4FOGA

Crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
260
structure length
260
Chain Sequence
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of binary and ternary complexes of thymidylate synthase (ThyA) from Mycobacterium tuberculosis: Insights into the selectivity and mode of inhibition
rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Mycobacterium tuberculosis
total genus 76
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4fogA00
1BDUA 1TDUA 3UWLB 4O1UA 3BHLA 3CLBA 2BBQA 3IK1A 2G8DA 4FGTA 4XSCA 1F4EA 1JMGA 2ONBA 4E5OA 5BY6A 3IJZA 1I00A 1JUTA 3IRNA 1TSLA 3EDWX 4TMSA 1JMHA 1TSDA 1BSPA 3GG5A 1JG0A 1NJCA 3I3RA 4XSDA 1VZDA 3TMSA 5J7WA 4GD7A 3C06A 1LCBA 3BFIA 3BNZA 2G8XA 1SEJA 2G8AA 1B02A 4GYHA 4H0UA 1EV5A 1JMIA 1BJGA 1F4CA 1F4DA 1AOBA 1BO7A 1F4GA 1DNAA 1BQ2A 1NJDA 2G89A 3BHRA 3IHIA 3JSUA 1LCAA 4H1IA 4EILA 3IX6A 1JTUA 1BKOA 4EINA 1B5DA 1F4BA 1VZBA 3BZ0A 3IRMA 5HS3A 1HW4A 1JU6A 1TSYA 4ISKA 1BSFA 1EVGA 1KZIA 1TYSA 1HZWA 3N5EB 1TVWA 1BO8A 3K2HA 1JMFA 1J3JC 2VETA 1NJBA 1HVYA 4ISWA 4DQ1A 1BQ1A 2FTNA 3N5GA 2TDMA 3IK0A 5WRNA 1NJEA 4KPWA 1EV8A 4Q0DA 3UWLA 1KCEA 4FOAA 1B5EA 1VZAA 1TVUA 4JEFA 1YPVA 3H9KA 5H39A 1TSXA 3KJRA 3C0AA 3DL5A 3NRRA 4UP1A 3IROA 1B49A 1HW3A 1TRGA 1DDUA 4LRRA 4FOGA 1JTQA 1TDCA 4G2OX 1J3KC 4IRRA 1VZCA 1RTSA 4G6WX 3EBUA 1TLSA 2FTOX 3DG8C 1LCEA 1TSNA 1TSVA 4KYAA 3CL9A 4GEVA 4DPDA 4EZ8A 2RD8A 3EF9A 4Q0EA 4F2VA 3ED7A 1VZEA 4KNZA 2RDAA 1CI7A 3DGAC 1TSWA 1J3IC 1TDAA 1QZFA 4DP3A 3GH2X 1FWMA 4KY8A 3BYXA 1TDBA 2OIPA 4EB4A 1AXWA 1KZJA 4O7UA 3B5BA 5FCTA 2G86A 1F28A 3QGTA 3INVA 4PSGA 3HB8A 3N5EA 5H3AA 3V8HA 4H0RA 4E28A 3OB7A 1F4FA 4IQQA 4FOXA 4XSEA 4DPHA 2H2QA 1AN5A 3EHIX 1FFLA 1BIDA 4KY4A 1BKPA 1JUJA 1TSZA 3DL6A 2AAZA 1EVFA 3UM8A 2FTQA 3EGYX 4O1XD 1ZPRA 1TVVA 2TDDA 3BGXA 3HBBA 1TLCA 3UM6A 1BP0A 1TISA 3KGBA 1BPJA 1NCEA 2TSCA 3EJLA 5H38A 1TSMA 1TJSA 3UM5A 4ECKA 1THYA 2A9WA 3EAWX 3HJ3A 3B9HA 4O1XA 1AIQA 2RD8B 2VF0A 3KJSA 3QG2A 3GH0A 1QQQA 3QJ7A 1AJMA 1NJAA 1BP6A 4IQBA 1SYNA 4FQSA 2KCEA 2TSRA
chains in the Genus database with same CATH superfamily
