4FOCA

Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
310
structure length
296
Chain Sequence
NPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title The Discovery and Optimization of a Novel Class of Potent, Selective, and Orally Bioavailable Anaplastic Lymphoma Kinase (ALK) Inhibitors with Potential Utility for the Treatment of Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 98
structure length 296
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4focA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4focA01
2DWBA 3DB6A 3QXOA 5EDPA 5F95A 3GQIA 1J1BA 5I9VA 5E91A 4FODA 4GEOA 2QG5A 5IMXA 5EM6A 3D9VA 3P1AA 3PP0A 4W9WA 4BI1A 2GCDA 1UNLA 1KV2A 3JYAA 4JBVA 4AN3A 4D0WA 3FZPA 3NRMA 2QHNA 2UZBA 4IX5A 4MHAA 3QRKA 1W82A 3POZA 4GS6A 1PXPA 3CD8A 2PUNA 3OEFX 3R8VA 3V01A 3SC1A 1MQBA 4CD0A 5L2SA 5I9ZA 5HQ0A 4EOQA 4I22A 1CM8A 4ORKA 4OBQA 1NA7A 3CQWA 5AP5A 4LGHA 1LEZA 4MXXA 1XBBA 4FTUA 2VWUA 4APPA 4I5CA 2W4JA 2W1EA 4FT5A 1J7IA 2BZKB 4EOJA 4MH7A 3REPA 3NIZA 3ANRA 1WZYA 2XRUA 1I09A 3P23A 5B7VA 3BQCA 4DG3E 4FA2A 1GIIA 4QMLA 1CTPE 5JFVA 3AC4A 4ENXA 5LMAA 3LCKA 3ZO1A 2BROA 4EL9A 4KKEA 4ZIMA 5DHJA 3SW4A 2I40A 1SNXA 1A06A 4KSQA 4XG3A 3G15A 3PFQA 4G16A 1IA8A 3CSVA 4WSQA 1UV5A 2EU9A 3RM7A 3GGFA 3PA5A 1ZMVA 4G9RA 5JH6A 1Z9XA 5F20A 5HEZA 3AMYA 2W05A 1OZ1A 5AUZA 3KRJA 4WG3A 1LUFA 5CI6A 2O2UA 4E3CA 4FV0A 4HVGA 1K3AA 3C4FA 4X3FC 3R8ZA 3AGMA 1QCFA 3LJ0A 3O96A 5M57A 3EQRA 2VGPA 1J7UA 1AGWA 4FSQA 3RGFA 2ZVAA 4PDOA 4C57A 3M2WA 1ZZ2A 1Z57A 4WRGA 3ORKA 3QTIA 4X2JA 3SV0A 2G2IA 5J79A 3VS6A 3R22A 4CLIA 3SOCA 3ORNA 4ASEA 3KXZA 4AOIA 5JSMA 4N57A 3KXXA 2OZOA 4D9TA 1M52A 4OTHA 4E5AX 2E9UA 4DITA 2O65A 5C01A 3WIKA 4ZTNA 3NSZA 2XNMA 2X0GA 4IM3A 4YGAA 3TIYA 3V6RA 4HNIA 1Q99A 4FIHA 2YLFA 4XP3A 2VX3A 2PVLA 3PPZA 5HBHA 3QKMA 2JLDA 3FJQE 4OTIA 3WBLA 2QC6A 4TWCA 4YLKA 3UVPA 5K5XA 3CEKA 5A3XA 1Q24A 4X3FB 5HNIX 3BYMA 2GQGA 2XKCA 3Q9YA 3UZTA 4R77A 4CCUA 3S00A 3OWLA 4RLKA 4RIYB 3U51A 2R3MA 1OMWA 4QPMA 4YLLA 4Q5EA 1Y57A 2QO7A 5H3QA 4RJ8A 5DG5A 4C02A 5FXQA 4PMPA 3FBVA 4YZMA 5E9EA 4S2ZA 3E5AA 2XEYA 3LFFA 5DEYA 3QHRA 4RJ6A 3RTPA 4IFCA 4NKAA 3K5VA 2WOTA 4L3LA 3DXQA 3TZ7A 4Y5QA 4ZSAA 5CU4A 4C4JA 1Q8ZA 3NZ0A 4KIQA 5IQBA 4MXOA 4C3PA 4YC8A 4O96A 4L01A 3PZHA 5D9HA 3IOPA 2F7ZE 3I0QA 5CNNA 2O8YA 4YZBA 3ZFXA 3ZC5A 3DLZA 4YP8A 4F1TA 3JR1A 4L6QA 4FKVA 4EC9A 2QVSE 3VS0A 1M2QA 2C1AA 2PE1A 3NAXA 2XNPA 4FG7A 5IQHA 2WTDA 3CQUA 3I6UA 3FL4A 4ZSEA 3BYUA 5HIEA 5K0XA 4L67A 2JDVA 3MIYA 3E63A 4S34A 4DBXA 3VS7A 5KHWA 4ERWA 3PXZA 5M56A 3EB0A 3HV4A 4PMSA 2E9PA 4LUEA 4HCVA 5EQPA 4QMXA 2BILB 3V51A 5IEYA 4RJ3A 1MRYA 4ITIA 2GNHA 4CXAA 4L43A 1E1VA 2WMQA 3C9WA 4ZTRA 4CFXA 4DFZE 4RWJA 4FL3A 5EI8A 5AR3A 5DWRA 5I9YA 3CKXA 4X7QA 5AIRA 5FP6A 3JVSA 4KB8A 4U5JA 5ANDA 2ZAZA 3EN6A 3L8XA 4I94A 1J91A 4AFJA 4ANSA 3CJGA 1JVPP 2O63A 4J98A 3HEGA 4KRCA 5LWNA 3Q4UA 4Q5HA 2BHHA 4ZLOA 3DKCA 4LG4A 4ZTQA 2J5EA 3DPKA 5IDNA 4I6BA 3EKKA 3PXRA 1H1WA 1OI9A 5EYKA 2ITYA 1UNGA 4IWOA 4FE2A 1BI8A 3CXWA 1RW8A 2WTKC 4J95A 4I41A 4BBMA 2JAMA 5DOSA 3U6JA 3P9JA 5IKWA 3ZH8A 4D55A 2BUJA 5AR4A 2HWOA 3NVMB 4AT3A 5CASA 3IW4A 3I1AA 3DS6A 2Z02A 1H07A 3PJ2A 3QAME 4NTSA 5AIKA 2XH5A 2E9OA 5C27A 4C0TA 4EOKA 5KMMA 4O82A 4O81A 1XJDA 4E4XA 3DA6A 4ZLZA 1BI7A 1FINA 4ACHA 3AD4A 4WD5A 5FLFA 4DINA 5GINE 3QFVA 5BYLA 4U44A 3EKNA 4DTBA 2XB7A 3FMMA 4FGBA 4ACMA 2ERZE 1K9AA 3O51A 4E20A 1ZRZA 5AV1A 4F99A 1U59A 5IDPA 3UQCA 1GZNA 5EH0A 3QCQA 3KY2A 3TKHA 4FR4A 2WEVA 5M51A 3CTQA 3VUGA 4IZ7A 3R7IA 3TUDA 3C4ZA 4LL5A 3CS9A 1FGIA 2WTKB 3F88A 4NM5A 3TV7A 4EH9A 4EJNA 1FBNA 3QUPA 3RPVA 2GQRA 5HO7A 2OZAA 3BRBA 3ZCLA 4CZTA 4C4FA 2CN5A 5FD2A 2XZSA 3UOLA 4LI5A 5IQGA 4AACA 4W4YA 3L9NA 3FI4A 4LRKA 5ICPA 2YISA 5JT2A 4G3GA 4L8MA 3E7OA 2XNNA 4U80A 4O7SA 2R3NA 3VULA 2VTAA 2VWWA 2R3LA 1H26A 3FPMA 4TYIA 5LCJA 3Q5IA 4HYIA 2B9HA 3TV6A 2NP8A 3ATSA 4XCUA 3QZFA 2J2IB 4K77A 4BDDA 3LVPA 2ZV7A 1GIJA 3C0GA 3PJCA 3LXKA 4O0TA 4WG4A 5AM6A 4CKRA 3O50A 2X7OA 4C4GA 5HTCA 1URWA 3PY1A 4BCKA 1TQPA 4EK3A 5IH6A 4RQVA 4DGNA 3OTVA 5A4LA 4PY1A 3IGGA 1OITA 2I1MA 1CDKA 1DAWA 3QZIA 3BE2A 2WTWA 3VVHA 4EWHA 4YSJA 3EMGA 4O1PA 2A19B 4MD8E 4RA5A 4W4WA 5KZ0A 1BKXA 5ACKA 3ZM9A 1SVHA 4O7VA 2A0CX 3ULIA 4QTAA 4HJOA 4ZSLA 5JQ8A 1Z5MA 2ITVA 2BIKB 2I0YA 3EYGA 2G9XA 4X0MA 4O84A 2VTOA 1JKTA 3CKWA 3PIYA 5CT0A 2PVKA 2X7GA 4EUUA 3TT0A 3QXPA 4IFGA 5KO1A 1KOAA 4ENYA 4AZVA 3E3PA 2UW8A 2OO8X 2W0JA 4FKJA 2VTMA 1XH7A 3HAMA 3R83A 2V5QA 3BGQA 4M13A 1VEBA 3WZEA 3Q2JA 3DZQA 4XRJA 5LMKC 3QQUA 4FTLA 4P90A 5I9UA 5DH3A 5CAOA 4LM5A 4UALA 3NNVA 4AX8A 3RALA 2ITQA 3KL8A 4YNEA 2VWYA 3ZSGA 3KA0A 3R8PA 2VTSA 4TW9A 3GEQA 1OVEA 1LPUA 2GNIA 2W17A 4PF4A 3OT3A 3ZXZA 4ZJIA 4E6QA 3ZONA 5BVWA 2IW9A 2JIVA 5IQIA 3O71A 2F7EE 5HG9A 4O1OA 2WTCA 3C7QA 3QTRA 4JX3A 5ANGA 4MYGA 1YXTA 3UJGA 2VUWA 5D12A 3PRIA 4K11A 5D11A 5D1JA 4NM0A 4HCTA 3TNHA 3AGLA 4R1YA 4J96A 3ENHA 3HL7A 4DH1A 4O91A 3UNJA 4UXLA 2R3JA 5F4NA 4O0SA 4R5YA 3RCJA 5KUPA 2HK5A 2VNYA 3R8LA 2PUPA 3ZOSA 3P7AA 4MX9A 5L6PA 5ANJA 4ZTLA 4ZXTA 1YI6A 1HCKA 2ONLA 3HLLA 2BKZA 5BUEA 4TYGA 5DR9A 3VQUA 3QD2B 1KOBA 3BV2A 