4FOJA

1.55 a crystal structure of xanthomonas citri fimx eal domain in complex with c-digmp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
253
Chain Sequence
b'DRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding
total genus 88
structure length 253
sequence length 255
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fojA00
3GG1A 4AFYA 3PJXA 2BASA 3PJUA 4KIEA 4F48A 4RNFA 4HU3A 4RNJA 5MF5A 5MKGA 3HV9A 4FOUA 4FOKA 4HJFA 3SY8A 4LYKA 4Q6JA 4RNHA 3GFXA 4RNIA 4Y9OA 3PFMA 3PJWA 4ES4A 3PJTA 3S83A 4FOJA 2W27A 4AG0A 5M1TA 4HU4A 3HV8A 4Y9NA 3U2EA 4Y9PA 4J40A 3N3TA 3GFYA 3KZPA 3GG0A 4LJ3A 4Y9MA 4F3HA 3GFZA 5MKGB 2R6OA 4Y8EA 3TLQA
chains in the Genus database with same CATH superfamily
4S3FA 5J5DA 4AIOA 2BASA 3AYTA 3KXQA 2CFFA 4B2DA 4JX4A 4ATLA 3M44A 3H2MA 3MCNA 3FA5A 3BQ5A 4UTMA 1XGDA 4Z1DA 4H7ZA 1KFLA 2GSEA 2ZX9A 1V0KA 5BXRA 3T4WA 3VFCA 4ADUA 2BVTA 1Q65A 2AQVA 1SFSA 3JVAA 3SN4A 4X22A 4JFVA 3IJ8A 5D03A 3KRZA 5AKQA 1RPXA 4JPGA 4LS1A 3DHFA 2WWCA 4XZ9A 2VWSA 3IVUA 5CPMA 2NT1A 3ZIZA 3WQOA 4AD3A 1OYCA 3LGGA 2PEVA 1E6ZA 2VOTA 3AHVA 4XSMA 3GR7A 3C3NA 1K1DA 1XXXA 1XIGA 1Z41A 4XTDA 1CB2A 4H83A 4AHPA 4ALDA 4IICA 4JY9A 4OKDA 4ZODA 4B4HA 1PBGA 1Y8BA 3U7VA 3MUIA 3L4XA 2ODOA 2R9RA 3UR8A 3SY5A 2WZTA 1E0VA 4JCMA 5G4WA 4DF1A 1MQQA 5D2WA 2VFDA 4F0MA 3T8QA 2HPMA 1FTXA 3B9OA 2HVMA 3L4ZA 2VD8A 2DZAA 2DSZA 3ITVA 4N2YA 4D6FA 1GOXA 1BXCA 1M9HA 4C6FA 5REQA 3OQ8A 5BZAA 2HK0A 1I2OA 5E93A 1U5VA 2H8ZA 1W3KA 2FVLA 3IAQA 3R89A 4JOMA 3QJAA 1TQXA 3P7YA 1XQLA 3A4XA 4PCTA 3MO4A 2QIWA 5FEWA 2JGYA 1WBJA 3UF9A 2CKRA 2EAWA 3W7NA 2J24A 5CLWA 3UR5A 5HMSA 4OBRA 5GNZA 3TSBA 4XKYA 1H5VA 3LM7A 5AY7A 1EPXA 4Q8MA 1EGMA 3Q58A 4PUMA 3R11A 4W5ZA 3CGTA 3WBEA 2WSPA 1SR9A 1WV2A 1E51A 4JTDA 2HISA 4PODA 3BCFA 5FL1A 1Z44A 1XYMA 3UR7A 3IARA 2QJHA 4S3BA 2WHMA 3NQ8A 3E12A 2KX9A 4HHLA 1OF6A 3QQWA 1B4KA 1G7UA 3EMQA 4RDVA 4RV8A 3B03A 3M0LA 4Q4PA 4C65A 4FP1A 1TR1A 3HPAA 4GBDA 1DWFM 1YADA 2Z4GA 1B54A 2OO0A 1UR0A 3EWBX 3KLLA 5FF0A 2VT0A 4UUIA 3GZ3A 4KCTA 3CYVA 5IFPA 2HJPA 3KLKA 1PYMA 3WQGA 5FOOA 2PGRA 1R3SA 3AZRA 5K2ZA 4NAEB 3THQA 2VEIA 2MANA 3ISIX 3RM9A 5CPLA 2RGLA 3JZEA 4CNTA 1E6RA 2XIBA 4LC8A 3SY8A 1WDPA 1HW6A 4A8NA 4PSPA 3V1PA 4IMDA 1SM9A 4PMYA 1W5QA 2ZE0A 1RY8A 4QQ3A 2QEZA 4H9YA 1B30A 1HZYA 3TZFA 1WZLA 1XIJA 3HU7A 4C1NB 2R91A 4MADA 1W3IA 3OIHA 1DKWA 2H8XA 3IJLA 4G8TA 1TVLA 3TFXA 1KLYA 3RUBL 5CKSA 4O0QA 2A0NA 4Z42C 3KUMA 1E71M 1YXCA 2P8CA 4O19A 2ZICA 1WYIA 4ZXLA 5I3FA 2FGZA 2QF7A 4DQWA 4I9TA 2VGFA 2GVLA 4BQ4A 5CJ5A 2WHLA 1IIHA 4K7VA 2EKGA 1VQTA 4IQDA 4H04A 1GOKA 1VLWA 3C0QA 2F6KA 2PMQA 3IANA 1S3HA 3DXIA 2YYTA 4QDWA 2OODA 4ZQMA 3A3WA 2ZZ3A 4IIEA 2PB1A 3PB0A 1GUVA 3FA4A 2XN2A 4EANA 1XS2A 4H7CA 3LEPA 4LBUA 4AXNA 1PKLA 1LRNA 2PWFA 2Q6ZA 4JXCA 4NRRA 5RUBA 3A9IA 5I09A 1LOLA 3CUHA 3TYZA 1Y0EA 4H9MA 3IIVA 4DM2A 1EBGA 5H8MA 3ABOA 3ONBA 4FOJA 5BCAA 5D4YA 3UG8A 4A8IA 1JI1A 1YTEA 3DGRA 3JW7A 2WK2A 2ATMA 4DBEA 2ABAA 3WYZA 3UETA 4K1GA 4QFUA 1W8SA 3HGJA 4H7VA 3BXWA 2VVNA 3L4YA 1PCKA 3VO0A 1XYAA 2MUCA 3ZWTA 5M03A 1NDWA 2PD5A 4MWAB 2GUUA 4FMVA 2JKAA 4DJDD 5AHIA 3AROA 2QJNA 3NXFA 3XIMA 1NP2A 1WXYA 2XUCA 3LY0A 1EKOA 3M43A 1XQKA 4KF1A 1L6WA 4RXFA 1ISZA 1MSSA 3S83A 2DZBA 1CGXA 1P43A 4AWUA 2IXUA 1EEXA 4QG9A 4U5KA 1QNVA 3T09A 3TYUA 1F2JA 4O54A 4Z2LA 3URBA 1R6WA 2ZDRA 4X63A 3UY7A 3AS3A 4Z1AA 2V2HA 3KTXA 1PL9A 2DQWA 4D1JA 3BMVA 2OX4A 1F3EA 5K7JA 4HN4A 1F8IA 3UXLA 4XAGA 2YIHA 1ZAJA 3GXMA 4NAEA 3VIMA 1XLGA 2PDIA 3MP4A 3W1QA 1Q6LA 3WNOA 1T8XA 2HZGA 2BHZA 5CGMA 5PTDA 2H3DA 2NWSA 8RUCA 2F8QA 3GVVA 3WLKX 3C86A 4DZAA 3HG5A 3RM8A 2WKJA 2GGHA 3MQTA 1AQFA 3EOLA 1JFHA 1ZJAA 2PDJA 3W29A 5KTLA 1X98A 2D22A 3URAA 3WJZA 1E55A 3EX4A 4IX2A 1K9EA 3B97A 2VVSA 3GNOA 4OQVA 1ZL1A 3T0DA 4M1RA 4V33A 2EQDA 2CETA 1FH8A 3P74A 3OU8A 3C56A 4C6CA 5D33A 1KGWA 4O1DA 2R8WA 3THUA 1H60A 2YFNA 3WK2A 3TN5A 4C1NA 1QR7A 3O9NA 3EA3A 1R7OA 3ITLA 4EE9A 4AHOA 1F6PA 3EWYA 2IKHA 3LCXA 3REQB 4MDOA 3M6YA 3W0KA 1ITQA 2QDHA 3NDYA 5EY5A 3U5UA 1Q6QA 3WL0A 3G1RA 3FDKA 1BRLB 1SO5A 3AS0A 4DM1A 3HFTA 1H7RA 2V81A 4H9TA 4ZOBA 3M0XA 2CERA 3KS5A 1JQVA 3CB3A 1RQBA 1ONXA 3PJUA 4FF5A 4TMCA 3V0TA 1NFGA 5FCZA 5C8BB 2V0TA 3O0KA 5ABEA 1PZ3A 2QS8A 1PAMA 4PRWA 4G2DA 4GABA 4ZQRA 4UB9A 4QLJA 3LB0A 2BVYA 5AZ1A 4NNAA 3BMWA 5I79A 4H6RA 1UBPC 2QMJA 3THAA 4IPNB 3R12A 3E49A 3EAUA 4L4OA 2VDGA 3WF0A 2BGSA 1Q85A 2G37A 3TWBA 2ZFAA 3ECQA 4QJ3B 4GYKA 4L1WA 1XSKA 4JZ5A 5DT5A 2RUSA 3IGSA 1KLZA 3CXOA 3RCYA 1MEWA 2C0AA 1GQKA 1FFRA 1TX2A 2BY3A 4ILSA 3CBWA 3W25A 4E4FA 1YQ2A 2ZUNA 3RFAA 3FW6A 4GXPA 4US5D 3WH6A 3LHTA 4MWAA 5D2YA 1W1PA 2Y85A 1W6TA 1ZAHA 2V9DA 3NAVA 1NM9A 2YL6A 3F4CA 1S2CA 3E96A 5EBUA 1GOIA 1JXJA 4DB7A 1ICSA 4ZXOA 2X7WA 1NP0A 4O10A 3ZO9A 1UUOA 1V3IA 2Z1VA 3GKAA 3CPRA 2YL9A 3QQ0A 4AEEA 3KDNA 2WBGA 3WEOA 2GFTA 3UNDA 1NWRA 4UCFA 4FXRA 5LIXX 1UP3A 1WUEA 1TG7A 3II1A 1EP1A 2D0HA 3C8NA 3DBNA 3TMLA 4ERGA 1UWSA 1KNWA 4MY1A 1V02E 1WAUA 1GYNA 1P0DA 4AX7A 8XIAA 2PLKA 4HGXA 2O56A 3SADA 3MMUA 1YLVA 1LORA 2WNWA 1UD8A 1HKIA 5BU9A 2RJGA 1UH3A 1DHKA 4ZENA 3HG3A 1HP5A 2DUAA 3VE7A 1E0WA 