4FOKA

1.8 a crystal structure of the fimx eal domain in complex with c-digmp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
VSIYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding
total genus 96
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fokA00
4LYKA 3GG1A 4RNIA 4ES4A 4AFYA 2R6OA 3PJUA 4J40A 4RNHA 3S83A 3GFYA 4Y9NA 4FOUA 3GFXA 4Y9PA 3TLQA 2BASA 3GFZA 3HV8A 3HV9A 4LJ3A 3N3TA 4FOKA 4Y8EA 5MF5A 2W27A 4HU4A 4AG0A 4Q6JA 4HU3A 3GG0A 3PJTA 4HJFA 4Y9OA 5MKGB 3PJXA 4F48A 4Y9MA 4FOJA 3U2EA 3KZPA 4KIEA 5MKGA 4RNJA 3SY8A 4F3HA 3PJWA 5M1TA 4RNFA 3PFMA
chains in the Genus database with same CATH superfamily
5D38A 2WW5A 3CZEA 2C1GA 3BLFA 5BXRA 3WD4A 3UF9A 4MY9A 5FJOA 2EPHA 2FKPA 1MYRA 1W1VA 4CKQA 5I06A 1J5SA 3VFCA 3WJSA 1CWYA 1VHCA 2RAGA 4QBXA 3T05A 3P7YA 2QPXA 1U5VA 4Q6JA 4L1WA 1UA7A 3GXMA 4GZEA 3EKLA 5CBJA 3VIGA 3NSNA 3H2AA 4BF9A 1IQ8A 3N9RA 4ZB5A 1G0CA 1F4AA 4AVFA 1BG4A 3KDOA 1B4KA 5BROA 2W5FA 2Z2BA 4DJFA 1LYXA 4DEFA 3LB0A 3NO3A 3CQHA 4AD0A 5D02A 4X0VA 4QR6A 1JAKA 4DELA 4O4VA 1CXLA 1KFCA 3EAUA 3QQ0A 3CV7A 3RNDA 4UMAA 1FWJC 1C8XA 2QDHA 1R9YA 2OJPA 4BJHA 1P7TB 1VCVA 3SCSA 1YNPA 1CT5A 3IIZA 3CMFA 3BJTA 3IVSA 2WSPA 3W0KA 4OOZA 2EO7A 4QAWA 3NWRA 2H9AA 7REQA 4MB4A 4ZGYA 3E1F1 3VGBA 1YTKA 3T08A 3BSGA 2QJJA 3I65A 5H8UA 3R94A 5KZMA 4A3RA 4PB4A 4H7CA 1FY6A 4GWEA 4PUWA 1EKOA 5B7YA 1I2RA 4IUOA 1K8XA 2J8TA 3HGJA 5FSDC 1ICPA 2YCLB 3QZAA 3M44A 2QKFA 3WQDA 2RGLA 4QNEA 1B3WA 1YXYA 3QXBA 5DY3A 4IMFA 1GTEA 3WD1A 3VZZA 1T40A 3N3TA 5FJIA 1DOSA 4AZHA 2QGYA 3MSGA 3VDBA 4DBWA 1W5QA 4GLEA 4ATDA 2I17A 2WZMA 4CCEA 4GX8A 4URIA 4M1RA 2CU0A 4JIHA 4ORMA 1HKJA 1ZU8A 3EMCA 2PP3A 3DDMA 3IUHA 3F2CA 2XJ7A 3GXTA 2J7CA 1A0CA 3MMWA 4QSHA 3EX3A 1R9XA 1XBYA 1NQKA 1UD6A 3GHSA 2VFIA 3WD0A 2J7BA 4HMDA 5CLTA 4NQ1A 4GUFA 1UR1A 4AWUA 4QQUA 2GGEA 1QRQA 5G1YA 5EGRA 1J10A 4REQB 3OOQA 3L4TA 1FWIC 5T9BG 2BLEA 3OVPA 3HQNA 1FH7A 2WVTA 3TIMA 4AMCA 5BOEA 1PX3A 4Z1CA 4YJ5A 3NPXA 1YPIA 3W07A 3P0WA 4WXYA 3N2OA 3U3HA 2G3FA 1JULA 2P3ZA 2YDRA 3CUGA 3MB9A 5AVNA 3DBPA 5C9WA 4ZXLA 1EBHA 4US6A 4ZQMA 1JCNA 4DLMA 1C7TA 4IFOA 1KLYA 1AZ1A 4YXGA 2HK0A 2HVMA 3FJNA 1WDPA 2E28A 4UMBA 3IRDA 4UFMA 2Y7DA 4K7YA 4LB3A 2HZGA 1VAHA 5A6TC 1K77A 3FHQA 2QCNA 1J0ZA 3OGVA 3K8MA 3G5EA 3WG6A 2W63A 3G1SA 3IJ6A 3W6MA 3QY8A 3UWEA 1XGDA 3I7SA 4JTKA 4RJEA 4EP8C 3TV8A 2QV4A 1XIHA 3M16A 5D04C 3UCDA 2I9UA 1CGXA 4ZQCA 3H2OA 5BZAA 1X1ZA 4WJEA 1S2UA 4UOJA 5E6ZA 4HIBA 3RMEA 1YLVA 4L56A 4C65A 1SW0A 4AD1A 4MWAE 2QEZA 3CTTA 4NNAA 5CJNA 1G1YA 3AHVA 4JIQA 1CI1A 3E2SA 4AVOA 3GDMA 4KS0A 1DJYA 1ML1A 2FPTA 3M0VA 4BWLA 3CIVA 1CLXA 1F74A 3GTFA 2FMNA 1XYCA 3B8WA 1VBRA 3GG0A 3UQNA 5GJNA 2NUXA 3HQPA 3OU8A 5D8ZA 4IMDA 1ZBKA 1MO0A 1OG6A 1HZYA 5I5RA 4JTIA 2WLYA 2JKAA 2ACSA 4S39A 2ZZ1A 4KRUA 1KD0A 4U5KA 2XIIA 1FHUA 2J79A 1UPPA 4B3KA 3H7VA 1KFBA 4LVFA 2CITA 3E0FA 1WCGA 2PDPA 4RUBA 1LUCA 3OBEA 1UR3M 5AHNA 1XD0A 2C6QA 6REQA 4J2PA 1VBJA 3TTEA 5XINA 1N2VA 1E72M 1VD6A 5HQEA 4Q8TA 1BGGA 4W88A 3MKVA 3ATYA 3TWAA 4LYKA 3RPMA 2VRKA 4YN5A 3VNIA 5CGQA 1KWKA 1XUUA 2OOFA 3ZO9A 1IEIA 3FDKA 4XZLX 4H9XA 3WMLA 4RZ5A 4JNZA 3GH4A 1SO3A 3KRBA 2WMFA 3GR8A 1ESWA 1LBMA 3C2EA 4HNUA 2DJLA 4FLQA 1ZGDA 2INEA 3DU0A 3UG3A 1Z32X 4KCUA 1TB3A 3CEPA 1PYMA 3P5YA 1ZQ5A 3H8AA 4K1WA 5ABHA 1XI3A 2BVTA 4HJFA 2WMIA 3ZJKA 4JXCA 4MUPA 1OFPA 4KQNA 4NI3A 1ONWA 2EPLX 3EB4A 5A8PA 1E0XA 3WNMA 1Q6LA 1E70M 1W3JA 5KINA 1MFUA 1SQ7A 3C2YA 3WD2A 1A3WA 2BGQA 1R3YA 4UOZA 3ZSSA 5HJXA 1LRNA 3ABRA 4AWTA 3DHPA 1TJ0A 3LERA 1Z6KA 3ONBA 5A5WA 4FR6A 3OJGA 1W31A 1L8NA 1J18A 2PD9A 3AMLA 4DJEA 3AIRA 5SWUA 3P62A 2FGZA 1DPMA 4Q4QA 1PZ1A 3WBXA 3SRFA 1O1ZA 3WMBA 2IQDA 2ZFAA 4C6PA 4CU6A 3WELA 3ZLHA 1GOOA 5H8MA 3JW7A 1G7UA 4WX2A 1BQCA 1I75A 4FNUA 3A12A 4DI9A 4YS1A 5C7VA 4OWGA 3GD6A 1HJWA 1H50A 4J3WA 4AYGA 5I23A 2X41A 4JIPA 1WXZA 3I3DA 4FIQA 1NIUA 4XKMA 2ZUVA 2IKIA 1BXBA 1Q6DA 1J9YA 3LN3A 4WZHA 4RNHA 3EWYA 1WB0A 1EGVA 3NL2A 3GKFA 3T81A 2PDJA 3S6TA 1KBLA 2NLYA 3K13A 4KMQA 3VD3A 1LL4A 1XSKA 1LL6A 4UZUA 1R5YA 3VDCA 2ZWYA 1U2YA 3KEHA 3FGCA 3KHDA 3UG4A 1VP5A 1NWTA 3GVVA 2Y2WA 2DT2A 5BXTA 2WZHA 1C91A 3GIYA 3QW4B 3DXIA 3DI0A 1JR1A 3PY2A 4KIEA 4ZO7A 1J2WA 2VZTA 3TZNA 1FWWA 2PU0A 2CFFA 3GC5A 1XLIA 2BVWA 1W1PA 2QUUA 2PUZA 1DJHA 1M65A 2D0HA 3NSXA 1P0DA 4G7EB 3WL0A 4K68A 3BH4A 1SW7A 1AUSL 1UUMA 4NX5A 4HNNA 1J0JA 5C9UA 3CC1A 4Z17A 3MT1A 4AD4A 2W66A 3EPNA 3KM8A 1IR2A 1OM0A 3HJZA 1FFQA 3DFSA 2XH0A 1HG3A 2I5QA 2CEQA 3SN1A 3LHUA 4R7WA 4XZBA 3W2MA 1W1A1 1XIJA 2VZUA 4E2BA 5E5CA 3GB6A 1UBSA 2QIIA 2OWWA 3AWNA 1H4PA 1JQVA 3RU8X 2HPMA 1VLWA 3EDKA 3I68A 2F2KA 4Y8FA 4A8LA 1BVZA 5E0CA 4Y6GA 3TYAA 3GNDA 2PLKA 4PB3A 5C2XA 2AQWA 3G1AA 2IPFA 3POHA 5ABFB 3N18A 4XIMA 4B4HA 2J75A 3LM7A 3MJMA 4YCOA 4I9TA 1BKHA 3P82A 3LGDA 4O0ZA 3GZAA 4JTLA 4NYUA 1E3ZA 2EQDA 1UIPA 2E8ZA 4I90A 4KPLA 1B3ZA 3UR8A 3WLIA 4C6KA 4MZ8A 4L61A 2NQJA 2J7GA 3BVJA 3H23A 4ZENA 2ZC8A 5DXYA 3UBPC 3RK8A 3EDEA 4H9MA 1X1NA 2CHOA 1XLAA 1VFMA 1GQJA 2FJUB 2A7PA 4D1JA 3ISIX 4W93A 1KFEA 3UESA 1V3KA 4XQ6A 3UWWA 1VRDA 3BCFA 5G2WA 4J4KA 2HBXA 1JL8A 4FPSA 3CWNA 