4IE9A 3C4WA 3LLAA 1WBOA 3NUPA 2PHKA 1UKHA 2G2HA 4GG5A 2F57A 4FIJA 4FL1A 5K9IA 3M11A 4AN2A 2GHGA 2QOOA 4LUDA 3ZXTA 3A7HA 4UMRA 4QQ5A 4AGCA 4L3PA 2JFMA 4ZSGA 1JLUE 4UYNA 4Y83A 5AWMA 3V5PA 4U6RA 3GCQA 3ZRMA 1VR2A 4I1ZA 3LMIA 3VW8A 2J90A 4I92A 2HY81 3AD6A 4RZWA 5IQDA 1DS5A 3IPHA 4YZCA 1YQJA 3EFJA 2WQOA 3FYKX 4LOQA 4RLLA 4YTIA 3W55A 3DT1A 2QODA 4QYFA 4KAOA 1RE8A 1BMKA 4HGTA 4IAZA 4YC3A 1H1SA 3EL7A 4FSTA 4BCNA 2XM9A 4I0RA 1O6KA 4XG4A 5F1ZA 4F9YA 4MXZA 4A9RA 4RT7A 2Y9QA 2UW3A 3IQ7A 4NKSA 4XRLA 5L2QA 3G9NA 3PG3A 5TO8A 3M1SA 4NFNA 4B7TA 4TNBA 3VS1A 3W16A 3HGKA 3RCDA 3KEXA 4E1ZA 1W0XC 3N4VA 3K3IA 3BIZA 4CFWA 4PL5A 4XP2A 4PPBA 3PSBA 3JPVA 3OS3A 4C33A 5AV2A 5C03A 3ORMA 2WEIA 3BBWA 2ZMCA 5K4JA 4IM0A 4YUQA 2B1PA 4CG9A 1M7NA 3BHYA 3R6XA 4FC0A 2OFVA 2J7TA 2PUIA 4QMUA 4FV5A 1B6CB 3OD6X 3VBVA 1M2PA 3CPBA 4F0IA 3MY1A 4G3DA 2GFCA 5AP6A 2C5OA 1P2AA 2BRNA 3F7ZA 3OCBA 5HE0A 1PXLA 3Q4ZA 3EOCA 4C59A 5EHLA 3KMUA 4L7SA 4Z3VA 2R0UA 5DFPA 1KUTA 3QL8A 4LOPA 2CLXA 3BPRA 3VBQA 3QTWA 3R7VA 5CSWA 3DZOA 5JGBA 2C6TA 4MVFA 4FT0A 4WNKA 4GYIA 4LGDA 3VBXA 5HG7A 1PRYA 2OJGA 2YWPA 3F5GA 3JY0A 4RIWB 1Q3WA 2RG5A 4ANOA 2VV9A 2QR7A 3RPYA 4CKIA 1NVSA 3IDCA 5JRQA 2NNWB 4LMUA 1OGUA 1OL2A 3FPQA 3V5QA 4B0GA 1KE8A 4RFYA 4E4MA 2UZNA 5CEKA 5CEOA 3KRWA 4BYJA 2X8IA 5A14A 5AA8A 5CVHA 1KE7A 5AUYA 4DLIA 5J9ZA 3FWQA 3HMOA 3R7OA 1Y8GA 4RJ5A 4EK6A 5BVNA 4IAIA 4IX6A 3RMFA 1OIYA 2B55A 4CMUA 3NUNA 3QYZA 4JG7A 3V6SA 3PJ8A 4BTJA 1RDQE 3F6XA 3DTCA 3UOKA 4AZEA 3WZJA 4GKHA 1KE6A 1O9UA 4JVGA 2ZYBA 4O21A 4MNEA 5E8SA 3RAIA 3D5WA 4QMNA 3GT8A 4ONAA 4RC4A 3VRYA 4E93A 3C4XA 4X2KA 4A4LA 2QHMA 2H8HA 5E4HA 5TT7A 5C26A 2GFSA 5EKOA 3KXGA 1P14A 5LVOA 3NYVA 3RAHA 4FTNA 3TNWA 2FVDA 2C68A 1I44A 4O0RA 3PE1A 4W8DA 3IW8A 3R9OA 2C6IA 5TR6A 3ZHPC 5KNJA 5ETIA 3SXSA 4UMTA 1UKIA 2XNBA 1HCLA 2C6EA 2QOKA 2R9SA 4UZHA 3D7ZA 3DXNA 4M12A 2R2PA 5DRDA 2H9VA 3QA0A 5JZNA 3OTUA 2C0OA 3P5KA 3TNIA 2GTMA 3AC2A 2ESMA 4JAIA 5LVMA 1R3CA 3UGCA 4R7HA 3OXIA 5AP3A 1WAKA 3ALOA 2X2LA 2YN8A 2ETKA 4J71A 4KINA 4L68A 3SXRA 4GFOA 5A4CA 1V1KA 1UU7A 3ZLYA 2OG8A 3PP1A 4RWLA 3HP5A 3DBCA 1WFCA 5EI6A 4O6EA 1XKKA 4EC8A 3COHA 3AD5A 3DK6A 4LOOA 4UWYA 3PJ3A 4MQ2A 1OKWA 3MW1A 1NY3A 2WQNA 4DEEA 3ZSHA 4DCAA 3V8SA 4IB0A 4Y46A 3SKCA 2KTYA 4CRLA 2PMLX 4O27B 1KE9A 4I20A 2UW5A 3VHKA 2P55A 5G1XA 3RVGA 4DEGA 4EZ3A 2Y8OA 3CGFA 4EH8A 4CCBA 1IAHA 1UVRA 5BYYA 4DFBA 3RBWA 4EHEA 2I0VA 2LAVA 3LQ5A 4EJ7A 4IB1A 4R8QA 3H9RA 2VTIA 3KXHA 4GH2A 2H96A 4GG7A 4HGSA 5BPYA 4U3ZA 4WA9A 1URCA 5LWMA 3UMXA 5C8MA 5HU9A 3ZYAA 4QP6A 2A2AA 3FXXA 5JFXA 3JVRA 4O7WA 4FSUA 3KC3A 3O0GA 3PA3A 4TYEA 1ZMWA 5HLNA 3D2IA 2FYSA 5IA3A 2UV2A 2XM8A 4FMQA 5KMLA 2XYNA 2WMVA 3E8EA 3DY7A 3U4UA 4QRCA 5HGIA 4EH2A 4TN6A 4AP7A 2Z7SA 5D41A 2O5KA 4ZZOA 4IX3A 1KV1A 2WU6A 3VBWA 5ITAA 4QMZA 4QOXA 4QQTA 5AADA 2IVTA 5FUTA 4GIIA 4DG2E 4OLIA 3GCUA 3NW6A 3DU8A 5BVFA 5IA0A 2CMWA 3G51A 1VYZA 3ZEWA 4RVTA 2GHMA 3CY2A 3FLZA 2W1CA 1OBGA 4QMMA 3HV3A 2BZJA 5KMKA 3IG7A 2WMWA 3KXMA 4O86A 2C0IA 3MA6A 2CN8A 1P5EA 3D83A 4AGDA 2OIQA 3TZ9A 3KQ7A 4F70A 1Q3DA 4M15A 5M07A 3SA0A 1NW1A 3H3CA 2JD5A 2HY0A 3HKOA 3Q60A 4XNEA 4EK5A 3QTUA 3PLAE 3TXOA 1EH4A 3UG2A 2IZTA 2QU6A 5EYCA 3BWJA 3ZEPA 2V55A 4MQ1A 4WUNA 1YXSA 5GIOE 2WOUA 2QOQA 1STCE 3FDNA 3HAVA 4FZDB 4AZTA 1QPEA 1F3MC 1X8BA 4AWIA 2X2KA 4G17A 3A7GA 4YJPA 3QCYA 3F5UA 2GNFA 2LGCA 4RA4A 1YI4A 5CALA 3NYXA 4BKJA 4GRBA 4H1JA 5DRBA 4U81A 3RAKA 1NT2A 4WSYA 4X2NA 4X6RA 3RKBA 5FDPA 3RHKA 2YDIA 2C5VA 3NGAA 3BGZA 4JRVA 3U55A 5IQEA 3CE3A 5IA2A 3SVVA 2XUUA 3LFQA 4MF0A 1PXMA 1Q62A 3MVMA 5HNBA 3GC0A 2OXXA 1WMKA 1LEWA 2ZB1A 3OY3A 3VIDA 3ZLWA 1OKVA 5AJQA 3RJCA 4FUYA 4NTTA 3GU6A 2CJMA 3BLRA 3ERKA 4IZAA 4ZZNA 2FGIA 5HO8A 3G90X 1GY3A 2G15A 3H9FA 4Y72A 4AA4A 5JGAA 5E7RA 4R3PA 3LCSA 3QRJA 2WXVA 5L8LA 4IWQA 4E8AA 4A9YA 4F4PA 3I4BA 4ANNA 1YXUA 3QD0A 3QQJA 3KK8A 4U45A 2YCFA 4NW5A 1IEPA 4CQGA 4FSNA 2WD1A 4IB5A 4D9UA 4EI4A 5IMEA 5DGZA 4NCTC 1ZOEA 3FHRA 2WFYA 4AS0A 4U7ZA 4FVRA 4RZVA 4M67A 4PTGA 4C4IA 3I5NA 2IWIA 4BZDA 4F1MA 3SAYA 3JY9A 5A9UA 5AP7A 2IVVA 2WMAA 3C0HA 4OTGA 1CKJA 2R3IA 5BX0A 3UPZA 3WYYA 1OM1A 3RZBA 3FKNA 3PIZA 4MBLA 4RX7A 5FEEA 5FM2A 3VQHA 1ZY5A 3WIGA 5I0BA 3MVLA 4RQKA 5IEXA 3UC3A 1BX6A 3GENA 3HRCA 1UA2A 3AMAA 1JKKA 4BCGA 3FKLA 3OWJA 3CTJA 3OVVA 3UO6A 3ELJA 3TTJA 3R1NA 4FV3A 2PZIA 3I7CA 5B0XA 4B8MA 5J1VA 4G31A 4FZAB 4XV1A 3FMKA 2C6MA 3UO5A 2OLCA 2X6EA 3C4CA 1YKRA 4DH8A 2CCHA 3HRFA 2YZLA 4BICA 4YJSA 5HI2A 3KN6A 4EK8A 2HAKA 2B9FA 3OF0A 1H25A 1XBAA 3EQBA 3PG1A 3R73A 4H39A 4ZTSA 2PVJA 3A4OX 4PP7A 5L8KA 2R3KA 4FUXA 5L6WL 3A8WA 2ITNA 3PXFA 4ALWA 4H36A 3UQGA 4BIEA 5BNJA 5HD4A 5KHXA 5HTIA 1G8SA 5AX9A 1YXVA 2RFEA 4JT3A 4V0GA 1PF8A 4J99A 2J0IA 4AE9A 5BUJA 2WTVA 2BZIB 4TKSA 4ANMA 3BHHA 5CU2A 1PXIA 3MY5A 4UBAA 4FSYA 4IJ9A 5EDQA 5HIDA 4F9BA 2QLQA 4ACCA 2YFXA 2HENA 4XH6A 5CTPA 3ZO2A 4E7WA 4ACGA 4QYEA 2BZHB 2BFXA 2BTRA 2AC3A 4LL0A 2OJ9A 3FXWA 2BDFA 4NSTA 5HVJA 5CQUA 2XJ2A 4D5HA 2HZ0A 3LPBA 4H3PA 4NWMA 1J1CA 2OJJA 2PVFA 4NH1A 3E8NA 3NX8A 2BHEA 2VWXA 5IG1A 4R6VA 2H6DA 4RMZA 3ZRKA 2PVNA 1CSNA 3HDNA 4BCOA 2JDRA 2X81A 3F3ZA 3MTFA 2YM4A 