4FO8A

Pseudomonas aeruginosa metap with met, in mn form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
259
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 83
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo8A00
1QZYA 2Q96A 1CHMA 1XGMA 3CTZA 2P99A 2GGCA 2GG2A 2P98A 2V3XA 2B3LA 1WKMA 4FLLA 2BWVA 2EA2A 2EA4A 4IF7A 1A16A 4IKUA 4S01A 3S6BA 3CB6A 3PKEA 4RZZA 2Q95A 4FO7A 2GU6A 4U1BA 4ZWOA 1YW8A 4FLKA 5JHUA 5JI6A 1R5GA 2BHAA 2OAZA 3L7GA 2BWTA 1QXWA 4QR8A 5E5BA 2GA2A 4PNCA 4FO8A 1WLRA 2NQ7A 1KQ9A 1C24A 4JUQA 3PKDA 1XGNA 2GG8A 1JAWA 2GU4A 3FM3A 3IU8A 4IPAA 5CNXA 3IU7A 3L24A 1XGOA 4OOKA 3CB5A 4A6WA 2P9AA 3TB5A 1Y1NA 2OKNA 2Q8KA 1QXYA 1WL9A 1W2MA 3FMQA 5CE6A 4U6CA 4U6ZA 4U6WA 4U69A 4IECA 4U75A 4PV4A 4S2TP 4U6JA 2G6PA 2Q93A 2BWXA 1O0XA 1BN5A 2GG0A 3MATA 1KQ0A 4R60A 4MATA 4U71A 1R5HA 4FKCA 2MATA 1C23A 2GU5A 3MR1A 3PKAA 4FLJA 2BHDA 5CDEA 4IKSA 2B3KA 1YW7A 4IU6A 5CIKA 2BHBA 2GTXA 4Z7MA 4U73A 2ZSGA 3IG4A 2GG9A 2GG5A 1XNZA 4U6EA 2EVMA 2Q92A 4S2RP 4RGZ1 5FCFA 1C22A 2V3ZA 1KP0A 1BOAA 1C21A 2GZ5A 4ZWUA 3TAVA 1WBQA 1WN1A 2GGBA 4KM3A 3D27A 4IDYA 4IKTA 4RZYA 4U70A 2HOWA 3FMRA 1M35A 4ZWPA 3RVAA 5FCHA 4ZNGA 2V6CA 2GU7A 2BWSA 3BIQA 2GG7A 1YVMA 4FLIA 3PKCA 2NQ6A 4U76A 2IW2A 1PV9A 4IKRA 1WL6A 2Q94A 1WY2A 3BIPA 5CDVA 1B6AA 3IU9A 1C27A 1MATA 2BHCA 2BWUA 1YW9A 2EVOA 3MX6A 1B59A 4A6VA 2BN7A 1R58A 4EGEA 4FUKA 4S00A 1QXZA 5CLSA 3PKBA 3RORA 3Q6DA 5D6FA 2EVCA 1YJ3A 2ADUA 5D6EA 2BH3A 1N51A 2GG3A 2BWWA 2V3YA 4B28A 5CDLA 5JFRA 2B3HA 1XGSA 4HXXA 2DFIA 2BB7A 1W7VA 3BITA 2BWYA
chains in the Genus database with same CATH superfamily
1QZYA 2Q96A 1CHMA 1XGMA 3CTZA 2P99A 2GGCA 2GG2A 2P98A 2V3XA 2B3LA 1WKMA 4FLLA 2BWVA 2EA2A 2EA4A 4IF7A 1A16A 4IKUA 4S01A 3S6BA 3CB6A 3PKEA 4RZZA 2Q95A 4FO7A 2GU6A 4U1BA 4ZWOA 1YW8A 4FLKA 5JHUA 5JI6A 1R5GA 2BHAA 2OAZA 3L7GA 2BWTA 1QXWA 4QR8A 5E5BA 2GA2A 4PNCA 4FO8A 1WLRA 2NQ7A 1KQ9A 1C24A 4JUQA 3PKDA 1XGNA 2GG8A 1JAWA 2GU4A 3FM3A 3IU8A 4IPAA 5CNXA 3IU7A 3L24A 1XGOA 4OOKA 3CB5A 4A6WA 2P9AA 3TB5A 1Y1NA 2OKNA 2Q8KA 1QXYA 1WL9A 1W2MA 3FMQA 5CE6A 