4A3YA 4RE0A 2VGGA 4LNYA 4WVXA 4WOQA 3WNMA 2G5WA 5A6BD 2FHBA 1UUQA 4GMEA 2ZA2A 1SUXA 1ZBWA 1WZKA 3QPZA 4DUVA 4AIBA 2EG6A 3IV8A 2WJEA 3UXDA 3NURA 4KW2A 4JKMA 3LLFA 1DWAM 3PZVA 1IT7A 3SGZA 2UWFA 4S2BA 2Y5EA 2HTMA 4N9EA 1DBTA 4HSHA 1NFBA 1Y5WA 3MVIA 3VNJA 3LCWA 1J0ZA 4R7OA 1W9PA 1QOQA 3REQA 3WK0A 1ZPTA 2PRHA 1TPWA 3KL5A 3UJSA 1ZBKA 2B4GA 2ACSA 1BRLA 4FLOA 1V3HA 1B0IA 2ZWZA 3RX4A 1HL2A 3A22A 3T2QA 2VURA 6XIAA 3TX9A 5M2FX 1CXKA 3APGA 2J9YA 1W1YA 1KKRA 1VBHA 4U3AA 3TV8A 4M81A 2Z2AA 4BR1A 3TZNA 4P5UA 2VQTA 4HOWA 3OYZA 4PMRA 4LAMA 1FQ0A 4MJ4A 5BWFA 4RZ6A 5KZEA 1EJTC 1WDQA 3GU2A 2YL8A 4H8VA 4GYPC 1YXDA 4XBKA 4A2RA 5KINA 4GZ7A 3G22A 3EKLA 2Z7GA 1A5LC 2QCFA 1FRBA 2C14A 3FSTA 3WQ4A 5DX7A 1VFTA 4W93A 2JBMA 2Z29A 1Y5XA 1NOWA 2P5NA 2XWDA 3FNDA 2ZUVA 4N0RA 3SCVA 4Z1CA 2A7PA 3I10A 1EO5A 3SRKA 4D6JA 3EKZA 3T55A 3ONCA 1ZAIA 1S5VA 4PFMA 3LXBA 2V5DA 3S6DA 5HUOA 3VGFA 1ZLPA 4AW7A 2DH2A 2GGGA 4BK9A 2FB3A 3SRHA 1J0YA 3IUDA 3STGA 2ACUA 3NWRA 4GH1A 3S5YA 4RDWA 4HKPA 1G0CA 1TO3A 3FJNA 3BWWA 5D30A 2GGJA 4FS9A 1H7XA 2YLAA 3WN6A 3EKGA 1J0JA 3LBOA 3QYQA 3HGSA 2VZTA 3W87A 2CHRA 4EK7A 1M41A 4X0NA 2E77A 3AIVA 1PDZA 5E6YA 4OE7A 2Y7GA 2W9MA 2F6UA 2XGIA 3HPZA 1E70M 2FPVA 2WMFA 1GVRA 3N04A 2P53A 5EYWA 2OSXA 2TODA 1LLZA 4BQ5A 2VELA 3O15A 2CWNA 1I9CB 2Y89A 3I3DA 2ISWA 4E8DA 2X0YA 1T96A 3RXZA 4QJ1A 4ONVA 1YPIA 3GFYA 5I2UA 1ONEA 4IIHA 3NEVA 4JGDA 4JTQA 3MO7A 3W26A 4B5TA 1GK8A 4BHYA 2V3EA 4EACA 4UR9A 1CW2A 3UW6A 3BUVA 4KETA 1FDZA 3MWCA 1TYGA 3GS6A 4M6QA 1WO2A 1H3GA 3K13A 1VFMA 1BVNP 3H2CA 1Y5VA 3WQEA 4NX0A 3LU2A 4WSKA 2HE5A 2VZVA 1IR1A 5AC6A 4UNKA 3GC4A 5G4HC 1KXTA 2E6YA 3JUGA 2FGLA 2FZ9A 2AQOA 4YLWA 1Q63A 3JS3A 2PWUA 2X1SA 3GAKA 4KEMA 2VC5A 4IX0A 1GZJA 3PWGA 1CB7B 2IKGA 2C79A 4RZ4A 4F40A 3VE9A 3PG9A 1VKFA 4RW3A 3TC6A 2ALRA 1H49A 3NFUA 5H1WA 1PEZA 1BVZA 2DGAA 1XD0A 2PP0A 2INEA 2Y70A 2EF9A 3P2VA 4IJCA 1VFOA 3CHVA 2X0SA 1R3QA 4JN6A 1U83A 5ABTA 4BI6A 1UKSA 2G3FA 2X1TA 4XZWA 4QRNA 3PS7A 1O60A 4H01A 1CLVA 2QUVA 1DWJM 2O7SA 1KGXA 2NV2A 4Z2IA 4H3DA 4JNYA 4O52A 5C6MA 4I9JA 4E5TA 1K6WA 3NGFA 2PDCA 1HX0A 2QW5A 2RHGA 2X0HA 2CZDA 4QCFA 3JU2A 1OFAA 7REQB 2VEKA 1TTQA 3B0VC 3NQ7A 1ZSXA 3NA8A 3KWXA 3VNIA 2Y5JA 3KVJA 3WH5A 1OX6A 3ITCA 3T40A 3W7LA 4I6VA 3UPBA 2WNNA 2PI6A 4LYQA 1KCXA 2V67A 3B8VA 2OVLA 4D6GA 4AMAA 3CTLA 3C0SA 2ACRA 4L6HA 2WJFA 4YWSA 3IGUA 4CCZA 1E5NA 1HF6A 1XIFA 3LPFA 1R38A 3EB3A 4ORIA 3RLGA 2XIMA 3CZ8A 4YIWA 3UWEA 3V5CA 4S2CA 2J88A 2XSAA 3AIBA 1XICA 4PUNA 2AKZA 4J40A 3QPEA 4LAKA 3AQUA 4IJBA 3MYOA 3MUAA 3K5XA 1YMYA 1TRIA 1POKA 3RG6A 5CBJA 3GH5A 4UR7A 4RXGA 1WQ5A 4O4VA 3KRUA 1UPMB 3WUBA 3W01A 4QQUA 1QU4A 5HWMA 3WDJA 5JXQA 4JBRA 2JF6A 3BSHA 4KGLA 1EH9A 3E2SA 4FR6A 1KRCC 5JBDA 2YW3A 1E6NA 3QV7A 4JEJA 1WB0A 3L5LA 4GCXA 5BRQA 5A6JA 4W8BA 2YZRA 2QZRA 3MPGA 2CHOA 1CENA 1YTKA 2YFOA 1UWUA 2OXNA 4M29A 1M68A 3QMTA 5ECUA 4N6FA 3ZS4A 2D69A 1CGTA 3O06A 4ZMGA 4HT3A 4JHMA 3CQHA 5LSMA 2Q8LA 2J7DA 3HPSA 1PTAA 1VBGA 1V4YA 4B3ZA 3GE7A 1MYRA 4DZ5A 1PPIA 3CT7A 1B31A 4LRTA 1QOPA 3W7CA 4IUGA 1F4AA 2CYGA 3LV5A 3GDRA 1B90A 1RVKA 5C7HA 2OMAA 2QVHA 4YHEA 3N2MA 2CLIA 1QUMA 3CMFA 4AVOA 3ARYA 5AOUA 3NQGA 3QKZA 3H7RA 4RE2A 1W3NA 3MV11 4L9YA 1ZBCA 5BOFA 5CC7A 4L9XA 3S2LA 4NQ1A 3T4CA 2E5CA 3VIGA 1CEOA 3UXAA 2CHNA 4JD4A 1JULA 3TJLA 3NQEA 3E9AA 5DMYA 3DKLA 3KP1A 3WLPA 3H23A 3I7RA 4P2VA 4QEHA 3THDA 1DJHA 1QI2A 3IVTA 1XFCA 4S3CA 4O14A 4IZGA 4AFYA 3GUGA 1NJJA 1FHVA 1SMDA 1KTNA 2P8BA 4KWSA 2PDQA 2GQ9A 4U31A 1VHNA 4MAVA 5A6LA 2NX1A 1FUYA 2D23A 2NUXA 3WLRA 1GQIA 1AD1A 5G1MA 5TD4A 4F8XA 4B5VA 7REQA 5LA0A 5HMDA 2OSWA 3WQVA 1HKKA 5ENLA 3VD9A 3PUOA 3UNTA 5EMUA 5D2XA 2WKGA 3BARA 3K2GA 2QUTA 1Q6CA 3OGSA 5C9ZA 2WM0A 5DY2A 4Q6JA 3UG3A 1OM0A 1I2NA 1AQ0A 1RBOB 3KDOA 3DX5A 4JTKA 1QNRA 2ZRUA 2XFRA 3WD1A 2V5BA 4QSHA 2W92A 3RPMA 3LCIA 1RLCL 5ABFB 2D0FA 2KZHA 1VR6A 4UOZA 2YX0A 4MWAE 2O9OA 2QAFA 1FWEC 1DWHM 2BGQA 2DQXA 3M16A 2VENA 5LGZA 1ZY9A 4M7SA 5A5WA 4DJDC 3NZGA 1M7JA 4FK9A 1EL3A 3MI6A 2C8NA 2CLMA 4WKHA 3G18A 1HKVA 1LL7A 3G8RA 2OKTA 4WSJA 2XGBA 2VC7A 3FKKA 1MXSA 1P6CA 1YNPA 5D8WA 3W07A 4JTLA 3FXYA 1FXQA 5CSSA 1TJPA 1WX0A 3GK0A 3S8HA 3BTNA 3KOWA 1E4MM 1YXYA 1VCFA 5CAKA 1TIWA 5CG7A 2QV5A 3LHYA 3NUKA 3F4NA 3SUSA 4D8LA 1RUSA 3PM6A 3I65A 4QJ5B 4TX9A 4A6GA 2X30A 1H7OA 3R8GA 4KCUA 4UZUA 2PE4A 4AISA 3O6DA 4KGJA 4PL2A 1OGSA 3F2CA 1DIKA 1L8PA 3LYEA 4AZ6A 4AXKA 4ZCWA 4BQ2A 3TJ4A 1JGMA 5ABGA 1SW0A 1MI3A 2HRWA 4MHBA 4WDWA 3BMXA 5CZTA 4D2JA 3GR4A 5XIMA 1X1OA 5HJXA 4EOUA 1GKQA 1CDGA 1OG0A 3CV6A 5HMFA 4GBUA 3ZQ9A 1ZCOA 1UA3A 4PCPA 3TOYA 2XGZA 3IJQA 2OELA 4V28A 4NXSA 1OT2A 4YNGA 1CLKA 2J77A 2DIJA 1XRFA 5EB8A 4E2DA 1QK2A 3WDRA 2Y7EA 3IIZA 3GXFA 1OY0A 3BV4A 1YPXA 4NI8A 5CZJA 3CO4A 5DBUA 3GVGA 3SN1A 5FSEC 2GWNA 2HNHA 3K4AA 1US2A 3WF2A 1HG3A 1JIBA 1R2SA 3NVDA 1P0NA 3OGRA 3LBMA 1A5AA 5F4WA 5D8ZA 5IDZA 3PPFA 1CLXA 4J4KA 3DC0A 4R9OA 3EOUA 7ODCA 3HQ1A 4MLRA 1EA0A 3N2BA 4XAPA 2ZOXA 3KZSA 4JN8A 3BAXA 3S2JA 5D9NA 1KRAC 3O0FA 4C6DA 4S3AA 4QLKA 1VYRA 3OW1A 5C71A 3VIPA 1AMYA 1EC9A 3GX9A 3VU2A 2YDQA 3B8SA 4QX4A 4F79A 3WQ5A 2XFFA 2PURA 2H90A 2Z6IA 