4YJVA 2I0HA 3SRVA 3WE4A 5L6OA 3VRZA 2BPMA 2Z8CA 3OUKA 3S2PA 2HYYA 4AZSA 4BVUA 3CLYA 1ERKA 5K5NA 5J9YA 2GS2A 2BDWA 3F3TA 3EN7A 4HYUA 1GNGA 3HP2A 5GHVA 3SDJA 5TE0A 4YHJA 2UZLA 4JR3A 2BRHA 2X4FA 4ITHA 4YBJA 5K4IA 2ITPA 4FV7A 3ZMMA 5CAPA 4RGJA 2GS6A 2QLUA 4CQEA 1PKDA 3DDQA 2VO0A 1L3RE 3TV4A 4FT9A 2UZDA 3OC1A 4I21A 4QYYA 4XV9A 1IR3A 2PVHA 2YIYA 5M44A 5DE2A 3D5VA 3UPXA 3NW5A 4JDKA 4XBUA 3Q2MA 4ERKA 4D2PA 3PZEA 3KMWA 1OPLA 3OBGA 5A4QA 2PL0A 3ALNA 5JFSA 3QLGA 2OF4A 5C8KA 1ATPE 4R78A 4JQEA 5ANKA 4JIKA 2RFNA 3O7LD 3TEIA 2GNGA 4S32A 1GOLA 4H1MA 4EH6A 4FKIA 3KRLA 5LVLA 3HMNA 2W4KA 2XK9A 3VUKA 3KCKA 4H05A 4D4VA 4NZWB 5CLPA 4ZLYA 4FK3A 3TJCA 3A4PA 3QF9A 4LV8A 4BBEA 2VTRA 2WB8A 2B9IA 2YAAA 3WZKA 4AW1A 4CMOA 5LVPA 4CFFA 2NRYA 2YIXA 2G2FA 3LFNA 4E6AA 3FUPA 4EBVA 5FEDA 3BWFA 4PTCA 5IF1A 1SZMA 4DFNA 5C8NA 2OBJA 2XKDA 4ARKA 3MSSA 4HVDA 4D28A 5DYJA 4IZ5A 3TM0A 5M09A 1H1QA 3FQSA 4HPTE 1MRVA 5DIAA 3UNZA 3WE8A 2X8DA 2XK6A 4IZYA 2B4SB 5HOAA 5JKGA 4MNFA 4ALUA 2X7FA 2QOIA 4QP7A 5T3QA 3FMEA 3LCTA 5DN3A 3GC8A 2PVMA 5E8XA 3P7BA 2ZV8A 3D15A 3HNGA 4FTKA 4XLIA 4DEBA 3QWKA 3AC3A 1GJOA 5AMNA 3S3IA 2CKOA 2OW3A 3F7WA 3LQ8A 2JBPA 3A62A 2R0IA 3RK7A 1G5SA 3IW7A 5CEIA 4BKYA 4CFVA 4EH3A 3HZTA 4FV1A 4TXCA 5T6KA 3R28A 3NUSA 3BBTB 2ETMA 2C5YA 1MP8A 2QOFA 4OT5A 5GZ9A 3HDMA 4CYIA 4P2KA 4L45A 2WZJA 4FNZA 4G6LA 1Y6BA 4I0SA 4FKLA 4KNBA 4L9IA 5FG8A 4AA0A 2WPAA 4A9UA 4E6CA 2UZEA 3RWQA 3V5JA 4TL0A 4RX9A 3LFBA 3OCGA 2FSLX 4IC7A 4AW5A 1NXKA 4BL1A 4FIFA 4H3QA 3ZSIA 1A48A 4BYIA 4FEWA 3ZUVA 2RL5A 2QNJA 3I5ZA 3LM0A 2WMBA 2CSNA 1BL6A 1REKA 1ZLTA 3FYJX 4J7BA 4RG0A 3LKMA 4IDTA 5G6VA 4P7EA 3PLSA 2IZSA 3TDVA 2HZ4A 2HIWA 1OIUA 2XK8A 3UYTA 2IW8A 3B2WA 2YM6A 5A4TA 4FYNA 1J7LA 3C5IA 3HX4A 4ZS4A 4RWIA 4V04A 4QMPA 1JNKA 4B8LA 4FTTA 3R02A 3C0IA 3DLSA 3NEWA 4G34A 3Q9ZA 3F9NA 3OWKA 2QU5A 3VUTA 1LR4A 4QMSA 5FRIA 3RI1A 3WF7A 5A6OA 5C4KA 3VAPA 4CFUA 3F2NA 1DI9A 2W7XA 4O2PA 5ACBC 3Q4TA 5J87A 2OJFE 4OTPA 5FTQA 5ETCA 3CCNA 2HW7A 2BALA 4WRSA 4A4XA 4BDJA 3FC2A 5JGDA 4BDHA 1Q61A 4DFLA 4QTCA 4MF1A 3C4EA 3AMBA 4IADA 3OWPA 3VHEA 2C6LA 5I3RA 3H0YA 3FAAA 5JRSA 4NJDA 2JFLA 2B9JA 4FSZA 3NNUA 3UZRA 3E8DA 3KULA 3PSDA 4Y73A 3UP2A 5IQAA 2P33A 3ORLA 5I4NA 2ZM3A 4DGGA 1U54A 5CU3A 2QR8A 3GI3A 3UIMA 2EXEA 3H4JA 3ZBFA 1XO2B 5D7VA 2PK9A 4GJ3A 3K2LA 2OI4X 4ANBA 4I24A 4EYMA 5CENA 4D1XA 5CQWA 3VS2A 5EDRA 1OB3A 1ZAOA 4BDBA 3LOKA 1O6YA 3R7EA 3NYOA 3ITZA 5H8BA 2WMSA 2JDTA 2ZOQA 3I0OA 4ZK5A 3ZDUA 4A7CA 4AZFA 5FGKA 4K1BA 4ZS0A 4M69B 4OT6A 2VGOA 3EQHA 4EHZA 3QA8A 3DDPA 4OR5A 4BKZA 5H8EA 5FP5A 5AV0A 4GT5A 4AF3A 3L9MA 3HMPA 2WAJA 2JAVA 3DAKA 4DEIA 4XLVA 2WTJA 3MPMA 3TUCA 4FEVA 4S30A 3QRUA 4CEGA 4FG9A 4D2VA 3EL8A 3MFSA 1QPCA 3WF5A 1ZYDA 4F1OA 1SYKA 2X39A 5FXSA 5HLPA 3DNDA 5K3YA 2XRWA 3WF9A 2H34A 1W7HA 3FKOA 4BB4A 2BVAA 5JQ5A 3V5TA 5H8GA 4EKLA 2Y4PA 3K3JA 3QHWA 1JKSA 3NR9A 3UC4A 3PVWA 4OBPA 5GIPE 3Q4CA 4GL9A 3UOJA 3KKVA 4RC3A 3EN4A 2AC5A 1NVRA 5TOZA 2ITZA 3B8QA 2EWAA 4G1WA 4IQ6A 4TWOA 4AW0A 4DH3A 4F9AA 3NAYA 3VWAA 5HX6A 3SGCA 3ORPA 4E26A 4CYJA 1PHKA 3UNKA 5CZIA 3VUIA 3BGPA 1P4OA 3F82A 4B99A 4U8ZA 4I0TA 1O6LA 3NUUA 2YCQA 4DFXE 3BU5A 3R9DA 3FV8A 3NVKI 4A07A 3GU7A 3TCPA 5FBNC 3L8SA 3OROA 4RIWA 4NUSA 5GJGA 4KIOA 4RIOA 4AFEA 2XEZA 2HWPA 3EJ1A 3ROCA 5J9LA 4JBQA 5CXZA 4M3QA 3DXPA 4FIGA 2ITWA 3RZFA 4O7YA 4EYJA 1YOLA 5B2LA 5EQYA 5CEQA 4BHZA 2Z60A 3BEGA 3UQFA 1MUOA 3JXWA 1GAGA 3QRTA 5AUVA 3PY3A 3TTIA 5IUGA 2YWVA 2WQEA 3EIDA 3PSCA 4O0UA 1YDTE 3QUDA 4BZOA 3K5UA 4WBBB 4KBAA 4J97A 2GNLA 4G6NA 5FWKK 3IDBA 4E5WA 4YJNA 5DI1A 4GUBA 5HCXA 4PDPA 1ZYJA 2QQ7A 1JSUA 2WU7A 1OL1A 3NPCA 4F6SA 2P0CA 4R3CA 4DA5A 3NUXA 4HCUA 5A54A 4Q9SA 4BIBA 2IO6A 2JKOA 5GJDA 2XMYA 3QX4A 4GYGA 4IACA 2UW7A 4R1VA 3WZDA 5EOLA 2WIPA 4DN5A 4J53A 4JS8A 4FEXA 4UB7A 2ERKA 5HVYA 3E8CA 1XR1A 3W18A 2RSVA 4G3EA 5C9CA 3LXNA 4W8EA 4D2SA 3UZPA 3VS5A 1OPJA 5CWZA 3V04A 4CTCA 3TKUA 3H10A 3R1QA 4GKIA 3DNEA 4BTMA 1BUHA 4E4LA 3LIJA 3S4QA 1PMVA 2QKWB 1WBWA 3DQXA 2UVYA 4IWPA 4QPSA 4TY1A 3LJ2A 3BKBA 4ZMEA 4FVPA 2RGPA 2BR1A 3V8WA 3FQHA 5EG3A 3QTQA 2WMTA 3UO4A 4O38A 5B2MA 4XG2A 4FV4A 2CGWA 5CF5A 4DFUA 3L9LA 5FEQA 2JIUA 1G8AA 3B8RA 3I79A 4F63A 3GP0A 4DG0E 1DI8A 3CD3A 3G5DA 4L44A 3LHJA 2X6DA 3UMWA 3BYVA 3PXYA 4U0IA 5AEPA 3QTSA 1Q5KA 3KU2A 3HRBA 2XS0A 2XBJA 1FVTA 4Y85A 5HESA 4YURA 5CAVA 3QZGA 3UE4A 4GT3A 3RM6A 2XK4A 4GVJA 5EW8A 1FVRA 4YU2A 4FTOA 5AR8A 2BTSA 5EI2A 4B6LA 3IO7A 4EHVA 3SG9A 3TNPC 5IQCA 4C61A 5BVDA 5FQDC 4G9CA 3R8UA 4CKJA 4M66A 4IBMA 2XCHA 4OTFA 4RJ7A 5AAFA 3VJNA 4C36A 4UY9A 4O0WA 3A7FA 4PX6A 4EK4A 3FLWA 4EORA 1B39A 1UWHA 3BYSA 4U9AA 3JUHA 3BEAA 3V5WA 4HVHA 4XS2A 1ZXEA 2OZAB 4IVAA 4DTAA 4O6LA 3CQEA 1REJA 1PY5A 3DKFA 5CF6A 3IECA 4M8TA 4QQJA 2W1IA 4PDYA 2WMUA 3FC1X 2C30A 3FZ1A 3PE2A 3DFCB 2BAKA 3NWWA 3LM5A 3E62A 4JQ7A 4RIXA 3ETAA 1QPJA 1Q8YA 3HA6A 3EQGA 2FH9A 2J9MA 3R01A 4NJ3A 4JBOA 2W1DA 5LARA 4DAWA 2OIBA 4BY9E 2BMCA 2XBAA 2Z7LA 3P79A 3QC9A 4GIHA 4YJOA 4MXYA 4XYFA 2BCJA 1WVWA 1AQ1A 4ASDA 1PMNA 2GPHA 4BWPA 5CANA 3FMNA 3NMUF 1SVGA 4G5PA 5H2UA 4FTCA 5M4UA 2WHBA 3KN5A 4NL0A 4KA3A 4MD7E 4UMUA 1W98A 5AP4A 2GS7A 