2OLSA 3USBA 4EF9A 2L5HA 3PULA 1DXIA 3DAQA 4OBSA 3KVLA 4LBSA 2FTYA 4HA1A 3DEQA 3E6EA 4H9ZA 4LEQA 4BWLC 1NWSA 3VGFA 1NFGA 1DQWA 5FEWA 4MWAC 4KRTA 3O2LA 4AEEA 3OA3A 4RR4A 5CGTA 3HURA 1E6NA 2X40A 2CZ5A 3PJTA 1TV4A 4B5TA 5HJYA 2FZNA 1TJ2A 1U5HA 1CIUA 1EA9C 3M9YA 1G5AA 3I4KA 2OLAA 1QNPA 1FWBC 4AC1X 2A7NA 4ECLA 1SFTA 2AKMA 4F40A 4QDPA 1KM1A 4LY8A 2NWRA 1E1FA 4F0RA 4EANA 3AI0A 4TX6A 3L65A 4KEVA 4GFSA 5DT5A 2WNZA 5CXPA 4EKJA 5ECUA 4NILA 3W86A 4TTUA 4YTRA 1SO5A 2ZUTA 5GVJA 1PSCA 5D9PA 3G8EA 4QCFA 2VOTA 2WBGA 4WY0A 3CWOX 8CGTA 4JY9A 1VYRA 1CENA 1OIFA 4JFSA 1H09A 2OSWA 1A5BA 3WDRA 5C2CA 1HQTA 3PZIA 1H1ZA 1UP0A 3C2FA 3MBDA 3PBWA 3P67A 2JGYA 3ZLGA 4DWSB 2X2GA 3SSZA 1W3IA 2DEPA 1CGYA 3BC9A 5CPQA 3TOYA 3G6MA 3WK0A 1KBBA 3TN6A 3K8LA 4WOQA 2FGLA 3L4ZA 4JTHA 3IANA 2Z7KA 2ZIDA 1T96A 3RCNA 2RFGA 3VNDA 3OBAA 3V5FA 5C55A 2CLEA 3GH5A 2VC7A 1SZNA 2C0AA 3EOUA 1MW1A 4YL2A 2IW0A 3B8DA 3MA8A 2Z1WA 2EKGA 4QS6A 1RXOB 1VJZA 4E6MA 3CV2A 3BV7A 4ZTXA 5GNZA 2NX9A 4GQRA 2EJAA 3N4EA 4HNOA 4UTHA 1XBVA 1TWSA 4J3UA 4Q6XA 3IPWA 4A6GA 4GC4A 2E77A 5LHFA 1GG1A 1XLEA 3AMGA 3LENA 4EXQA 4DJEC 4LUTB 4BFAA 1NFBA 2WAGA 4OV9A 3CPGA 1X97A 1JJKA 1ZNNA 3NVTA 3RAOA 1RJQA 3RIKA 3W1NA 4AIOA 4FX6M 4IQEA 4HU4A 4OKDA 1E43A 4PCTA 4XVDA 2JEPA 4HTBA 4KFNA 4LVAA 4UC5A 3AU2A 3EBVA 3HPSA 1Y0EA 3SUUA 3N6JA 3PUOA 1TRDA 2Z1VA 4AD5A 1ZP4A 5E9AA 3NQ2A 1REQB 2XH4A 3KBWA 3OA5A 3RF9A 2AMXA 3STGA 5K7JA 3WBYA 1G69A 3ZLFA 3NYZA 3LGEA 2GJRA 3L2LA 1KXVA 2RKXA 3N2TA 3GNPA 1ZHAA 1YW1A 4LVDA 3W75A 1TUFA 4I5XA 3SGZA 3SUSA 1UCWA 5KZDA 5D2TA 4Z0JA 2E3ZA 4QAIA 4AIBA 2PURA 3DERA 5EFDA 2BOEX 1E0VA 1PKMA 4WJ8A 4B5VA 1X6NA 1VEMA 1L6GA 4MLJA 4ILSA 3NOYA 4IX0A 4ZB0A 2VZVA 5A2BA 3OW1A 4MB1A 2F8QA 4OQVA 2GDUA 5BU6A 3PWIA 1KBIA 3MI3A 3TSDA 5FACA 3HN3A 1UZDA 5KEZA 4CU8A 1E1EA 1V0KA 3DH7A 1EH9A 4LF2A 4MADA 2EG7A 3CBWA 4W84A 8A3HA 3TYUA 1Z41A 5AYIA 4A8NA 3H2NA 2VT0A 3NQVA 1X39A 5K3VA 1ZBCA 5A95A 3VUSA 4PCFA 3WF2A 2JIWA 2J7EA 4PTXA 5HWJA 2ISDA 1ZBVA 4RZBA 4P8VA 4PBGA 3NYDA 2VJXA 4OUIA 4N02A 3UZJA 4YIWA 1Z42A 1WO2A 8RUCA 1OCNA 1PUDA 4P7NA 3C86A 2GPTA 1PE1A 2NXHA 1VPYA 4LCQA 3S6OA 4ZOEA 2OQHA 1OY0A 1QOQA 3WUGA 4AEOA 3ARPA 4GGBA 2Y62A 2E68A 4LGXA 2WKLA 4XWUA 4Z2HA 4QXIA 2DIKA 4PRRA 1TQJA 4R3UA 1MXGA 2C91A 1CXKA 3WDQA 4L5ZA 2QIWA 4LB4A 4WF7A 2XH7A 3VILA 3H22A 4GGHA 3QQWA 5LKYA 3B8TA 3W2KA 3QN3A 3AICA 5AC8A 2XSBA 4XZIA 3LCGA 1JRBA 3MY9A 3AIWA 3A3XA 4XKYB 2VGGA 2BY0A 4GZ7A 3O6DA 1C8VA 2AGTA 2Y6ZA 1M04A 2XG9A 3OHIA 3EX1A 4HSNA 2E7FA 2VDGA 3BMXA 2VWSA 1EDGA 1W54A 1YTDA 2GQ8A 2PPGA 3LXAA 2IMRA 4GY1A 3W81A 2Z27A 3VKDA 3PZUA 5LIYX 4DRSA 4RDWA 2XVGA 4GI9A 5BYWA 1OFAA 1GOMA 1ISWA 2CPUA 4J3ZA 1DE5A 3QGVA 1A4LA 3HM7A 2W67A 1M03A 3ZS4A 1XKYA 3S4TA 3TDFA 2ZUNA 3KL5A 3WSUA 4X2RA 4QNWA 2GUYA 3B8VA 2C16A 3L5MA 1E6ZA 1M9HA 4OZOA 4LJ3A 5H91A 5GJPA 4PTVA 4JQAA 1KGXA 3EX2A 3ZIZA 1QXLA 4Y9OA 4BQ4A 3BGGA 4OOUA 4XD4A 2OOGA 4WOZA 2EPNA 2HBVA 2RDWA 2VDIA 6PTDA 4KESA 5HK4A 1VIZA 3AC0A 3WK1A 4LS2A 1JZ6A 3UZXA 3EZ4A 3MDUA 3LM3A 4M80A 1B57A 4LX4A 2GJXB 3BAXA 2A3HA 1XYAA 2G8ZA 1H63A 1V03A 1J5TA 3WF0A 4FLOA 4HHMA 2VFFA 4W8BA 4C6IA 1KM2A 1QAPA 2CETA 2Z4GA 1I0DA 4C5YA 2OLHA 3SRKA 4JTTA 4FOKA 2NUYA 1YXDA 2J9YA 3FEMA 3AQUA 1UUOA 3KOYA 3GKAA 2YL6A 2QUVA 2YA0A 1K1DA 4I5RA 4H9UA 4R5EA 3TFCA 3WQOA 4A3UA 4BY3A 3VCNA 4H3DA 1CB2A 5AN7A 4PMUA 4M6UA 3G24A 3GYCA 1K70A 2ZVIA 2E25A 3KXQA 1U5JA 2HTMA 4Q8PA 1E6XM 4IPIA 3R8RA 2ZDSA 3QPZA 1GGOA 4HHHA 1XSIA 1T5AA 2OVLA 3ZSTA 4QDWA 4DM1A 1CYGA 4TV6A 1XUZA 4H6RA 3MWCA 2GVLA 2AAAA 1SZFA 3VE7A 5LNUA 1TCDA 3ITTA 3NZQA 4HMCA 1ECQA 3BOLA 1W9VA 2XIOA 1E9YB 1O5KA 1Q6EA 4PMVA 1MMFA 3CH9A 1WUEA 4EOUA 1FCQA 2G4FA 3WZ0E 2VGBA 3AMCA 4WY0F 1W1ZA 3HMCA 3LOTA 3OVRA 1OZMA 3EWZA 2CIPA 4DNHA 3USZA 4MSSA 3AZTA 5I6SA 2O92A 1RP8A 3M0MA 2ASHA 2WQPA 2ZRXA 4JYEA 1FWAC 5A69A 3VNZA 5FOOA 2EG6A 4EPKA 3LQLA 3B97A 1XBXA 3DKJA 3ELFA 5C2GA 1ZCOA 4I9MA 3K8KA 4G8TA 3MP3A 1TO3A 2MNRA 2V8ZA 4LBRA 2BB0A 1EXPA 4H7VA 4DWDA 2BOFX 1GKPA 1DP0A 3PFMA 3MCNA 1ZTVA 4KWWA 2MANA 2FDMA 2HEJA 3T4WA 3TU9A 1G4TA 3AIBA 4HPNA 2DSKA 4GVHA 1ECEA 4Q4MA 1PZ3A 1R8LA 2XWDA 5E70A 1S5NA 1TJ1A 2YL8A 1XICA 4YVXA 1TPDA 3B8UA 2XYLA 1PKNA 1F07A 1US0A 2ON3A 1I9CB 3A13A 2JQXA 1F3TA 3L67A 4GINA 1JCXA 2F7FA 4A8IA 4HTYA 4LV9A 2QYGA 3PPFA 5JBDA 3MMUA 2PDXA 4OJYA 1XIBA 3ANUA 3RITA 1FDJA 3W7CA 1E0TA 1CEOA 2BXYA 1AL8A 4O0QA 4DAIA 1UQYA 4NAEB 2YDSA 1QNQA 4INFA 4O4WA 3B9EA 1RQBA 5FL0A 2XGZA 2P1FA 3MS8A 2A2IA 1NELA 2QJIA 2DZTA 5LSMA 4MB3A 3HV9A 4A21A 4J35A 1RLCL 1ITCA 1GK8A 2VQUA 4XD3A 2WYSA 3F5JA 1EQCA 3S1VA 3FOKA 1GYMA 5J5RA 1IYXA 3PF3A 4S2BA 3BCDA 4IUGA 1ZAHA 3TMQA 1LOLA 3U7BA 3C8FA 3TONA 3WLHA 3GVGA 3VI2A 2D2GA 5U7SA 2NX1A 3TA9A 4DJDD 1EPXA 4L9YA 2Z1BA 3CLMA 1WZKA 3W53A 4XZNX 2KZHA 3PTQA 3E0IA 5I03A 1QHOA 3WLSA 4FXRA 1UC4A 2WLZA 3COTA 1E0WA 1OHLA 3H4GA 3DESA 2ZRWA 2PWHA 4JQ3A 2Q3RA 3I6RA 1S1PA 1UASA 3KOZA 1XWYA 3LA4A 4NL1A 4GKLA 4GBDA 4A29A 4XZWA 4FXJA 1HVXA 3BAIA 2F6XA 4ZQRA 3RLUA 3VX0A 1Z3NA 4ZO8A 3WLMA 1E4IA 4ZXOA 3UCCA 3WH7A 5D37A 3OEXA 3S46A 2XINA 5GNXA 1EJVC 3WLRA 3S2NA 3BLPX 