2C7FA 2B0MA 1NF0A 3OJGA 2YBUA 1FWBC 1UPPA 4P8VA 4ZOCA 1PHWA 3TTYA 1IT8A 1WE5A 1OFOA 3BW4A 2PLJA 1EZ2A 3OHIA 2AMGA 3P62A 1JVNA 4ROQA 5ABFA 4HNTA 1XRVA 3QFEA 1TMLA 4B2DD 5AHMA 4IL0A 1TTIA 1P0EA 2A6LA 2J6XA 2FZBA 3SFWA 5D09A 3UU0A 4Q22A 2FJKA 2VRJA 2ZX7A 3CUGA 2IQDA 1LWHA 3WKZA 4LC6A 1IE7C 4H9XA 3KRSA 3F4DA 5E70A 1WAWA 5CPTA 2HBXA 3EYPA 3VUPA 3KFTA 1LM1A 5HINA 1B2YA 1ZCCA 1G4SA 1H62A 1UWTA 3T0BA 4EPEC 3CUJA 2J7HA 1LG2A 3TNOA 3KS6A 3LQGA 1GW9A 3QZEA 1EZWA 2E9MA 3WMCA 1BQCA 4HJWA 4M51A 1TV7A 2NQZA 3G0XA 1IGWA 4ZOEA 1IWBA 4HPJA 2VFGA 4JX5A 4V2XA 1YW1A 4RCXA 4J3WA 4KQNA 3M0KA 1GOWA 3G1SA 3W27A 1O95A 1NWSA 1UMLA 3CV7A 4JQ3A 3VMNA 3G0UA 3IEBA 1E0UA 2C71A 2H3BA 1E73M 4RNFA 2ZX6A 5D9PA 5A94A 2BXYA 3KWSA 4LRSA 4AIEA 1PKMA 4E6MA 1XLIA 4L61A 3W84A 4AD0A 3UERA 1MRAA 4N4QA 2ISSA 1GTEA 2V68A 4PMOA 3GYEA 3QR0A 4F48A 4M1BA 4MYXA 4NU7A 3PBGA 4CVUA 3IJ7A 3U2ZA 3J7HA 4FLSA 3B0XA 3MDWA 2O9PA 1UD2A 2FGBA 3UJRA 5H8PA 3C8FA 1EJRC 3FN9A 4S3KA 5U7SA 1ICPA 1S5WA 3L66A 4H8HA 3V7PA 2JFEX 3MSDA 4OGZA 3OVRA 1L2UA 1EP2A 1GG0A 4QAWA 1WNOA 1XPGA 3H4XA 3TTSA 3IUIA 1RBLA 2W6RA 3EX6A 2WBKA 2ZC8A 3GQYA 4HHPA 4I8DA 1OT1A 2BVDA 2GZXA 1I0DA 3BG5A 1B9ZA 1DQXA 2IMRA 3MS8A 4DNHA 2DVUA 2PDBA 1XG4A 5HAOA 3ABZA 1N82A 1CNVA 4Q4MA 2YXOA 4ACZB 2W62A 2DEPA 3SRDA 4GO8A 3UJFA 2UY2A 2WC7A 2Y6ZA 3MVTA 1EA9C 1R9XA 1KRMA 4ZEPA 3CL7A 3W4RA 3VNMA 2OLAA 3WFLA 3DHUA 3ZSSA 1AJ0A 5TAOA 2PTWA 4M3PA 3VKDA 1PX4A 3N4AA 3JZUA 4NNCA 4INFA 1BKHA 1HT6A 4EPDC 4HMEA 1LROA 2RKXA 3KOZA 1YBQB 1F05A 2PPGA 3WNLA 3PTQA 1J01A 4WY0F 1TX0A 3BG3A 4MFEA 3P84A 4S23A 1UD3A 4PMUA 1OCNA 4Y9AA 1ITXA 1BTMA 4C7DA 2J7GA 3W7MA 3E0WA 3FAWA 1LJYA 1I60A 5FF3A 2EPKX 3IV3A 3RCMA 4CQDA 5E9XA 5BNKA 1GWJA 3PZUA 1R46A 1ADDA 2PDWA 2WSQA 1SYTA 2GJPA 2HQAA 2OU4A 3SY1A 3RR4A 3HJZA 3S6TA 4GC3A 1ZJIA 1V5XA 2ZZ4A 3PBWA 3WD3A 3RLHA 4A22A 1MFUA 1VJSA 4FOUA 3AI0A 2VUNA 1W1TA 5E0KA 1C9DA 2XINA 1HN1A 2J9XA 2VCCA 3GHTA 4CQBA 2V5JA 4Y9MA 3TQKA 4HSNA 2INFA 2OWWA 4K38A 4KESA 1KC7A 1J9YA 4HU8A 2QNEA 3HG4A 2CLHA 5CJNA 5FEZA 1EDTA 2OTDA 3P5YA 4DUOA 1IXNA 4IPIA 3EPMA 5CGTA 4JYFA 3M5VA 1W3HA 3VDCA 2PRMA 4P8XA 3NZQA 3NEHA 2CEQA 1CGYA 1ZRQA 2ZX5A 3NOYA 4PZVA 4L4LA 1F8MA 1SR0A 4N6EA 3PPGA 2WMGA 5I23A 4RK8A 1TWDA 3FSUA 3WX7A 3DH7A 3KBJA 3QH2A 2TSYA 4IGHA 1ZNNA 4S1FA 4MJ2A 4Q33A 2ESCA 3M5ZA 5E09A 1U1JA 1SSDA 1NIUA 1TV4A 2WNQA 3S9IA 1UB3A 4N02A 1KM1A 4GZEA 1IEIA 3K8KA 5D2TA 3VIFA 3CMGA 1KBLA 1A4LA 4W9TA 4JTFA 4WSHA 3HB9A 3MI2A 1RQHA 2IS7A 3AAMA 4EP8C 4KWOA 4JAWA 5HXMA 2DT3A 4QITA 4GINA 1ZJHA 4FXJA 5EMLA 2GDQA 4AZ7A 3MW7A 3GXDA 4J3ZA 1CGUA 3SIMA 3LPGA 2NQHA 3P81A 2XU2A 2C18A 4ACZA 4Y90A 4LV9A 4DXXA 1OGGA 1V93A 4LNCA 3TN4A 1O94A 3WMBA 3WNPA 4YTTA 5CC6A 3SCRA 4LB3A 2Z28A 3DN5A 2BG5A 3SUTA 2X1IA 5K3VA 3AFBA 2GOUA 2GDVA 3M0JA 1PX8A 4MJZA 4GJIA 3T81A 3VDGA 3MJMA 3FVMA 1VEOA 3ARTA 3BAYA 4CCEA 4GI6A 3ZOAA 1FFQA 1PIIA 1YBQA 3BSGA 2WMKA 3GY1A 3UJEA 4R9XA 3VMOA 4XVEA 4H2HA 1XHGA 3VX0A 3EX1A 4DPQA 2Z1SA 1U1HA 3QTPA 1IXOA 4R34A 4GXWA 1EP3A 1X6NA 1RJRA 3CNYA 1UQZA 3ID7A 5DO8A 1XCWA 3DFHA 4X0VA 4MPQA 3W2JA 3APTA 2B31A 5A2AA 1KQZA 2VCBA 4NXKA 4D6CA 1FKWA 1X7FA 1X1ZA 5F1UA 1W31A 1OABA 1SJAA 3EOOA 1P6BA 3LZ5A 3O16A 3SCOA 1XYLA 3VNDA 4LUJA 4Q8VA 1GEQA 5CAHA 4QG8A 3GW0A 5DMLA 4F3HA 1TV2A 4TQTA 3S3GA 2XSXA 2VR5A 3VOHA 2XIJA 1Q3NA 2GOKA 4W89A 1ISWA 3FS2A 1DVJA 5MF5A 4HPHA 1PTGA 4IWWA 2DZPA 5JMUA 3DFTA 2WVVB 4G9PA 1XYZA 1P6WA 5DT7A 1LG1A 2JF7A 1C8QA 4J3VA 1K03A 1XIBA 2WZIA 3LLDA 4NYUA 1Z32X 1GQNA 4M6PA 1W1VA 1A5UA 4LPCA 4BKNA 3RO6A 1RP9A 4UOQA 5E0CA 4YHGA 4GVHA 3HQOA 1Q5MA 2QJIA 2JALA 3W7HA 3SCSA 1BSIA 3AMGA 3WBYA 3ARQA 1XIMA 3A47A 4UTIA 6CGTA 4O15A 1GVQA 1A5SA 4G1NA 3G6MA 2YKKA 3STFA 3CJPA 3CT2A 2JK2A 4JTSA 2ATSA 1CXLA 1TCDA 4PB5A 5JBFA 5DCBA 4JTTA 4GFIA 3UEQA 3PBMA 4B91A 1DXIA 2NZLA 5BROA 3PAJA 2BX7A 4J27A 3B0YA 2CWXA 4Z2HA 3ZVIA 3E5PA 4PEKA 5A8MA 2E0PA 1GJUA 4RNHA 3PUEA 1E6SM 2GQAA 1V79A 1X1NA 1WUFA 1RAKA 3SCPA 3N4EA 3SCUA 3R8HA 1A5BA 3CWHA 4MNMA 3N12A 1FHDA 2PWHA 4QAIA 3AUOA 3S42A 3V4BA 1YYAA 3G24A 2FZ8A 3NG3A 1TE6A 3WSUA 2OWCA 2YSWA 3DCPA 2VGBA 2RJHA 3MB9A 1PWLA 3M0HA 1G94A 4AF0B 4Q7NA 2V5LA 2DP3A 3IGXA 1N8IA 4H41A 1R5YA 3O2LA 2QCMA 4JFTA 1MUMA 5GJMA 5MKGB 3AJXA 1RP8A 2Y8UA 2CLKA 5FIPA 5B80A 1J18A 5CPSA 4Y7EA 2O0TA 4IXXA 1JPMA 5E0FA 1W1ZA 4AZIA 4DZIA 4E2BA 3TP4A 3ITTA 4H8UA 3WUEA 4M8UA 1OINA 1T40A 3LNPA 2D3LA 3S1WA 3VKBA 3S5OA 1ZBVA 3DYMA 1VPQA 5CEWA 3V5FA 1G5AA 2ON3A 1TJ1A 4QE4A 4HZMA 6ENLA 3Q37A 3HFYA 5M17A 4G56A 1LCOA 1JZ5A 2P3EA 2FPTA 3TIMA 2V8ZA 5IHSA 3TROA 4NG3A 4HPNA 3ZJ7A 3CPGA 3V3WA 3T0CA 3SCWA 5LA2A 3K8MA 3AWNA 3W74A 2ZQ0A 1BXNA 3H7VA 1JCLA 4XO7A 1NEYA 4V15A 4M19A 5BMXA 2PCQA 5JH2A 5M5DA 1FDYA 2D24A 5DRCA 1LOSA 4RL3A 1JZ6A 3TU9A 1EGZA 1FH9A 4MSSA 4A3UA 2ZUMA 4F0HA 1LLWA 2IKJA 3SFKA 4A3QA 5G5IA 4FALA 1Y65A 4K6AA 4ICCX 2CIPA 4UTTA 4AZGA 1X39A 2YA2A 2VFFA 1SJDA 5DRIA 3H26A 1HGYA 3BCDA 3QV9A 1FXPA 2C15A 2WVVA 3GHSA 2PCEA 2BMBA 3TFCA 2OWXA 1OK4A 5HNNA 3TEVA 4LS2A 3PVFA 3PF3A 3CEUA 1JF6A 2O4QA 3OIXA 5A69A 3SZ8A 1FH7A 1O5QA 1Z6KA 1V3KA 1XDJA 2P50A 3AICA 2BGNE 