3EZVA 3QZHA 1YW2A 4FV2A 3MVJA 4FV6A 4USDA 3IGOA 3JS2A 3U4WA 5BVOA 2PULA 4FTIA 2YM3A 4QMTA 3VUDA 3ZTXA 4QYGA 2IG7A 2JBOA 5AM7A 3F3WA 3R00A 3T9TA 5FXRA 5M53A 4Z9LA 4ZY5A 3O8UA 3O8TA 2YCRA 2BFYA 3QKLA 5AX3A 2VWIA 2RKUA 5BUIA 1RQQA 3VN9A 4FZ7A 4J8NA 4UXQA 4PNKA 4MD9E 4IAKA 4AA5A 2O3PA 5CVGA 5DA3A 4FOBA 4FNXA 3ORIA 4L53A 4F9CA 1JWHA 4G2FA 1UWJA 4KS7A 2JKQA 4HNFA 2CDZA 2VN9A 3Q96A 2IPXA 3QUEA 3MA3A 4CGAA 4PWNA 3ACJA 4M0ZA 3KREA 5DVRA 3VF9A 4JXFA 2CGXA 3A8XA 3R2BA 3R7YA 2YM5A 4C37A 4UYAA 3MY0A 4NIFB 1GZ8A 3F5XA 3QGWA 5ANEA 3MBLA 5BYZA 2ONLC 4OTQA 1LP4A 3OOGA 3I6WA 2J6MA 3UTOA 4YC6A 4UWCA 2XNOA 2ZDUA 3LJ1A 4TYHA 3KGAA 4X2FA 3ZM4A 2C69A 3UP7A 4QMOA 1PXKA 5J5TA 4C35A 4PV0A 3MGYA 3LCDA 4XHKB 3SLSA 4EH5A 4CNHA 4U97A 3FLQA 2EXCX 1YXXA 3MB7A 4JDJA 3UODA 2E9NA 4U79A 5IISA 2Q83A 3EQCA 3I81A 2VNWA 4C34A 3E93A 3EYHA 4NYEA 3S1HA 4RFMA 4YSMA 5BVEA 1JAMA 4EHGA 4F0FA 4DEDA 1XH9A 4F09A 4CT1A 4DE4A 3OFMA 4ANLA 4RWKA 4HVIA 4J8MA 4JRNA 4F7SA 4FTAA 4XG6A 4QMVA 2IVUA 3VNTA 5HBJA 3D94A 2VTTA 2XNEA 4ASXA 4QTBA 2W5BA 2YACA 4NK9A 5KMJA 3TZ8A 4CFNA 2XYUA 1DAYA 5J1WA 2BIYA 5DT0A 3EFLA 3H30A 3FMLA 5AR7A 3DTWA 5L2WA 2PVRA 4BI0A 3LXPA 4F08A 3OT8A 5LVNA 2XCKA 3FMHA 4GU6A 3G9LX 2QOCA 2R3FA 4DYMA 2W9FB 2Y4IC 4EH4A 4Z16A 2XNGA 4LV5A 3T8OA 4JDIA 3LXLA 4PRJA 1FVVA 2CNUA 5DBXA 1ND4A 1F5QA 2QKRA 4FSRA 2ZM1A 3U9CA 3W2OA 5IU2A 4LRJA 5IH4A 1R78A 1OPKA 3RNYA 3MH2A 4BHNA 4HGLA 3U54A 5DPVA 4EQMA 4C62A 4MKCA 4GJ2A 4GSBA 5EFQA 3HV5A 3Q04A 3E88A 4DHFA 3BE9A 1IG1A 3QRIA 4PPCA 5E8UA 2OSCA 4C2WA 5GJFA 3LFEA 2UW0A 5ANOA 5EYDA 4GMYA 3EQPA 3OOMA 4GW8A 3F66A 4FOCA 2HZIA 3D7TB 5CVFA 1ZWSA 4FK6A 2VO3A 4YPSA 3AOXA 3DBDA 2IW6A 3KRXA 5GZ8A 3GU5A 2X1NA 4BDEA 3F3VA 4QP8A 3DKGA 4UMQA 1UU9A 2GU8A 2VAGA 2Y6MA 1W84A 3BELA 4D4RA 5IA4A 4EOMA 3C50A 3SG8A 4WOVA 4BWKA 4RPVA 3TG1A 4O0VA 3VO3A 3MS9A 3O8PA 2V0DA 3C51A 4AGWA 5AV3A 2VTLA 4DCEA 3TUBA 3OG7A 4D5KA 3ORTA 1XH5A 4OTDA 3DJ7A 3WF8A 4DH5A 4FYOA 5F9EA 4YO4A 4NT4A 3A2CA 4GV1A 2E9VA 2F2CB 3U6IA 4YTHA 4X3FA 2VX0A 4F64A 1P4FA 4FZFB 3BZ3A 2OKRA 2EXMA 3TL8A 4AW2A 4YZ9A 4BBFA 4RIYA 4DGLC 3GCPA 5E8TA 3L8VA 3BX5A 4F9WA 4B4LA 1S9IA 4D58A 3P4KA 2R3QA 4HGEA 2UZOA 2OF2A 2YDKA 1FPUA 3NIEA 4FIEA 3G6HA 4GK2A 4H58A 4KWPA 5GNKA 5KMNA 3A61A 4FKSA 3F2RA 2YABA 2VTHA 4AOTA 2B0QA 2YDJA 3DK7A 2WO6A 2KULA 1XWSA 3EH9A 5AP1A 2RFSA 5AR5A 2ITXA 3E87A 5L3AA 1H4LA 3PXQA 2PZRA 3PXKA 4K8AA 1JSTA 5E8WA 3SOAA 5M4IA 4AE6A 4O83A 5FM3A 4V05A 4C58A 3PUPA 5ETAA 3R1YA 5EQEA 4MNEB 4JOAA 4USEA 3GUBA 4TT7A 3RWPA 2HELA 3VW6A 4IH8A 2UW6A 3MFTA 3FEGA 3ROYA 2HCKA 2XJ0A 3M42A 4LQMA 4JNWA 3SD0A 3VUMA 4G3CA 3RINA 3TACA 2W1GA 4PP9A 5KZIA 4BF2A 2HOGA 4FKPA 3MFRA 1RJBA 2IN6A 1GZOA 4M68A 5DMZA 3MJ2A 2QI8A 3LW0A 1XQZA 4C3FA 2PE2A 3WARA 3TNQB 3E64A 1Y91A 2C3JA 4Q9ZA 4KIKB 1ZYLA 3HVCA 5L2IA 3QWJA 4IM2A 4N6ZA 1IAJA 4IDVA 2C6KA 4L46A 3KB7A 4O7TA 3Q6UA 2X4ZA 2O64A 3CY3A 2FO0A 2XIYA 3OEZA 4GVAA 3PTGA 2EUFB 4BCMA 5JN2A 2W1ZA 1T45A 3ZS5A 5EW3A 3BU6A 3IS5A 4ALVA 5TF9A 3ZLSA 1SNUA 1BLXA 3FI8A 4BR3A 4I6QA 4XX9A 4DH7A 4FF8A 4AT5A 4BCQA 4F0GA 3EQFA 5M4FA 2OXDA 4L42A 5EM7A 4EOOA 3AG9A 1S9JA 4B9DA 5LMBA 1T46A 5LXMA 2QO2A 4QMWA 5H9BA 4NEUA 4XUFA 2PYWA 1BYGA 1W8CA 3P86A 2ETRA 3OW4A 3C5UA 4K6ZA 4FI1A 3LMHA 4PQNA 3MV5A 4DF3A 4FIIA 1H27A 2C4GA 1XH6A 3Q3BA 5E92A 4IHPA 1M2RA 2JC6A 4I6HA 3AT3A 5LQFA 2B52A 4O7RA 3A7IA 2G1TA 3UYSA 3AC8A 5JK3A 4UZDA 2JEDA 4I5PA 2CPKE 1YI3A 2VRXA 5HICA 5J7BA 4QO9A 4OGRA 4MBIA 4FKQA 2YM8A 5CU0A 4BDKA 2OH0E 3Q9WA 4QQCA 4CMTA 5DR2A 1OKYA 3LE6A 4BCHA 4YBKA 3NUAA 4IVCA 4ZAUA 3NLBA 4KIPA 4LMNA 2SRCA 2CKEA 3PWYA 4RJ4A 5E90A 2EB2A 2BAQA 4AOJA 4GK4A 4L3JA 5AV4A 4YNOA 3GXLA 3QQLA 1FOTA 2P2IA 4OBOA 3W2PA 3CC6A 4X21A 3OXTA 5HIBA 4ZTMA 4GCJA 3PA4A 3FXZA 5HHWA 1SMHA 1R0PA 1OL5A 1OUKA 2DQ7X 4FGRA 2PMIA 4I4EA 4S31A 3R8MA 3SHEA 4M69A 4U42A 2PUUA 3ZLXA 4BTFA 5J7HA 1J3HA 4BDAA 5CF4A 4DLJA 3VC4A 2P2HA 4CTBA 3GB2A 3THBA 2YA9A 3VBTA 4QD6A 2C47A 2PMNX 4FBXA 4KKGA 4APCA 4IEBA 2Z7RA 4AZWA 3EZRA 2Z7QA 3GC7A 3MFUA 4AU8A 2IVSA 1YDRE 3GNIB 5DT4A 2AYPA 5TKDA 2R3PA 5AUTA 3PWDA 3L8PA 5BMSA 4JG8A 4WO5A 2PZPA 4P4CA 2Z2WA 3FZRA 3KF4A 4NU1A 3GFEA 1PXOA 4RRVA 1CMKE 1ZYCA 1JPAA 2G01A 4FTRA 4K2RA 4JQ8A 4BFMA 3CIKA 3U6HA 4O7ZA 4FT3A 5B2KA 1XH8A 4A9SA 4FKTA 4MXAA 3OZ6A 4YJQA 3D14A 2PSQA 4AT4A 3DBFA 3R71A 5KCVA 5AAGA 1YVJA 2C3LA 3ZUUA 4RVKA 4N6YA 2I7QA 1R0EA 5HD7A 1BL7A 2C3KA 3MPAA 2F7XE 3QU0A 5CU6A 5AP2A 2B54A 3D2KA 2W96B 3L1SA 3ZFYA 5IZFA 5A6NA 2XKFA 2XIRA 1WBVA 3ODYX 2PPQA 1YOMA 1Y6AA 3R04A 4YTCA 3EQDA 3HMMA 4GU9A 3FMJA 4MAOA 2W06A 4PTEA 2XJ1A 2W5AA 4Y95A 1M17A 3BHVA 3KCFA 4PMTA 2QOHA 3R0TA 4ID7A 4IAYA 5HBEA 2FUMA 3HUBA 1G3NA 5E8VA 3ZZEA 3G2FA 5CNOA 3R9NA 3NCGA 5IPJA 3N51A 5D7AA 4WUAA 3FMDA 5HNGA 4JI9A 4QT1A 2I0EA 5KBRA 1GIHA 3DBEA 4QP3A 3AXWA 3LFAA 3QD4A 2QURA 5M08A 2QD9A 3TI1A 5IA5A 3DGKA 5FTOA 5KE0A 4BI2A 4FTQA 4EKKA 1H0WA 1Q97A 2YIQA 2UUEA 5DNRA 3BI6A 5CF8A 2JGZA 4OAUC 5ETFA 4YHFA 4KBKA 4KUJA 5HE3A 2YERA 3EFWA 1QL6A 5IUHA 2P4IA 3MB6A 4PUZA 3DQWA 2C6OA 3QQFA 4GUEA 2V62A 3PVUA 3FLSA 2VO7A 5LMKA 1TVOA 2FSOX 3GFWA 5CEPA 1E9HA 5I5ZA 4FKGA 2W99B 