4U6CA 4U6ZA 4U6WA 4U69A 4IECA 4U75A 4PV4A 4S2TP 4U6JA 2G6PA 2Q93A 2BWXA 1O0XA 1BN5A 2GG0A 3MATA 1KQ0A 4R60A 4MATA 4U71A 1R5HA 4FKCA 2MATA 1C23A 2GU5A 3MR1A 3PKAA 4FLJA 2BHDA 5CDEA 4IKSA 2B3KA 1YW7A 4IU6A 5CIKA 2BHBA 2GTXA 4Z7MA 4U73A 2ZSGA 3IG4A 2GG9A 2GG5A 1XNZA 4U6EA 2EVMA 2Q92A 4S2RP 4RGZ1 5FCFA 1C22A 2V3ZA 1KP0A 1BOAA 1C21A 2GZ5A 4ZWUA 3TAVA 1WBQA 1WN1A 2GGBA 4KM3A 3D27A 4IDYA 4IKTA 4RZYA 4U70A 2HOWA 3FMRA 1M35A 4ZWPA 3RVAA 5FCHA 4ZNGA 2V6CA 2GU7A 2BWSA 3BIQA 2GG7A 1YVMA 4FLIA 3PKCA 2NQ6A 4U76A 2IW2A 1PV9A 4IKRA 1WL6A 2Q94A 1WY2A 3BIPA 5CDVA 1B6AA 3IU9A 1C27A 1MATA 2BHCA 2BWUA 1YW9A 2EVOA 3MX6A 1B59A 4A6VA 2BN7A 1R58A 4EGEA 4FUKA 4S00A 1QXZA 5CLSA 3PKBA 3RORA 3Q6DA 5D6FA 2EVCA 1YJ3A 2ADUA 5D6EA 2BH3A 1N51A 2GG3A 2BWWA 2V3YA 4B28A 5CDLA 5JFRA 2B3HA 1XGSA 4HXXA 2DFIA 2BB7A 1W7VA 3BITA 2BWYA
chains in the Genus database with same CATH topology
1QZYA 2Q96A 1CHMA 1XGMA 3CTZA 2P99A 2GGCA 2GG2A 2P98A 2V3XA 2B3LA 1WKMA 4FLLA 2BWVA 2EA2A 2EA4A 4IF7A 1A16A 4IKUA 4S01A 3S6BA 3CB6A 3PKEA 4RZZA 2Q95A 4FO7A 2GU6A 4U1BA 4ZWOA 1YW8A 4FLKA 5JHUA 5JI6A 1R5GA 2BHAA 2OAZA 3L7GA 2BWTA 1QXWA 4QR8A 5E5BA 2GA2A 4PNCA 4FO8A 1WLRA 2NQ7A 1KQ9A 1C24A 4JUQA 3PKDA 1XGNA 2GG8A 1JAWA 2GU4A 3FM3A 3IU8A 4IPAA 5CNXA 3IU7A 3L24A 1XGOA 4OOKA 3CB5A 4A6WA 2P9AA 3TB5A 1Y1NA 2OKNA 2Q8KA 1QXYA 1WL9A 1W2MA 3FMQA 5CE6A 4U6CA 4U6ZA 4U6WA 4U69A 4IECA 4U75A 4PV4A 4S2TP 4U6JA 2G6PA 2Q93A 2BWXA 1O0XA 1BN5A 2GG0A 3MATA 1KQ0A 4R60A 4MATA 4U71A 1R5HA 4FKCA 2MATA 1C23A 2GU5A 3MR1A 3PKAA 4FLJA 2BHDA 5CDEA 4IKSA 2B3KA 1YW7A 4IU6A 5CIKA 2BHBA 2GTXA 4Z7MA 4U73A 2ZSGA 3IG4A 2GG9A 2GG5A 1XNZA 4U6EA 2EVMA 2Q92A 4S2RP 4RGZ1 5FCFA 1C22A 2V3ZA 1KP0A 1BOAA 1C21A 2GZ5A 4ZWUA 3TAVA 1WBQA 1WN1A 2GGBA 4KM3A 3D27A 4IDYA 4IKTA 4RZYA 4U70A 2HOWA 3FMRA 1M35A 4ZWPA 3RVAA 5FCHA 4ZNGA 2V6CA 2GU7A 2BWSA 3BIQA 2GG7A 1YVMA 4FLIA 3PKCA 2NQ6A 4U76A 2IW2A 1PV9A 4IKRA 1WL6A 2Q94A 1WY2A 3BIPA 5CDVA 1B6AA 3IU9A 1C27A 1MATA 2BHCA 2BWUA 1YW9A 2EVOA 3MX6A 1B59A 4A6VA 2BN7A 1R58A 4EGEA 4FUKA 4S00A 1QXZA 5CLSA 3PKBA 3RORA 3Q6DA 5D6FA 