3L12A 5XIAA 2IPFA 2ZVIA 5CC5A 5A8PA 5F2LA 3PPHA 5F2IA 4RE4A 2WB5A 4WXZA 3VMPA 3N6QA 2QKFA 1S5NA 1NU5A 4J2PA 3OODA 1H41A 2CNCA 2Q02A 5FACA 3D46A 2WVSA 3W70A 1I1XA 3HURA 4NZJA 3WQPA 1ITCA 1RJQA 3PJXA 2NLIA 3LSBA 3LI1A 3N13A 4QROA 4S39A 2EGZA 1EWEA 2QUNA 4C6MA 1F76A 3BLIA 3EOSA 1FY6A 2E4TA 3R0DA 1NF7A 4JL1A 1SZEA 4QIUA 4AH7A 1H4PA 1HIZA 1DOSA 3M41A 3PSVA 3QY8A 4O1FA 4XO6A 1CXIA 3LENA 4N42A 5EL1A 2HWGA 3V36A 3QC0A 3V75A 1EJVC 4AU0A 2OEJA 4PMDA 1E0TA 3TONA 1JGIA 3KEHA 4A8LA 3B4UA 5IRPA 2NSOA 4JDYA 2ZKMX 5LNSA 1UD4A 2Y7DA 5MKGA 3KAOA 1B5TA 4GI4A 5EA9A 1NH6A 3LSCA 1VPXA 3RX3A 3KVLA 1SO3A 2P76A 3PTDA 2CESA 3W2UA 4S38A 4WZHA 5CBBA 1SZGA 3OEXA 4MGGA 4ZO7A 2VMFA 4GZIA 2FQIA 4MUPA 4UTJA 4DLMA 3G77A 2YCLB 3TUUA 1A53A 1TWZA 1IF2A 3BDKA 1EIBA 1BFNA 1AJ2A 3G1XA 3UFYA 4O50A 2J8GA 3NL5A 3QTGA 3S1XA 4JDBA 4KWUA 1PIGA 2I9UA 2FDSA 1QASA 1XRTA 1XH1A 4IGMA 3WBWA 5CSYA 4KWVA 5BXPA 2VOMA 3EWDA 1KXVA 3Q65A 4C1KA 1MMFA 1V8EA 3R25A 5AYIA 3OB8A 4R7WA 2C1IA 1KFKA 2O4MA 4CQCA 3H8AA 5BXTA 1KBIA 5G4EA 4BZYA 4NAFB 4JICA 1P1MA 6TIMA 1ZQ5A 3FX4A 2J8TA 1FHUA 4HTBA 1JDAA 3OQEA 1RD6A 2BY0A 4NZ1A 4IMEA 5FJPA 4JL2A 1UC5A 3MHFA 3FVDA 4LCRA 3MBDA 5DXXA 3T9PA 3F5LA 2DSUA 1XH2A 1VBRA 4WDTA 1E1CB 3COTA 3ARVA 3URNA 4DEFA 1O68A 1NQKA 4LGXA 3PUDA 3VCCA 3UWZA 3DI0A 3ZLGA 2FFCA 3T42A 1FDJA 4L9ZA 4KRTA 1QXLA 4EAYA 1BD0A 2PBGA 1AW1A 4M80A 4XK2A 2WYSA 1U33A 4IMGA 4A4AA 3BQ6A 1WKDA 4M7TA 3OVPA 3GR8A 2J7BA 2MNRA 1BPLB 2WMIB 4I7VA 4LEQA 2D1ZA 1EDQA 2V30A 2Z7KA 1MDRA 3GVRA 4ICNA 3GG0A 3EXTA 1CPUA 2AGTA 2B7QA 3TC7A 4PBFA 3DKJA 4UQBA 1QO2A 3WLJA 4YXGA 3L9CA 2ZADA 2D73A 3KL0A 3E0IA 2HROA 3ARZA 3U2CA 4LCSA 4DJED 1UOZA 1ZUAX 1G4TA 1PS9A 3M7SA 4NZ3A 2X2YA 4BEUA 3CHFA 2F2KA 4O16A 2AL1A 3VIJA 3BOXA 3GUWA 1UKPA 5JQ9A 3KL3A 2VEFA 4BJHA 3AHXA 5G2IA 3A21A 2OT0A 4M6VA 3W1XA 1TRDA 4PMJA 3STEA 3W7OA 3CQJA 4H9VA 1OC6A 1HNYA 4B9YA 3CPUA 3SM0A 1W3TA 1C7SA 1HO1A 2YJQA 4LVBA 4NJJA 1DXEA 1UZDA 5M3WA 2YCLA 3BH4A 2PGWA 2YL5A 4HZ7A 3UXIA 3PZTA 4X9SA 4GQQA 4DO7A 3W1NA 1K7FA 2I56A 1QW9A 1W9VA 3GKFA 5KSWA 3WJSA 1VP5A 4N9CA 1JF5A 1F6YA 4DVOA 4AYSA 1OWQA 3JRKA 3U9IA 5HUPA 2QCNA 5EMJA 1UZHA 4K36A 1B4EA 3SSZA 3N9RA 1JRCA 4IL2A 3OVGA 2C13A 3MZ2A 3WH7A 1UWIA 2ISDA 1MXDA 3W75A 2I14A 2PODA 2BOEX 1R3RA 2ZCGA 3IK2A 1YRRA 3EGJA 1SMAA 3VDHA 3LV6A 3QKEA 4NX5A 3E02A 4AZ5A 4NAFA 4KEUA 1R2TA 3IRSA 3ME3A 5I6SA 4PTVA 3QMSA 4E3VA 4DLFA 3WENA 1I2QA 3GB6A 5I7GA 1V03A 4A21A 5BRBA 2PC4A 3WUGA 3SIZA 1E40A 2ZZ5A 1VH7A 1XCFA 2FZDA 5DANA 1QATA 2YA0A 1JG9A 6PTDA 3O8AA 3VA8A 5LA1A 3L5AA 4PUWA 2R1MA 5DELA 3VGHA 3IS4A 1E1CA 3MTWA 3QYSA 4AWEA 4JIRA 4K1WA 1E9YB 3KE0A 4AZBA 4GY1A 1I75A 1UA7A 3MCOA 1W5OA 3PJTA 2YBTA 3VC6A 2Q71A 4UQAA 1NAL1 1UIPA 4FNTA 5DF0A 4JIHA 4TV5A 4F2BA 1NY1A 3ZJ6A 4PUUA 2DUZA 3ZFHA 3VIOA 4J35A 4LVAA 4ZGYA 4G5DA 1ZTVA 4QBXA 4ML4A 4OU1A 2EG7A 2WMIA 1DTNA 3MBFA 1OFQA 3LDVA 4O12A 3W7GA 4UTKA 3N6HA 3A5VA 2PC8A 1JYWA 4BI7A 3NXLA 3VC5A 2ZA3A 2DU2A 4YU1A 2GVJA 1GNXA 3DC8A 3LMZA 1A50A 3EXSA 5EKYA 3RMJA 2Z1WA 1EGVA 2O92A 4AD4A 5G1YA 1A4MA 4PA8A 3WDHA 3KCLA 9CGTA 4IIBA 3TYBA 1KA9F 3KBVA 4WLCA 3OZYA 5D9OA 4AX6A 3SI9A 3WLQA 3GTFA 1V02A 1JRBA 3SAZA 1JDFA 2TRSA 2A2IA 3HIJA 2J7CA 1BWVA 1G7VA 1UQYA 1TVNA 4ROPA 3UZJA 2QDGA 5HK4A 3AXMA 3HZ3A 2IXVA 4BWLA 1GVFA 1Z89A 4DJDA 4LX4A 3W85A 3KW3A 5I3GA 3A3XA 5FJUA 3PZMA 1GVEA 3AIRA 3APYA 1ME9A 1TZ9A 3UWWA 4D6EA 4PN2A 4B5XA 3H2NA 4HYRA 3QM3A 1Q2RA 1XLKA 6REQB 5A2CA 1HVQA 1NWTA 1TSIA 2XYLA 1E56A 2OT1A 4XG1A 3NL3A 4F0LA 2FTYA 3VD3A 3GTNA 1YX1A 4ZQOA 3WNNA 4QEEA 2QULA 2VX7A 1B3WA 3C5QA 2V63A 1KB3A 1O1ZA 4LYKA 4IMCA 3IVSA 4DO5A 4WQ6A 1H1YA 4K7YA 4CKQA 1JNEA 4NHVA 5LKYA 1VPYA 1AZ2A 3H2OA 4NP7A 1OCQA 1VEMA 3VZXA 1A47A 4Z1YA 1R47A 1FBAA 2E9LA 1J4EA 4C7GA 3WK3A 5F2GA 1FWDC 3NSXA 4J3UA 2PDXA 4H19A 1T6MA 3LERA 3R6IA 4GGBA 3VOCA 3AC0A 1AZ1A 2DFAA 3MWAA 2V38A 4UMCA 2HV5A 5K9DA 3A24A 1JNDA 2E5BA 1P5BA 3PZGA 1BLIA 4DJFA 4ZA0A 4F9JA 1UR4A 3NO1A 1UCWA 3OP2A 2E6FA 2TYSA 2G4JA 4W8AA 4P61A 1F3WA 1U1UA 4CQAA 3NQFA 5C9XA 4EKJA 2Y5SA 3VPLA 4GIAA 2YBVA 2VTFA 3TYEA 3FKRA 4AY8A 4MAZA 4WGXA 1OADA 5LIUX 5HR6A 3W37A 3D6NA 3HM7A 1KXQA 3S0CA 1I4NA 3GW3A 4C1LA 3H4WA 3GDKA 4ACYA 4HNLA 1VGAA 3DYPA 5C55A 2ZTKA 2B7NA 4XKMA 1PVNA 3CL8A 2P0OA 3N29A 2BHUA 2GDUA 1I6NA 3TJXA 3P60A 5LIWX 1ICQA 2VX5A 4Q8OA 1OD8A 1NFPA 1TE1A 4LYPA 3W7DA 3CB8A 1JCYA 4HQVA 3O6YX 4AG0A 3P80A 4O8RA 3P0XA 3AHYA 3IUHA 3BZJA 3R1ZA 3ERPA 1JAKA 3ATZA 3ANUA 3UQNA 2BODX 4KWWA 1NOFA 1TPC1 4D9PA 1SW7A 1HL9A 3B8TA 1XD1A 4EPKA 1W37A 4JHOA 3P3BA 1WKEA 2VX6A 3CC1A 2ZIDA 3ZYZA 4ZVJA 3NJ3A 3NZPA 1XIIA 2IKIA 3A4JA 3CLMA 2PBOA 4RJEA 5HNUA 1K6AA 3UJ2A 4JKLA 5I3JA 3DG6A 4NJIA 5A3HA 3EDEA 4JS3A 1F6KA 4I6KA 4OFCA 4PTWA 5EFFA 5L9FA 2VKZG 5LYRA 5GJNA 3PANA 2JEQA 1AH4A 4ZQPA 2PF8A 2CZEA 2XDFA 3V16A 2ZUUA 4CD8A 3AHZA 6REQA 4JY8A 3BW2A 2PS2A 1TUXA 2GVYA 1YDYA 1OK6A 2BXZA 3ABXA 2PDLA 3H54A 1OX4B 3CQIA 3HOJA 2Q3OA 1EUAA 2FTWA 2FMNA 1N8FA 4LF1A 3IWPA 1OD0A 1JZ3A 4MPKA 5C54A 3SGGA 1DJXA 3PBVA 5HULA 2J27A 2E8YA 1H09A 4MB1A 4TVUA 3DHDA 1V0MA 3KBNA 3DOPA 3ITOA 3VD4A 4GG9A 3WIJA 3ENLA 