2C71A 2D24A 5C9XA 1FRBA 3TQ0A 2CC0A 2GVEA 5FF7A 1WKDA 1G9HA 1TQXA 3BG3A 1FWTA 4WSKA 4ROPA 3VDHA 3VVGA 1GOIA 5HWNA 1GPFA 1HO1A 3MMDA 3H2FA 2IXUA 2NX3A 2PTWA 4C6EA 2G41A 1I1XA 4DBEA 1M1BA 4XD5A 1RSCA 1U33A 3TSMA 1Y8BA 3LPFA 3N29A 1V3LA 2BWGA 2VCBA 3S2LA 2D2HA 1BRLB 3G77A 1GOWA 1KRBC 2G3MA 4AZIA 4LYQA 4FXFA 1S5WA 2PZNA 2FYMA 1Q7QA 2DUXA 1FBAA 3IRSA 2ADAA 2WNQA 3NZ1A 2P10A 1H0GA 5CSRA 3ZR4A 3T8QA 3IJ7A 4F0KA 1OFDA 2Z6JA 4W89A 4WXZA 5DF0A 2DZPA 4ERAA 1KRMA 1TTPA 3DFYA 3U5UA 1ADDA 2CKSA 3FAXA 3H26A 4RPPA 3EPOA 4RK8A 4NNBA 3CHFA 3P81A 3ABOA 4AIUA 1GVOA 2X1SA 3VE9A 3BURA 2PDNA 2QS8A 7A3HA 4G5DA 1EGZA 1ZP3A 1EP1A 2DPEA 2W92A 3LCXA 4HA4A 3W1RA 2FZ8A 2JKEA 1BTCA 4QITA 2BG5A 4GIYA 4GQBA 5C9RA 4TIMA 2OZ8A 3UETA 1V5XA 4J28A 4H41A 4F8XA 1S3HA 2QCCA 4PRWA 4MKSA 5CC5A 2E5DA 3NQBA 2QT3A 3FN9A 1GYNA 3L21A 2GFTA 3B0PA 5DLCA 3KZPA 2E6FA 2DSVA 3BSHA 5AYZA 1UR8A 2BGSA 3C4UA 2WJZA 1W37A 1W5PA 1XCWA 4Q4OA 3O63A 1CLVA 1IR1A 2J78A 1K4HA 3A4JA 3ANVA 3TEVA 2WHKA 2F6UA 2W27A 3W7LA 2OO0A 2D73A 1TPB1 5HATA 3GBEA 3PZNA 5AC6A 4DI8A 2AOSA 1KCZA 3TX9A 2VX7A 1JUKA 3WDJA 4YHGA 3KVMA 3L68A 3NGJA 4JKKA 5HR6A 1VBGA 1Y7VA 4GQGA 1GHRA 5AZ0A 2I57A 4FNPA 3AU6A 1F7BA 4KCWA 4O8RA 4AHOA 1XR2A 3VDGA 2YJQA 3WMSA 1PX8A 2NVDA 1YRRA 4K38A 1JGMA 3WQCA 4ZQNA 4GXWA 4NIRA 1HGWA 4N9EA 1GHSA 4PGLA 1AFSA 4FI4A 4LUIA 2HPIA 4AIEA 3EWXA 5DN1A 5BCAA 2G5WA 7REQB 3ZT5A 4H6QA 5CCZA 3GQYA 4HHPA 1JCYA 3CGTA 3LPPA 1M68A 1XPGA 1PVNA 4KFOA 2PC4A 2PZ0A 2DSWA 4GNKB 4TQTA 4A05A 1XLBA 1PIGA 1M7OA 4H2CA 1TJPA 1BXCA 1I2NA 1VYPX 3ZR5A 4DJDA 3ECQA 1VBUA 1RK6A 3TYEA 4DPQA 2DW6A 1KA9F 1KQYA 3OODA 3TTOA 4DUOA 1GVSA 3CO4A 3GK0A 1J6OA 1D7FA 2PLCA 4HPXA 4QLKA 5CZJA 3CNYA 2VEGA 1QNRA 3CIXA 2QNEA 3RJYA 1EJTC 3VIPA 1ADSA 4BF5A 3S5OA 2X8RA 1K6AA 1JZ2A 3QLLA 5CJ5A 4GUHA 5AFDA 2D0GA 3L5LA 2A5HA 4RZ4A 1P43A 3F4WA 3CYJA 3U4FA 3HTWA 4PRTA 3M0IA 1UA3A 3TFXA 1XF0A 1GOKA 2QUTA 4ML4A 3BO9A 2LLEA 1I45A 2P5NA 2WHMA 1TMQA 2OXNA 3ARQA 4AU0A 4F2UA 2J6XA 2IXVA 4Q3MA 2NQHA 3QKZA 2ZRYA 2R1NA 4ZMGA 1SJCA 3KUMA 4X3ZA 2ZA1A 1EUAA 2YCJA 3QC3A 2Y7FA 3HF3A 1QWGA 2Y5EA 2NSOA 1OFEA 1LDCA 1LL7A 1UMYA 3UFYA 1UMLA 2CZFA 1UWIA 1BWVA 1VLIA 2QGHA 4G7EA 4FS9A 1TPEA 2NV9A 1ZZMA 4PFHA 3IWPA 5M1TA 4O12A 2QF7A 3PNUA 1VJIA 5C5YA 4CGTA 1HW6A 1O94A 4TXEA 1XPYA 3LHVA 4D6HA 4Z2LA 1HGYA 1P0EA 4NZ4A 2WNWA 3KLLA 4BQ2A 1KXTA 1UJPA 1XSJA 3SCPA 1H11A 4P8WA 4UR7A 1V7YA 1VKFA 2F9RA 3FK4A 3LXCA 4D8LA 3SY8A 1W9UA 1XDMA 2DT0A 1OCBA 3I6TA 3V35A 1TIWA 3P3BA 1DJZA 3LSBA 5LNSA 1QUMA 2HV5A 2ZUMA 5I24A 5HA7A 2BX7A 1TE6A 1NWRA 1RALA 4DYEA 3AIEA 3QHMA 3FEQA 1TV8A 4CQBA 2A3CA 2W4XA 2EAWA 3E12A 5ABFA 2E9MA 2GUBA 4JDYA 2F61A 4HYVA 4HGXA 4O54A 5HMSA 4PFMA 4QCEA 2ZUUA 3W1MA 2PWVA 4Q8NA 1M01A 1HP4A 3GZ3A 1WDDA 3QV9A 2CESA 4UNKA 3DUGA 2VZOA 3CAWA 1V6UA 2CBUA 1VR6A 4J40A 2G3JA 4UBPC 4FZIA 1GJWA 1I2PA 1K4GA 3JRKA 4S2CA 4K36A 2D0FA 1W9PA 1C3FA 2WKGA 3LTPA 5LNRA 4HYWA 3O0FA 4O28A 1VB9A 6REQB 2EGZA 1JPKA 1MEHA 3KS6A 3SRHA 4AF0A 2ZA2A 4GOAA 4GBUA 2XPKA 3HFTA 2QCLA 4JHMA 3DHUA 2XWEA 3W70A 1L0PA 1JDEA 4NZFA 3W88A 2VEFA 3FVMA 4B2DD 3E2VA 3JS3A 3EXRA 3W00A 3GVWA 1QI2A 3W1LA 4KF1A 2GQ3A 4IQJA 4LCSA 1MQPA 3W1TA 2J24A 5JVLA 3T2OA 2H90A 3VKKA 7CGTA 4FNQA 4IPLA 2OR2A 1MZRA 2PWDA 5CZKA 3PVFA 1BWLA 3N3MA 5D2VA 4F66A 5KZEA 2DT1A 2WMIB 3D6NA 3L4UA 2ZICA 4F0MA 2ZUWA 2O0TA 3R2GA 2YXXA 4AZGA 3IJ8A 2OSXA 3NZPA 3WH8A 2PF8A 1NOUA 2I16A 1XYFA 5LZLA 1JI1A 1BSLA 3CWHA 3W27A 5C54A 2GUUA 3DFPA 3CZKA 3KHJA 3QYSA 5D9MA 5DFAA 5BOOA 1XCXA 2YLAA 5AHEA 3UWUA 2ZX9A 3UP8A 3W83A 1JIBA 2PRMA 3R6IA 2ZBTA 5I3GA 3O6AA 1MVYA 4RZ6A 2FQIA 4LPCA 3MBFA 4XTIA 4P7QA 4GPNA 3W2JA 5I77A 1NARA 5FAGA 1CPUA 1IF2A 4HOXA 1GKRA 3W25A 4DF0A 3RYSA 3Q37A 1KKRA 3L2MA 4KT2A 1ZJBA 4MIMA 1O95A 4CN6A 2PBOA 1ZJAA 1OABA 2FTWA 4D72A 1EWEA 1X6LA 3G1RA 4Z42C 1QASA 3BQ5A 3AALA 3T0TA 5HOSA 4HU3A 5HWMA 1LQ2A 3UPWA 4JL2A 5L6UA 1R3WA 5IOBA 3R5EA 2GGIA 3EKGA 1H1NA 1UYQA 4MNJA 2H3BA 2J88A 4LH8A 4KETA 4LUTA 3RX2A 3CV1A 4AWSA 4HZ7A 3LBMA 2PTDA 2NVAA 1W3HA 4US5D 4V2XA 1A49A 3EOOA 4N4QA 1XXXA 1EC8A 1HP5A 3NQEA 1EP2A 4Q7NA 4Q4KA 4IMCA 5BXPA 1F6PA 5XIMA 3CMGA 4GUJA 3C0SA 1S5TA 2VDHA 1OWQA 4PE8A 2WC7A 2XHYA 2WMGA 2HE5A 3O9NA 2NQZA 2IPGA 3I7QA 3PANA 3RDKA 2FZMA 1AJ2A 1IIGA 3RM9A 3IACA 4XAYA 3STEA 1DHKA 3O0KA 3UVIA 2OU4A 3WUBA 1XRSA 1OC7A 1SMDA 1XDLA 3BQ6A 4D6JA 3ITYA 2Z24A 4ZO9A 5IFTA 4TX8A 1K7EA 1R3TA 2GOKA 3LLFA 4IP4A 3QF0A 2W79A 1QPOA 2OFJA 4B3LA 4EWJA 3S5NA 5LYRA 2VKZG 3UERA 1GVIA 2VURA 5EMJA 2DZUA 5T26A 1DV7A 3CZLA 2QQ6A 1T99A 1GOXA 5LNWA 2QV5A 4B3ZA 1TR9A 4S3DA 5EA9A 3AJXA 3O07A 3WN6A 1J0HA 3OZYA 3NGFA 4DLFA 4W4QA 2GWGA 3E0WA 4HNVA 1S46A 3QFEA 3E96A 4IJBA 3V4BA 2NV1A 4XX6A 4FHAA 2P0IA 3G2GA 2A85A 3EWCA 4QLJA 1K02A 1GUVA 3H12A 2UBPC 3VGHA 1V0LA 1AVAA 3MO7A 4DXXA 4HK5A 1OCQA 3FYOA 1VIWA 4IFRA 3UU0A 3PTMA 3BICA 4AZ5A 3AUJA 3T78A 3M5VA 5D30A 1HJXA 4I7UA 2PODA 3M0JA 2R8WA 1AH4A 1DVJA 1KFKA 4K39A 3SCOA 1FXQA 2HNEA 1TWZA 4S3EA 2OX1A 1A5SA 5A1AA 4TMBA 1UW9A 4DY1A 3BZGA 5DRIA 3W7KA 4AZ6A 4QE5A 4Q7IA 1KCXA 4B2DA 4S3JA 4U33A 2YB1A 3XISA 2BMBA 2HROA 2O9RA 