4FO8A

Pseudomonas aeruginosa metap with met, in mn form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
259
Chain Sequence
b'TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 83
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo8A00
4IKTA 2V3XA 2ADUA 3PKBA 4RGZ1 4ZWUA 2GU6A 2EVCA 3BIQA 1A16A 4IKUA 2GZ5A 1WKMA 2NQ7A 2BWUA 1YVMA 4U6ZA 4A6WA 3CB6A 2GA2A 2Q8KA 2BN7A 2G6PA 2DFIA 1YW9A 2P98A 3PKEA 2GGBA 2Q93A 2V6CA 1QXWA 4FLJA 3CB5A 3MR1A 4IECA 1C23A 1QXYA 4RZYA 1O0XA 1KQ0A 2BWXA 4ZWOA 3RORA 2EVOA 3PKDA 4PNCA 3IG4A 3L24A 2Q96A 2BWWA 3TAVA 4U71A 4QR8A 5CDVA 5D6EA 3L7GA 4IF7A 2BWSA 1W7VA 4FLLA 4FO7A 4U73A 1KQ9A 2MATA 1WL6A 2P99A 3IU7A 2Q92A 4U75A 4S2TP 3FMQA 1WL9A 1BOAA 5JI6A 4IKRA 4S01A 4KM3A 2P9AA 5JHUA 2BHDA 4Z7MA 1YW7A 2GG7A 4OOKA 4FUKA 1WY2A 4B28A 5FCHA 2HOWA 2GG3A 2BWVA 5CLSA 5FCFA 5CIKA 2BHCA 2IW2A 3BIPA 1KP0A 4A6VA 2GU4A 4U70A 4S2RP 5JFRA 4MATA 2GGCA 1C24A 2ZSGA 1QZYA 1R5GA 4RZZA 4ZNGA 5D6FA 1PV9A 3IU8A 4FLKA 4JUQA 1M35A 4U6EA 2GG9A 1BN5A 2EA2A 1N51A 2V3ZA 1C27A 1XGNA 1XGMA 2B3KA 4R60A 2V3YA 1R5HA 2GG5A 3PKCA 1YW8A 2GTXA 1C22A 1QXZA 3BITA 2Q95A 5CE6A 1XNZA 2GG8A 1Y1NA 1MATA 4HXXA 5E5BA 1XGSA 2BH3A 2B3LA 3CTZA 4ZWPA 1B6AA 1WLRA 2GU5A 2B3HA 4IDYA 3D27A 5CDEA 2Q94A 1W2MA 1R58A 2EA4A 1B59A 5CNXA 4U76A 2BWTA 4U69A 4U6CA 4FKCA 1XGOA 4PV4A 3RVAA 2GG2A 4IPAA 2OKNA 2EVMA 4U6WA 3S6BA 3IU9A 4EGEA 1YJ3A 5CDLA 4U1BA 1CHMA 2NQ6A 2BB7A 3Q6DA 4S00A 3PKAA 3TB5A 2BWYA 4IU6A 4FLIA 1WN1A 4U6JA 4IKSA 3FMRA 2GG0A 1JAWA 2BHBA 1WBQA 4FO8A 2BHAA 3FM3A 1C21A 2GU7A 2OAZA 3MX6A 3MATA
chains in the Genus database with same CATH superfamily
4IKTA 2V3XA 2ADUA 3PKBA 4RGZ1 4ZWUA 2GU6A 2EVCA 3BIQA 1A16A 4IKUA 2GZ5A 1WKMA 2NQ7A 2BWUA 1YVMA 4U6ZA 4A6WA 3CB6A 2GA2A 2Q8KA 2BN7A 2G6PA 2DFIA 1YW9A 2P98A 3PKEA 2GGBA 2Q93A 2V6CA 1QXWA 4FLJA 3CB5A 3MR1A 4IECA 1C23A 1QXYA 4RZYA 1O0XA 1KQ0A 2BWXA 4ZWOA 3RORA 2EVOA 3PKDA 4PNCA 3IG4A 3L24A 2Q96A 2BWWA 3TAVA 4U71A 4QR8A 5CDVA 5D6EA 3L7GA 4IF7A 2BWSA 1W7VA 4FLLA 4FO7A 4U73A 1KQ9A 2MATA 1WL6A 2P99A 3IU7A 2Q92A 4U75A 4S2TP 3FMQA 1WL9A 