1BDUA 1TDUA 3UWLB 4O1UA 3BHLA 3CLBA 2BBQA 3IK1A 2G8DA 4FGTA 4XSCA 1F4EA 1JMGA 2ONBA 4E5OA 5BY6A 3IJZA 1I00A 1JUTA 3IRNA 1TSLA 3EDWX 4TMSA 1JMHA 1TSDA 1BSPA 3GG5A 1JG0A 1NJCA 3I3RA 4XSDA 1VZDA 3TMSA 5J7WA 4GD7A 3C06A 1LCBA 3BFIA 3BNZA 2G8XA 1SEJA 2G8AA 1B02A 4GYHA 4H0UA 1EV5A 1JMIA 1BJGA 1F4CA 1F4DA 1AOBA 1BO7A 1F4GA 1DNAA 1BQ2A 1NJDA 2G89A 3BHRA 3IHIA 3JSUA 1LCAA 4H1IA 4EILA 3IX6A 1JTUA 1BKOA 4EINA 1B5DA 1F4BA 1VZBA 3BZ0A 3IRMA 5HS3A 1HW4A 1JU6A 1TSYA 4ISKA 1BSFA 1EVGA 1KZIA 1TYSA 1HZWA 3N5EB 1TVWA 1BO8A 3K2HA 1JMFA 1J3JC 2VETA 1NJBA 1HVYA 4ISWA 4DQ1A 1BQ1A 2FTNA 3N5GA 2TDMA 3IK0A 5WRNA 1NJEA 4KPWA 1EV8A 4Q0DA 3UWLA 1KCEA 4FOAA 1B5EA 1VZAA 1TVUA 4JEFA 1YPVA 3H9KA 5H39A 1TSXA 3KJRA 3C0AA 3DL5A 3NRRA 4UP1A 3IROA 1B49A 1HW3A 1TRGA 1DDUA 4LRRA 4FOGA 1JTQA 1TDCA 4G2OX 1J3KC 4IRRA 1VZCA 1RTSA 4G6WX 3EBUA 1TLSA 2FTOX 3DG8C 1LCEA 1TSNA 1TSVA 4KYAA 3CL9A 4GEVA 4DPDA 4EZ8A 2RD8A 3EF9A 4Q0EA 4F2VA 3ED7A 1VZEA 4KNZA 2RDAA 1CI7A 3DGAC 1TSWA 1J3IC 1TDAA 1QZFA 4DP3A 3GH2X 1FWMA 4KY8A 3BYXA 1TDBA 2OIPA 4EB4A 1AXWA 1KZJA 4O7UA 3B5BA 5FCTA 2G86A 1F28A 3QGTA 3INVA 4PSGA 3HB8A 3N5EA 5H3AA 3V8HA 4H0RA 4E28A 3OB7A 1F4FA 4IQQA 4FOXA 4XSEA 4DPHA 2H2QA 1AN5A 3EHIX 1FFLA 1BIDA 4KY4A 1BKPA 1JUJA 1TSZA 3DL6A 2AAZA 1EVFA 3UM8A 2FTQA 3EGYX 4O1XD 1ZPRA 1TVVA 2TDDA 3BGXA 3HBBA 1TLCA 3UM6A 1BP0A 1TISA 3KGBA 1BPJA 1NCEA 2TSCA 3EJLA 5H38A 1TSMA 1TJSA 3UM5A 4ECKA 1THYA 2A9WA 3EAWX 3HJ3A 3B9HA 4O1XA 1AIQA 2RD8B 2VF0A 3KJSA 3QG2A 3GH0A 1QQQA 3QJ7A 1AJMA 1NJAA 1BP6A 4IQBA 1SYNA 4FQSA 2KCEA 2TSRA
chains in the Genus database with same CATH topology
1BDUA 1TDUA 3UWLB 4O1UA 3BHLA 3CLBA 2BBQA 3IK1A 2G8DA 4FGTA 4XSCA 1F4EA 1JMGA 2ONBA 4E5OA 5BY6A 3IJZA 1I00A 1JUTA 3IRNA 1TSLA 3EDWX 4TMSA 1JMHA 1TSDA 1BSPA 3GG5A 1JG0A 1NJCA 3I3RA 4XSDA 1VZDA 3TMSA 5J7WA 4GD7A 3C06A 1LCBA 3BFIA 3BNZA 2G8XA 1SEJA 2G8AA 1B02A 4GYHA 4H0UA 1EV5A 1JMIA 1BJGA 1F4CA 1F4DA 1AOBA 1BO7A 1F4GA 1DNAA 1BQ2A 1NJDA 2G89A 3BHRA 3IHIA 3JSUA 1LCAA 4H1IA 4EILA 3IX6A 1JTUA 1BKOA 4EINA 1B5DA 1F4BA 1VZBA 3BZ0A 3IRMA 