2EVCA 1YJ3A 2ADUA 5D6EA 2BH3A 1N51A 2GG3A 2BWWA 2V3YA 4B28A 5CDLA 5JFRA 2B3HA 1XGSA 4HXXA 2DFIA 2BB7A 1W7VA 3BITA 2BWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  2Q96 A;  1CHM A;  1XGM A;  3CTZ A;  2P99 A;  2GGC A;  2GG2 A;  2P98 A;  2V3X A;  2B3L A;  1WKM A;  4FLL A;  2BWV A;  2EA2 A;  2EA4 A;  4IF7 A;  1A16 A;  4IKU A;  4S01 A;  3S6B A;  3CB6 A;  3PKE A;  4RZZ A;  2Q95 A;  4FO7 A;  2GU6 A;  4U1B A;  4ZWO A;  1YW8 A;  4FLK A;  5JHU A;  5JI6 A;  1R5G A;  2BHA A;  2OAZ A;  3L7G A;  2BWT A;  1QXW A;  4QR8 A;  5E5B A;  2GA2 A;  4PNC A;  4FO8 A;  1WLR A;  2NQ7 A;  1KQ9 A;  1C24 A;  4JUQ A;  3PKD A;  1XGN A;  2GG8 A;  1JAW A;  2GU4 A;  3FM3 A;  3IU8 A;  4IPA A;  5CNX A;  3IU7 A;  3L24 A;  1XGO A;  4OOK A;  3CB5 A;  4A6W A;  2P9A A;  3TB5 A;  1Y1N A;  2OKN A;  2Q8K A;  1QXY A;  1WL9 A;  1W2M A;  3FMQ A;  5CE6 A;  4U6C A;  4U6Z A;  4U6W A;  4U69 A;  4IEC A;  4U75 A;  4PV4 A;  4S2T P;  4U6J A;  2G6P A;  2Q93 A;  2BWX A;  1O0X A;  1BN5 A;  2GG0 A;  3MAT A;  1KQ0 A;  4R60 A;  4MAT A;  4U71 A;  1R5H A;  4FKC A;  2MAT A;  1C23 A;  2GU5 A;  3MR1 A;  3PKA A;  4FLJ A;  2BHD A;  5CDE A;  4IKS A;  2B3K A;  1YW7 A;  4IU6 A;  5CIK A;  2BHB A;  2GTX A;  4Z7M A;  4U73 A;  2ZSG A;  3IG4 A;  2GG9 A;  2GG5 A;  1XNZ A;  4U6E A;  2EVM A;  2Q92 A;  4S2R P;  4RGZ 1;  5FCF A;  1C22 A;  2V3Z A;  1KP0 A;  1BOA A;  1C21 A;  2GZ5 A;  4ZWU A;  3TAV A;  1WBQ A;  1WN1 A;  2GGB A;  4KM3 A;  3D27 A;  4IDY A;  4IKT A;  4RZY A;  4U70 A;  2HOW A;  3FMR A;  1M35 A;  4ZWP A;  3RVA A;  5FCH A;  4ZNG A;  2V6C A;  2GU7 A;  2BWS A;  3BIQ A;  2GG7 A;  1YVM A;  4FLI A;  3PKC A;  2NQ6 A;  4U76 A;  2IW2 A;  1PV9 A;  4IKR A;  1WL6 A;  2Q94 A;  1WY2 A;  3BIP A;  5CDV A;  1B6A A;  3IU9 A;  1C27 A;  1MAT A;  2BHC A;  2BWU A;  1YW9 A;  2EVO A;  3MX6 A;  1B59 A;  4A6V A;  2BN7 A;  1R58 A;  4EGE A;  4FUK A;  4S00 A;  1QXZ A;  5CLS A;  3PKB A;  3ROR A;  3Q6D A;  5D6F A;  2EVC A;  1YJ3 A;  2ADU A;  5D6E A;  2BH3 A;  1N51 A;  2GG3 A;  2BWW A;  2V3Y A;  4B28 A;  5CDL A;  5JFR A;  2B3H A;  1XGS A;  4HXX A;  2DFI A;  2BB7 A;  1W7V A;  3BIT A;  2BWY A; 