1BOAA 5JI6A 4IKRA 4S01A 4KM3A 2P9AA 5JHUA 2BHDA 4Z7MA 1YW7A 2GG7A 4OOKA 4FUKA 1WY2A 4B28A 5FCHA 2HOWA 2GG3A 2BWVA 5CLSA 5FCFA 5CIKA 2BHCA 2IW2A 3BIPA 1KP0A 4A6VA 2GU4A 4U70A 4S2RP 5JFRA 4MATA 2GGCA 1C24A 2ZSGA 1QZYA 1R5GA 4RZZA 4ZNGA 5D6FA 1PV9A 3IU8A 4FLKA 4JUQA 1M35A 4U6EA 2GG9A 1BN5A 2EA2A 1N51A 2V3ZA 1C27A 1XGNA 1XGMA 2B3KA 4R60A 2V3YA 1R5HA 2GG5A 3PKCA 1YW8A 2GTXA 1C22A 1QXZA 3BITA 2Q95A 5CE6A 1XNZA 2GG8A 1Y1NA 1MATA 4HXXA 5E5BA 1XGSA 2BH3A 2B3LA 3CTZA 4ZWPA 1B6AA 1WLRA 2GU5A 2B3HA 4IDYA 3D27A 5CDEA 2Q94A 1W2MA 1R58A 2EA4A 1B59A 5CNXA 4U76A 2BWTA 4U69A 4U6CA 4FKCA 1XGOA 4PV4A 3RVAA 2GG2A 4IPAA 2OKNA 2EVMA 4U6WA 3S6BA 3IU9A 4EGEA 1YJ3A 5CDLA 4U1BA 1CHMA 2NQ6A 2BB7A 3Q6DA 4S00A 3PKAA 3TB5A 2BWYA 4IU6A 4FLIA 1WN1A 4U6JA 4IKSA 3FMRA 2GG0A 1JAWA 2BHBA 1WBQA 4FO8A 2BHAA 3FM3A 1C21A 2GU7A 2OAZA 3MX6A 3MATA
chains in the Genus database with same CATH topology
4IKTA 2V3XA 2ADUA 3PKBA 4RGZ1 4ZWUA 2GU6A 2EVCA 3BIQA 1A16A 4IKUA 2GZ5A 1WKMA 2NQ7A 2BWUA 1YVMA 4U6ZA 4A6WA 3CB6A 2GA2A 2Q8KA 2BN7A 2G6PA 2DFIA 1YW9A 2P98A 3PKEA 2GGBA 2Q93A 2V6CA 1QXWA 4FLJA 3CB5A 3MR1A 4IECA 1C23A 1QXYA 4RZYA 1O0XA 1KQ0A 2BWXA 4ZWOA 3RORA 2EVOA 3PKDA 4PNCA 3IG4A 3L24A 2Q96A 2BWWA 3TAVA 4U71A 4QR8A 5CDVA 5D6EA 3L7GA 4IF7A 2BWSA 1W7VA 4FLLA 4FO7A 4U73A 1KQ9A 2MATA 1WL6A 2P99A 3IU7A 2Q92A 4U75A 4S2TP 3FMQA 1WL9A 1BOAA 5JI6A 4IKRA 4S01A 4KM3A 2P9AA 5JHUA 2BHDA 4Z7MA 1YW7A 2GG7A 4OOKA 4FUKA 1WY2A 4B28A 5FCHA 2HOWA 2GG3A 2BWVA 5CLSA 5FCFA 5CIKA 2BHCA 2IW2A 3BIPA 1KP0A 4A6VA 2GU4A 4U70A 4S2RP 5JFRA 4MATA 2GGCA 1C24A 2ZSGA 1QZYA 1R5GA 4RZZA 4ZNGA 5D6FA 1PV9A 3IU8A 4FLKA 4JUQA 1M35A 4U6EA 2GG9A 1BN5A 2EA2A 1N51A 2V3ZA 1C27A 1XGNA 1XGMA 2B3KA 4R60A 2V3YA 1R5HA 2GG5A 3PKCA 1YW8A 2GTXA 1C22A 1QXZA 3BITA 2Q95A 5CE6A 1XNZA 2GG8A 1Y1NA 1MATA 4HXXA 5E5BA 1XGSA 2BH3A 2B3LA 3CTZA 4ZWPA 1B6AA 1WLRA 2GU5A 2B3HA 4IDYA 3D27A 5CDEA 2Q94A 1W2MA 1R58A 2EA4A 1B59A 5CNXA 4U76A 2BWTA 4U69A 4U6CA 4FKCA 1XGOA 4PV4A 3RVAA 2GG2A 4IPAA 2OKNA 2EVMA 4U6WA 3S6BA 3IU9A 4EGEA 1YJ3A 5CDLA 4U1BA 1CHMA 2NQ6A 2BB7A 3Q6DA 