5HS3A 1HW4A 1JU6A 1TSYA 4ISKA 1BSFA 1EVGA 1KZIA 1TYSA 1HZWA 3N5EB 1TVWA 1BO8A 3K2HA 1JMFA 1J3JC 2VETA 1NJBA 1HVYA 4ISWA 4DQ1A 1BQ1A 2FTNA 3N5GA 2TDMA 3IK0A 5WRNA 1NJEA 4KPWA 1EV8A 4Q0DA 3UWLA 1KCEA 4FOAA 1B5EA 1VZAA 1TVUA 4JEFA 1YPVA 3H9KA 5H39A 1TSXA 3KJRA 3C0AA 3DL5A 3NRRA 4UP1A 3IROA 1B49A 1HW3A 1TRGA 1DDUA 4LRRA 4FOGA 1JTQA 1TDCA 4G2OX 1J3KC 4IRRA 1VZCA 1RTSA 4G6WX 3EBUA 1TLSA 2FTOX 3DG8C 1LCEA 1TSNA 1TSVA 4KYAA 3CL9A 4GEVA 4DPDA 4EZ8A 2RD8A 3EF9A 4Q0EA 4F2VA 3ED7A 1VZEA 4KNZA 2RDAA 1CI7A 3DGAC 1TSWA 1J3IC 1TDAA 1QZFA 4DP3A 3GH2X 1FWMA 4KY8A 3BYXA 1TDBA 2OIPA 4EB4A 1AXWA 1KZJA 4O7UA 3B5BA 5FCTA 2G86A 1F28A 3QGTA 3INVA 4PSGA 3HB8A 3N5EA 5H3AA 3V8HA 4H0RA 4E28A 3OB7A 1F4FA 4IQQA 4FOXA 4XSEA 4DPHA 2H2QA 1AN5A 3EHIX 1FFLA 1BIDA 4KY4A 1BKPA 1JUJA 1TSZA 3DL6A 2AAZA 1EVFA 3UM8A 2FTQA 3EGYX 4O1XD 1ZPRA 1TVVA 2TDDA 3BGXA 3HBBA 1TLCA 3UM6A 1BP0A 1TISA 3KGBA 1BPJA 1NCEA 2TSCA 3EJLA 5H38A 1TSMA 1TJSA 3UM5A 4ECKA 1THYA 2A9WA 3EAWX 3HJ3A 3B9HA 4O1XA 1AIQA 2RD8B 2VF0A 3KJSA 3QG2A 3GH0A 1QQQA 3QJ7A 1AJMA 1NJAA 1BP6A 4IQBA 1SYNA 4FQSA 2KCEA 2TSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDU A;  1TDU A;  3UWL B;  4O1U A;  3BHL A;  3CLB A;  2BBQ A;  3IK1 A;  2G8D A;  4FGT A;  4XSC A;  1F4E A;  1JMG A;  2ONB A;  4E5O A;  5BY6 A;  3IJZ A;  1I00 A;  1JUT A;  3IRN A;  1TSL A;  3EDW X;  4TMS A;  1JMH A;  1TSD A;  1BSP A;  3GG5 A;  1JG0 A;  1NJC A;  3I3R A;  4XSD A;  1VZD A;  3TMS A;  5J7W A;  4GD7 A;  3C06 A;  1LCB A;  3BFI A;  3BNZ A;  2G8X A;  1SEJ A;  2G8A A;  1B02 A;  4GYH A;  4H0U A;  1EV5 A;  1JMI A;  1BJG A;  1F4C A;  1F4D A;  1AOB A;  1BO7 A;  1F4G A;  1DNA A;  1BQ2 A;  1NJD A;  2G89 A;  3BHR A;  3IHI A;  3JSU A;  1LCA A;  4H1I A;  4EIL A;  3IX6 A;  1JTU A;  1BKO A;  4EIN A;  1B5D A;  1F4B A;  1VZB A;  3BZ0 A;  3IRM A;  5HS3 A;  1HW4 A;  1JU6 A;  1TSY A;  4ISK A;  1BSF A;  1EVG A;  1KZI A;  1TYS A;  1HZW A;  3N5E B;  1TVW A;  1BO8 A;  3K2H A;  1JMF A;  1J3J C;  2VET A;  1NJB A;  1HVY A;  4ISW A;  4DQ1 A;  1BQ1 A;  2FTN A;  3N5G A;  2TDM A;  3IK0 A;  