3V8TA 3ZDIA 2OU7A 4O7LA 3BCEA 4BDGA 2VZ6A 3B2TA 1KSWA 4HVSA 3IONA 3G33A 4G6OA 4I5HA 3ATTA 2J50A 4FG8A 5EHYA 3ZZWA 3KRRA 4K9YA 3QCXA 3VF8A 4D4YA 5HCYA 2YEXA 4F6WA 2PMOX 5FTGA 1H1PA 4JX7A 2V22A 4ANQA 5EHOA 4QPAA 2CKPA 4V0GB 3MH0A 4M14A 4X6QC 2WMXA 3RPOA 2F49A 3HV7A 5CS6A 1PJKA 3WF6A 4HW7A 1ZZLA 4UWBA 1KE5A 3NNXA 2JITA 1OECA 3ENMA 4TWPA 2FA2A 3QD3A 4E4NA 1PYXA 1R39A 4BTKA 3U9NA 4NFMA 2UW9A 3QLFA 3POOA 4S33A 4K33A 4FSMA 3R9HA 2E2BA 3KVWA 2JKKA 2X2MA 5HKMA 3TN8A 4N70A 1F0QA 4AXAA 4D2WA 4YTFA 3LMGA 4C4HA 2J4ZA 5DEWA 3T3VA 3ODZX 2OFUA 4NM7A 5CX9A 3SRVB 3OCSA 4E5BA 5K0KA 1A9UA 2OGVA 4QP9A 1WBNA 1JBPE 1Q8TA 2CCIA 2W1FA 3VJOA 2YZAA 2FSTX 4F7LA 4DEHA 5HTBA 2ITOA 3UIXA 4DFYA 2REIA 2CGUA 4YPDA 5E8YA 4X3JA 2UW4A 1PXNA 2VTJA 4IB3A 4IAAA 2C3IB 3T3UA 4CG8A 1ZOHA 3FI3A 3P7CA 4FEUA 1H00A 4ZSJA 3FLNC 4EOSA 5HG8A 4RX5A 2ZM4A 4I93A 1PMEA 3RAWA 5JFWA 4H3BA 4BDIA 2R7IA 3TWJA 3E3BX 3EQIA 1E1XA 3MPTA 2ACXA 2C1BA 4FNWA 4K18A 3G0FA 4JG6A 3QCSA 2OIDA 2XF0A 4W9XA 3RP9A 5AA9A 4OTWA 2CHLA 3IDPA 3FSKA 4R5SA 4ZOGA 2BDJA 4TPTA 2YIRA 2NRUA 3QTXA 4C8BA 1MRUA 4AQCA 5JZJA 1OIQA 1SM2A 2X9EA 4I5MA 4JLCA 5CZHA 3QYWA 3RK5A 3GBZA 3Q5ZA 3MYGA 4O0YA 1V0PA 3ZFMA 1APME 2VWBA 4K0YA 4MWIA 5I3OA 3DCVA 2CNVA 4F6UA 4XEYA 3QC4A 4FV9A 1OIRA 4KRDA 3AC5A 2Y7JA 1H01A 2Y6OA 3ACKA 4WG5A 5M55A 5IQFA 3GVUA 4ACDA 4JR7A 3U87A 2XP2A 3UIBA 3C13A 2BAJA 5EKNA 2ITTA 2NO3A 3BYOA 3QKKA 5IH5A 2A4LA 5LCKA 1XH4A 1CKPA 3ET7A 3TJDA 2WNTA 3MIAA 3R63A 4LYNA 3UIUA 4CZUA 4OAVB 4IWDA 2GMXA 3MJ1A 1YWNA 4FTMA 1TKIA 2R3OA 2J0KA 4AAAA 2C5NA 2VTQA 1UU8A 4PNIA 2X9FA 1U5QA 2XKEA 4YZDA 2PE0A 3I7BA 4U41A 3R7UA 2F9GA 4A4OA 4DEAA 5IUIA 2OICA 3Q32A 3LFSA 4D2TA 3L9PA 3MH3A 1FMOE 4FKRA 3DOGA 4MTAA 3TZMA 5KMOA 2I6LA 4FSWA 3VUHA 3R1SA 3QBNA 4GFGA 4PL4A 4EBWA 4BCIA 1JSVA 5CSHA 4CSVA 1FQ1B 4EUTA 1H8FA 1Y8YA 5JEBA 1QMZA 3DB8A 4U43A 3RK9A 3AC1A 3D5UA 1PXJA 5EYMA 4OW8A 1CKIA 1Q4LA 2HXQA 2VWZA 4CV9A 3FQEA 2OXYA 4IW0A 4P5QA 1U4DA 2WQBA 2ITUA 4NIFA 3ZC6A 2YIWA 2J5FA 3OCTA 4TNDA 2UZUE 4Y8DA 2RFDA 3QQGA 3RHXA 3TKIA 4BZNA 2XIZA 2NPQA 3CGOA 1Q8WA 4GT4A 3LLTA 1ZY4A 3K54A 3IK3A 4UV0A 4DT9A 3AT2A 4L52A 1V0BA 3UBDA 4JDHA 4ZEGA 3ZU7A 4ZJJA 4YZNA 3UG1A 5BQ0A 3RPRA 4FKOA 3GQLA 4D0XA 4EEVA 5E1SA 3BLHA 4EZ7A 4F7NA 3EHAA 3II5A 4P5ZA 4AGUA 1B38A 5KX8A 5AR2A 1L8TA 4RVLA 4QNYA 2VD5A 3DJ5A 3GU4A 1ZOGA 2JKMA 4XV3A 2VTNA 2C6DA 3FLYA 5T68A 3FZTA 1UNHA 3LFDA 4IXPA 5J5SA 4QP1A 4Q2AA 4J52A 2F4JA 4TWNA 1Q41A 2ZJWA 4TRLA 4BIDA 3F5PA 1OBDA 3N9XA 4YHTA 2W9ZB 2YJRA 3H9OA 5DLSA 3COMA 4I3ZA 1PYEA 1JQHA 4XOYA 4D4SA 3G0EA 2B7AA 4M84A 2DUVA 3UDBA 4EWQA 4Y5HA 4R3RA 4IANA 2YLEA 4XG8A 4AG8A 1U5RA 3COIA 2VWVA 4J1RA 4QMQA 5CSPA 4MEDA 4Z7HA 3NYNA 4IJPA 3SQQA 5CXHA 3RNIA 2CNQA 4U3YA 3KXNA 4BGHA 2A1AB 4HOKA 4KBCA 3KULB 2CGVA 5I9XA 1XBCA 4BWXA 4EONA 4ASZA 2XK3A 4RVMA 2FSMX 4CLJA 3IW5A 3WILA 3PVGA 1W83A 5CAUA 3NDMA 2OK1A 3FHIA 2R5TA 2V7AA 5M06A 4UEUA 1U54B 4PPAA 5HLWA 1IASA 1VJYA 4MCVA 1ZMUA 4YJRA 2PZ5A 2XK7A 4LGGA 3PRFA 2QCSA 2B53A 3MI9A 2UVXA 4TTHB 4KKHA 3BHTA 5HE1A 3E92A 3AT4A 2HW6A 3OW3A 2OWBA 4FKUA 4WNPA 1XHAA 1NVQA 4G3FA 3U8WA 2PWLA 4AUAA 4BN1A 3WI6A 4W4XA 4BCJA 2PTKA 3V5LA 2EB3A 1VZOA 4FL2A 4MXCA 4QMYA 3DJ6A 1JOWB 3EN9A 2EVAA 4E6DA 3O23A 5HVKA 1GZKA 3ZRLA 1HOWA 3T9IA 2YJSA 4PL3A 4WKQA 2HXLA 3H0ZA 2X8EA 1PW2A 4TYJA 3NW7A 3O2MA 1QPDA 3HMIA 1OUYA 4BDFA 2ZB0A 4WHZA 5EW9A 5C1QB 3BQRA 4D1SA 4EH7A 5LOHA 3SX9A 2VU3A 5AFVA 3HA8A 5EOBA 3D7TA 4L00A 3ZO4A 4XG7A 4FVQA 4KSPA 1H0VA 4O22A 3D4QA 4PMMA 5F94A 3W2CA 3PIXA 4EQUA 2A27A 2WTIA 2GSFA 2BRGA 3F3UA 1K2PA 1ZARA 5DR6A 4OUCA 4IIRA 4JIAA 2YITA 2WKMA 3CR0A 4BDCA 4N0SA 3R2YA 4CT2A 4E73A 5HORA 4F65A 3F61A 3O7LB 4RSSA 2QOLA 4WNOA 2W4OA 5HO6A 4HPUE 4YLJA 3E7VA 4UMPA 4OTRA 2QOBA 3GC9A 4IVBA 3EN5A 4YJTA 3UOHA 1TQIA 3W32A 3W8QA 3ZUTA 4DTKA 4O0XA 4DT8A 3CPCA 4M0YA 2QO9A 3W2SA 1YRPA 3P08A 3PY0A 5AUXA 5AUWA 2O0UA 1WBSA 5HX8A 1YHWA 1YOJA 3HECA 4FEQA 4FNYA 4QYHA 5EM8A 4CFMA 5D10A 3PDTA 3ID6C 2V7OA 2XVDA 2YM7A 3DAEA 3SXFA 4JJRA 4FICA 1KWPA 3LAUA 4IC8A 2YAKA 3MTLA 3PJ1A 4N4SA 4U40A 5A4EA 4C4EA 3C1XA 5CY3A 1IRKA 4II5A 4NW6A 5DT3A 5EK7A 5J95A 5BVKA 5CSXA 2IJMA 3DKOA 3ZO3A 3PPKA 4C3RA 2J0MB 4Z7GA 2P3GX 3D5XA 2YCSA 3RPSA 4GFMA 2GQSA 1WVXA 2J0LA 2ZDTA 3Q6WA 2QONA 4QP2A 2R64A 1ZYSA 4BCFA 4RC2A 1JKLA 2J51A 3W2RA 3QX2A 5HU3A 2AUHA 5AAEA 4LRMA 3BU3A 1M7QA 4XP0A 1WVYA 3DAJA 3QQKA 5FDXA 3W8LA 2GTNA 4D1ZA 4EOLA 5E1EA 3MH1A 2R3RA 3BHUA 2PY3A 2IZRA 3GOPA 3S0OA 4ZTHA 3NS9A 5L4QA 1OKZA 4KS8A 1U46A 2JDOA 2Y0AA 4KD1A 5AUUA 3N4UA 4JBPA 2RG6A 1VYWA 5CYIA 3WZUA 1WCCA 3S95A 5GZAA 3IOKA 2UZWE 5EM5A 3V3VA 1OL7A 3R30A 4ZY6A 3ORXA 4TZRA 4DGMA 4FKWA 4EOIA 4O2ZA 5FBOA 4HZSA 4KIKA 4IMYA 4JL9A 1YWRA 1YHSA 4BC6A 1H24A 1DM2A 2UZVA 3FE3A 3GU8A 4G5JA 2R7BA 4HYHA 3WOWA 3GOKA 2WGJA 3W2QA 2PVYA 4V01A 4CZYB 4USFA 1SVEA 3OY1A 5CI7A 3AQVA 4GK3A 4W4VA 5JMSA 1WBPA 4R7IA 4RFZA 2Q0NA 4PDSA 5KKRC 2W1HA 2RF9A 4WNMA 4FX3A 3MWUA 3HYHA 3R7GA 3KVXA 4NCTA 4WT6A 1FGKA 4DBNA 2C5XA 4YR8A 1YDSE 3FZSA 3TIZA 5CAQA 3R9RA 3LZBA 5LJJA 1R1WA 4ITJA 4LFIA 5HE2A 3GCVA 2BKKA 4YO6A 5ANIA 3FY2A 2BRBA 3Q52A 4A06A 4FZ6A 