4S00A 3PKAA 3TB5A 2BWYA 4IU6A 4FLIA 1WN1A 4U6JA 4IKSA 3FMRA 2GG0A 1JAWA 2BHBA 1WBQA 4FO8A 2BHAA 3FM3A 1C21A 2GU7A 2OAZA 3MX6A 3MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKT A;  2V3X A;  2ADU A;  3PKB A;  4RGZ 1;  4ZWU A;  2GU6 A;  2EVC A;  3BIQ A;  1A16 A;  4IKU A;  2GZ5 A;  1WKM A;  2NQ7 A;  2BWU A;  1YVM A;  4U6Z A;  4A6W A;  3CB6 A;  2GA2 A;  2Q8K A;  2BN7 A;  2G6P A;  2DFI A;  1YW9 A;  2P98 A;  3PKE A;  2GGB A;  2Q93 A;  2V6C A;  1QXW A;  4FLJ A;  3CB5 A;  3MR1 A;  4IEC A;  1C23 A;  1QXY A;  4RZY A;  1O0X A;  1KQ0 A;  2BWX A;  4ZWO A;  3ROR A;  2EVO A;  3PKD A;  4PNC A;  3IG4 A;  3L24 A;  2Q96 A;  2BWW A;  3TAV A;  4U71 A;  4QR8 A;  5CDV A;  5D6E A;  3L7G A;  4IF7 A;  2BWS A;  1W7V A;  4FLL A;  4FO7 A;  4U73 A;  1KQ9 A;  2MAT A;  1WL6 A;  2P99 A;  3IU7 A;  2Q92 A;  4U75 A;  4S2T P;  3FMQ A;  1WL9 A;  1BOA A;  5JI6 A;  4IKR A;  4S01 A;  4KM3 A;  2P9A A;  5JHU A;  2BHD A;  4Z7M A;  1YW7 A;  2GG7 A;  4OOK A;  4FUK A;  1WY2 A;  4B28 A;  5FCH A;  2HOW A;  2GG3 A;  2BWV A;  5CLS A;  5FCF A;  5CIK A;  2BHC A;  2IW2 A;  3BIP A;  1KP0 A;  4A6V A;  2GU4 A;  4U70 A;  4S2R P;  5JFR A;  4MAT A;  2GGC A;  1C24 A;  2ZSG A;  1QZY A;  1R5G A;  4RZZ A;  4ZNG A;  5D6F A;  1PV9 A;  3IU8 A;  4FLK A;  4JUQ A;  1M35 A;  4U6E A;  2GG9 A;  1BN5 A;  2EA2 A;  1N51 A;  2V3Z A;  1C27 A;  1XGN A;  1XGM A;  2B3K A;  4R60 A;  2V3Y A;  1R5H A;  2GG5 A;  3PKC A;  1YW8 A;  2GTX A;  1C22 A;  1QXZ A;  3BIT A;  2Q95 A;  5CE6 A;  1XNZ A;  2GG8 A;  1Y1N A;  1MAT A;  4HXX A;  5E5B A;  1XGS A;  2BH3 A;  2B3L A;  3CTZ A;  4ZWP A;  1B6A A;  1WLR A;  2GU5 A;  2B3H A;  4IDY A;  3D27 A;  5CDE A;  2Q94 A;  1W2M A;  1R58 A;  2EA4 A;  1B59 A;  5CNX A;  4U76 A;  2BWT A;  4U69 A;  4U6C A;  4FKC A;  1XGO A;  4PV4 A;  3RVA A;  2GG2 A;  4IPA A;  2OKN A;  2EVM A;  4U6W A;  3S6B A;  3IU9 A;  4EGE A;  1YJ3 A;  5CDL A;  4U1B A;  1CHM A;  2NQ6 A;  2BB7 A;  3Q6D A;  4S00 A;  3PKA A;  3TB5 A;  2BWY A;  4IU6 A;  4FLI A;  1WN1 A;  4U6J A;  4IKS A;  3FMR A;  2GG0 A;  1JAW A;  2BHB A;  1WBQ A;  4FO8 A;  2BHA A;  3FM3 A;  1C21 A;  2GU7 A;  2OAZ A;  3MX6 A;  3MAT A; 