5WRN A;  1NJE A;  4KPW A;  1EV8 A;  4Q0D A;  3UWL A;  1KCE A;  4FOA A;  1B5E A;  1VZA A;  1TVU A;  4JEF A;  1YPV A;  3H9K A;  5H39 A;  1TSX A;  3KJR A;  3C0A A;  3DL5 A;  3NRR A;  4UP1 A;  3IRO A;  1B49 A;  1HW3 A;  1TRG A;  1DDU A;  4LRR A;  4FOG A;  1JTQ A;  1TDC A;  4G2O X;  1J3K C;  4IRR A;  1VZC A;  1RTS A;  4G6W X;  3EBU A;  1TLS A;  2FTO X;  3DG8 C;  1LCE A;  1TSN A;  1TSV A;  4KYA A;  3CL9 A;  4GEV A;  4DPD A;  4EZ8 A;  2RD8 A;  3EF9 A;  4Q0E A;  4F2V A;  3ED7 A;  1VZE A;  4KNZ A;  2RDA A;  1CI7 A;  3DGA C;  1TSW A;  1J3I C;  1TDA A;  1QZF A;  4DP3 A;  3GH2 X;  1FWM A;  4KY8 A;  3BYX A;  1TDB A;  2OIP A;  4EB4 A;  1AXW A;  1KZJ A;  4O7U A;  3B5B A;  5FCT A;  2G86 A;  1F28 A;  3QGT A;  3INV A;  4PSG A;  3HB8 A;  3N5E A;  5H3A A;  3V8H A;  4H0R A;  4E28 A;  3OB7 A;  1F4F A;  4IQQ A;  4FOX A;  4XSE A;  4DPH A;  2H2Q A;  1AN5 A;  3EHI X;  1FFL A;  1BID A;  4KY4 A;  1BKP A;  1JUJ A;  1TSZ A;  3DL6 A;  2AAZ A;  1EVF A;  3UM8 A;  2FTQ A;  3EGY X;  4O1X D;  1ZPR A;  1TVV A;  2TDD A;  3BGX A;  3HBB A;  1TLC A;  3UM6 A;  1BP0 A;  1TIS A;  3KGB A;  1BPJ A;  1NCE A;  2TSC A;  3EJL A;  5H38 A;  1TSM A;  1TJS A;  3UM5 A;  4ECK A;  1THY A;  2A9W A;  3EAW X;  3HJ3 A;  3B9H A;  4O1X A;  1AIQ A;  2RD8 B;  2VF0 A;  3KJS A;  3QG2 A;  3GH0 A;  1QQQ A;  3QJ7 A;  1AJM A;  1NJA A;  1BP6 A;  4IQB A;  1SYN A;  4FQS A;  2KCE A;  2TSR A; 
#chains in the Genus database with same CATH topology
 1BDU A;  1TDU A;  3UWL B;  4O1U A;  3BHL A;  3CLB A;  2BBQ A;  3IK1 A;  2G8D A;  4FGT A;  4XSC A;  1F4E A;  1JMG A;  2ONB A;  4E5O A;  5BY6 A;  3IJZ A;  1I00 A;  1JUT A;  3IRN A;  1TSL A;  3EDW X;  4TMS A;  1JMH A;  1TSD A;  1BSP A;  3GG5 A;  1JG0 A;  1NJC A;  3I3R A;  4XSD A;  1VZD A;  3TMS A;  5J7W A;  4GD7 A;  3C06 A;  1LCB A;  3BFI A;  3BNZ A;  2G8X A;  1SEJ A;  2G8A A;  1B02 A;  4GYH A;  4H0U A;  1EV5 A;  1JMI A;  1BJG A;  1F4C A;  1F4D A;  1AOB A;  1BO7 A;  1F4G A;  1DNA A;  1BQ2 A;  1NJD A;  2G89 A;  3BHR A;  3IHI A;  3JSU A;  1LCA A;  4H1I A;  4EIL A;  3IX6 A;  1JTU A;  