4YL2A 3USBA 1DQWA 2XZ9A 4K37A 3UD6A 1AA1B 3WD4A 4O18A 1AL7A 3CAWA 4IFKB 2YCJA 4LVGA 3W2NA 3NQAA 1UJPA 2HCVA 3G5EA 3QZAA 3WNKA 3LRLA 5BOOA 2VUYA 2O7QA 4UXDA 1GT8A 1A49A 1G6CA 2RFGA 4H9ZA 5DMMA 5HPOA 3PC0A 4Q4OA 2AMXA 2E6DA 2PDNA 1A0EA 3WQWA 1VFSA 5FF7A 3TVAA 4GIRA 1G4PA 1JI2A 1KD0A 3NGJA 3R2GA 4TIMA 2YYUA 2ZZ1A 1G01A 4BF7A 2V6AA 1BQGA 1VFHA 1E6PA 4HMCA 3LX9A 2AL2B 4XZNX 4NT0A 3S6OA 2EPLX 1BF6A 3BLOA 2W66A 3AU2A 4PB3A 4Z0SA 4N4PA 1RPKA 4UTFA 3PWIA 4XD6A 1GORA 4ZO6A 3BC9A 3GFZA 2P0IA 4KFPA 1XG3A 5U4NA 5F4XA 2AQWA 3I7QA 2G97A 1X97A 1S39A 3LD5A 5HNRA 1S2WA 2L5HA 4UNLA 1XGEA 3S9ZA 2YW4A 4L6OA 2W5FA 3EWXA 4TV6A 4Q4KA 4FAMA 3QHNA 1MQRA 1O6IA 4FNSA 1JUBA 2J75A 1XRSA 3RO8A 2QYGA 3UYCA 3UP8A 4L4PA 4LVFA 4U33A 3SB0A 4ZTYA 3OO2A 5HPCA 1E3XA 1GZ1A 1R2RA 4IQJA 3AIWA 5AVNA 1SJCA 3ZWSA 2BY2A 2OX1A 1ZHAA 3C3UA 4L6DA 4X60A 2G3NA 1YNYA 2PLMA 3CHCA 1AW2A 3DESA 2EPNA 3U4FA 1TTJA 1NSJA 4HSOA 5CSUA 2QUMA 3F2BA 2GJXB 1QJWA 2CC0A 4UWMA 5M1TA 1LDCA 4LBRA 4GHRA 1QT1A 2PF0A 2RGMA 2VEMA 4ZQCA 1HJVA 4S3GA 4XD5A 1E43A 2QV4A 1OZQA 4PRRA 1G9HA 4MKSA 1KTCA 2C0HA 3ANVA 1C8VA 4KIRA 1UW9A 2TPSA 1HL8A 2PDMA 5D04C 3GNXA 2ZXQA 1J8VA 3W7PA 5FJRA 2DZXA 3VOJA 1OX4A 2E40A 4AUBA 4GZJA 1CX9A 3BLDA 3M9YA 4UBPC 3SSJA 4LOCA 4MLJA 3ZSTA 1ENUA 1LBLA 3Q45A 1E3ZA 1ISXA 1K7XA 4B5UA 2WCAA 4US6A 1VHCA 1K4GA 1C8XA 1I2RA 1OBAA 4IISA 3ZJ8A 5D9MA 3VGGA 4IFKA 1VRXA 1XP3A 3M0YA 1H51A 2X16A 2V5CA 4NRSA 1JDEA 5CH9A 4YN5A 3P82A 4U5IA 1PIFA 3A6OA 2QPSA 1E5JA 1F61A 5H8UA 3GXIA 3HN3A 3L2MA 1DIOA 3MHUA 2NSXA 1QNOA 3M7WA 4B15A 3TCEA 5A8GA 2A3CA 3KCOA 4FXSA 1FWTA 3N3MA 5AC7A 5KMYA 2PP1A 4GVIA 5AC4A 2G96A 4E0CA 3EA1A 3QSRA 3NOEA 1XR2A 1LT8A 2EKCA 5FJJA 3MY9A 1RZMA 3W3OA 2AL2A 4P7RA 1J6PA 4HCLA 1IWAA 1KWGA 3OLIA 1U30A 3BGGA 1BYDA 2A6NA 3BPWA 1XBZA 4LXFA 2J66A 2QCCA 3WUFA 4NASA 2QPXA 5GNYA 3VNLA 1NELA 5HQLA 1XM3A 2RAGA 2UZ9A 4DBSA 4GNVA 1F5ZA 3W1TA 3CIXA 3OYXA 3OOQA 4L7ZA 3E2QA 3NQBA 4JFUA 3U0HA 3QW4B 1QDSA 3HA1A 1GW1A 1OB0A 4MZYA 3ZVHB 3MKCA 4O28A 2GUYA 2ZUWA 5F4SA 2E8ZA 4C6EA 4NJHA 2NQJA 2Z25A 4MY8A 2OZ0A 4FNUA 4MB5A 4CUCA 4R7JA 1XYFA 3HGRA 2GK1B 7ENLA 4OV9A 3KOXA 1SJBA 2FVKA 4LY4A 1R9ZA 3VINA 1JL8A 4NZCA 4G1KA 3PG8A 4J3TA 3GG1A 1YKWA 4L1XA 3K4DA 4H2CA 4MNJA 1JPDX 3R0KA 4YYCA 4HHHA 1MEHA 3BOFA 3AO0A 3DDMA 3S5SA 3T05A 4YMZA 1WXJA 4DJEC 1S38A 3TXZA 3C4UA 2JKPA 4UQCA 3RPDA 2XH4A 1Z3NA 1R9YA 2EPMX 4K39A 2GJXA 3AS2A 4A35A 1L0PA 4NY2A 4HZ8A 5DFAA 5K9XA 4PUEA 4IJRA 4CD6A 4D6HA 4MTVA 4MB3A 4IIGA 2HVOA 1D3CA 3K46A 5B7YA 4WXYA 1ME7A 1NQ6A 1Z9AA 2QLYA 3NDOA 2PDGA 4TUFA 3R13A 1PB0A 3ABQA 1XWYA 2ANUA 4UFIA 3SUUA 5K4XA 2X05A 3KBMA 4PSRA 1M53A 4IPPA 4XQ6A 4EF9A 2ZWYA 1PHQA 3LHZA 4H9UA 2ISFA 1U22A 3UVAA 3E38A 3VILA 1QK0A 3E5BA 1L6YA 1TMQA 2Z00A 4XBJA 1ZJBA 4KH2A 5AYYA 1V6YA 3FJ6A 2A3HA 2LLEA 2BBFA 3AIUA 1TKKA 3SW6A 3EDDA 1QRQA 3M0MA 3BANA 4AZCB 2DY3A 5A6AA 3NNTA 1TTPA 4EXAA 5A6MA 5IHRA 4XAYA 7CGTA 3N19B 1BHGA 1P4CA 3P93A 1O1HA 5IM51 3I68A 2Z1BA 1Q6OA 3TA6A 5CSRA 1OHLA 4Q8PA 3L2IA 4UFHA 1K7EA 4FIQA 1BAGA 3S5ZA 1MZRA 4PUKA 4O1CA 3BJTA 4FSAA 4K8EA 1J96A 2G95A 3CUZA 4M82A 3VIKA 2GPTA 3C2OA 3NIYA 4ZZ9A 1UWAA 1TREA 4JTCA 5HMEA 1YHTA 2ZRVA 5AC8A 2ZZ7A 1GOQA 2HS6A 3ITXA 3KBWA 5AYBA 4LUSB 3W72A 1QPRA 3UG4A 3FHAA 1OF8A 1JD7A 2YOCA 2YCEA 2J7EA 3KOYA 4NIRA 2WMJA 3BCJA 1JCNA 3TR2A 5E1QA 3CO8A 5G1TA 4PB4A 4POCA 2X1RA 3C2EA 4RPQA 2VQUA 4JTGA 4KFOA 5BU6A 3GDLA 4OJYA 4MDPA 1H63A 2OB3A 1TV8A 2YA1A 1KV5A 4J5NA 1KBJA 4BEQA 7TIMA 1S2UA 2OQHA 2A21A 1KWKA 4UFKA 4W86A 3BV7A 3ZJKA 1IIGA 1HJSA 2X8RA 4LVDA 1TCMA 1EPVA 5FEPA 4EPBC 4V1YA 3W82A 3ZVHA 2BXVA 1DL3A 3V5OA 3LHUA 4IQLA 3CZJA 5TF0A 3MSYA 4I3GA 1KV8A 5H2ZA 3EEGA 3AMLA 2GK1A 4Y9PA 3LNMA 4KKXA 3TKFA 2QJGA 1CTNA 4E4PA 2W63A 1H11A 4B5NA 4ZBCA 2WCSA 2OSYA 3K4WA 4EAMA 4C6IA 4S3JA 5HJLA 1LYXA 4D6DA 2OGYA 3BAWA 3M5XA 2C16A 3OTRA 3TYCA 4JTEA 4I7UA 1W9UA 1KR0A 4GX9A 4I7WA 1QHZA 2YCIX 3UVIA 2WZMA 1TJ0A 4OVXA 3WL1A 3RGTA 3W73A 1WDWA 2EG8A 2P1FA 3M07A 2VFEA 1M04A 4GC4A 2BP1A 1E6XM 3HV9A 4U4MA 2DT2A 1WP6A 1E15A 1KXHA 2B7OA 4AEFA 4HCDA 3CQ0A 1YDOA 3I4KA 1Y7VA 4GVGA 4GCAA 3TN3A 3DFSA 2E1DA 1WDSA 3BVJA 3AWOA 1ML1A 4JEQA 4U10A 3S2NA 1WKYA 1UROA 1QNPA 4GQBA 1FCUA 3GU1A 2G8ZA 4RUBA 1HKJA 1KCKA 2PDYA 4G6CA 4AZCA 3HMJG 2QCHA 1MNSA 1HQTA 1CGWA 3ZMRA 1SU5A 2XJ7A 3SRFA 1KTBA 3FJ4A 1MXGA 3GNNA 4BA0A 1S1PA 5FF4A 1XCXA 1K8ZA 4MM1A 2OZ3A 2HK1A 1RVGA 4UMBA 3AMDA 5HWNA 4TMBA 2VEPA 4FF7A 1UMYA 1DTUA 4GA8A 3UPMA 1BWLA 3RIKA 3G1DA 1A3HA 1G67A 1J5TA 1KM2A 3W7RA 3P5ZA 2RDWA 3GXTA 3POCA 3NSNA 3ZR4A 1XKYA 3GLCA 2DZWA 4LT9A 1JD9A 3G8EA 2NUYA 5C70A 2XFWA 2OPJA 3W6MA 1G1YA 2DIKA 1Z42A 1AK5A 4LUSA 4GH3A 7A3HA 1QI4A 2R94A 1YEYA 3BK0A 1VLIA 4J2MA 4UIOA 3W6YA 4AD5A 4F0KA 4FA3A 5HQMA 3R0UA 1T5AA 1V3MA 1QAPA 1J2WA 2C1GA 3HQNA 1TPB1 2FZNA 5C5YA 2A3EA 2FMOA 2CITA 1FWIC 3GU9A 3BLFA 4XZBA 4JHZA 1E4NA 1R3WA 3WD0A 3RU6A 1C3FA 3ZM8A 2YGYA 1AG1O 1VF8A 3NTYA 4JYDA 4OOZA 5KZMA 4GPNA 1C90A 1N2VA 4XKYB 4PC8A 4LV4A 1P0KA 2PSNA 4AVFA 5CCZA 3QQ1A 4GFSA 3RMEA 3TNBA 1UUMA 2QVNA 2OOFA 1UR1A 3O05A 3U5YA 3FIGA 5CPOA 5MHBA 2CCRA 2PD9A 