B A;  4RZZ A;  2BWV A;  1BN5 A;  1WL9 A;  2GG5 A;  1C22 A;  2BWY A;  2BWW A;  1Y1N A;  4KM3 A;  2GTX A;  4MAT A;  1CHM A;  2EVO A;  3IU9 A;  5D6E A;  5JFR A;  2Q8K A;  4ZWP A;  4FKC A;  2MAT A;  2Q93 A;  4A6W A;  1C21 A;  1QXY A;  4FLL A;  5CDE A;  4Z7M A;  1XGM A;  2V3X A;  3IU7 A;  3PKC A;  5D6F A;  2Q96 A;  2ZSG A;  1YW9 A;  4OOK A;  4U6C A;  2P9A A;  1WLR A;  3RVA A;  5CE6 A;  4IEC A;  4PV4 A;  2EVC A;  1WKM A;  2NQ6 A;  1JAW A;  1WY2 A;  5JHU A;  2EA4 A;  4IF7 A;  4S01 A;  2HOW A;  4IKR A;  2NQ7 A;  1XNZ A;  2BB7 A;  2GG3 A;  3FM3 A;  4S00 A;  2BWU A;  4U6E A;  1W7V A;  1KQ0 A;  5E5B A;  3MAT A;  4U1B A;  5CDV A;  4JUQ A;  1C23 A;  2GG7 A;  2Q92 A;  2EA2 A;  2V3Y A; 
#chains in the Genus database with same CATH topology
 1R5G A;  3CB6 A;  1YVM A;  2EVM A;  4IKS A;  2P99 A;  1R5H A;  1W2M A;  2BH3 A;  3MR1 A;  4ZWO A;  2GZ5 A;  1N51 A;  2B3K A;  2GA2 A;  2Q94 A;  3FMQ A;  2GU7 A;  5FCH A;  1KP0 A;  2Q95 A;  5CNX A;  1B6A A;  3PKE A;  4IKU A;  1QZY A;  2BWT A;  4FLJ A;  4U6W A;  2B3H A;  1R58 A;  3PKD A;  4B28 A;  3PKA A;  3ROR A;  3IG4 A;  2GG2 A;  5FCF A;  4HXX A;  4RZY A;  4IDY A;  4IU6 A;  3TAV A;  4FO8 A;  4FO7 A;  4U6Z A;  5JI6 A;  4R60 A;  3TB5 A;  3CTZ A;  2GU4 A;  4U75 A;  4S2T P;  2V6C A;  4S2R P;  1QXZ A;  3BIP A;  2GG8 A;  2V3Z A;  1QXW A;  1M35 A;  2GG9 A;  3PKB A;  1BOA A;  4IKT A;  4IPA A;  4U70 A;  1C24 A;  1A16 A;  3IU8 A;  3FMR A;  4U76 A;  2B3L A;  2DFI A;  3BIT A;  2GGC A;  1WBQ A;  2BWS A;  4U73 A;  1YW7 A;  2GGB A;  4PNC A;  1YJ3 A;  5CIK A;  1YW8 A;  2GU6 A;  2P98 A;  4ZWU A;  2BN7 A;  3BIQ A;  2GG0 A;  4A6V A;  1MAT A;  1WN1 A;  5CLS A;  2IW2 A;  1KQ9 A;  3Q6D A;  1XGO A;  1C27 A;  4FLI A;  1O0X A;  4ZNG A;  1XGS A;  1WL6 A;  2OKN A;  2BHC A;  4U6J A;  4EGE A;  4FUK A;  2G6P A;  2BWX A;  1B59 A;  2OAZ A;  2ADU A;  2BHA A;  3CB5 A;  3MX6 A;  3D27 A;  4U69 A;  5CDL A;  2BHD A;  2GU5 A;  4U71 A;  2BHB A;  3L7G A;  1PV9 A;  1XGN A;  4QR8 A;  4RGZ 1;  3L24 A;  4FLK A;  3S6B A;  4RZZ A;  2BWV A;  1BN5 A;  1WL9 A;  2GG5 A;  1C22 A;  2BWY A;  2BWW A;  1Y1N A;  4KM3 A;  2GTX A;  4MAT A;  1CHM A;  2EVO A;  3IU9 A;  5D6E A;  5JFR A;  2Q8K A;  4ZWP A;  4FKC A;  2MAT A;  2Q93 A;  4A6W A;  1C21 A;  1QXY A;  4FLL A;  5CDE A;  4Z7M A;  1XGM A;  2V3X A;  3IU7 A;  3PKC A;  5D6F A;  2Q96 A;  2ZSG A;  1YW9 A;  4OOK A;  4U6C A;  2P9A A;  1WLR A;  3RVA A;  5CE6 A;  4IEC A;  4PV4 A;  2EVC A;  1WKM A;  2NQ6 A;  1JAW A;  1WY2 A;  5JHU A;  2EA4 A;  4IF7 A;  4S01 A;  2HOW A;  4IKR A;  2NQ7 A;  1XNZ A;  2BB7 A;  2GG3 A;  3FM3 A;  4S00 A;  2BWU A;  4U6E A;  1W7V A;  1KQ0 A;  5E5B A;  3MAT A;  4U1B A;  5CDV A;  4JUQ A;  1C23 A;  2GG7 A;  2Q92 A;  2EA2 A;  2V3Y A; 