#chains in the Genus database with same CATH topology
 4IKT A;  2V3X A;  2ADU A;  3PKB A;  4RGZ 1;  4ZWU A;  2GU6 A;  2EVC A;  3BIQ A;  1A16 A;  4IKU A;  2GZ5 A;  1WKM A;  2NQ7 A;  2BWU A;  1YVM A;  4U6Z A;  4A6W A;  3CB6 A;  2GA2 A;  2Q8K A;  2BN7 A;  2G6P A;  2DFI A;  1YW9 A;  2P98 A;  3PKE A;  2GGB A;  2Q93 A;  2V6C A;  1QXW A;  4FLJ A;  3CB5 A;  3MR1 A;  4IEC A;  1C23 A;  1QXY A;  4RZY A;  1O0X A;  1KQ0 A;  2BWX A;  4ZWO A;  3ROR A;  2EVO A;  3PKD A;  4PNC A;  3IG4 A;  3L24 A;  2Q96 A;  2BWW A;  3TAV A;  4U71 A;  4QR8 A;  5CDV A;  5D6E A;  3L7G A;  4IF7 A;  2BWS A;  1W7V A;  4FLL A;  4FO7 A;  4U73 A;  1KQ9 A;  2MAT A;  1WL6 A;  2P99 A;  3IU7 A;  2Q92 A;  4U75 A;  4S2T P;  3FMQ A;  1WL9 A;  1BOA A;  5JI6 A;  4IKR A;  4S01 A;  4KM3 A;  2P9A A;  5JHU A;  2BHD A;  4Z7M A;  1YW7 A;  2GG7 A;  4OOK A;  4FUK A;  1WY2 A;  4B28 A;  5FCH A;  2HOW A;  2GG3 A;  2BWV A;  5CLS A;  5FCF A;  5CIK A;  2BHC A;  2IW2 A;  3BIP A;  1KP0 A;  4A6V A;  2GU4 A;  4U70 A;  4S2R P;  5JFR A;  4MAT A;  2GGC A;  1C24 A;  2ZSG A;  1QZY A;  1R5G A;  4RZZ A;  4ZNG A;  5D6F A;  1PV9 A;  3IU8 A;  4FLK A;  4JUQ A;  1M35 A;  4U6E A;  2GG9 A;  1BN5 A;  2EA2 A;  1N51 A;  2V3Z A;  1C27 A;  1XGN A;  1XGM A;  2B3K A;  4R60 A;  2V3Y A;  1R5H A;  2GG5 A;  3PKC A;  1YW8 A;  2GTX A;  1C22 A;  1QXZ A;  3BIT A;  2Q95 A;  5CE6 A;  1XNZ A;  2GG8 A;  1Y1N A;  1MAT A;  4HXX A;  5E5B A;  1XGS A;  2BH3 A;  2B3L A;  3CTZ A;  4ZWP A;  1B6A A;  1WLR A;  2GU5 A;  2B3H A;  4IDY A;  3D27 A;  5CDE A;  2Q94 A;  1W2M A;  1R58 A;  2EA4 A;  1B59 A;  5CNX A;  4U76 A;  2BWT A;  4U69 A;  4U6C A;  4FKC A;  1XGO A;  4PV4 A;  3RVA A;  2GG2 A;  4IPA A;  2OKN A;  2EVM A;  4U6W A;  3S6B A;  3IU9 A;  4EGE A;  1YJ3 A;  5CDL A;  4U1B A;  1CHM A;  2NQ6 A;  2BB7 A;  3Q6D A;  4S00 A;  3PKA A;  3TB5 A;  2BWY A;  4IU6 A;  4FLI A;  1WN1 A;  4U6J A;  4IKS A;  3FMR A;  2GG0 A;  1JAW A;  2BHB A;  1WBQ A;  4FO8 A;  2BHA A;  3FM3 A;  1C21 A;  2GU7 A;  2OAZ A;  3MX6 A;  3MAT A; 