3O3RA 1NVMA 1S5MA 4F2UA 3RX2A 3N1AA 5I0DA 4EXBA 5LNWA 4GISA 1CI1A 1JPHA 5IBXA 2EO7A 5LIYX 4DYJA 2WWDA 3EWCA 1RBAA 4G7FA 4B5SA 4EWND 3CWOX 3HMCA 4IHCA 1O7AA 4G7EB 4KIEA 4A2SA 5JBEA 4EVZA 3GHRA 3PBUA 1N8WA 2BSLA 2IW0A 2XIOA 3B8WA 4GO9A 5I5RA 3K1GA 4HU4A 4CCDA 3N4FA 1Q8JA 3PAOA 4GGHA 1K70A 1KKOA 4LW7A 3AYSA 3UGRA 1K8YA 4M6UA 3GBEA 1DIEA 4HJFA 3F5JA 4J9JA 3GBDA 4TU1A 4LALA 3TQVA 3KHJA 4XV0A 5EPDA 3WLIA 3PUGA 3LI0A 3MCMA 3E0VA 4QLLA 1LOQA 1XLAA 1AD4A 2FYMA 1EBHA 3BSMA 4IT1A 4YVVA 4QS5A 3PTMA 1A3XA 4CGTA 3GXPA 3QMRA 1FWRA 3ZLHA 4O17A 2ZX8A 1BGGA 3W7KA 1OVDA 3LZ3A 3N15A 2FH6A 1O5XA 5A6SA 3QZ6A 3ES7A 3M6DA 4L65A 3VDAA 3U57A 3PFRA 1SSGA 1DWIM 2P88A 1A80A 2BLEA 5A8OA 1B57A 4JIQA 1VEPA 3TWAA 1UR3M 3W28A 4LFYA 3GC2A 4JN7A 4IIFA 1UG6A 3KCJA 4XZMX 3VKCA 2J74A 5EU9A 2V2CA 3CUIA 3OG2A 4GD0A 4YJ5A 4GE8A 3ZT5A 4OBTA 2EPOA 3GM8A 5H91A 2QCLA 3SJ3A 2UV8G 3N2CA 1UC4A 4GIYA 1UBSA 4JR5A 2IQTA 1VENA 1R7AA 3W86A 4IMAA 1W91A 3V1HA 3ARSA 2NXIA 4K68A 3N17A 2WHJA 3WLNA 2ZC1A 1I2PA 3H2AA 3CV1A 1MEIA 2G3MA 3B05A 3P0WA 1W1A1 3UR2A 1W17A 4XTIA 3TQPA 5I3HA 2CZ5A 3UWYA 4UTHA 3WF1A 3GC5A 5I07A 1CCWB 4XWUA 1EXBA 1XI3A 3PHAA 1QCWA 1IZKA 1I1WA 1QFEA 4AD1A 5I24A 4AMCA 1ZS2A 3VTRA 3AHTA 1EJXC 4LU0A 2ABBA 3ZXWA 4DUXA 1V6UA 5BOEA 1QO5A 3PZNA 2IPGA 3D3AA 1FWFC 4MKNA 3W6LA 4WJEA 3G1VA 3RM4A 3LTSA 4GKTA 1K9TA 3WLLA 3QY6A 4PGLA 1TVPA 1RV8A 2DJXA 3U6WA 1J6OA 5EBAA 1GOOA 1KFCA 2YLLA 4EIVA 1ISVA 3VAVA 3MJYA 4RPPA 4CVWA 3QOKA 1ONWA 4QXIA 2PAJA 1HUVA 4O1BA 2D20A 3MMWA 1CYGA 4Q3MA 3MHGA 4RW5A 3GG8A 4G7EA 4WGHA 4Q8WA 4FHAA 4ZSTA 1JFXA 2FH8A 3EXRA 4DWSD 4KCWA 3TTEA 1QTWA 2PDHA 3B06A 1POJA 4DNMA 4H6QA 4N9BA 1JUKA 4AY1A 3G3MA 4ZTXA 3OBEA 1VCGA 4UR8A 4JTUA 1QI0A 4LB4A 1PCWA 3RDKA 4DO6A 3EX3A 4NJGA 4PTNA 3M0VA 4E8CA 5JU6A 1BVWA 3B9AA 4AHQA 4NL1A 1SZRA 3IIPA 2ZRXA 3T2OA 4C5YA 4LUTB 2W4XA 2NVAA 1PZ1A 1DJGA 3VGDA 1W0MA 4C91A 2XN0A 2C3ZA 1JPIA 1NOUA 1V3LA 3DFOA 4IM4A 4MZ8A 1KBKA 1P1XA 4PUJA 1RXOB 1XBYA 1Q6EA 5LNVA 1ONRA 4V27A 9RUBA 3FCPA 4OUEA 4F66A 4IUOA 1KM0A 3NQDA 3FEQA 4OZOA 3PP7A 1THFD 4S3EA 2Z2UA 2FB2A 5F1VA 2JE8A 4Z0JA 2I1OA 1IT0A 4IG2B 2Z1KA 3WH9A 2VX4A 2PDFA 1OYAA 3H2FA 1D9EA 3RLUA 3L23A 4OBSA 5D37A 1DIDA 3MUCA 3W1AA 1T99A 1O12A 4Q7BA 5KZDA 2NVDA 2I16A 4J3SA 1LZOA 2Y61A 2NV9A 2YCKX 1V0LA 1H50A 3N3TA 4HOXA 2AGKA 2JEPA 4MKVA 1TWSA 4QNEA 3MP3A 5BW6A 2Y88A 1KM4A 3DERA 5C2GA 2XZ7A 2X42A 1EC8A 4L80A 4TX6A 1AJZA 3QR1A 4I90A 4AB4A 3BL3A 4DYEA 4J1OA 2VJXA 3NQ2A 3T6CA 3BLPX 2YB4A 1K8XA 1WOAA 3SECA 3GSMA 4MG4A 1UKOA 3IACA 4GNJA 1GVYA 1H7NA 3QC3A 1IEVA 1UKTA 1JZ4A 4HB7A 3L0GA 4B92A 4HA1A 5C9RA 1XLCA 4IP7A 4UQ9A 2VFHA 4W87A 5FEXA 3ZT6A 3R94A 1EJ7L 3V0UA 4AEOA 3CAQA 4LWWA 3GD6A 4U3CA 4X9YA 1QPKA 4W7UA 1EYWA 1XUUA 4IPJA 5CLTA 1N7KA 1VC4A 2OZTA 3W1MA 4Y2WA 1SZNA 3EZ4A 2CBUA 1ALDA 4R27A 3BAKA 3NO5A 2IUZA 3UWUA 4MMWA 1K8CA 1XSIA 1I45A 5AZ0A 1KFEA 5AFDA 4CU7A 2F38A 5HOSA 3WQCA 4NZFA 1A5KC 1QNSA 1OYBA 1AW5A 1ECQA 3GAYA 5A6TC 2XG9A 4B9ZA 1BF2A 5JVLA 2A3BA 2UY5A 4F9DA 1C7TA 2BVWA 3LXAA 3ABRA 2GYIA 4DXVA 2INZA 4HZ6A 3R10A 1TPUA 5I03A 1GONA 1R3TA 5IFTA 2IQ0A 1RK6A 1WZMA 2VR2A 1LRQA 2WSRA 1E9IA 1V6VA 4HIBA 1C93A 5A8NA 4XISA 3CHDA 4CNOA 3MMTA 4WIWA 3A13A 4JIIX 4YWIA 3TYAA 3P67A 4LYRA 2ADAA 2UBPC 5C7VA 1VFUA 3TSDA 4J7RA 2W27A 3SQLA 3SURA 2BZNA 3EMZA 4MJMA 4LUTA 2EJAA 4B16A 4DAIA 2WVUA 2YR1A 1TQJA 4ENLA 3LHWA 3M0ZA 1QHOA 1IYXA 1B3VA 1X96A 4LCQA 1LT7A 2OEMA 2NQLA 4UCGA 4CD7A 1TUFA 2E09A 4N7QA 3KOFA 1TMHA 3WY1A 3M46A 1AFSA 8CGTA 2PTYA 4NYYA 2VM8A 4PL1A 1T8QA 1XLFA 1ZENA 4C6BA 2D2HA 5KZ6A 1P7TB 1AQHA 4FB7A 1KGUA 1CXEA 4IG2A 3TTOA 1LLOA 2ASHA 4A05A 4DJFD 4KS0A 4JIEA 8TIMA 3T07A 3PJWA 4C5ZA 4PTDA 3RILA 3SCNA 3WBXA 4GACA 3GHUA 4REQB 1JYNA 3CQKA 3L4VA 3MP5A 4P7NA 3FFSA 3L68A 2WZHA 4LTSA 2NWRA 4Y96A 1V3JA 3VCNA 5AHLA 3NQVA 1PWMA 4QISA 3UPWA 4AIUA 4C6LA 3NQ6A 5EMMA 3DI1A 1H2JA 2WJDA 4YS1A 5D05A 3CIVA 1WKFA 1S5TA 1Z7AA 2ZYFA 3CAKA 2HNEA 1US3A 3NSMA 3FEMA 4CLMA 4BF5A 1O5KA 3CK5A 3SEPA 1GVOA 4LAUA 2Y0FA 1SFTA 2ZXDA 4XZIA 3STCA 3MUY1 5B7ZA 3OZPA 3VNYA 2PUZA 4MOZA 4A3RA 3NZ1A 2XVPA 1XYBA 2H9AB 1XBVA 3H4GA 1FCBA 4UOJA 3LUTA 2QGYA 2XVGA 2WLZA 1A3WA 4A8RA 3Q2DA 3EPOA 4KBXA 5DBTA 1M5WA 2FPYA 3DYOA 4RDYA 4RV3A 4QGCA 4M56A 3G3DA 4XAFA 2OR2A 1MW1A 5HBFA 2PDKA 1V51A 4HA0A 2CBJA 2EXOA 3ARWA 1EX1A 3WBAA 4QDPA 5AVHA 1C92A 1OG6A 2DZVA 4PUDA 4ERIA 4MB4A 1F3XA 5C2CA 1QMLA 2E67A 2PDPA 3GTIA 5JUVA 3HGOA 3QVQA 3VDBA 2E68A 1GPWA 4DAFA 4DELA 4LUYA 3S2CA 4N9DA 4I8YA 3WLOA 4IXHA 4XUYA 3BO9A 4Q4SA 1G69A 4B90A 3WQFA 1Q6DA 3DECA 1D7FA 1W2VA 4TO8A 2PU0A 1FOBA 2YXGA 1EOKA 3S1GA 1OGBA 1Z8AA 1W5NA 3AZSA 3P6LA 5DQPA 1BEUA 2GQ8A 4Z08A 5A8QA 1MNZA 3LBCA 1A5OC 4OECA 1J79A 1V6XA 3VM5A 2J6VA 3VOIA 1FWCC 4WEVX 1W3JA 1UWRA 4P7LA 2QAPA 1NDYA 3MZNA 3ATYA 1GOMA 1XH0A 3FV9A 1E9ZB 2A79A 3T44A 3YPIA 3PSWA 5HWJA 4HYVA 1L6SA 3KHDA 2PLCA 6TAAA 1XINA 1DJWA 4RDZA 3WCZA 1J11A 2ONEA 1MDLA 3HBLA 1UJQA 4PCNA 1PXGA 3MV01 1OFBA 2PTDA 3L7RA 2VC9A 1RCQA 1BG4A 1VZWA 2XIQA 4IF2A 5FAJA 1HXJA 4GUGA 3VYLA 1O5RA 1FP9A 4UTTC 1P7TA 1TV5A 2GSJA 4H1ZA 1DE6A 4XB3A 4AWTA 3QXBA 