2QAPA 3ICJA 1OQFA 1W3LA 4S3KA 4XKYA 1OVDA 3O15A 3W1QA 2XVKA 3ERPA 3OHMB 3QSTA 3B9NA 4E0CA 4UR8A 1UQZA 3C2OA 3GUGA 2FVKA 5FEXA 1XD1A 3W84A 3PHAA 3W23A 3W38A 4Y9NA 3VFLA 3UJRA 1DIDA 3KE0A 3SIMA 5I00A 5D2WA 1HJVA 2DDXA 3AIQA 2ZZ2A 1RA5A 4XD6A 4UIOA 3J7HA 3NZRA 1CECA 2TSYA 1C8YA 1S2CA 3CEUA 4O57A 4W87A 2V6AA 1XJBA 3V0SA 1G4PA 2EEXA 2PDFA 3CAKA 1OX6A 1OT1A 1PYFA 4L1GA 2TMDA 1DL3A 4Y8EA 1RR2A 3OPSA 1H7XA 3CXOA 2ZZ4A 1RV8A 4LT9A 1EIXA 2GSHA 1JYXA 3GR4A 3BSMA 2OWXA 3L66A 4HCLA 4PMZA 3ARZA 1NP2A 4NZ1A 3LLXA 2R1LA 1OX5A 1KLZA 3EPMA 2EPKX 4GY7A 1KV8A 4J3XA 2R82A 2DZSA 2HNHA 4BKNA 2VUNA 2YBUA 4OBRA 2J6VA 4YYCA 2W6RA 4UQEA 4E3VA 2B31A 2H6RA 2ZX6A 1XLFA 3AXKA 3M7SA 4ACZA 1JCMP 3TLQA 3A4WA 1WBJA 3G0XA 3HV8A 4PBFA 4CD4A 4R34A 2PA6A 3VKAA 4ZEPA 5A8OA 2J8FA 3MP4A 3VZXA 4B5XA 1Q85A 2GK1B 1CCWB 4WDXA 4GJJA 3N14A 3RLGA 1E6PA 3WJYA 2QF8A 3K1DA 2CW6A 2ZZ7A 2JIEA 2REQA 1PBGA 4US5A 4DWSC 1D7KA 3GRIA 2HK1A 1TFVA 4BI6A 1WA3A 1VFUA 4JFVA 1UB3A 3WQGA 3QPYA 4PC8A 3LD5A 2ZDRA 2WVVA 1P1XA 3EDJA 1IGSA 1UWSA 5D9NA 1GEHA 3BMWA 2Y61A 1BHGA 4HSOA 3WUEA 3IARA 3BOFA 4ZQOA 3M1ZA 4O19A 3VGEA 1QPRA 2XTKA 4HMEA 4G1KA 3L4XA 3N6HA 3ARYA 3CPRA 2AQOA 4PL1A 2E67A 2ZUSA 1VENA 4WK9A 3VIFA 5FSEC 1FDYA 2WM0A 2IPWA 1A3XA 1TREA 3KLKA 2XFWA 6CGTA 1YHTA 2WQDA 4P7LA 2PAJA 1OIMA 2G50A 3PSVA 3WEMA 2BGNE 1T6MA 1GVFA 1QK2A 4MKNA 2J9ZA 1DWAM 4Z2JA 3H2EA 2DP3A 3VAVA 4CN4A 4LS1A 4OT7A 1EDTA 4NY2A 3N4AA 2AL1A 1O7AA 4JTQA 1TPH1 1GKQA 4AVNA 5IHSA 2X0YA 4HK6A 1XBZA 4XTDA 2Y63A 3ITCA 1PEZA 4FNRA 2PMQA 4GXMA 4RXFA 1FWNA 3NXFA 1Z89A 2CLKA 4Q8VA 4YTTA 1ISYA 1BLIA 1ME9A 3E5PA 1M3UA 5IBXA 4ATLA 4OE7A 3N19B 1QO5A 1VZWA 2D1ZA 1GVRA 5HPOA 2V3EA 4FF5A 3RUBL 4I8YA 5KTLA 4C1NA 1YXCA 3TYZA 4NXKA 2BP1A 4F2TA 3KBSA 1GOQA 4B5NA 2YZ5A 3H21A 5D4YA 5JMUA 1J79A 4K3ZA 4M6PA 1VEOA 4XUYA 2V82A 1E55A 2X05A 4LAZA 3PZTA 1YDNA 3SJ3A 3T2QA 3NVDA 2A4AA 4QROA 3UWZA 4PTDA 5J04A 4B9YA 2JF7A 4WRHA 3ARRA 3WQ5A 1EPVA 4JOMA 1TWDA 2HXTA 2XFYA 4KCTA 2QCMA 1MDRA 1QDSA 4UTWA 5U4NA 4EWND 1R47A 3LCWA 2TYSA 1DXFA 3OLIA 1MQQA 4PR4A 3SUWA 1ISXA 1OX4A 3LK6A 5M17A 2ZX8A 4A22A 3G18A 1NSJA 4JFTA 2VOMA 5EPDA 3BLLA 1H62A 3TP4A 1EWDA 4JN6A 3OB8A 1EIBA 3BW4A 2A1YA 4IMGA 3G0UA 3ZT6A 4FNSA 1DKWA 3LGGA 3VPLA 2Y7EA 3QTGA 1AJ0A 2R24A 4OECA 2J9XA 4S3AA 3WQWA 2EXOA 1YKWA 5I3KA 2Y7GA 2A3AA 3A4XA 3VABA 1WX0A 2ISFA 3PWGA 4MM1A 3BV4A 3GDTA 3QV7A 3HPXA 3VM5A 1FX6A 1QPNA 3W26A 1AODA 4AY1A 4X61A 5FF2A 3B0UX 1PAMA 4IXHA 4PTMA 1RHCA 3IK4A 4GJIA 1CNVA 4UFJA 1E4MM 3BLIA 3C0LA 3PUDA 4PUUA 1XLDA 3FJ6A 3V75A 2V5KA 2BY2A 3UNTA 3AZRA 5FF3A 3PB0A 2Q02A 3WJWA 5F2GA 2GOUA 1ZS2A 2OYMA 3A3WA 5C7HA 1EGMA 2J47A 2J62A 5CZTA 2P50A 4TO8A 1W8GA 5BU9A 1WQ5A 1P6CA 5CG7A 3T40A 1V02E 3ARUA 1DORA 4DZ5A 2HDJA 3N9KA 1MQRA 4JHZA 1FH9A 1R2SA 1I1WA 1XH1A 4CUCA 3RJXA 2C0HA 3QPEA 1P1MA 4BF7A 2X1RA 4W7UA 3A5VA 1N7KA 1EJ7L 1E3XA 4UTIA 3RXZA 4LRSA 4DUWA 5F2MA 3FJ4A 2XSXA 5F2LA 3HQOA 3FLUA 1IEQA 4CNSA 3OIHA 1W3KA 2I5GA 4XSMA 2G96A 4RXGA 4WVXA 2EBNA 3NQFA 4QE4A 1H1YA 1QI5A 1BQGA 5I3IA 3PBUA 1ZY9A 3R0UA 4U5IA 1N8IA 1A4MA 1HT6A 4NX0A 1MRQA 4O15A 3LCIA 4GYPC 1DJQA 3L5AA 4GVFA 3OQ8A 2QCEA 2BS9A 3WH6A 3T9PA 4GRSA 3V5OA 2PF0A 2FFCA 2V67A 1PCWA 2OZTA 3H2CA 3E49A 1UC5A 1U22A 3APGA 3E2RA 2QJNA 1J0IA 1VHNA 1NJJA 1SFLA 3G1FA 3GDBA 1XLMA 3OLEA 1FP9A 1IHIA 1QMLA 3N25A 3PZOA 4GHRA 4K1GA 4XO6A 3U0HA 3K1GA 2FB2A 2PS2A 3W2LA 1JCJA 2EG8A 3U5YA 1W32A 1XLKA 3OZOA 2YYTA 1MUMA 4GIAA 4RE0A 4P7OA 3IGXA 1S3TC 1NDWA 2Z2UA 1QHZA 3V18A 4G6CA 3ZVIA 4M29A 3W7MA 1QT1A 1OD0A 2O56A 2SFPA 2JK2A 3MCMA 4QX4A 1UWQA 2A79A 2V3FA 3DN5A 1RQEA 2CXEA 1D8WA 4G1NA 1K9FA 3BJFA 2ALDA 3Q67A 4CEUC 3QR0A 3OQEA 4QEEA 2ABBA 1P6BA 1RVGA 2CERA 3FYYA 2QJMA 2XISA 2Y85A 3N15A 4Y90A 3GTIA 4ZOAA 2VP8A 3KDNA 4S3FA 5EKYA 4Q32A 1AQ0A 2BY3A 3L0NA 2EHHA 1W6TA 3C56A 1GEQA 4JEQA 1W9BM 3BLDA 2FLIA 4GVGA 1C9WA 5FIPA 3GVQA 1LWIA 5E93A 3R79A 2UZ9A 4WGHA 1TUXA 4KERA 4AD2A 5M03A 1NVMA 3TJXA 4KGJA 4UNIA 1TX0A 1UZ4A 3C0JA 1FHDA 3AISA 1CTNA 3THDA 4DZIA 1MW0A 3SY1A 5IBXC 1W2VA 4TVUA 1WNOA 3DG7A 1MXDA 3RRXA 2PLJA 4CLMA 3QOKA 4TMCA 5CAHA 1GJUA 5BWAA 3M5ZA 2H3DA 1SZRA 2E1WA 3S8HA 3CQIA 4D9PA 5BW6A 3BXWA 4O52A 4GKTA 3RILA 1MZHA 1N82A 5HAOA 4LUSA 3KBMA 5JXQA 1LQAA 5K9DA 2W3ZA 4JFUA 4UQDA 2HXUA 4LSBA 1A5LC 4GE8A 4GYFA 1KFLA 1OFQA 1E5JA 8XIMA 4M24A 2ZADA 4LVBA 1E40A 1I0BA 1ZENA 3WFLA 1C92A 3NPVA 3POCA 5FI8A 1OYAA 1JYVA 4HKPA 2VYOA 1WDRA 1EHNA 1NFPA 3R0DA 1DWJM 4CNUA 3B9OA 3ID7A 2G4JA 2C14A 2RJGA 3H54A 2D3LA 3F4DA 1VBHA 3TR2A 3FDGA 1HKWA 1EL3A 1RUSA 5LIUX 3WEZA 4F9JA 3G0SA 3SAZA 3SQSA 1KM3A 2IQTA 1WZLA 3LI0A 1R9ZA 3E74A 4P61A 4BI7A 3GU9A 3RFAA 2VR4A 3SSJA 4CD5A 5FCZA 3CS2A 1KRAC 1TA3B 3VIOA 2NZLA 3HZ3A 2TRSA 1RD6A 3NQDA 3WH9A 3P8JA 1TKKA 1XGZA 2ZCGA 1WBHA 4LAOA 1KXHA 3DYMA 1BXNA 1BF6A 3BLKA 5EMYA 2V2CA 3MI6A 3GG7A 3GU1A 5HJLA 3LXBA 4M8UA 1JZ7A 1SR0A 3HG4A 4H04A 4JKLA 4HCHA 4JPGA 1XLJA 2OGJA 4XBSA 1WXYA 4JIEA 2YFOA 4C6BA 4LS0A 4FLSA 3QKEA 4X63A 4R27A 3W28A 2FJKA 2BHUA 3T6CA 4HOWA 1XIIA 2I1OA 3KTSA 3IS4A 5I3HA 3HPZA 1HTIA 4AHPA 3LYEA 5KITA 3ZJ7A 3PBMA 1BYCA 