#chains in the Genus database with same CATH homology
 4IKT A;  2V3X A;  2ADU A;  3PKB A;  4RGZ 1;  4ZWU A;  2GU6 A;  2EVC A;  3BIQ A;  1A16 A;  4IKU A;  2GZ5 A;  1WKM A;  2NQ7 A;  2BWU A;  1YVM A;  4U6Z A;  4A6W A;  3CB6 A;  2GA2 A;  2Q8K A;  2BN7 A;  2G6P A;  2DFI A;  1YW9 A;  2P98 A;  3PKE A;  2GGB A;  2Q93 A;  2V6C A;  1QXW A;  4FLJ A;  3CB5 A;  3MR1 A;  4IEC A;  1C23 A;  1QXY A;  4RZY A;  1O0X A;  1KQ0 A;  2BWX A;  4ZWO A;  3ROR A;  2EVO A;  3PKD A;  4PNC A;  3IG4 A;  3L24 A;  2Q96 A;  2BWW A;  3TAV A;  4U71 A;  4QR8 A;  5CDV A;  5D6E A;  3L7G A;  4IF7 A;  2BWS A;  1W7V A;  4FLL A;  4FO7 A;  4U73 A;  1KQ9 A;  2MAT A;  1WL6 A;  2P99 A;  3IU7 A;  2Q92 A;  4U75 A;  4S2T P;  3FMQ A;  1WL9 A;  1BOA A;  5JI6 A;  4IKR A;  4S01 A;  4KM3 A;  2P9A A;  5JHU A;  2BHD A;  4Z7M A;  1YW7 A;  2GG7 A;  4OOK A;  4FUK A;  1WY2 A;  4B28 A;  5FCH A;  2HOW A;  2GG3 A;  2BWV A;  5CLS A;  5FCF A;  5CIK A;  2BHC A;  2IW2 A;  3BIP A;  1KP0 A;  4A6V A;  2GU4 A;  4U70 A;  4S2R P;  5JFR A;  4MAT A;  2GGC A;  1C24 A;  2ZSG A;  1QZY A;  1R5G A;  4RZZ A;  4ZNG A;  5D6F A;  1PV9 A;  3IU8 A;  4FLK A;  4JUQ A;  1M35 A;  4U6E A;  2GG9 A;  1BN5 A;  2EA2 A;  1N51 A;  2V3Z A;  1C27 A;  1XGN A;  1XGM A;  2B3K A;  4R60 A;  2V3Y A;  1R5H A;  2GG5 A;  3PKC A;  1YW8 A;  2GTX A;  1C22 A;  1QXZ A;  3BIT A;  2Q95 A;  5CE6 A;  1XNZ A;  2GG8 A;  1Y1N A;  1MAT A;  4HXX A;  5E5B A;  1XGS A;  2BH3 A;  2B3L A;  3CTZ A;  4ZWP A;  1B6A A;  1WLR A;  2GU5 A;  2B3H A;  4IDY A;  3D27 A;  5CDE A;  2Q94 A;  1W2M A;  1R58 A;  2EA4 A;  1B59 A;  5CNX A;  4U76 A;  2BWT A;  4U69 A;  4U6C A;  4FKC A;  1XGO A;  4PV4 A;  3RVA A;  2GG2 A;  4IPA A;  2OKN A;  2EVM A;  4U6W A;  3S6B A;  3IU9 A;  4EGE A;  1YJ3 A;  5CDL A;  4U1B A;  1CHM A;  2NQ6 A;  2BB7 A;  3Q6D A;  4S00 A;  3PKA A;  3TB5 A;  2BWY A;  4IU6 A;  4FLI A;  1WN1 A;  4U6J A;  4IKS A;  3FMR A;  2GG0 A;  1JAW A;  2BHB A;  1WBQ A;  4FO8 A;  2BHA A;  3FM3 A;  1C21 A;  2GU7 A;  2OAZ A;  3MX6 A;  3MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...