#chains in the Genus database with same CATH homology
 1R5G A;  3CB6 A;  1YVM A;  2EVM A;  4IKS A;  2P99 A;  1R5H A;  1W2M A;  2BH3 A;  3MR1 A;  4ZWO A;  2GZ5 A;  1N51 A;  2B3K A;  2GA2 A;  2Q94 A;  3FMQ A;  2GU7 A;  5FCH A;  1KP0 A;  2Q95 A;  5CNX A;  1B6A A;  3PKE A;  4IKU A;  1QZY A;  2BWT A;  4FLJ A;  4U6W A;  2B3H A;  1R58 A;  3PKD A;  4B28 A;  3PKA A;  3ROR A;  3IG4 A;  2GG2 A;  5FCF A;  4HXX A;  4RZY A;  4IDY A;  4IU6 A;  3TAV A;  4FO8 A;  4FO7 A;  4U6Z A;  5JI6 A;  4R60 A;  3TB5 A;  3CTZ A;  2GU4 A;  4U75 A;  4S2T P;  2V6C A;  4S2R P;  1QXZ A;  3BIP A;  2GG8 A;  2V3Z A;  1QXW A;  1M35 A;  2GG9 A;  3PKB A;  1BOA A;  4IKT A;  4IPA A;  4U70 A;  1C24 A;  1A16 A;  3IU8 A;  3FMR A;  4U76 A;  2B3L A;  2DFI A;  3BIT A;  2GGC A;  1WBQ A;  2BWS A;  4U73 A;  1YW7 A;  2GGB A;  4PNC A;  1YJ3 A;  5CIK A;  1YW8 A;  2GU6 A;  2P98 A;  4ZWU A;  2BN7 A;  3BIQ A;  2GG0 A;  4A6V A;  1MAT A;  1WN1 A;  5CLS A;  2IW2 A;  1KQ9 A;  3Q6D A;  1XGO A;  1C27 A;  4FLI A;  1O0X A;  4ZNG A;  1XGS A;  1WL6 A;  2OKN A;  2BHC A;  4U6J A;  4EGE A;  4FUK A;  2G6P A;  2BWX A;  1B59 A;  2OAZ A;  2ADU A;  2BHA A;  3CB5 A;  3MX6 A;  3D27 A;  4U69 A;  5CDL A;  2BHD A;  2GU5 A;  4U71 A;  2BHB A;  3L7G A;  1PV9 A;  1XGN A;  4QR8 A;  4RGZ 1;  3L24 A;  4FLK A;  3S6B A;  4RZZ A;  2BWV A;  1BN5 A;  1WL9 A;  2GG5 A;  1C22 A;  2BWY A;  2BWW A;  1Y1N A;  4KM3 A;  2GTX A;  4MAT A;  1CHM A;  2EVO A;  3IU9 A;  5D6E A;  5JFR A;  2Q8K A;  4ZWP A;  4FKC A;  2MAT A;  2Q93 A;  4A6W A;  1C21 A;  1QXY A;  4FLL A;  5CDE A;  4Z7M A;  1XGM A;  2V3X A;  3IU7 A;  3PKC A;  5D6F A;  2Q96 A;  2ZSG A;  1YW9 A;  4OOK A;  4U6C A;  2P9A A;  1WLR A;  3RVA A;  5CE6 A;  4IEC A;  4PV4 A;  2EVC A;  1WKM A;  2NQ6 A;  1JAW A;  1WY2 A;  5JHU A;  2EA4 A;  4IF7 A;  4S01 A;  2HOW A;  4IKR A;  2NQ7 A;  1XNZ A;  2BB7 A;  2GG3 A;  3FM3 A;  4S00 A;  2BWU A;  4U6E A;  1W7V A;  1KQ0 A;  5E5B A;  3MAT A;  4U1B A;  5CDV A;  4JUQ A;  1C23 A;  2GG7 A;  2Q92 A;  2EA2 A;  2V3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...