1Q45A 3C2RA 4M0XA 4LU0A 4PCNA 1ODUA 2Y4SA 3BJSA 3TYCA 2E1DA 5EU9A 2GL5A 5A2AA 4QFUA 4DYJA 2VUYA 3QGAC 1A3HA 4MOZA 1XIFA 5E0KA 1GZJA 1FHVA 1LROA 4UXDA 3BW3A 3WQFA 4DX3A 4PMNA 4UR9A 4FIRA 1WYIA 4EPBC 2WNNA 1PO9A 3D46A 2OMAA 2X30A 3O8AA 1M6JA 1V08A 4RDZA 3WIJA 1TG7A 4JNYA 4XUGA 4PSRA 4UQCA 3E9AA 4KCVA 3SN4A 3QC0A 2PBGA 5ECVA 3TNOA 5DMMA 2O9PA 3LLDA 4R85A 4HJWA 5K4XA 3L4VA 7TIMA 4TX9A 3BGJA 3WBAA 1DQUA 2FHFA 3I7RA 1L6WA 2B7QA 1WZAA 3NDOA 2Y0FA 3RRAA 4ZZ9A 3QM3A 5CPOA 4DIAA 3WF3A 4ML9A 3EKZA 3WJXA 3OZPA 1UUQA 5HMFA 1NOWA 1ONEA 1TVPA 2G37A 4MKVA 4OU1A 1HFBA 1OFOA 1Q2RA 4QS5A 1POJA 3HIJA 5KZ6A 2EPMX 3WLQA 5BNKA 3ZVHB 3K4AA 1G67A 1V51A 3OYZA 3EWDA 5CC3A 2ZTKA 5B7ZA 4N7QA 5EB8A 1O60A 1UBPC 3GHUA 1XIDA 1ITQA 1D8CA 3IJLA 2ALRA 4BS0A 1OEPA 4Z1BA 4S23A 1PZ0A 3TW7A 1XQKA 5HUPA 3H55A 4Q8MA 1UH4A 5EL1A 1AL7A 4WSHA 1B0IA 1JPIA 3R89A 1PZ2A 2J7FA 5D32A 5H8PA 3OYXA 3LHWA 2H8ZA 5I79A 4IGHA 4OV4A 1GVYA 5H6HA 4B91A 2V5BA 3GXFA 3FYPA 2IPJA 1KC7A 4H9YA 1VPXA 4O0KA 3TXVA 1MUWA 1H61A 4PCSA 2Z2AA 2NW0A 4CVUA 4IL2A 1P5BA 2ATSA 3DFNA 3L2IA 5A2CA 3G1DA 2CWXA 1YE6A 1H7PA 4GY0A 1TR1A 4V33A 4IQLA 3TA6A 1YDVA 3E2QA 3NO1A 2JBMA 4C7DA 3AXIA 4IHCA 4DJFC 2X0SA 2GVGA 1TV2A 1SZGA 1VFLA 5CSSA 3G1YA 3D0CA 4CEXC 2QPUA 3LZ5A 3K2GA 4C91A 1XINA 1XRVA 3KOFA 2XZ9A 1VFTA 2Q6ZA 2DORA 4MPKA 3QTPA 1JZ8A 4DYKA 1EYEA 3CT7A 1JDDA 5T8GA 2WHJA 1IZJA 4MJ2A 1S2TA 5JBFA 1LOSA 4H9TA 2OEKA 1XG3A 2J74A 3SR7A 3GDRA 2PWGA 4UTUA 4QSFA 4PUKA 3CIWA 3TKFA 1DTUA 1W2PA 2C1IA 1C90A 5FJPA 1PCKA 4KRZA 3NPUA 2X7WA 4F0SA 4D6IA 4L4PA 3T2PA 4WLCA 4BR1A 3QMTA 1EJUC 5LXEA 3BE7A 3NO5A 1I2QA 4F0LA 3LBCA 3VD4A 3CJPA 2F2HA 3M0HA 3THAA 4AW7A 1EEPA 2OYKA 4KGLA 1BYAA 4FXSA 3ITOA 4CCDA 2CHRA 3RCMA 1YNYA 1TV5A 2VRJA 3O3RA 2UY2A 2R14A 5I3JA 1Z9AA 1F9CA 3RPDA 1HKVA 3MU7A 4O13A 2DVUA 1IE7C 5EBAA 1ZBWA 3HMJG 5MHBA 1NF7A 4GACA 2BSLA 4O8AA 4EXBA 4EE9A 3F4NA 1XYMA 4S38A 3W4RA 3L4WA 3JR2A 4WUIA 5CPSA 3A21A 4XG1A 1GZGA 3IGUA 1IXQA 3NCOA 2BFGA 1P0BA 1AD1A 1V93A 2QMKA 4FX8A 1QW9A 3ARVA 2CWNA 1ONXA 1W1B1 2KAUC 4PL2A 3B03A 4TUFA 1FWFC 2YDAA 3HG3A 5MF5A 3UJEA 4ZODA 3SIZA 4RW5A 2PD5A 1TRIA 1I8JA 1KR0A 1WKYA 3W71A 2HVNA 3MMTA 4MY8A 1TJRA 2YXGA 4MF4A 3IGSA 1W5OA 3HPFA 9XIAA 4JL1A 2YBTA 1XHGA 3WQ8A 1ISZA 3O6YX 4TTGA 4WSJA 3AHZA 1LRTA 2HVOA 4QJ4B 4ROQA 5D03A 2E5BA 1A5UA 1FWRA 3S5YA 3WUFA 4MUZA 3URAA 1CGUA 2BV9A 3GYEA 1AD4A 5D09A 3N2BA 3LBOA 3GSMA 3GAYA 3W1XA 3WDHA 3MUXA 2YIHA 4JR5A 1FA2A 4HCDA 1B3XA 5I0DA 4ACYA 2ACUA 3TE9A 1RD5A 3TJ4A 5C8BB 3W9ZA 3D3AA 3FA4A 1Q6RA 3H2MA 4M81A 2OEJA 4QEHA 4Z2GA 4ORIA 3WO8A 1TELA 1TMLA 3BTNA 1QJWA 5HNRA 2VEPA 5HXMA 2CYGA 2Z6IA 3W74A 1SFJA 2G3IA 2WSKA 5EBUA 4ERIA 1U1UA 1JI2A 1IXPA 5BXSA 4K6AA 2B0MA 1YPXA 1ME7A 3K46A 5GNYA 1UP2A 3EB2A 4R9OA 1D3HA 2OQLA 1VF8A 1HIZA 1X38A 3N2XA 2FHBA 3AYRA 3URBA 4S1FA 4CNPA 2VWTA 1EFZA 4AF0B 1KM5A 2ISVA 3I10A 3DECA 5D05A 3QH2A 1XFBA 3AYSA 4UCGA 2XDFA 4LF1A 7TAAA 4K7VA 1RK5A 2GSEA 4JHOA 4RX0A 4JYDA 2VL4A 3R0KA 4E4PA 3P74A 2IKJA 1OT2A 5CC7A 2NLIA 4QG9A 4XBKA 2ACRA 1X8FA 2Q8XA 4PMYA 1AMYA 4UTLA 2ZVRA 1IWAA 4MZ1A 4FNTA 3CZ8A 5HNUA 1TE1A 3W7OA 3GTXA 1LJYA 4IJCA 4UMCA 1Q6FA 4M7SA 5C6MA 2PWEA 3VMPA 4JIIX 1XIEA 4BQ3A 5DXXA 3URQA 4G9PA 1B9BA 3SUTA 1Q6GA 2C13A 1OYBA 2X16A 5HQLA 1F6KA 3MQTA 3HJEA 1IWBA 1EP3A 1OJXA 1NU5A 3NZGA 3NEHA 1FVPA 1W3NA 2HS6A 3TMLA 1OB0A 3ZM8A 1NDYA 3T4CA 3ONCA 1V4YA 4DM2A 1E15A 1S2WA 4I9JA 4EPDC 4WD0A 1R3VA 2CKRA 2RH9A 4LYPA 1J0YA 4QJ3B 4X2PA 4C6LA 4IFKA 1JD7A 3V0TA 1XP3A 4E5TA 3KWSA 4C1LA 2YYUA 1BWKA 4CQAA 4U31A 2GK1A 4MB5A 2OT1A 4DNMA 1BG9A 1EOKA 4JTJA 3S9YA 3REQB 5BMWA 3THUA 2BTMA 3ALGA 4J1OA 3WCZA 1MDLA 3FKRA 3SY5A 3SGGA 3UYIA 3W1AA 4Q8UA 3F03K 1W1TA 1H2JA 1RPKA 4ASTA 5JU6A 1A5OC 1TIMA 2ZXQA 4TU1A 2YZRA 3MKKA 2YBVA 3UXDA 3WDIA 5F7UA 1EQPA 1J93A 3EXTA 3NSMA 4AUBA 4H8VA 3IJDA 1BF2A 3NPWA 4Z1YA 1DWGM 4HPHA 2FPVA 2V5JA 1IZCA 3A23A 3V7PA 2HJPA 4U2YA 2EKCA 2AAMA 5JQ9A 1S1RA 2HCVA 4X9SA 1FH8A 1KTCA 3GHTA 1KCKA 4UFKA 1F3XA 3C3NA 2DZAA 4GIEA 3BLOA 3WQ4A 3LY0A 4JICA 3MP5A 5H2ZA 4ZOBA 4HOZA 1TPWA 3BL3A 1QNSA 5FA5A 3BCJA 4HN8A 4DZAA 3S5SA 3WBEA 2C19A 3W82A 4HN4A 3TQPA 3BDKA 2DW7A 4EACA 2PB1A 5MKGB 4C6OA 1UIOA 3UZYA 3UZWA 1WOAA 2QULA 4DO5A 3ZXWA 4YVVA 4NAFB 3WNLA 3TAKA 3V3WA 3NJ3A 4R9XA 1EHAA 2XGIA 1MEWA 4LTSA 5HMEA 1EO5A 4IZGA 2ESCA 1QPKA 5AYXA 1LBLA 2O7SA 1X7FA 1BKSA 1VFSA 3QSRA 3VKBA 1Z44A 3TK7A 1GQLA 3GFXA 2ZWZA 4G7FA 5CLWA 1XV8A 4DUXA 3TROA 2D69A 2ODOA 5DCDA 1FWCC 3ZWSA 1BSIA 1A80A 1ZUAX 4NASA 5G4HC 3VK5A 3VM7A 4W5UA 3GNOA 3WQEA 4RCXA 2FH8A 2OWCA 3W7RA 1JRCA 2ZRZA 4E8DA 2XH2A 3VOFA 3IIVA 4J5NA 5CPTA 4CQCA 5FKYA 3E0LA 4CNNA 5AHFA 3N9SA 4Z1DA 1IGWA 1RY0A 4XZ9A 1R86A 3KTCA 1H0IA 4GXPA 3MANA 4D8ZA 1EC7A 1OGGA 1JD9A 1ALDA 3Q4DA 4L4LA 1C93A 3OGRA 5J5DA 4NSBA 1RJRA 1FCUA 1D3GA 2GJLA 2Y70A 4P8UA 4O1EA 3UY8A 1UD4A 4B90A 4YWIA 2CLFA 2GWNA 2OTDA 5K4ZA 4RLIA 1UD3A 3KBNA 3T07A 2Z29A 4ICNA 1CGVA 1E9IA 2WPGA 2ISSA 1LCOA 4AY8A 4GA8A 1GVQA 5EMMA 4DQWA 2BY1A 1IT8A 4Q33A 1AQHA 4GUIA 4GCAA 4H83A 5HUOA 4GQ0A 4H01A 4LY4A 2FIQA 3QHNA 4H6KA 4IPNB 1AQMA 1OFBA 4FX7A 