1XLEA 1TPVA 4WJXA 1WPCA 4RKAA 1EO7A 1KBBA 1V0NA 2GVEA 4KMQA 2QJJA 3CUFA 3QW3A 1XLBA 1EJSC 4REQA 2QDDA 3LM3A 3BLLA 5CGQA 1UASA 1QW8A 2C91A 1OFRA 4UTWC 4Q6XA 3L2LA 3UWVA 1OIMA 4IP4A 1C29A 4WK9A 1IGSA 2BDQA 4DXKA 3C2YA 1ECEA 2CPUA 2DSKA 4XX6A 3AXXA 2BB0A 2J7FA 2XFYA 3G6LA 1HP4A 4FEZA 4QHRA 2C1HA 1ZP4A 1KFWA 3MC5A 3NL2A 3ARRA 4BCEA 1Q8AA 1J5SA 4HCHA 1MW3A 4J3XA 2QR6A 1M3UA 1J0KA 4UQDA 4J28A 5JIPA 1X6LA 4Q8UA 1LL6A 3W88A 3B8IA 1X7IA 3Q94A 4U2ZA 6A3HA 1BYCA 4IQEA 4B4FA 2H9AA 1JXKA 3OLGA 5LHEA 4D8AA 4ZE4A 3TLLA 2J4GA 4AVNA 4P7QA 2ICSA 1OCJA 2QF8A 3P8JA 1JUEA 3XINA 3U7BA 3E6EA 3KVMA 3EWZA 1XL9A 4FZIA 3LXCA 4IFOA 4C7FA 1E6QM 4AYGA 3NDZA 1K9FA 5E5CA 2W3ZA 2XH7A 3A5FA 2HDJA 2PDUA 1BWKA 1EEPA 1VB9A 3BAJA 1GQLA 1GYMA 1GYLA 1HJQA 2V69A 1U2YA 1JCXA 5AHNA 3LQLA 3PK7A 5HDRA 3U8GA 1FWWA 4DBUA 1WDRA 1B3YA 2VP8A 3H6OA 2EBNA 3E0FA 2CBIA 4F4RA 2DW6A 4M24A 1MWOA 4HPXA 3FYOA 1TFVA 1AH3A 1GPFA 3CH9A 4K8HA 2EJ1A 1BYBA 1M7XA 2W0UA 1J0IA 1LBMA 1QNQA 4LJ3A 1E1EA 2YXXA 3M0IA 4D1IA 2GJLA 2Z2BA 2DZUA 3TJIA 3GG7A 1FWNA 3NPVA 1FHLA 1VS1A 4NVTA 2F2HA 4NUWA 2X7VA 2Y1HA 3F1QA 4XD4A 4GNKB 1GZGA 9XIAA 1UIOA 1J93A 3A4WA 4TVDA 1KRBC 3I6TA 3RJYA 1ZZMA 5C0QA 2R6OA 2NQ5A 4OT7A 3EDFA 3RLVA 1EF2A 2A85A 3FYYA 2WANA 5G2HA 2PGFA 1UD6A 2VZSA 4KEZA 1TWIA 5EMYA 3GVQA 2F84A 3NPXA 4ZB5A 1XKJA 4OV4A 2Y8KA 2BS9A 3XISA 2NT0A 5BYWA 4RNJA 1Q4NX 4W7VA 3DFYA 5FF2A 4HOZA 1V7AA 2WZEA 3I3EA 3N2OA 4PH6A 1KM5A 3GRIA 4MNKA 3T7VA 4DIAA 3W1UA 2G3JA 1DJQA 3QF0A 1VBUA 2NX9A 1CZ1A 1UZ4A 1XF0A 4WY0B 2J9ZA 3FHQA 1UKQA 2BY1A 1X8FA 3OBKA 3WO8A 5GVJA 1H7WA 3CASA 1TPFA 5AYZA 1H7PA 3LCGA 1WA3A 2OLHA 3AXIA 3I4EA 4Z2JA 1TPDA 2J25A 3AYVA 1CGVA 3AZTA 1B9BA 2ZZ6A 3WLMA 2KAUC 4MWAD 5BWAA 2A3AA 4QS6A 3O6AA 4IOTA 1D3GA 3EBVA 4OHQA 3B04A 3FAXA 1A5NC 2XH0A 2ZUSA 4MUZA 4NSBA 4URIA 2C6QA 4HK5A 2QQ6A 1X38A 4AD2A 3R5EA 4UMAA 3GIQA 4QG6A 3WJXA 3ALFA 4LEFA 2F6XA 3VGBA 2V3DA 2D2GA 3VNKA 3LGEA 4GRSA 1DV7A 2FZMA 2Y2WA 4DJEA 3H55A 5AECA 1Z48A 1C8YA 1JPKA 4JIPA 4GUJA 3LRKA 1V08A 3AU6A 2QPUA 3UESA 3SUVA 5CBIA 2Q8ZA 1WOBA 1LWJA 4PEEA 3LOTA 4NZ4A 3SO7A 2YB1A 1RR2A 2FHCA 4IIDA 3IJ6A 2Y8VA 3FXGA 3QHOA 4H6EA 1PZ0A 5IOBA 4ZFCA 1XJBA 3QN3A 5J8LA 3I6RA 1XC6A 2XH2A 2RH9A 4E3TA 4RNIA 5I3DA 4DY1A 4GVFA 1B3OA 4CD4A 4FR1A 4NF7A 1Q7QA 1NWUA 2EEXA 3W24A 1XUZA 4JKKA 4GQ0A 3DG7A 3MUXA 1V7YA 1QW7A 1EF3A 3MU7A 3UCCA 3OLEA 3QFWA 4U28A 4KCVA 4JTAA 3GTXA 1GVSA 3WDPP 5K9CA 5KEZA 4DWSC 2RDUA 3WJWA 2C19A 1HJXA 2BTMA 2Q01A 1FWJC 1QWGA 3UY8A 2ACQA 3BZGA 4GXMA 4FLRA 4PTMA 1K77A 2E5DA 3L67A 2X41A 1K3UA 1NTHA 1TJRA 1RK5A 3TR9A 1EWDA 5HR7A 5BXSA 1DJNA 2VZUA 4I5UA 4DI8A 2PTZA 4CNUA 4YCPA 3QPYA 5FA5A 4F0SA 1GHSA 2H6RA 1D2KA 3VUSA 2F61A 2J62A 1IEXA 1HFBA 4IFRA 4PTXA 3QV8A 1U5JA 4W8LA 3EWWA 4GYPA 2OCZA 3L0NA 1PJ9A 1W3LA 2EPHA 3B8DA 1QWKA 5FL0A 4WUIA 1FCVA 2OFJA 3W7IA 3TAKA 2J78A 1ZU8A 3EEZA 4Q32A 3T8LA 2JQXA 1S2VA 4WY0A 5CQ1A 1PE1A 1RQEA 5KETA 2WNZA 4YTUA 3UCDA 1JYVA 1A0DA 3UZWA 4WF7A 3Q4DA 1QBAA 2VZOA 3CEPA 5GQBA 1QBBA 3SR7A 3LA4A 1BKSA 2R14A 2WSYA 5BRPA 2DVTA 1SVDA 3CUXA 4HPGA 4AF0A 4Q8NA 3LRMA 3OA3A 4M5PA 4HK7A 2R1KA 1W5MA 2GGEA 2QXWA 2VRKA 4W84A 3HTWA 2PZ0A 3A4AA 3M4HA 3WG6A 1R86A 3VIHA 4GYFA 1DWGM 4PMXA 2AAAA 4AY7A 1JYXA 1MRQA 1PTDA 3F4VA 1JDDA 1LP6A 1RALA 4E8GA 4LAOA 1S46A 3D5HA 3O63A 1M7PA 4ML9A 2WPBA 2CXEA 3QOMA 3W38A 3H7UA 2HMCA 4D6IA 4XAZA 2DZTA 4O4WA 4KERA 3SN0A 3PZOA 1R8LA 2Y4SA 3A3HA 4GI9A 5C9WA 2NW0A 3W2MA 4RZBA 2V3GA 1R3YA 2WC3A 1V6WA 5ABHA 1EQCA 1Q6RA 3IJIA 3DAQA 3VFLA 1TPEA 4DN1A 1D8CA 2V3FA 3SQSA 1RA5A 4E2OA 3O6CA 4BWLC 1AQMA 2A3LA 2Y7FA 1GJPA 1M7OA 5HANA 3WELA 5I3IA 2GQ3A 4XBSA 4B3KA 4PBGA 1PSCA 4PMNA 4ADTA 4LANA 1KFBA 3WMLA 2VNCA 2Z1XA 1SQ7A 3GH7A 3DGBA 1B3XA 2OLSA 1FWAC 5T9CE 1ME8A 5FKYA 1PDYA 3W23A 3FA3A 4H00A 1CXFA 2F7FA 4LQ1A 3BICA 3N9KA 3EPNA 1H1ZA 3LTYA 5J5RA 1EUNA 3V0SA 4HNCA 4WKAA 4AC7C 4R53A 1KQYA 3GNRA 2DDXA 2PA6A 4X2RA 4CN1A 5LHFA 2WAGA 1XFBA 4GUIA 3S1VA 1D8WA 4PRTA 6XIMA 4GQGA 3AISA 5HQEA 4NZ5A 2A4AA 2ZRZA 4QJ4B 3EOEA 5L6UA 2NV1A 1JQXA 2ALDA 2DZSA 4DWDA 4NJKA 2DSVA 3H22A 1IEWA 1H0GA 3AS1A 2V2DA 2OQYA 5FESA 4GJ1A 3RITA 1JCMP 4IP5A 4U2YA 3W02A 1H1NA 3I6EA 1NDVA 3EWUA 4ZQNA 8A3HA 3TDFA 2VEGA 3MSGA 3NM3A 1OIFA 5FD0A 4C6QA 2QHAA 4R5EA 1B3ZA 1I0BA 1Q2SA 5I78A 4KT2A 1Q13A 3LN3A 3TXVA 4ADSA 3VZYA 5D02A 2X40A 4Z2GA 3GIPA 4AAJA 4DJFC 1TPH1 2BHYA 3DIPA 1SZFA 4W7WA 3TCSA 2DVXA 3VM7A 2IPWA 3AJ7A 1TZZA 4LAZA 1AH0A 2X2GA 2G3IA 3W1LA 1EFZA 3LPOA 2VR4A 3PZ9A 5HATA 3BE7A 1Q66A 1U5HA 4WKFA 2BOFX 3NCOA 3A12A 3OHMB 1H61A 1J0HA 2CLPA 1GEHA 3GWQA 2XISA 1MVYA 3DZ1A 1M1BA 3QV6A 2E9BA 1IR2A 5GPRA 3C6CA 3OGVA 2D2OA 2UY4A 2JGQA 1PZ2A 2ZXAA 2A7NA 3WF4A 3FJLA 2P10A 1ADOA 1FP8A 3M47A 3NPUA 4ERAA 4I5XA 3VK5A 1E4IA 3WJYA 4HVXA 7XIMA 3V35A 4JTHA 4DPPA 3BAIA 2WOQA 5A95A 1RCXB 2CXGA 4D8ZA 5AHFA 4ORMA 1RLDA 3GZAA 5I3KA 4UFMA 1TV3A 1P0BA 2ZA1A 4IH3A 1XLHA 1DJZA 2J47A 4UTUA 2ISVA 3KVKA 1XW8A 1EB3A 2FVMA 5FJOA 3RRXA 3FY1A 4H4IA 2ZVRA 4C6PA 2OQLA 3S47A 2DT1A 3N6JA 3U2OA 2R1NA 1BG9A 3GFXA 2VDIA 1SPQA 3R43A 2B81A 4GK8A 2E1WA 1GQJA 3S1UA 3QGAC 1UH2A 4NNBA 1XIDA 