#chains in the Genus database with same CATH topology
 1QZY A;  2Q96 A;  1CHM A;  1XGM A;  3CTZ A;  2P99 A;  2GGC A;  2GG2 A;  2P98 A;  2V3X A;  2B3L A;  1WKM A;  4FLL A;  2BWV A;  2EA2 A;  2EA4 A;  4IF7 A;  1A16 A;  4IKU A;  4S01 A;  3S6B A;  3CB6 A;  3PKE A;  4RZZ A;  2Q95 A;  4FO7 A;  2GU6 A;  4U1B A;  4ZWO A;  1YW8 A;  4FLK A;  5JHU A;  5JI6 A;  1R5G A;  2BHA A;  2OAZ A;  3L7G A;  2BWT A;  1QXW A;  4QR8 A;  5E5B A;  2GA2 A;  4PNC A;  4FO8 A;  1WLR A;  2NQ7 A;  1KQ9 A;  1C24 A;  4JUQ A;  3PKD A;  1XGN A;  2GG8 A;  1JAW A;  2GU4 A;  3FM3 A;  3IU8 A;  4IPA A;  5CNX A;  3IU7 A;  3L24 A;  1XGO A;  4OOK A;  3CB5 A;  4A6W A;  2P9A A;  3TB5 A;  1Y1N A;  2OKN A;  2Q8K A;  1QXY A;  1WL9 A;  1W2M A;  3FMQ A;  5CE6 A;  4U6C A;  4U6Z A;  4U6W A;  4U69 A;  4IEC A;  4U75 A;  4PV4 A;  4S2T P;  4U6J A;  2G6P A;  2Q93 A;  2BWX A;  1O0X A;  1BN5 A;  2GG0 A;  3MAT A;  1KQ0 A;  4R60 A;  4MAT A;  4U71 A;  1R5H A;  4FKC A;  2MAT A;  1C23 A;  2GU5 A;  3MR1 A;  3PKA A;  4FLJ A;  2BHD A;  5CDE A;  4IKS A;  2B3K A;  1YW7 A;  4IU6 A;  5CIK A;  2BHB A;  2GTX A;  4Z7M A;  4U73 A;  2ZSG A;  3IG4 A;  2GG9 A;  2GG5 A;  1XNZ A;  4U6E A;  2EVM A;  2Q92 A;  4S2R P;  4RGZ 1;  5FCF A;  1C22 A;  2V3Z A;  1KP0 A;  1BOA A;  1C21 A;  2GZ5 A;  4ZWU A;  3TAV A;  1WBQ A;  1WN1 A;  2GGB A;  4KM3 A;  3D27 A;  4IDY A;  4IKT A;  4RZY A;  4U70 A;  2HOW A;  3FMR A;  1M35 A;  4ZWP A;  3RVA A;  5FCH A;  4ZNG A;  2V6C A;  2GU7 A;  2BWS A;  3BIQ A;  2GG7 A;  1YVM A;  4FLI A;  3PKC A;  2NQ6 A;  4U76 A;  2IW2 A;  1PV9 A;  4IKR A;  1WL6 A;  2Q94 A;  1WY2 A;  3BIP A;  5CDV A;  1B6A A;  3IU9 A;  1C27 A;  1MAT A;  2BHC A;  2BWU A;  1YW9 A;  2EVO A;  3MX6 A;  1B59 A;  4A6V A;  2BN7 A;  1R58 A;  4EGE A;  4FUK A;  4S00 A;  1QXZ A;  5CLS A;  3PKB A;  3ROR A;  3Q6D A;  5D6F A;  2EVC A;  1YJ3 A;  2ADU A;  5D6E A;  2BH3 A;  1N51 A;  2GG3 A;  2BWW A;  2V3Y A;  4B28 A;  5CDL A;  5JFR A;  2B3H A;  1XGS A;  4HXX A;  2DFI A;  2BB7 A;  1W7V A;  3BIT A;  2BWY A; 