1IT0A 5LA2A 5EMKA 4D8AA 4MNMA 3WLJA 2DV0A 1CDGA 3LHYA 1KFWA 4CNOA 3CUXA 2YR1A 4XZMX 3PR2A 3CUHA 2J4GA 3UWQA 3CAQA 2WM1A 1DJGA 4X22A 3CHDA 1R7OA 1TPFA 3W22A 1XL9A 4MWAD 1VH7A 1PPIA 1TVLA 1SW3A 3EMQA 2VCAA 4OBTA 3VNMA 4ZVJA 2UY5A 4IPPA 6ALDA 2ZRUA 4MJZA 3VC6A 4P8XA 1HKKA 3BK0A 3DFQA 1EX5A 2QDDA 3TJIA 3VA8A 1N8FA 3A5FA 5JIWA 5FEZA 3M46A 4HYRA 4Q8QA 1O12A 2HMCA 3WEOA 4ACZB 3GVRA 4I6VA 3ES7A 1A0DA 4IH3A 2VNCA 3S2JA 2CZDA 4AQLA 4V1XA 3S3GA 1DJWA 1G94A 2NT1A 1YPFA 2XZ7A 1D9EA 2YB4A 1XKJA 3HBLA 4GISA 5DBUA 1AQFA 3ITVA 3VIIA 2WJDA 2WJEA 3H6OA 1Q7MA 4PTWA 2OZ3A 3PPCA 3VYLA 3CUFA 4L7ZA 1NDVA 3V1HA 5A8GA 3UA4A 4S3GA 2C1HA 2V68A 4K8GA 3T44A 2REQB 2PDWA 2XIJA 4Z0SA 3NQ7A 1EZWA 3W73A 1EBGA 1CGTA 1EC9A 4Q4RA 5HPCA 4FA3A 4H6EA 3QHOA 3ABSA 3ZWTA 4N2YA 4E3TA 2YLLA 4PTNA 1UOZA 3KVKA 3R58A 3KP0A 2B7NA 2WVVB 4J3VA 4I7VA 5K2ZA 2VFDA 1OGBA 2WOQA 2QAFA 1Z8AA 4U3CA 1LLZA 3SCUA 2PDMA 1AH3A 4EIVA 2OCZA 1JPHA 3HQ1A 1V3HA 4UB9A 5AVHA 2QDGA 3W72A 3HG5A 5M2FX 4DF1A 3CT2A 2TPSA 2PDKA 2J66A 3WFAA 3C61A 4CQ9A 4PULA 2BODX 2VI0A 4MY1A 3AROA 3AYTA 3B8SA 1Q66A 4MDPA 2VFEA 3QQ1A 1HN1A 1FCBA 1KTNA 4ZO6A 3PG9A 4UFIA 4UTFA 4GQQA 2IKGA 5CH9A 2P8BA 3IJ9A 3MUZ1 1BFNA 4EAMA 1E1CA 5FJUA 1ZALA 3QVQA 1IV8A 3UZZA 1Q8JA 4C90A 1WPCA 4DJED 1X6UA 1U1HA 2XN2A 3GHRA 1A53A 1ZPTA 2C3ZA 4RE4A 2QCDA 3KL3A 3GG1A 3ITXA 5DX7A 1Q2SA 4C5ZA 3E38A 3N6QA 4BI5A 4JX6A 1JEZA 3F2DA 4UQAA 1THFD 3UYCA 3OLGA 1R2RA 3PBVA 3TR9A 4HU0A 5DMYA 2NWSA 1SM9A 2D2JA 2NSXA 1JPDX 3GO2A 4C1NB 4MFEA 4ZFMA 4V28A 4FLRA 4JTCA 2BOGX 3FS2A 3ZR6A 3IV3A 5DRCA 2CLIA 1DBTA 2PU1A 3IEBA 2CLOA 4F48A 2I7GA 5HINA 4L4MA 5A8MA 3KRSA 2CLPA 2HISA 1B30A 3O06A 1CZ1A 3VIJA 3FY1A 2W91A 3R11A 3QLDA 1QCWA 1Q4NX 4AH7A 4LANA 1V6YA 1CXEA 1XCFA 2VO5A 1DXEA 1WXJA 2V5LA 5LIXX 2NQLA 4N0RA 2INZA 4IIGA 3SI9A 2ABAA 3WLPA 1Z69A 1Y5WA 5FAJA 7ENLA 3C0QA 2YA1A 4O11A 2NUWA 1UR9A 2YSWA 2ZOXA 4E8GA 3N4FA 3PPGA 1OX4B 4POCA 2GQAA 3WNKA 2FPYA 2DUAA 1TPUA 1DIEA 1QOPA 3U2OA 4ES4A 1KB3A 3HA1A 1XG4A 4C6QA 2QPSA 3M5YA 1QK0A 1OYCA 4IL0A 3W01A 2A3LA 2O4QA 3UXLA 2Z00A 1KBKA 3GTNA 4CCCA 1CW2A 5G4EA 2VX4A 3NNTA 1C7SA 4I3GA 1C29A 4DBUA 4M56A 5TBOA 4BQ5A 3BWWA 3THCA 2E9LA 1BVWA 1O6IA 3WLTA 1F76A 3R8HA 3HFYA 2VM8A 4MWAA 5FD0A 4Y9AA 4CD8A 5ABEA 2VRQA 4NXSA 4E4UA 2VEIA 1F2JA 2O7QA 3SN0A 3KAOA 3SEPA 4J3TA 1JZ5A 4W86A 4XAZA 4N9BA 1B9ZA 5BRBA 1TA3A 4HSHA 3B0YA 4C6CA 4P2VA 4HPJA 1OGSA 1GQIA 4WGXA 3LQGA 2JALA 3ES8A 1PS9A 2Z1KA 1GT8A 3QMSA 3M7WA 4RW3A 2V2HA 2OSYA 3WF4A 3L0GA 3S6DA 2DFAA 1UPMB 1GQNA 4GNJA 5HR7A 3B05A 1R87A 4Q22A 3JZEA 3LX9A 3PP7A 4FP1A 4JQ1A 3B06A 1NP0A 3QJAA 1AA1B 2A3EA 1SMAA 3W2NA 1L9WA 1ME8A 5KMYA 1BD0A 1H3GA 4GI4A 4M1BA 1ZAJA 1MW2A 3AIVA 1HO4A 3KOWA 4AD3A 3B3DA 3P5ZA 3GBDA 1QVBA 1PWMA 3NL5A 3NM1A 6TAAA 5CG0A 2RDXA 3ABZA 4AISA 3DX5A 3ZJ8A 1IEXA 3MTWA 3UY7A 4HP5A 1QNOA 1O4UA 3NFUA 2P88A 3DGRA 5M3WA 3TVAA 4L4OA 2D20A 4M51A 3AUOA 3UVAA 1Z7AA 3B8IA 1UZ1A 1XLCA 1ZAIA 3CB8A 1KXQA 3FW6A 1C9DA 2OEMA 4UTJA 4W5ZA 2I14A 3R12A 3QY6A 2BHYA 3VOHA 2DVTA 3HOJA 2VELA 3CQ0A 1ZB5A 1QI3A 3AHYA 5I2UA 1QWKA 3NDYA 3LU2A 3WFZA 3OTRA 3AXMA 3TTSA 1FCVA 1KW1A 4NUWA 5E9XA 3CHCA 1NM9A 3FHAA 4XK2A 2J7DA 3AMDA 4YPJA 2V30A 3UG8A 1E51A 5I78A 4K2SA 1WV2A 4TR9A 1R6WA 4HQVA 4GFIA 4H4IA 9CGTA 1VEPA 1DJNA 4B15A 3UCQA 1YE4A 1RBLA 5IHRA 1X96A 4F4RA 3CYVA 5DT7A 1K8YA 1UJQA 1M7JA 4Z08A 3ALFA 2I56A 1W3TA 3KTXA 3W3OA 2J25A 5DCBA 4XVEA 3P80A 3ZVHA 2E09A 4L6DA 1Q8AA 5CKSA 2DSUA 2GZXA 3QRHA 5LXXA 3QMRA 2F6KA 2GQ9A 4QIUA 1DTNA 4XIAA 5DCEA 5FL1A 6XIAA 3WK3A 2W61A 4F2BA 1SZEA 5ABGA 3NQ6A 1TPVA 5AC7A 4GYJA 3IUDA 4Q4SA 3PNZA 2NQ5A 3F5KA 3A3HA 1UHVA 3T7VA 3GU2A 1UKQA 3T0CA 3VIHA 1IEWA 2E0PA 2Q3OA 4ICMA 4WKHA 3W29A 4GI8A 1KGWA 2QCFA 5EY5A 1CXFA 1NF0A 4UUIA 1TTJA 4LNYA 4S3BA 3MHUA 4C6FA 3QY7A 1T41A 4FALA 4PZVA 3RM4A 1S2VA 4PUNA 2C7FA 4NJJA 4CCZA 4M3PA 3C52A 1WZMA 4JX4A 7XIMA 3FCPA 5A6JA 3KRUA 4HPGA 1WOBA 3W1PA 1E6RA 4AWEA 2R1MA 2ZTJA 4DN1A 3QOMA 1FKWA 2OQYA 1AZ2A 3QEZA 4DF2A 4QQ3A 4L65A 3VKJA 4QP0A 3RU6A 2P53A 4LUSB 4IP7A 3CUZA 4GG9A 4RKAA 2R1KA 4YYFA 5BOFA 3BAWA 4CQ8A 3DIPA 1OG0A 2BBFA 1JG9A 1E9LA 1UWUA 1X98A 2Y5JA 4ZE4A 1LZOA 4D6FA 1K6WA 4E38A 5G2IA 4RE2A 1QHPA 2ZX5A 4PEEA 1G7VA 3STPA 2YX0A 1OK4A 3EDFA 5E0FA 2XIMA 5F4SA 1UP3A 1ZJHA 4LUJA 5HANA 4LCRA 3F4CA 2P76A 3VMOA 2GGGA 3FSUA 3IAPA 5C9ZA 1VPQA 3WH5A 2WCSA 5D2YA 4ENLA 3R7MA 2ATMA 3S2CA 5DY2A 4AX7A 1RY8A 3DC0A 2WHLA 3CPUA 4LC8A 4NKCA 4AXNA 3N12A 1LRQA 2BASA 1U1JA 1H5YA 2ZA3A 1YMYA 3PC0A 1O5XA 4AZCA 1UZHA 4NZ3A 1LP6A 3BGAA 2ZYFA 4RNJA 3GY1A 1TZ9A 3GTHA 1Q6CA 3FX4A 1ZRQA 1M7XA 1AW2A 1US2A 3CH0A 3RR4A 3S1GA 4S3CA 2ZKMX 3SECA 1U30A 2OPJA 1J6PA 4MHBA 1O5RA 3PZMA 2BHZA 4AG0A 4C60A 3S9IA 4YU1A 3OO2A 4MAZA 1GONA 2HSAA 2Q8LA 4LAMA 4H9VA 2ZX7A 4A3YA 4JKMA 4K37A 1WP6A 3VX1A 2VX5A 3GFYA 3CQJA 4KEMA 4U2ZA 3U4AA 3OLDA 3IGHX 2E8YA 3FIGA 1XLLA 2Y1HA 3S0CA 4NNCA 2DZXA 4ZL1A 4I8DA 5A6BD 3TN4A 1D2KA 3BLEA 3VC5A 1KKOA 4HZMA 3RM8A 2W9MA 3PJWA 3PZQA 1MEIA 4IIHA 4XV0A 3UG5A 4EF8A 2PDLA 4O50A 2DQXA 2JFEX 4LW7A 1JF5A 3B0VC 1YTEA 3N34A 1ZL1A 4J7RA 4EK7A 3AOFA 4AXKA 