4BGQA 4C38A 4Z55A 4EOPA 2R4BA 3NCZA 4I4FA 4WIHA 3A99A 3Q53A 1H1RA 1PKGA 3BV3A 4CRSA 4IAFA 3OXZA 2QG7A 4QP4A 2W5HA 3W33A 3ZBXA 2J0JA 4CVAA 2RIOA 5L8JA 2DYLA 5L2TA 4UX9A 2ZV2A 3CTHA 5HZNA 5HCZA 2OH4A 3A7JA 2Y4IB 3FI2A 4XV2A 4NM3A 4AN9A 1YHVA 3I60A 3SW7A 3TDWA 5KKRB 3KFAA 2PZYA 4BGGA 3OHTA 3OMVA 3P78A 4QNAA 2F2UA 3KMMA 3FSFA 3BLQA 1IA9A 2WMRA 4IVDA 3MESA 4RIXB 4JAJA 2BRMA 5C4LA 4QTEA 1TQMA 2DS1A 2OJIA 1YWVA 2FB8A 2CKQA 1H08A 2R3GA 3CJFA 4D2RA 3LFCA 3IW6A 2GNJA 3UVRA 2JDSA 5E8ZA 4BCPA 4DGOA 3LCOA 2VO6A 2UZTA 4O7NA 4MWHA 4M7IA 3N4TA 4A9TA 2ZMDA 4CV8A 3DV3A 3P0MA 4QTDA 3COKA 4HZRA 3DFAA 2UVZA 3MN3A 4YMJA 1WBTA 2VTPA 3F69A 3NUYA 3FY0A 1OL6A 3G6GA 3OUNB 3PVBA 3QQHA 5AP0A 1AD5A 2WIHA 3HUCA 4UN0C 5IEVA 3HV6A 3LQ3A 4R7BA 3IKAA 3EFKA 4XBRA 1MQ4A 4RBLA 4YJUA 5BMMA 3CBLA 3PYYA 2YHVA 2JIIA 4ZJVA 1PMUA 4FV8A 1UU3A 5I9WA 4I6FA 4XMOA 4XOZA 3W10A 3DBQA 5CT7A 3VS3A 4HYSA 3EWHA 2GHLA 3FZOA 4ZMFA 1H28A 4X2GA 2IZUA 3KK9A 2ZV9A 5CEMA 1Q8UA 4IX4A 2PU8A 2XIXA 5KMIA 3ANQA 2GDOA 3DK3A 3W1FA 3KF7A 4MBJA 3VS4A 5KBQA 4DC2A 5M4CA 4WBOA 3QTZA 1FMKA 3NNWA 4ZZMA 4I23A 4EQCA 1M14A 3ORZA 5HG5A 3MDYA 3R21A 3F2AA 3CP9A 4F7JA 4C2VA 4M97A 4C7TA 2Q0BA 3O17A 3OBJA 4RX8A 3FL5A 2VX1A 2XIKA 2R3HA 3WYXA 4FTJA 4ZP5A 3GCSA 2WELA 5J8IA 3A60A 2CLQA 2WQMA 3QALE 4FT7A 2C0TA 4TYHB 3VBYA 3OP5A 3Q9XA 3UVQA 3ULZA 4EZ5A 3D0EA 4BRXA 3PPJA 4ZY4A 4KABA 5IA1A 3QGYA 2HZNA 3MVHA 4MK0A 1V0OA 4XG9A 5CSVA 4XJ0A 5A46A 2XA4A 4L7FA
chains in the Genus database with same CATH superfamily
2DWBA 3DB6A 3QXOA 5EDPA 5F95A 3GQIA 1J1BA 5I9VA 5E91A 4FODA 4GEOA 2QG5A 5IMXA 5EM6A 3D9VA 3P1AA 3PP0A 4W9WA 4BI1A 2GCDA 2XAMA 1UNLA 1KV2A 3JYAA 4JBVA 4AN3A 4D0WA 1XMMA 3FZPA 3NRMA 2QHNA 2UZBA 4IX5A 4MHAA 3QRKA 1W82A 3POZA 4GS6A 1PXPA 3CD8A 2PUNA 3OEFX 3R8VA 3V01A 3SC1A 1MQBA 4CD0A 5L2SA 5I9ZA 5HQ0A 4EOQA 4I22A 1CM8A 4ORKA 4OBQA 1NA7A 3CQWA 5AP5A 4LGHA 1LEZA 4MXXA 1XBBA 4FTUA 2VWUA 4APPA 4I5CA 2W4JA 2W1EA 4FT5A 1J7IA 2BZKB 4EOJA 4MH7A 3REPA 3NIZA 3ANRA 1WZYA 2XRUA 1I09A 3P23A 5B7VA 3BQCA 4DG3E 4FA2A 1GIIA 4QMLA 1CTPE 5JFVA 3AC4A 4ENXA 5LMAA 3LCKA 3ZO1A 2BROA 4EL9A 4KKEA 4ZIMA 5DHJA 3SW4A 2I40A 1SNXA 1A06A 4KSQA 4XG3A 3G15A 3UDTA 3PFQA 4G16A 1IA8A 3CSVA 4WSQA 1UV5A 2EU9A 3RM7A 3GGFA 3PA5A 1ZMVA 4G9RA 5JH6A 1Z9XA 5F20A 5HEZA 3AMYA 2W05A 1OZ1A 5AUZA 3KRJA 4WG3A 1LUFA 5CI6A 2O2UA 4E3CA 4FV0A 4HVGA 1K3AA 3C4FA 4X3FC 3R8ZA 3AGMA 1QCFA 3LJ0A 3O96A 5M57A 3EQRA 2VGPA 1J7UA 1AGWA 4FSQA 3RGFA 4FRFA 2ZVAA 4PDOA 4C57A 3M2WA 1ZZ2A 4AXCA 1Z57A 4WRGA 3ORKA 3QTIA 4X2JA 3SV0A 2G2IA 5J79A 3VS6A 3R22A 4CLIA 3SOCA 3ORNA 4ASEA 3KXZA 4AOIA 5JSMA 4N57A 3KXXA 2OZOA 4D9TA 1M52A 4OTHA 4E5AX 2E9UA 4DITA 2O65A 5C01A 3WIKA 4ZTNA 3NSZA 2XNMA 2X0GA 4IM3A 4YGAA 3TIYA 3V6RA 4HNIA 1Q99A 4FIHA 2YLFA 4XP3A 2VX3A 2PVLA 3PPZA 5HBHA 3QKMA 2JLDA 3FJQE 4OTIA 3WBLA 2QC6A 4TWCA 4YLKA 3UVPA 5K5XA 3CEKA 5A3XA 1Q24A 4X3FB 5HNIX 3BYMA 2GQGA 2XKCA 3Q9YA 3UZTA 4R77A 4CCUA 3S00A 3OWLA 4RLKA 4RIYB 3U51A 2R3MA 1OMWA 4QPMA 4YLLA 4Q5EA 1Y57A 2QO7A 2IEWA 4RJ8A 5DG5A 5H3QA 4C02A 5FXQA 4PMPA 3FBVA 4YZMA 5E9EA 4S2ZA 3E5AA 2XEYA 3LFFA 5DEYA 3QHRA 4RJ6A 3RTPA 4IFCA 4NKAA 3K5VA 2WOTA 4L3LA 3DXQA 3TZ7A 4Y5QA 4ZSAA 5CU4A 4C4JA 1Q8ZA 3NZ0A 4KIQA 5IQBA 4MXOA 4C3PA 4YC8A 4O96A 4L01A 3PZHA 5D9HA 3IOPA 2F7ZE 3I0QA 5CNNA 2O8YA 4YZBA 3ZFXA 3ZC5A 3DLZA 4YP8A 4F1TA 3JR1A 4L6QA 4FKVA 4EC9A 2QVSE 3VS0A 1M2QA 2C1AA 2PE1A 3NAXA 2XNPA 4FG7A 5IQHA 2WTDA 3CQUA 3I6UA 3FL4A 4ZSEA 3BYUA 5HIEA 5K0XA 4L67A 2JDVA 3MIYA 3E63A 4S34A 4DBXA 3VS7A 5KHWA 4ERWA 3PXZA 5M56A 3EB0A 3HV4A 4PMSA 2E9PA 4LUEA 4HCVA 5EQPA 4QMXA 2BILB 3V51A 5IEYA 4RJ3A 1MRYA 4ITIA 2GNHA 4CXAA 4L43A 1E1VA 2WMQA 3C9WA 4ZTRA 4CFXA 4DFZE 4RWJA 4FL3A 5EI8A 5AR3A 5DWRA 5I9YA 3CKXA 4X7QA 5AIRA 5FP6A 3JVSA 4KB8A 4U5JA 5ANDA 2ZAZA 3EN6A 3L8XA 4I94A 1J91A 4AFJA 4ANSA 3CJGA 1JVPP 2O63A 4J98A 3HEGA 4KRCA 5LWNA 3Q4UA 4Q5HA 2BHHA 4ZLOA 3DKCA 4LG4A 4ZTQA 2J5EA 3DPKA 5IDNA 4I6BA 3EKKA 3PXRA 1H1WA 1OI9A 5EYKA 2ITYA 1UNGA 4IWOA 4FE2A 1BI8A 3CXWA 1RW8A 2WTKC 4J95A 4I41A 4BBMA 2JAMA 5DOSA 3U6JA 3P9JA 5IKWA 3ZH8A 4D55A 2BUJA 5AR4A 2HWOA 3NVMB 4AT3A 5CASA 3P5JC 3IW4A 3I1AA 3DS6A 2Z02A 1H07A 3PJ2A 3QAME 4NTSA 5AIKA 2XH5A 2E9OA 5C27A 4C0TA 4EOKA 5KMMA 4O82A 1ST0A 4O81A 1XJDA 4E4XA 3DA6A 4ZLZA 1BI7A 1FINA 4ACHA 3AD4A 4WD5A 5FLFA 4DINA 5GINE 3QFVA 5BYLA 4U44A 3EKNA 4DTBA 2XB7A 3FMMA 4FGBA 4ACMA 2ERZE 1K9AA 3O51A 4E20A 1ZRZA 5AV1A 4F99A 1U59A 4QDVA 5IDPA 3UQCA 1GZNA 5EH0A 3QCQA 3KY2A 3TKHA 4FR4A 2WEVA 5M51A 3CTQA 3VUGA 4IZ7A 3R7IA 3TUDA 3C4ZA 4LL5A 3CS9A 1FGIA 2WTKB 3F88A 4NM5A 3TV7A 4EH9A 4EJNA 1FBNA 3QUPA 3RPVA 2GQRA 5HO7A 2OZAA 3BRBA 3ZCLA 4CZTA 4C4FA 2CN5A 5FD2A 2XZSA 3UOLA 4LI5A 5IQGA 4AACA 4W4YA 3L9NA 3FI4A 4LRKA 5ICPA 2YISA 5JT2A 4G3GA 4DDGA 4L8MA 3E7OA 2XNNA 4U80A 4O7SA 2R3NA 3VULA 2VTAA 2VWWA 2R3LA 1H26A 3FPMA 4TYIA 5LCJA 3Q5IA 4HYIA 2B9HA 3TV6A 2NP8A 3ATSA 4XCUA 3QZFA 2J2IB 4K77A 4BDDA 3LVPA 2ZV7A 3NFGB 1GIJA 3C0GA 3PJCA 3LXKA 2X0OA 4O0TA 4WG4A 5AM6A 4CKRA 3O50A 2X7OA 4C4GA 5HTCA 1URWA 3PY1A 4BCKA 1TQPA 4EK3A 5IH6A 4RQVA 4DGNA 3ML1A 3OTVA 5A4LA 4PY1A 3AKJA 