1BKO A;  4EIN A;  1B5D A;  1F4B A;  1VZB A;  3BZ0 A;  3IRM A;  5HS3 A;  1HW4 A;  1JU6 A;  1TSY A;  4ISK A;  1BSF A;  1EVG A;  1KZI A;  1TYS A;  1HZW A;  3N5E B;  1TVW A;  1BO8 A;  3K2H A;  1JMF A;  1J3J C;  2VET A;  1NJB A;  1HVY A;  4ISW A;  4DQ1 A;  1BQ1 A;  2FTN A;  3N5G A;  2TDM A;  3IK0 A;  5WRN A;  1NJE A;  4KPW A;  1EV8 A;  4Q0D A;  3UWL A;  1KCE A;  4FOA A;  1B5E A;  1VZA A;  1TVU A;  4JEF A;  1YPV A;  3H9K A;  5H39 A;  1TSX A;  3KJR A;  3C0A A;  3DL5 A;  3NRR A;  4UP1 A;  3IRO A;  1B49 A;  1HW3 A;  1TRG A;  1DDU A;  4LRR A;  4FOG A;  1JTQ A;  1TDC A;  4G2O X;  1J3K C;  4IRR A;  1VZC A;  1RTS A;  4G6W X;  3EBU A;  1TLS A;  2FTO X;  3DG8 C;  1LCE A;  1TSN A;  1TSV A;  4KYA A;  3CL9 A;  4GEV A;  4DPD A;  4EZ8 A;  2RD8 A;  3EF9 A;  4Q0E A;  4F2V A;  3ED7 A;  1VZE A;  4KNZ A;  2RDA A;  1CI7 A;  3DGA C;  1TSW A;  1J3I C;  1TDA A;  1QZF A;  4DP3 A;  3GH2 X;  1FWM A;  4KY8 A;  3BYX A;  1TDB A;  2OIP A;  4EB4 A;  1AXW A;  1KZJ A;  4O7U A;  3B5B A;  5FCT A;  2G86 A;  1F28 A;  3QGT A;  3INV A;  4PSG A;  3HB8 A;  3N5E A;  5H3A A;  3V8H A;  4H0R A;  4E28 A;  3OB7 A;  1F4F A;  4IQQ A;  4FOX A;  4XSE A;  4DPH A;  2H2Q A;  1AN5 A;  3EHI X;  1FFL A;  1BID A;  4KY4 A;  1BKP A;  1JUJ A;  1TSZ A;  3DL6 A;  2AAZ A;  1EVF A;  3UM8 A;  2FTQ A;  3EGY X;  4O1X D;  1ZPR A;  1TVV A;  2TDD A;  3BGX A;  3HBB A;  1TLC A;  3UM6 A;  1BP0 A;  1TIS A;  3KGB A;  1BPJ A;  1NCE A;  2TSC A;  3EJL A;  5H38 A;  1TSM A;  1TJS A;  3UM5 A;  4ECK A;  1THY A;  2A9W A;  3EAW X;  3HJ3 A;  3B9H A;  4O1X A;  1AIQ A;  2RD8 B;  2VF0 A;  3KJS A;  3QG2 A;  3GH0 A;  1QQQ A;  3QJ7 A;  1AJM A;  1NJA A;  1BP6 A;  4IQB A;  1SYN A;  4FQS A;  2KCE A;  2TSR A; 
#chains in the Genus database with same CATH homology