3SFWA 1UR0A 3SJNA 4C6NA 1MSSA 1RPXA 5L9FA 2DZVA 3CHEA 4DB7A 5XIAA 3GC4A 1B90A 1HF6A 3MW7A 1P4CA 3G6LA 3U7VA 2OODA 3GWQA 4JTFA 3OG3A 4U28A 3BAKA 4AMAA 1FWGC 3GXDA 1J12A 4ZCWA 2PGEA 2B81A 3AIUA 4I9AA 3HU7A 1XH2A 1RQHA 4IT1A 3DBNA 2FH6A 3TNBA 3TJLA 3T0AA 1CB7B 2QJGA 4AX6A 1B3VA 4PSPA 5G1MA 3L4YA 1FTXA 3WK2A 1SR9A 5HNTA 3TWBA 5AC4A 3EWBX 3U8GA 3GXIA 1JZ4A 1A0EA 4N9CA 2AKZA 2J77A 3A4AA 3U57A 4CD6A 3B9DA 3PB2A 5CJMA 2AGKA 1YBQB 5REQA 5HMDA 2E6YA 1IXOA 2FGBA 4E2OA 5DEZA 4EPEC 2WK2A 4NZCA 1K9DA 3BAJA 1XIGA 1V0MA 1EF2A 4W8AA 5TAOA 3PZ9A 4MDOA 4Z2KA 1JFHA 1FFRA 3AS0A 3W1UA 3QV6A 1W17A 2V3DA 4KEUA 4AEFA 1I4NA 4BZYA 1IEVA 1LLOA 1B2YA 3OIXA 4CQDA 1O66A 2BVYA 4BEQA 4A2SA 1S38A 1ZCCA 2VFHA 3TCSA 1FHLA 1M5WA 3DFHA 2O55A 2IS7A 5LGXA 2GVYA 4B4FA 3LEPA 3MHGA 2P8CA 4JEJA 5HULA 1BYDA 2BVDA 2PP1A 3WY1A 4XAPA 1XRTA 3N17A 2R91A 3DI1A 1GPWA 1E5NA 3LS9A 1K03A 3CU2A 3R8GA 4RNIA 1PIIA 2BXVA 4FO4A 5LIKX 2ZZ5A 4BK9A 5JH2A 4DBDA 3TC7A 2PGRA 2QR6A 4LALA 4OGZA 1R7AA 2ACQA 1KWGA 1YDYA 1WAWA 2TAAA 2VC5A 4KIRA 2NQ9A 2R1PA 2OKOA 4MLRA 3ZOAA 1TZ7A 4H2HA 3RN6A 4QG8A 1TTIA 1V3IA 3RLVA 3JU2A 3GR7A 1G6CA 1OD8A 3PWAA 4UTKA 1WDSA 3G3DA 1EDQA 5T9CE 2PDHA 1SYTA 2VFGA 1G4EA 1UKTA 3U2CA 1XYLA 3UEQA 3MVIA 1SPQA 4TVDA 4H19A 3UXAA 3VNKA 4O1AA 2ZE3A 4IIBA 4H8HA 3LG3A 1E9ZB 4JIRA 2VEKA 2Z28A 1K3UA 2X1UA 3SZ8A 2BNJA 2POZA 5JH1A 2PCEA 3AZSA 2PTYA 3PZGA 3NQMA 1PHQA 3DHDA 3M0LA 1Q4WA 4PUMA 4IGSA 2OGYA 2B7PA 4PMRA 3SCQA 1XIMA 3MPGA 2JF6A 1J4EA 2RGMA 1DWHM 1V0NA 4JY8A 4FAMA 3C5QA 4A2RA 1QW8A 4R7OA 3LMYA 3A24A 1ODZA 2GLKA 1TPC1 3VUPA 3KVJA 3REQA 3MZNA 3KBJA 1HKMA 2PRLA 4LC6A 1PIFA 4H8UA 3L12A 1SUXA 1QTWA 1RCOB 3UA3A 4R7JA 3LRKA 3BPWA 3DYPA 4B9ZA 3APYA 1SJAA 2XVLA 3D47A 3QV8A 4V1YA 4IWWA 4DJDC 2WVSA 2A6NA 4OFCA 3W7HA 3LCHA 3BW2A 3ZZ1A 2GDQA 2QW5A 4AHQA 4C6JA 3VDAA 3BOXA 2FVMA 3T09A 3Q2DA 1VGAA 5I3DA 1W91A 2CCRA 1MI3A 3U9IA 1QOXA 2DZBA 1RJPA 2UY4A 1NEYA 3WQ6A 1CXIA 3EEGA 2EF9A 3GDKA 2AL2B 4B5WA 1P0KA 1H41A 3WD3A 1HX0A 1TV3A 3EWUA 1FOBA 5A6BA 2OYLA 5T91A 4IP5A 1W5MA 3K4WA 4LAUA 3UXKA 3DENA 3LSCA 3U2EA 1L6SA 2EJ1A 3LDVA 1YX1A 1UKOA 5FJRA 1DWIM 4MFDA 3RCYA 2V69A 1K7FA 1LT8A 4PUEA 1XYBA 2D2OA 2V5DA 3K4DA 1J8VA 2DIJA 2IKHA 3M07A 3N13A 5C71A 5FF4A 3RGTA 3M0YA 2KX9A 3SW6A 5MKGA 1AW5A 2F84A 3CZJA 1U83A 1J01A 3NM3A 2ZXAA 2OB3A 4IGNA 4NAFA 5FJJA 4JS3A 4H00A 4TOQA 3FFSA 1A5NC 2CBJA 1M41A 3S2MA 5C70A 3TSBA 2YW4A 4W7VA 3C2VA 2WC4A 2J7HA 3AFBA 2MUCA 3RHGA 1E73M 2Z1XA 1EJSC 1MUCA 4JYFA 3BG9A 4XZHA 3WENA 2FZ9A 2VGFA 7PTDA 5CC6A 3PTKA 4LVGA 3T42A 4XO7A 2ZXBA 4H7ZA 4G2DA 4AC7C 4YNGA 3N11A 2AQVA 5HNNA 2GSJA 1Q13A 2QZRA 4IISA 3UT0A 2WVUA 4WR3A 5FJTA 1JF6A 2B4GA 5ENLA 1TTQA 4IIDA 3S9ZA 3IV8A 4AZ7A 3LCLA 3M43A 5LHEA 1GW9A 3GLCA 2XIBA 4HNTA 4XBJA 2YCIX 3C8NA 2PTZA 4IM4A 4RL3A 3KW3A 1KRCC 4R33A 2PDGA 3PAJA 1E6QM 4Y9PA 1HNYA 3VCRA 3DG6A 5K9XA 1QI4A 4WQ6A 3DFTA 3FA5A 3PBYA 1UR2A 4GVIA 1TMHA 2B7OA 1IIHA 4DHGA 4HT3A 4P5UA 1AG1O 2C8NA 2CHNA 4HB7A 4ZE5A 5F2IA 1W8SA 2P3EA 3PTDA 4RV8A 1F3EA 3MSYA 2D23A 3DYOA 1EXBA 1UH3A 3EX4A 2I5IA 4MVAA 4UQBA 1OSEA 2J13A 2FB3A 3W24A 3GS6A 2WWCA 4JDBA 4PB5A 1NAL1 2VQTA 4IG2A 4D6EA 2XN0A 4PUDA 2ZXDA 4M7TA 1RAKA 1F8IA 3GM8A 5GPRA 3A64A 3SRDA 2G3NA 2DY3A 4D1IA 2PWFA 4JCLA 1A50A 3P60A 3SGUA 1W9DM 1M53A 1FP8A 1J0KA 2YFNA 4CNTA 3M64A 4ADSA 4WIWA 4WDTA 3U48A 5EYWA 2DUZA 4Z2IA 3VOCA 3WYZA 1WDQA 2GGJA 1EX1A 1HL9A 3PJUA 3ARWA 3GXNA 1GWJA 3LRMA 1PB0A 5I02A 1Y65A 1QO2A 2QMJA 3SCTA 4LUYA 1X8CA 1VYSX 4DXKA 1A5KC 3H4XA 2V2DA 2WSYA 4C6DA 4B5SA 4UCFA 2JE8A 3B04A 4IFKB 1BYBA 2RHGA 3PG8A 4QM1A 2FHCA 4QLLA 4UQ9A 3QFWA 3QZEA 2FZDA 2Q8ZA 3UNDA 1ISVA 4KFPA 3CL7A 4FB7A 3GUWA 2R6OA 2XIQA 1Q65A 2V63A 1CBGA 1K9TA 1G01A 3KBVA 3NL3A 1B3OA 4X9YA 1B4EA 3U6WA 4GABA 2OG9A 4YVPA 2VC6A 4JQ4A 3IIPA 1H51A 2E40A 3GIPA 1P7TA 4MJ4A 4IIEA 3AJ7A 2A21A 3LCFA 3UW6A 1V79A 3WJZA 4K8HA 1KO0A 4MGGA 4FF7A 3W2UA 3DCPA 2PFHA 3OG2A 5AYYA 4UZSA 4MZYA 3P2VA 1FWSA 2CLMA 5AHIA 1LTDA 3NQCA 2PDIA 4HBKA 1LORA 2DGAA 1FWEC 4XB3A 1UD2A 1PL9A 2QCHA 4GYKA 4IF2A 4DO6A 3IVUA 5AECA 4LYRA 5E09A 3A6OA 2PP0A 3WMCA 1DE6A 3LV6A 5A8QA 5PTDA 4KKXA 3WNNA 2YCLA 4IMAA 3E5BA 2OO6A 3CAVA 4V15A 1N55A 5RUBA 3W02A 3MI2A 1Q6OA 3PN8A 1NQ6A 3LUTA 1EJRC 4BCEA 3KX6A 2INFA 4N9DA 3IK2A 3FJLA 4CD7A 1KTBA 3G8RA 4QG6A 3SUVA 1GJPA 3VD7A 1VFOA 3TYDA 3TN5A 1YYAA 4AYSA 1OADA 2PDQA 1ICQA 5AYBA 5ABTA 1CXHA 2PWUA 4QHRA 3N04A 3IJQA 4JQ2A 1F3WA 1H7WA 3MYOA 4O53A 1Q5MA 3EA1A 1XW8A 4NZ5A 3MWAA 4I5UA 1O1HA 3K5XA 4O14A 3VXGA 2WMKA 4XAFA 4N4PA 3NXLA 5A6SA 4GIRA 4ZSUA 2WC3A 3UPBA 3Q45A 4GX9A 1ZFJA 4REQA 5F1VA 3TYBA 3YPIA 4J2MA 3G1HA 8TIMA 2ZE0A 1JVNA 3K30A 4NG3A 3L7RA 4OIFA 1PHWA 2F38A 3H53A 3I4EA 2O4MA 4RPQA 3KOXA 3WQPA 5CBBA 1E6SM 4C1KA 4PUJA 4IGMA 2NV2A 1EJXC 4JTDA 4Z1AA 3OVGA 1JDFA 4IICA 1LQ0A 5K9CA 1TCMA 3P93A 2WMHA 1P48A 4ZA0A 2VVSA 5CPLA 1LOQA 2PDCA 2X2YA 4NF7A 2E9BA 3LTYA 2CBIA 4KEZA 4AAJA 1K7XA 1NY1A 2PDBA 4NJIA 1DYSA 4FOUA 5CGMA 3TN3A 1R46A 4LBUA 2DSZA 1L2UA 3KL0A 3UR5A 2XGBA 3RG6A 2V3GA 1TV7A 4Y9MA 1S5MA 3TXZA 4DVOA 4QRNA 2YGYA 1V6XA 3NDZA 4E2DA 4FMVA 4UFHA 1ZLPA 