3IGGA 1OITA 2I1MA 1CDKA 1DAWA 3QZIA 3BE2A 4QDEA 2WTWA 3W0OA 3VVHA 4EWHA 4YSJA 3EMGA 4O1PA 2A19B 4MD8E 4RA5A 4W4WA 5KZ0A 1BKXA 5ACKA 3ZM9A 1SVHA 4O7VA 2A0CX 3ULIA 4QTAA 4HJOA 4ZSLA 5JQ8A 1Z5MA 2ITVA 2BIKB 2I0YA 3EYGA 2G9XA 4X0MA 4O84A 2VTOA 1JKTA 3CKWA 3PIYA 5CT0A 2PVKA 2X7GA 4EUUA 3TT0A 3QXPA 4IFGA 5KO1A 1KOAA 4ENYA 4AZVA 3E3PA 2UW8A 2OO8X 2W0JA 4FKJA 2VTMA 1XH7A 3HAMA 3R83A 2V5QA 3BGQA 4M13A 1VEBA 3WZEA 3Q2JA 3DZQA 4XRJA 5LMKC 3QQUA 4FTLA 4P90A 5I9UA 5DH3A 5CAOA 4LM5A 3KIOC 4UALA 3NNVA 4AX8A 3RALA 2ITQA 3KL8A 4YNEA 2VWYA 3ZSGA 3KA0A 3R8PA 2VTSA 4TW9A 3GEQA 1OVEA 1LPUA 2GNIA 2W17A 4PF4A 3OT3A 3ZXZA 4ZJIA 4E6QA 3ZONA 5BVWA 2IW9A 1TFFA 2JIVA 5IQIA 3O71A 2F7EE 5HG9A 4O1OA 2WTCA 3C7QA 3QTRA 4JX3A 5ANGA 4MYGA 1YXTA 3UJGA 2VUWA 5D12A 3PRIA 4K11A 5D11A 5D1JA 4NM0A 4HCTA 3TNHA 3AGLA 4R1YA 4J96A 3ENHA 3HL7A 4DH1A 4O91A 3UNJA 4UXLA 2R3JA 5F4NA 4O0SA 4R5YA 3RCJA 5KUPA 2HK5A 2VNYA 3R8LA 2PUPA 3ZOSA 3P7AA 4MX9A 5L6PA 5ANJA 4ZTLA 4ZXTA 1YI6A 1HCKA 2ONLA 3HLLA 2BKZA 5BUEA 4TYGA 5DR9A 3VQUA 3QD2B 1KOBA 3BV2A 4IE9A 3UDSA 3C4WA 3LLAA 1WBOA 3NUPA 2PHKA 1UKHA 2G2HA 4GG5A 2F57A 4FIJA 4FL1A 5K9IA 3M11A 4AN2A 2GHGA 2QOOA 4LUDA 3ZXTA 3A7HA 4UMRA 4QQ5A 4AGCA 4L3PA 2JFMA 4ZSGA 1JLUE 4UYNA 4Y83A 5AWMA 3V5PA 4U6RA 3GCQA 3ZRMA 1VR2A 4I1ZA 3LMIA 3VW8A 2J90A 4I92A 2HY81 3AD6A 4RZWA 5IQDA 1DS5A 3IPHA 4YZCA 1YQJA 3EFJA 2WQOA 3FYKX 4LOQA 4RLLA 4YTIA 3W55A 3DT1A 2QODA 4QYFA 4KAOA 1RE8A 1BMKA 4HGTA 4IAZA 4YC3A 1H1SA 3EL7A 4FSTA 4BCNA 2XM9A 4I0RA 1O6KA 4XG4A 5F1ZA 4F9YA 4MXZA 3W0PA 4A9RA 4RT7A 2Y9QA 2UW3A 3IQ7A 4NKSA 4XRLA 5L2QA 3G9NA 3PG3A 5TO8A 3M1SA 4NFNA 4B7TA 4TNBA 3VS1A 3W16A 3HGKA 3RCDA 3KEXA 4E1ZA 1W0XC 3N4VA 3K3IA 3BIZA 4CFWA 4PL5A 4XP2A 4PPBA 3PSBA 3JPVA 3OS3A 4C33A 5AV2A 5C03A 3ORMA 2WEIA 3BBWA 2ZMCA 5K4JA 4IM0A 4YUQA 2B1PA 4CG9A 1M7NA 3BHYA 3R6XA 4FC0A 2OFVA 2J7TA 2PUIA 4QMUA 4FV5A 1B6CB 3OD6X 3VBVA 1M2PA 3CPBA 4F0IA 3MY1A 4G3DA 2GFCA 5AP6A 2C5OA 1P2AA 2BRNA 3F7ZA 3OCBA 5HE0A 1PXLA 3Q4ZA 3EOCA 4C59A 5EHLA 3KMUA 4L7SA 4Z3VA 2R0UA 5DFPA 1KUTA 3QL8A 4LOPA 2CLXA 3BPRA 3VBQA 3QTWA 3R7VA 5CSWA 3DZOA 5JGBA 2C6TA 4MVFA 4FT0A 4WNKA 4GYIA 4LGDA 3VBXA 5HG7A 1PRYA 2OJGA 2YWPA 3F5GA 3JY0A 4RIWB 1Q3WA 2RG5A 4ANOA 2VV9A 2QR7A 3RPYA 4CKIA 1NVSA 3IDCA 5JRQA 2NNWB 4LMUA 1OGUA 1OL2A 3FPQA 3V5QA 4B0GA 1KE8A 4RFYA 4E4MA 2UZNA 5CEKA 5CEOA 3KRWA 4BYJA 2X8IA 5A14A 5AA8A 5CVHA 3AKLA 1KE7A 5AUYA 4DLIA 5J9ZA 3FWQA 3HMOA 3R7OA 1Y8GA 4RJ5A 4EK6A 5BVNA 4IAIA 4IX6A 3RMFA 1OIYA 2B55A 4CMUA 3NUNA 3QYZA 4JG7A 3V6SA 3PJ8A 4BTJA 1RDQE 3F6XA 3DTCA 3UOKA 4AZEA 3WZJA 4GKHA 1KE6A 1O9UA 4JVGA 2ZYBA 4O21A 4MNEA 5E8SA 3RAIA 3D5WA 4QMNA 3GT8A 4ONAA 4RC4A 3VRYA 4E93A 3C4XA 4X2KA 4A4LA 2QHMA 2H8HA 1XMLA 5E4HA 4O4BB 5TT7A 5C26A 2GFSA 5EKOA 3KXGA 1P14A 5LVOA 3NYVA 3RAHA 4FTNA 3TNWA 2FVDA 2C68A 1I44A 4O0RA 3PE1A 4W8DA 3IW8A 3R9OA 2C6IA 5TR6A 3ZHPC 5KNJA 5ETIA 3SXSA 4UMTA 1UKIA 2XNBA 1HCLA 2C6EA 2QOKA 2R9SA 4UZHA 3D7ZA 3DXNA 4M12A 2R2PA 5DRDA 2H9VA 3QA0A 5JZNA 3OTUA 3W0RA 2C0OA 3P5KA 3TNIA 2GTMA 3AC2A 2ESMA 4JAIA 5LVMA 1R3CA 3UGCA 4R7HA 3OXIA 5AP3A 1WAKA 3ALOA 3NFFB 2X2LA 2YN8A 2ETKA 4J71A 4KINA 4L68A 3SXRA 4GFOA 5A4CA 1V1KA 1UU7A 3ZLYA 2OG8A 3PP1A 4RWLA 3HP5A 3DBCA 1WFCA 5EI6A 4O6EA 1XKKA 4EC8A 3COHA 3AD5A 3DK6A 4LOOA 4UWYA 3PJ3A 4MQ2A 1OKWA 3MW1A 4AQKA 1NY3A 2WQNA 4DEEA 3ZSHA 4DCAA 3V8SA 4IB0A 4Y46A 3SKCA 2KTYA 4CRLA 2PMLX 4O27B 1KE9A 4I20A 2UW5A 3VHKA 2P55A 5G1XA 3RVGA 4DEGA 4EZ3A 2XAOA 2Y8OA 3CGFA 4EH8A 4CCBA 1IAHA 1UVRA 5BYYA 4DFBA 3RBWA 4EHEA 2I0VA 4JMQA 2LAVA 3LQ5A 4EJ7A 4IB1A 4R8QA 3W0QA 3H9RA 2VTIA 3KXHA 4GH2A 2H96A 4GG7A 4HGSA 5BPYA 4U3ZA 4WA9A 1URCA 5LWMA 3UMXA 5C8MA 5HU9A 3ZYAA 4QP6A 2A2AA 3FXXA 5JFXA 3JVRA 4O7WA 4FSUA 3KC3A 3O0GA 3PA3A 4TYEA 1ZMWA 5HLNA 3D2IA 2FYSA 5IA3A 2UV2A 2XM8A 4FMQA 5KMLA 2XYNA 2WMVA 3E8EA 3DY7A 3U4UA 4QRCA 5HGIA 4EH2A 4O4CA 4TN6A 4AP7A 2Z7SA 5D41A 2O5KA 4ZZOA 4IX3A 1KV1A 2WU6A 3VBWA 5ITAA 4QMZA 4QOXA 4QQTA 5AADA 2IVTA 5FUTA 4GIIA 4DG2E 4OLIA 3GCUA 3NW6A 3DU8A 5BVFA 5IA0A 2CMWA 3G51A 1VYZA 3ZEWA 4RVTA 2GHMA 3CY2A 3FLZA 2W1CA 1OBGA 4QMMA 3HV3A 2BZJA 5KMKA 3IG7A 2WMWA 3KXMA 4O86A 2C0IA 3MA6A 2CN8A 1P5EA 3D83A 4AGDA 2OIQA 3TZ9A 3KQ7A 4F70A 1Q3DA 4M15A 5M07A 3SA0A 1NW1A 3H3CA 2JD5A 2HY0A 3HKOA 3Q60A 4XNEA 4EK5A 3QTUA 3PLAE 3TXOA 1EH4A 3UG2A 2IZTA 2QU6A 5EYCA 3BWJA 3ZEPA 2V55A 4MQ1A 4WUNA 1YXSA 5GIOE 2WOUA 2QOQA 1STCE 3FDNA 3HAVA 4FZDB 4AZTA 1QPEA 1F3MC 1X8BA 4AWIA 2X2KA 4G17A 3A7GA 4YJPA 3QCYA 3F5UA 2GNFA 2LGCA 4RA4A 1YI4A 5CALA 3NYXA 4BKJA 4GRBA 4H1JA 5DRBA 4U81A 3RAKA 1NT2A 4WSYA 4X2NA 4X6RA 3RKBA 5FDPA 3RHKA 2YDIA 2C5VA 3NGAA 3BGZA 4JRVA 3U55A 5IQEA 3W0SA 3CE3A 5IA2A 3SVVA 2XUUA 3LFQA 4MF0A 1PXMA 1Q62A 1W2DA 3MVMA 5HNBA 3GC0A 2OXXA 1WMKA 1LEWA 2ZB1A 3OY3A 3VIDA 3ZLWA 1OKVA 5AJQA 3RJCA 4FUYA 4NTTA 3GU6A 2CJMA 3BLRA 3ERKA 4IZAA 4ZZNA 2FGIA 5HO8A 3G90X 1GY3A 2G15A 3H9FA 4Y72A 4AA4A 5JGAA 5E7RA 4R3PA 3LCSA 3QRJA 2WXVA 5L8LA 4IWQA 4E8AA 4A9YA 4F4PA 3I4BA 4ANNA 1YXUA 3QD0A 3QQJA 3KK8A 4U45A 2YCFA 4NW5A 1IEPA 4CQGA 4FSNA 2WD1A 4IB5A 4D9UA 4EI4A 5IMEA 5DGZA 4NCTC 1ZOEA 3FHRA 2WFYA 