#chains in the Genus database with same CATH homology
 1QZY A;  2Q96 A;  1CHM A;  1XGM A;  3CTZ A;  2P99 A;  2GGC A;  2GG2 A;  2P98 A;  2V3X A;  2B3L A;  1WKM A;  4FLL A;  2BWV A;  2EA2 A;  2EA4 A;  4IF7 A;  1A16 A;  4IKU A;  4S01 A;  3S6B A;  3CB6 A;  3PKE A;  4RZZ A;  2Q95 A;  4FO7 A;  2GU6 A;  4U1B A;  4ZWO A;  1YW8 A;  4FLK A;  5JHU A;  5JI6 A;  1R5G A;  2BHA A;  2OAZ A;  3L7G A;  2BWT A;  1QXW A;  4QR8 A;  5E5B A;  2GA2 A;  4PNC A;  4FO8 A;  1WLR A;  2NQ7 A;  1KQ9 A;  1C24 A;  4JUQ A;  3PKD A;  1XGN A;  2GG8 A;  1JAW A;  2GU4 A;  3FM3 A;  3IU8 A;  4IPA A;  5CNX A;  3IU7 A;  3L24 A;  1XGO A;  4OOK A;  3CB5 A;  4A6W A;  2P9A A;  3TB5 A;  1Y1N A;  2OKN A;  2Q8K A;  1QXY A;  1WL9 A;  1W2M A;  3FMQ A;  5CE6 A;  4U6C A;  4U6Z A;  4U6W A;  4U69 A;  4IEC A;  4U75 A;  4PV4 A;  4S2T P;  4U6J A;  2G6P A;  2Q93 A;  2BWX A;  1O0X A;  1BN5 A;  2GG0 A;  3MAT A;  1KQ0 A;  4R60 A;  4MAT A;  4U71 A;  1R5H A;  4FKC A;  2MAT A;  1C23 A;  2GU5 A;  3MR1 A;  3PKA A;  4FLJ A;  2BHD A;  5CDE A;  4IKS A;  2B3K A;  1YW7 A;  4IU6 A;  5CIK A;  2BHB A;  2GTX A;  4Z7M A;  4U73 A;  2ZSG A;  3IG4 A;  2GG9 A;  2GG5 A;  1XNZ A;  4U6E A;  2EVM A;  2Q92 A;  4S2R P;  4RGZ 1;  5FCF A;  1C22 A;  2V3Z A;  1KP0 A;  1BOA A;  1C21 A;  2GZ5 A;  4ZWU A;  3TAV A;  1WBQ A;  1WN1 A;  2GGB A;  4KM3 A;  3D27 A;  4IDY A;  4IKT A;  4RZY A;  4U70 A;  2HOW A;  3FMR A;  1M35 A;  4ZWP A;  3RVA A;  5FCH A;  4ZNG A;  2V6C A;  2GU7 A;  2BWS A;  3BIQ A;  2GG7 A;  1YVM A;  4FLI A;  3PKC A;  2NQ6 A;  4U76 A;  2IW2 A;  1PV9 A;  4IKR A;  1WL6 A;  2Q94 A;  1WY2 A;  3BIP A;  5CDV A;  1B6A A;  3IU9 A;  1C27 A;  1MAT A;  2BHC A;  2BWU A;  1YW9 A;  2EVO A;  3MX6 A;  1B59 A;  4A6V A;  2BN7 A;  1R58 A;  4EGE A;  4FUK A;  4S00 A;  1QXZ A;  5CLS A;  3PKB A;  3ROR A;  3Q6D A;  5D6F A;  2EVC A;  1YJ3 A;  2ADU A;  5D6E A;  2BH3 A;  1N51 A;  2GG3 A;  2BWW A;  2V3Y A;  4B28 A;  5CDL A;  5JFR A;  2B3H A;  1XGS A;  4HXX A;  2DFI A;  2BB7 A;  1W7V A;  3BIT A;  2BWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...