3KZSA 2VMFA 4GZJA 4NRSA 4UOQA 1QBBA 4LOCA 3NOEA 1K8ZA 4JTAA 1D3CA 3T0DA 4A35A 1BTMA 3QZ6A 2JGQA 2VEMA 1E4LA 1ADOA 3A9BA 4O18A 3DC8A 4RNFA 4A3HA 3B4UA 1UR4A 2ICSA 4M6VA 3H70A 3H7RA 3W76A 1O5QA 2PC8A 5CZSA 2JKPA 3NURA 3CB3A 4Q8OA 4M19A 4JTEA 1MNSA 2XFRA 1L2QA 3SB0A 1SVDA 4JN7A 3KCLA 2QJHA 3PBGA 2XVNA 4QDMA 1MXSA 2C15A 2VXNA 1PX4A 1FWHC 4MTVA 4WKAA 3TOPA 3VOGA 2HQAA 3B9AA 5A6AA 1MRAA 2D3NA 1V6TA 2A7RA 3HPAA 1VRXA 5D9OA 3SQLA 4PODA 1SJBA 3T0BA 1GVEA 1UROA 3INPA 3WX7A 3CV6A 1NDZA 1SSDA 4CN1A 1DEDA 1FXPA 4RV3A 4HNLA 3MJYA 4ZOCA 4ICCX 1ZSXA 3QR3A 5G4WA 3S5ZA 3GC2A 2POTA 2V0TA 1US3A 2CBVA 3NIYA 3GXPA 6TIMA 2WSQA 3GNRA 4O10A 2PTXA 5DMNA 4L9XA 1F5ZA 2YPIA 3AYVA 3UWYA 4IQDA 3BZJA 3VCCA 4WJXA 2DH2A 4MPQA 1LLWA 3ZYZA 3NA8A 3VNYA 1Q7ZA 3NL6A 2VD8A 1SJDA 3BANA 5C0QA 2DT3A 2OX4A 1QI0A 4W7WA 4PEKA 5AZ1A 3ORWA 3SCVA 3VD9A 1F6YA 3STCA 1UWAA 4JBRA 2YW3A 4ZSTA 4KWOA 1KBJA 3MV01 1H5VA 1XS2A 1QFEA 1GTHA 4OUEA 1WKEA 4AB4A 3O6CA 2QUNA 3P14A 3V0UA 4Y7EA 2YKKA 4GMEA 3D5HA 2WZEA 3KFTA 2EPOA 3VNJA 2G97A 4NJKA 3P61A 2H9AB 5BMXA 3CK5A 3HGRA 5A6KA 4HNCA 3WLOA 2PSNA 2ZQ0A 1A5MC 3G22A 4JD4A 1ITUA 1W1IE 4XAGA 4D2JA 1DIKA 3URNA 5CBIA 3IVTA 3BUVA 3SO7A 1WAUA 3AHXA 4DAFA 4N6EA 4EX4A 2DQWA 4YCPA 5DANA 1Q3NA 4EVZA 3CLWA 4C6MA 4MJMA 4WDWA 1T8QA 4LRTA 1K8CA 1VCGA 4DWSD 4MAVA 4Y96A 1E1CB 1XYZA 4YTSA 1JAEA 3EX6A 3STFA 2QDEA 1KM6A 3MSDA 2C79A 2FZBA 3TQKA 3XIMA 2YA2A 1OBAA 5J8LA 3EGJA 3FKKA 3SCNA 2PI6A 2YL9A 2X1IA 2QCDB 1ITXA 3VU2A 3VGDA 1JGIA 2GJPA 1SU5A 4YMZA 1JCTA 3F1QA 4PMQA 2XSAA 4KW2A 5M5DA 5HDRA 2VVNA 3MDWA 5CQ1A 5LGZA 4PMJA 2PE4A 2VZSA 5FF0A 2GGHA 1TWIA 2G95A 3R10A 4Y2WA 4HU8A 3D3FA 2WMJA 4GH1A 3EDDA 3W7EA 2VR5A 4MG4A 2DJXA 3S47A 4UWMA 1VQTA 3GNXA 3JUGA 1WDWA 3TH6A 1HL2A 1L6FA 5A6LA 1JZ3A 1H7NA 1AH0A 3TZFA 2VGIA 3H7UA 4KWVA 1R30A 3PM6A 1QW7A 3S42A 1WUFA 2RUSA 3DKLA 4O16A 2WCAA 3N2CA 1YEYA 1A5AA 1F05A 3LV5A 1XX1A 3OZMA 3DHFA 1S2AA 1RA0A 3QR1A 1LBFA 4NJGA 3WLKX 3JZUA 3W7IA 1OF6A 3B0XA 3UWVA 1PKLA 2FTPA 2A6LA 1PDYA 3WNPA 4AZBA 4A3QA 3PFRA 1I2OA 1H49A 4ALDA 2PGWA 3SDOA 2WXDM 4LAKA 3L23A 1XLHA 3KWXA 3WLLA 2HS8A 5DMLA 3OBKA 5F1UA 5E1QA 4PCPA 3W7NA 3AMKA 3ENLA 1PTAA 3L0KA 4YLWA 3RPTA 1QBAA 1EF3A 4AY7A 5AKQA 2Z26A 2JEQA 7ODCA 3II1A 1QU4A 3VNLA 2CLLA 4JTSA 5DBTA 1GORA 6ENLA 1W5NA 2I9EA 4GH3A 3PPHA 3MUY1 3ZFHA 1SSGA 3EEZA 2CNCA 1WE5A 1POKA 1XH0A 3UPMA 4NJHA 2NXIA 4UTWC 3GW0A 4KH2A 1BVNP 1SO6A 3OP2A 4MMWA 4MYAA 3UGVA 2HWGA 1RZMA 2W0UA 2CZEA 2VC9A 4X60A 4DUVA 2X1TA 4MWAB 3W87A 2E4TA 1SFSA 3TW6A 3SQMA 2HE8A 3MV11 3DFOA 3FXGA 3AS3A 3MUIA 1X1OA 5D33A 2Y24A 1T7LA 3VO0A 4WHBA 5DO8A 1GCYA 3G1VA 1B1YA 2OZ0A 4C7FA 3W7DA 1JYWA 3F2BA 1PXGA 3A22A 1BPLB 3KS5A 4TVCA 1IT7A 3AS2A 4ZQPA 3L9CA 1I60A 1JUEA 1A5CA 1UG6A 5CAKA 1GZ1A 2J27A 5KSWA 1LUCB 3KP1A 3CL8A 2Q01A 4PH6A 2GJNA 4DPPA 3VD5A 4JTRA 2UWFA 2J8GA 3NQGA 3BAYA 1J2BA 3GFZA 1EYWA 1XFCA 4B92A 1VFHA 1AJZA 4ZFCA 1FKXA 1W9XA 4ADTA 1V3JA 3PZVA 1JXJA 2X42A 4W85A 3LHZA 1F61A 5F4WA 3VZYA 3RMJA 1VS1A 1R2TA 3OVQA 3ARTA 3TAOA 3BMVA 3V16A 2YXOA 2QHAA 3NUKA 1PTDA 4O17A 3AWOA 2V81A 4IMEA 4ATWA 5JIPA 1UWRA 2G0WA 3CM4A 1EA0A 3Q65A 2PGFA 3THQA 1R85A 1EO7A 3R25A 3SCWA 3ZQ9A 4I6KA 3E0VA 2ANUA 3CZGA 3CQKA 1PV8A 1BGAA 3LNPA 5I09A 4LXFA 1LWJA 1GNXA 2Q09A 1HJUA 2UV8G 1E56A 3MUAA 2PDYA 4GO8A 2Y8VA 1TSIA 4NU7A 3GG8A 4D6CA 5EMUA 1TYGA 5EMLA 3R13A 3GDLA 1ICSA 2V38A 1IXNA 3N2MA 4DO4A 3P0XA 5E6YA 1HJQA 3CL6A 1JCLA 2OKTA 4JGDA 1B31A 4DWSA 1KQZA 1PJ9A 3EYPA 3ZJ6A 3ATZA 3RO8A 5LIWX 1JUBA 1EEXA 5TNVA 4W9TA 5DQPA 1JDCA 1RBOB 1YBQA 3AXXA 1HXJA 1HUVA 4QISA 3IJIA 4MNLA 1V6VA 2VCCA 2VTFA 2BXZA 1R3RA 4CU7A 3M0KA 4I7WA 3AXHA 4FSAA 5D2XA 1P6WA 3ARXA 3LZ3A 3UR2A 1OC5A 2WKJA 1V77A 3B4YA 4W8LA 1ZJIA 2QUMA 3RO6A 3VTRA 1LWHA 1NH6A 1VC4A 1EOMA 3LPGA 3V1PA 4BHYA 4L6OA 1QNVA 3NG3A 2Y89A 2WBKA 2QVHA 4J3SA 2YL5A 5LNVA 4A8RA 3FSTA 2D22A 1H7RA 2Z25A 4O1DA 4LNCA 1FDZA 1DWFM 5AOUA 3WL1A 5G2HA 4GO9A 2E6DA 3S1UA 1UKSA 4YTQA 3MVTA 5A94A 3RX4A 4UNLA 4F3HA 2RJHA 5TF0A 3VKCA 2Y88A 4HA3A 2C18A 3FGCB 2Y5SA 3A9IA 3PUEA 5F4XA 1HVQA 3BG5A 2QLYA 3IIXA 3SBFA 4IPJA 4Q8WA 1XDJA 4A4AA 3GNNA 5BWFA 4DO7A 3SFKA 3CO8A 5CZ0A 1V6WA 4PMDA 3W6YA 1KM4A 1DQXA 1WKFA 3NR0A 1REQA 4HA0A 2XVPA 3E3HA 1KR1A 1GQKA 3F4VA 1W56A 4IOTA 2V9DA 2Z1SA 4KWSA 1MNZA 4GUGA 1K9EA 4LV4A 2X0HA 1KNWA 2R94A 1PTGA 2X7VA 4RDVA 3G3MA 1RLDA 4M5PA 1H7OA 2NVCA 3F5LA 1CX9A 4JTGA 1L6YA 1V3MA 5AC5A 4M6QA 2AMGA 4PYSA 4XISA 1IWPA 1DJIA 1VJSA 1QPQA 4LWWA 1V8EA 5A6MA 3IIOA 1ELSA 2YOCA 4ONVA 2GYIA 2YDQA 4R88A 2TODA 5AY7A 3WDPP 3EA3A 2FMOA 3M4HA 3W37A 3TCEA 4FR1A 1DHPA 2WPBA 2XUCA 3MUCA 4Q7BA 2E5CA 4H8NA 4F0HA 3O05A 4E2VA 3HB9A 5FEPA 3N73A 4H1ZA 2CLHA 1E0UA 1ONRA 3CUIA 2PCQA 1EUNA 2V5CA 1NTHA 1YNQA 5D8WA 3TC6A 4OVXA 3QBUA 3PSWA 2GDVA 4JNMA 3M0XA 3ZT7A 1Y5XA 4AZCB 3T55A 4LEFA 4RE3A 1LG1A 3LHTA 3M41A 5TQLA 1F8MA 3MYPA 2Y8KA 3EA2A 2YCKX 2AL2A 1XGEA 4RDYA 3HO8A 1PKYA 4X0NA 1S5VA 2CXGA 2QXWA 1E71M 4JAWA 3WKZA 2PRHA 5CSUA 1J11A 4GNVA 4NP7A 2HRWA 1N8WA 3FV9A 4XSLA 4LQ1A 3ITLA 4G56A 2WZIA 1B5TA 1O68A 3TTYA 1HKIA 2OELA 3UJSA 3MCOA 1UOKA 3NQAA