4AS0A 4U7ZA 4FVRA 4RZVA 4M67A 4PTGA 4C4IA 3I5NA 2IWIA 4BZDA 4F1MA 3SAYA 3JY9A 5A9UA 5AP7A 2IVVA 2WMAA 3C0HA 4OTGA 1CKJA 2R3IA 5BX0A 3UPZA 3WYYA 1OM1A 3RZBA 3FKNA 3PIZA 4MBLA 4RX7A 5FEEA 5FM2A 3VQHA 1ZY5A 3WIGA 5I0BA 3MVLA 4RQKA 5IEXA 3UC3A 1BX6A 3GENA 3HRCA 1UA2A 3AMAA 1JKKA 4BCGA 3FKLA 3OWJA 3CTJA 3OVVA 3UO6A 3ELJA 3TTJA 3R1NA 4FV3A 2PZIA 3I7CA 5B0XA 4B8MA 5J1VA 4G31A 4FZAB 4XV1A 3FMKA 2C6MA 3UO5A 2OLCA 2X6EA 3C4CA 1YKRA 4DH8A 2CCHA 3HRFA 2YZLA 4BICA 4YJSA 5HI2A 4BJJA 3KN6A 4EK8A 2HAKA 2B9FA 3OF0A 1H25A 1XBAA 3EQBA 3PG1A 3R73A 4H39A 4ZTSA 2PVJA 3A4OX 4PP7A 5L8KA 2R3KA 4FUXA 5L6WL 3A8WA 2ITNA 3PXFA 4ALWA 4H36A 3UQGA 4BIEA 5BNJA 5HD4A 5KHXA 5HTIA 1G8SA 5AX9A 1YXVA 2AQXA 2RFEA 4JT3A 4V0GA 1PF8A 4J99A 2J0IA 4AE9A 5BUJA 2WTVA 2BZIB 4TKSA 4ANMA 3BHHA 5CU2A 1PXIA 3MY5A 4UBAA 4FSYA 4IJ9A 5EDQA 5HIDA 4F9BA 2QLQA 4ACCA 2YFXA 2HENA 4XH6A 5CTPA 3ZO2A 4E7WA 4ACGA 3PFYA 4QYEA 2BZHB 2BFXA 2BTRA 2AC3A 4LL0A 2OJ9A 3FXWA 2BDFA 4NSTA 5HVJA 5CQUA 2XJ2A 4D5HA 2HZ0A 3PUFC 3LPBA 4H3PA 4NWMA 1J1CA 2OJJA 2PVFA 4NH1A 3E8NA 3NX8A 2BHEA 2VWXA 5IG1A 4R6VA 2H6DA 4RMZA 3ZRKA 2PVNA 1CSNA 3HDNA 4BCOA 2JDRA 2X81A 3F3ZA 3MTFA 2YM4A 4YJVA 2I0HA 3SRVA 3WE4A 5L6OA 3VRZA 2BPMA 2Z8CA 3OUKA 3S2PA 2HYYA 4AZSA 4BVUA 3CLYA 1ERKA 5K5NA 5J9YA 2GS2A 2BDWA 3F3TA 3EN7A 4HYUA 1GNGA 3HP2A 5GHVA 3SDJA 5TE0A 4YHJA 2UZLA 4JR3A 2BRHA 2X4FA 4ITHA 4YBJA 5K4IA 2ITPA 4FV7A 3ZMMA 5CAPA 4RGJA 2GS6A 2QLUA 4CQEA 1PKDA 3DDQA 2VO0A 1L3RE 3TV4A 4FT9A 2UZDA 3OC1A 4I21A 4QYYA 4XV9A 1IR3A 2PVHA 2YIYA 5M44A 5DE2A 3D5VA 3UPXA 3NW5A 4JDKA 4XBUA 3Q2MA 4ERKA 4D2PA 3PZEA 3KMWA 1OPLA 3OBGA 5A4QA 2PL0A 3ALNA 5JFSA 3QLGA 2OF4A 5C8KA 1ATPE 4R78A 4JQEA 5ANKA 4JIKA 2RFNA 3O7LD 3TEIA 2GNGA 4S32A 1GOLA 4H1MA 4EH6A 4O4FA 4FKIA 3KRLA 5LVLA 3HMNA 2W4KA 2XK9A 3VUKA 3KCKA 4H05A 4D4VA 4NZWB 5CLPA 4ZLYA 4FK3A 3TJCA 3A4PA 3QF9A 4LV8A 4BBEA 2VTRA 2WB8A 2B9IA 2YAAA 3WZKA 4AW1A 4CMOA 2XANA 5LVPA 4F78A 4CFFA 2NRYA 2YIXA 2G2FA 3LFNA 4E6AA 3FUPA 4EBVA 5FEDA 3BWFA 4PTCA 5IF1A 1SZMA 4DFNA 5C8NA 2OBJA 2XKDA 4ARKA 3MSSA 4HVDA 4D28A 5DYJA 4IZ5A 3TM0A 5M09A 1H1QA 3FQSA 4HPTE 1MRVA 5DIAA 3UNZA 3WE8A 2X8DA 2XK6A 4IZYA 2B4SB 5HOAA 5JKGA 4MNFA 4ALUA 2X7FA 2QOIA 4QP7A 5T3QA 3FMEA 3LCTA 5DN3A 3GC8A 2PVMA 5E8XA 3P7BA 2ZV8A 3D15A 3HNGA 4FTKA 4XLIA 4DEBA 3QWKA 3AC3A 1GJOA 5AMNA 3S3IA 2CKOA 2OW3A 3F7WA 3LQ8A 2JBPA 3A62A 2R0IA 3RK7A 1G5SA 3IW7A 5CEIA 4BKYA 4CFVA 4EH3A 3HZTA 4FV1A 4TXCA 5T6KA 3R28A 3NUSA 3BBTB 2ETMA 2C5YA 1MP8A 2QOFA 4OT5A 5GZ9A 3HDMA 4CYIA 4P2KA 4L45A 2WZJA 4FNZA 4G6LA 1Y6BA 4I0SA 4FKLA 4KNBA 4L9IA 5FG8A 4AA0A 2WPAA 4A9UA 4AXEA 4E6CA 2UZEA 3RWQA 3V5JA 4TL0A 4RX9A 3LFBA 3OCGA 2FSLX 4IC7A 4AW5A 1NXKA 4BL1A 4FIFA 4H3QA 3ZSIA 1A48A 4BYIA 4FEWA 3ZUVA 2RL5A 2QNJA 3I5ZA 3LM0A 2WMBA 2CSNA 1BL6A 1REKA 1ZLTA 3FYJX 4J7BA 4RG0A 3LKMA 4IDTA 5G6VA 4P7EA 3PLSA 2IZSA 3TDVA 2HZ4A 2HIWA 1OIUA 2XK8A 3UYTA 2IW8A 3B2WA 2YM6A 5A4TA 4FYNA 1J7LA 3C5IA 3HX4A 4ZS4A 4RWIA 4V04A 4QMPA 1JNKA 4B8LA 4FTTA 1OGYA 3R02A 3C0IA 3DLSA 3NEWA 4G34A 3Q9ZA 3F9NA 3OWKA 2QU5A 3VUTA 1LR4A 4QMSA 5FRIA 3RI1A 3WF7A 5A6OA 5C4KA 3VAPA 4CFUA 3F2NA 1DI9A 2W7XA 4O2PA 5ACBC 3Q4TA 5J87A 2OJFE 4OTPA 5FTQA 5ETCA 3CCNA 2HW7A 2BALA 4WRSA 4A4XA 4BDJA 3FC2A 5JGDA 4BDHA 1Q61A 4DFLA 4QTCA 2NYAA 2XALA 4MF1A 3C4EA 3AMBA 4IADA 3OWPA 3VHEA 2C6LA 5I3RA 3H0YA 3FAAA 5JRSA 4NJDA 2JFLA 2B9JA 4FSZA 3NNUA 3UZRA 3E8DA 3KULA 3PSDA 4Y73A 3UP2A 5IQAA 2P33A 3ORLA 5I4NA 2ZM3A 4DGGA 1U54A 5CU3A 2QR8A 3GI3A 3UIMA 2EXEA 3H4JA 3ZBFA 1XO2B 5D7VA 2PK9A 4GJ3A 3K2LA 2OI4X 4ANBA 4I24A 4EYMA 5CENA 4D1XA 5CQWA 3VS2A 5EDRA 1OB3A 1ZAOA 4BDBA 3LOKA 1O6YA 3R7EA 3NYOA 3ITZA 5H8BA 2WMSA 2JDTA 2ZOQA 3I0OA 4ZK5A 3ZDUA 4A7CA 4AZFA 5FGKA 4K1BA 4ZS0A 4M69B 4OT6A 2VGOA 3EQHA 4EHZA 3QA8A 3DDPA 4OR5A 4BKZA 5H8EA 1G8KA 5FP5A 5AV0A 4GT5A 4I6LA 4AF3A 3L9MA 3HMPA 2WAJA 2JAVA 3DAKA 4DEIA 4XLVA 2WTJA 3MPMA 3TUCA 4FEVA 4S30A 3QRUA 4CEGA 4FG9A 4D2VA 3EL8A 3MFSA 1QPCA 3WF5A 1ZYDA 4F1OA 1SYKA 2X39A 5FXSA 5HLPA 3DNDA 5K3YA 2XRWA 3WF9A 2H34A 1W7HA 3FKOA 4BB4A 2BVAA 5JQ5A 3V5TA 3BL9A 5H8GA 4EKLA 2Y4PA 3K3JA 3QHWA 1JKSA 3NR9A 3UC4A 3PVWA 4OBPA 4FJVA 5GIPE 3Q4CA 4GL9A 3UOJA 3KKVA 4RC3A 3EN4A 2AC5A 1NVRA 5TOZA 2ITZA 3B8QA 2EWAA 4G1WA 4IQ6A 4TWOA 4AW0A 4DH3A 4F9AA 3NAYA 3VWAA 5HX6A 3SGCA 3ORPA 4E26A 4CYJA 1PHKA 3UNKA 5CZIA 3VUIA 3BGPA 1P4OA 3F82A 4B99A 4U8ZA 4I0TA 1O6LA 3NUUA 2YCQA 4DFXE 3BU5A 3R9DA 3FV8A 3NVKI 4A07A 3GU7A 3TCPA 5FBNC 3L8SA 3OROA 4RIWA 4NUSA 5GJGA 4KIOA 4RIOA 4AFEA 2XEZA 2HWPA 3EJ1A 3ROCA 5J9LA 4JBQA 5CXZA 4M3QA 3DXPA 4FIGA 2ITWA 3RZFA 4O7YA 4EYJA 1YOLA 5B2LA 5EQYA 5CEQA 4BHZA 2Z60A 3BEGA 3UQFA 1MUOA 3JXWA 1GAGA 3QRTA 5AUVA 3PY3A 3TTIA 5IUGA 2YWVA 2WQEA 3EIDA 3PSCA 4O0UA 1YDTE 3QUDA 4BZOA 3K5UA 4WBBB 4KBAA 4J97A 2GNLA 4G6NA 5FWKK 3IDBA 4E5WA 4YJNA 5DI1A 4GUBA 5HCXA 4PDPA 1ZYJA 2QQ7A 1JSUA 2WU7A 1OL1A 3NPCA 4F6SA 2P0CA 4R3CA 4DA5A 3NUXA 4HCUA 5A54A 4Q9SA 4BIBA 2IO6A 2JKOA 5GJDA 2XMYA 3QX4A 4GYGA 4IACA 2UW7A 4R1VA 3WZDA 5EOLA 2WIPA 4DN5A 4J53A 4JS8A 4FEXA 4UB7A 2ERKA 5HVYA 3E8CA 1XR1A 3W18A 2RSVA 4G3EA 5C9CA 3LXNA 4W8EA 4D2SA 3UZPA