3TK7A 4BQ3A 4PFHA 3FGCB 1KM3A 3U3HA 2NX3A 2G50A 1T7LA 4QE1A 3T0AA 2IPJA 5CXPA 3DFPA 2WMHA 3FOKA 2GUBA 5I02A 4O8AA 4JNMA 3CH0A 4HA4A 2I5GA 1DHPA 3RYSA 3UT0A 3N2XA 2WSKA 3I3BA 3THCA 3N9SA 4QDMA 1KO0A 2W67A 2HXUA 4C6KA 2WLYA 3LCFA 1JZ7A 2WQPA 2RDTA 3CLWA 3RJXA 1EIXA 3F03K 2CZVA 5D38A 2PZNA 3VKKA 1EX5A 1PKYA 4TXEA 3NO3A 4QNWA 4FLQA 2GL5A 5EMKA 2PWGA 2BFGA 5F7UA 1LUCB 3AIQA 4QTGA 3WH8A 1BSLA 4HNOA 1OEPA 4ZFMA 2XHYA 3PPCA 4JCLA 3HO8A 4PBEA 1Q4WA 5T9BG 3L21A 4K8GA 2XVNA 3PNUA 1NARA 3MUZ1 3MSRA 1VYSX 3VNZA 1W8GA 3SCTA 5J04A 2CLOA 3V18A 1M6JA 3P8IA 1HKMA 1D7KA 1HKWA 2AKMA 4ZB0A 3L4WA 1A0CA 4MFDA 3DEQA 3UZXA 5DY3A 1RY0A 4CN4A 3M64A 3ZR5A 5I00A 1RH9A 1O4UA 4DRSA 5A6KA 1R87A 4DUWA 3HV8A 2EHHA 4FNQA 3UCQA 3HF3A 3DFNA 4XZHA 1OFPA 3GDBA 5HJYA 3DHPA 1TWWA 1MO0A 2FTPA 3WDIA 1K4HA 4OIFA 3F4WA 1XPYA 5I77A 1Q6FA 3IIOA 1XX1A 3T2PA 4LBSA 5C2XA 4ES4A 3W2KA 2I57A 1UR8A 4Y8FA 3AOFA 3CZEA 3CAVA 3GNDA 3F5KA 4DYKA 5LNUA 5CZSA 3SUWA 1P48A 4XIAA 4HHMA 4WD0A 4NI3A 3H53A 4WJ8A 2BNJA 4XZLX 2GWGA 3LCHA 3WQDA 4C6NA 3B9DA 1GGOA 2FHFA 3IPWA 4OTKA 1XLDA 4UFLA 4DO4A 3KM8A 3CL6A 1WXZA 3LK6A 3MANA 4ZR8A 4JQ1A 3TAOA 3NYDA 3VOGA 4EX4A 3KTCA 1FWHC 2POZA 1EOMA 2PU1A 4WDUA 4CU6A 3TTQA 1F7BA 3OPSA 2NQ9A 1M01A 3M1ZA 3QY7A 1OFEA 3ANYA 1UH4A 2JIWA 3NPWA 1XISA 3CZKA 4W85A 1GVIA 3TYDA 3H21A 2R24A 3UZZA 2OYMA 3AXHA 4UC5A 3UZYA 4HMDA 1H5YA 3W7EA 4PR4A 2R1PA 3E3HA 2QGHA 4LUIA 3KZPA 3LTPA 1YDNA 1F73A 3EDJA 1JCTA 4JNZA 3TW6A 3CZLA 2Y62A 2Q8XA 1V6TA 3ZLFA 4D71A 1M03A 3FGCA 4CNNA 2YDRA 2PWDA 1SO6A 2X09A 2VXNA 4CNSA 2ZE3A 2WQDA 1S3TC 4WR3A 3LHVA 1GKRA 3GIYA 3WF3A 1XBXA 3TH6A 1FX6A 4Q8QA 1FA2A 2PGEA 1TELA 3FYPA 3T0TA 3BLEA 1DQUA 3C0LA 3QHMA 4FX8A 1OSEA 5LNRA 3UZ5A 2DV0A 2W91A 4JTIA 3CM4A 3LPPA 3OG3A 4I9MA 4P7OA 2A7RA 4C60A 1LUCA 1RSCA 3BGJA 2WXDM 1DE5A 1JDCA 1F4HA 1N55A 2CLEA 1BGAA 5T8GA 5FJIA 1MUCA 1W1B1 4HYWA 3ITYA 4R3UA 4UFJA 3LMYA 3W22A 1C91A 4XVDA 1TJ2A 2OG9A 2BOGX 4CN6A 1IV8A 2OJPA 2DH3A 3RNDA 5XINA 3L4UA 3QLDA 3TOPA 1XIEA 3PWAA 4UZSA 3RF9A 2D0GA 1X8CA 3CS2A 3PY2A 2XSBA 3WLHA 3RN6A 4FI4A 3AYRA 4DBDA 3QLLA 3G1AA 2QCGA 4BFAA 4OUIA 4DBWA 1W9BM 1LTDA 3ARUA 4QE5A 4L56A 4RR4A 5TIMA 1Q7ZA 1AODA 4E38A 4A29A 5D32A 4EXQA 3BOLA 3LG3A 3TN6A 5FSDC 2DIEA 2YPIA 1GG1A 5TBOA 4HN8A 1EDGA 5AC5A 1WCGA 4ZL1A 4AZHA 4YTSA 2QUUA 4A3HA 1HVXA 1FWGC 4FO4A 1TA3B 2REQB 2XVKA 1J2BA 4IMFA 3N2TA 3QRHA 4O0ZA 2VFIA 3FLUA 2HE8A 4MWAC 1DJYA 3SCQA 1ELSA 3VVGA 3GNPA 3TC3A 1VRDA 3VGEA 4O1EA 4US5A 1AUSL 3UGVA 3MT1A 4CCCA 3O07A 2GVGA 3GTHA 3PTKA 1YE6A 1ZB5A 1IXQA 1MW0A 2NVCA 1OJXA 1VJZA 2HVNA 1H0IA 1KW1A 2JIEA 1GCYA 2Z26A 1LQ2A 4ECLA 1MFVA 3N11A 2R1LA 4RX0A 5JH1A 4BF9A 3W83A 5DMNA 4FOKA 3G1HA 1UYQA 3B0PA 2VI0A 5CZ0A 1CWYA 5IXEA 1SGJA 2FLIA 4DHGA 4B5WA 4TVCA 1UP0A 3O7UA 1OFDA 1YDVA 3W00A 1XIHA 1CT5A 1IQ8A 4BS0A 1REQB 3GDMA 4ZSUA 2FJUB 1QOXA 1FCQA 4ICMA 3UA3A 3CIWA 1R30A 2WO5A 1UZ1A 4KEVA 4XSLA 1VIZA 3C2VA 4ZOAA 4ZO9A 4PYSA 2CLFA 5A2BA 1RA0A 4E4UA 5FI8A 3A23A 3RR1A 3ZZ1A 4E2VA 1SFLA 3CV2A 1ODZA 1D3HA 5A6BA 5CC3A 4MYAA 2RDXA 1KCLA 2OYKA 3CU2A 2E6AA 3POHA 4TX8A 5HNTA 2V82A 2VHLA 2E28A 3QR3A 1TB3A 3F7JA 4X2PA 3SQMA 1RHCA 3S4TA 2PWVA 3GYCA 1J10A 3ORWA 1R3VA 4BI5A 1JZ2A 1OQFA 1WDDA 3UG5A 1L2QA 3S9YA 2GJRA 3TA9A 5LXXA 4KRZA 1JCJA 2QT3A 1ITUA 5TNVA 1ADSA 1LWIA 4V1XA 3N18A 2DORA 1V77A 2FFIA 4BY3A 2OOGA 3OLDA 1UR9A 4Y9OA 1OCBA 4XUGA 1YPFA 1L9WA 2E25A 4NKCA 3KX6A 5F2MA 1PKNA 1PO9A 3PNZA 1S2AA 1ISYA 3MYPA 3CTTA 4Z17A 4WDXA 1UP2A 3S46A 3GO2A 4PE8A 1XLLA 2J8FA 2ZRWA 1S1RA 3B4YA 3MDUA 3VI2A 4L5ZA 3RK8A 3VCRA 1LF1A 3UA4A 3U48A 3DBPA 3WLSA 1CBGA 1FKXA 1MZHA 3LLXA 5LGXA 3EB2A 2OKOA 2VWTA 4Z1BA 1YE4A 4PCSA 2I9EA 3H12A 3SJNA 1UWQA 4C6OA 1QI5A 4LY8A 4P8UA 4CQ9A 4H8NA 3KRBA 4Z2KA 2DPEA 3IIXA 1M65A 4RE3A 5FAGA 3U4AA 1PV8A 1ZP3A 4GY7A 1TA3A 3NM1A 2REQA 2Q3RA 2E3ZA 2OO6A 3C61A 5LZLA 3QBUA 1VD6A 2DJLA 1QHPA 5DLCA 1VBJA 2WCGA 2Z6JA 4ATDA 3E1F1 4KFNA 4F0RA 1XYCA 1KM6A 1B1YA 1FVPA 3T08A 1BXBA 2JKEA 4FPSA 3DUGA 4QM1A 3PBYA 5T91A 4W5UA 3PZIA 3HG2A 4KRUA 2NXHA 3UBPC 4ZO8A 3VXGA 5A1AA 4HNNA 5GJPA 4I5RA 3CHEA 4JYEA 1YNQA 3G0SA 1US0A 3ICJA 4HK6A 3AMCA 1HJWA 2ZTJA 3HPFA 3B9EA 3RCNA 1LQAA 1QPNA 3DENA 3VOFA 2O9RA 4UTLA 4RZ5A 3E0LA 1REQA 5AB3A 1W5PA 1VCVA 3INPA 3BJSA 1DJIA 1NDZA 3W71A 4HU3A 5DCDA 4JFSA 3G1YA 5LXEA 3T1GA 2ZZ2A 3TMQA 2XPKA 2F9RA 1A5CA 1MW2A 3CMJA 3KTSA 1DPMA 2UY3A 3H24A 2TMDA 4YVXA 4O13A 5DEZA 3MI3A 4Q4QA 2HEJA 3QGVA 2WPGA 4YTQA 2PWEA 3MMDA 2DT0A 5CPNA 4XIMA 4O53A 4Y6GA 3OZMA 1F9CA 2XTKA 4MY9A 3RPTA 3G1FA 1E1FA 3NQCA 4UTWA 2QDEA 1TZ7A 4FNRA 1IZJA 2GLKA 3K8LA 5DN1A 3L5MA 4WX2A 3RAOA 3AALA 3W7JA 4ASTA 1XLJA 3F2DA 1TIMA 4FX6M 4FNPA 5GNXA 4Q7IA 1IWPA 3UXKA 3IK4A 3K1DA 4GQRA 3LGDA 3GH4A 2HS8A 3W1RA 4HMNA 1OC5A 3R7MA 4GI8A 4CEUC 2QCDB 4YCOA 1BTCA 4MF4A 3TLQA 2B7PA 3QGKC 5IDIA 4D72A 4PMVA 3C2RA 5TQLA 5ECVA 1QI3A 1AMKA 5AYXA 3RRAA 3PFMA 5K4ZA 1E9LA 4AQLA 4RLIA 3UYIA 3MA8A 1RD5A 1Z69A 3WZ0E 1IHIA 1F07A 3AUJA 3VIIA 2YDSA 4QP0A 1L6GA 1W54A 3HPXA 2SFPA 3B0UX 3R79A 3BURA 4OOUA 4GY0A 4HTYA 4HD5A 3MKVA 3E2VA 1IZCA 1XLMA 5HA7A 7TAAA 3W7QA 1W9DM 4YTRA