 1BDU A;  1TDU A;  3UWL B;  4O1U A;  3BHL A;  3CLB A;  2BBQ A;  3IK1 A;  2G8D A;  4FGT A;  4XSC A;  1F4E A;  1JMG A;  2ONB A;  4E5O A;  5BY6 A;  3IJZ A;  1I00 A;  1JUT A;  3IRN A;  1TSL A;  3EDW X;  4TMS A;  1JMH A;  1TSD A;  1BSP A;  3GG5 A;  1JG0 A;  1NJC A;  3I3R A;  4XSD A;  1VZD A;  3TMS A;  5J7W A;  4GD7 A;  3C06 A;  1LCB A;  3BFI A;  3BNZ A;  2G8X A;  1SEJ A;  2G8A A;  1B02 A;  4GYH A;  4H0U A;  1EV5 A;  1JMI A;  1BJG A;  1F4C A;  1F4D A;  1AOB A;  1BO7 A;  1F4G A;  1DNA A;  1BQ2 A;  1NJD A;  2G89 A;  3BHR A;  3IHI A;  3JSU A;  1LCA A;  4H1I A;  4EIL A;  3IX6 A;  1JTU A;  1BKO A;  4EIN A;  1B5D A;  1F4B A;  1VZB A;  3BZ0 A;  3IRM A;  5HS3 A;  1HW4 A;  1JU6 A;  1TSY A;  4ISK A;  1BSF A;  1EVG A;  1KZI A;  1TYS A;  1HZW A;  3N5E B;  1TVW A;  1BO8 A;  3K2H A;  1JMF A;  1J3J C;  2VET A;  1NJB A;  1HVY A;  4ISW A;  4DQ1 A;  1BQ1 A;  2FTN A;  3N5G A;  2TDM A;  3IK0 A;  5WRN A;  1NJE A;  4KPW A;  1EV8 A;  4Q0D A;  3UWL A;  1KCE A;  4FOA A;  1B5E A;  1VZA A;  1TVU A;  4JEF A;  1YPV A;  3H9K A;  5H39 A;  1TSX A;  3KJR A;  3C0A A;  3DL5 A;  3NRR A;  4UP1 A;  3IRO A;  1B49 A;  1HW3 A;  1TRG A;  1DDU A;  4LRR A;  4FOG A;  1JTQ A;  1TDC A;  4G2O X;  1J3K C;  4IRR A;  1VZC A;  1RTS A;  4G6W X;  3EBU A;  1TLS A;  2FTO X;  3DG8 C;  1LCE A;  1TSN A;  1TSV A;  4KYA A;  3CL9 A;  4GEV A;  4DPD A;  4EZ8 A;  2RD8 A;  3EF9 A;  4Q0E A;  4F2V A;  3ED7 A;  1VZE A;  4KNZ A;  2RDA A;  1CI7 A;  3DGA C;  1TSW A;  1J3I C;  1TDA A;  1QZF A;  4DP3 A;  3GH2 X;  1FWM A;  4KY8 A;  3BYX A;  1TDB A;  2OIP A;  4EB4 A;  1AXW A;  1KZJ A;  4O7U A;  3B5B A;  5FCT A;  2G86 A;  1F28 A;  3QGT A;  3INV A;  4PSG A;  3HB8 A;  3N5E A;  5H3A A;  3V8H A;  4H0R A;  4E28 A;  3OB7 A;  1F4F A;  4IQQ A;  4FOX A;  4XSE A;  4DPH A;  2H2Q A;  1AN5 A;  3EHI X;  1FFL A;  1BID A;  4KY4 A;  1BKP A;  1JUJ A;  1TSZ A;  3DL6 A;  2AAZ A;  1EVF A;  3UM8 A;  2FTQ A;  3EGY X;  4O1X D;  1ZPR A;  1TVV A;  2TDD A;  3BGX A;  3HBB A;  1TLC A;  3UM6 A;  1BP0 A;  1TIS A;  3KGB A;  1BPJ A;  1NCE A;  2TSC A;  3EJL A;  5H38 A;  1TSM A;  1TJS A;  3UM5 A;  4ECK A;  1THY A;  2A9W A;  3EAW X;  3HJ3 A;  3B9H A;  4O1X A;  1AIQ A;  2RD8 B;  2VF0 A;  3KJS A;  3QG2 A;  3GH0 A;  1QQQ A;  3QJ7 A;  1AJM A;  1NJA A;  1BP6 A;  4IQB A;  1SYN A;  4FQS A;  2KCE A;  2TSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...