4FOKA

1.8 a crystal structure of the fimx eal domain in complex with c-digmp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
b'VSIYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding
total genus 96
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fokA00
5M1TA 4Y9NA 3U2EA 3PJXA 3S83A 4FOKA 5MKGA 4AFYA 4Y9MA 2W27A 2R6OA 4AG0A 4HU3A 3HV8A 4FOUA 4HU4A 3GG1A 3GFZA 4ES4A 4LJ3A 4HJFA 3SY8A 4F48A 4RNJA 3KZPA 2BASA 3PFMA 3PJUA 3PJWA 4RNHA 3TLQA 5MF5A 3GG0A 4Y9PA 4RNIA 4J40A 4FOJA 4Y8EA 3HV9A 5MKGB 3GFXA 4F3HA 3PJTA 4KIEA 4LYKA 3N3TA 4Y9OA 4RNFA 3GFYA 4Q6JA
chains in the Genus database with same CATH superfamily
3KDNA 4ZQOA 5D37A 1J5SA 4AY7A 3R5EA 4F0HA 4GCAA 2VX7A 3W1AA 4IFKB 3ZSTA 1W1TA 4PUUA 2CLPA 2XH2A 2DVTA 2YL5A 4UR9A 1NDZA 3CIVA 3R89A 1FUYA 3WH6A 3PZMA 2GJXB 4WOZA 2PDXA 2OODA 3VIGA 1SFSA 3ARXA 3T8QA 1E72M 1PUDA 2F8QA 3BCDA 2OO6A 3M0VA 1H0GA 2CITA 1OG0A 2H9AB 1KO0A 4GACA 3R10A 4JL2A 4GNKB 1NF0A 5JIWA 2IPWA 1EBGA 1TPFA 2CW6A 1A80A 3PVFA 1K9EA 2JK2A 3O1NA 1XLEA 5IFPA 7A3HA 2Y5SA 3OU8A 2AQWA 3LQLA 3U3HA 1KGXA 5IHRA 4P7RA 3PULA 3SN4A 4QG6A 2H3BA 1S5MA 1EJTC 1HJVA 1B2YA 5A6AA 1VAHA 1ALDA 4QS6A 2GVJA 3LYEA 1WX0A 4E8CA 3OQ8A 3CL6A 4OV9A 4DHGA 4MB1A 3MZNA 1YDVA 3O3RA 3SUTA 3WK0A 1PKMA 3A24A 1UWAA 1ISZA 2R1PA 3QYQA 3NVTA 1NDVA 1CBGA 1NSJA 3VNJA 3ABQA 4JKKA 3YPIA 2H8ZA 2ACUA 4DQWA 3TTSA 4LCRA 3SECA 4AVNA 2ZVIA 3IJDA 1E0WA 4MJ4A 4DEFA 3E6EA 4TOQA 3RM8A 2R14A 1OVDA 4I7WA 1EJWC 3SEPA 1JI1A 1OD8A 3VILA 1J01A 4JEQA 1JXKA 4OJYA 3KBVA 4MZ1A 2DZXA 1CGXA 3STFA 1LG1A 1DJIA 3ZT7A 5BMWA 1AMKA 4HCDA 1LBLA 3STEA 4MTVA 1QPNA 1QRQA 1WZAA 3W1QA 3ZSSA 3RNDA 3SGZA 1OEPA 3GIQA 2PLMA 4LY4A 3U5UA 3UYCA 4E4UA 1QNRA 2CC0A 3OG3A 1JNEA 3BSMA 5SWUA 1QATA 4CNUA 3WQEA 3RRXA 4MM1A 3A13A 5DMMA 4AZCB 3N6HA 2EPOA 1H60A 3FJLA 1TIMA 2QDEA 2C6QA 5AYIA 1K7EA 1MW3A 4I6VA 4V2XA 3TTYA 4Q4PA 2PWDA 2HISA 1OFOA 4S2BA 1GCYA 2ZZ1A 2VWSA 3M43A 3EEZA 1VH7A 4S3DA 4AIBA 4ZMGA 5AY7A 2VQUA 4Y9MA 1DJHA 2CZEA 3CUIA 3A4AA 5F1VA 5C7VA 1DVJA 4F8XA 4E38A 1QASA 5LNSA 2QS8A 4IMGA 2CLMA 3IRDA 4FR1A 1Q6OA 3WLJA 3COTA 1QNSA 1U22A 1DOSA 3UR2A 3DXIA 1ZFJA 5M2FX 1JL8A 2XFFA 5EMKA 3DG6A 1ZQ5A 1P4CA 1XD1A 4N0RA 3DC8A 1GVRA 1Z48A 4JAWA 4O4VA 3B0VC 4NZJA 4H9YA 2BXZA 1XP3A 1E73M 2XWEA 3PSVA 3GD6A 1EA0A 3UXLA 2PWHA 4TO8A 2P88A 5KMYA 4LBSA 2O7SA 1TJPA 3FEMA 2J9YA 1XQLA 4LT9A 4QTGA 1QI3A 1ZZMA 1R3YA 3G2GA 1XGZA 5CJ5A 4O4WA 8A3HA 2ALDA 1XLKA 3MDWA 2J47A 3N2CA 2ZZ2A 4D72A 4F0RA 4UWMA 5HMEA 5GJMA 2CKRA 5F2IA 3Q37A 1SSGA 3EGJA 1WBHA 2HROA 3W74A 3ZJ7A 3K2GA 4Z2LA 4H19A 1V0KA 1SZRA 2XIMA 1L6FA 4US5A 1GPFA 4BA0A 1F74A 1R85A 4H04A 1JUKA 1UCWA 1KWGA 7REQB 4HN8A 1YIXA 3E0IA 5CPMA 3G8RA 4GVIA 1QUMA 1C93A 3WLOA 4AAJA 4KIRA 1RCQA 2OWXA 4EE9A 3M0LA 4CQBA 4K8HA 1VFSA 3C2YA 1SZFA 1JQXA 4S3JA 2DUAA 3QQ0A 1WCGA 1W3JA 1HTIA 3BJFA 4N2YA 5BXRA 3QKZA 1IZJA 2ACQA 3GHSA 1EWEA 3OJGA 3SCTA 1FXQA 2BSLA 4NAEB 1QK0A 2C18A 4ZB5A 4QAIA 4I3GA 4B16A 5AB3A 1P5BA 1HF6A 4GZEA 1TJ0A 4IZGA 4ZQRA 3IUIA 1EP3A 4XAYA 3N2TA 4FLSA 1XRVA 3SN0A 2ZOXA 2C1IA 2XH0A 1HNYA 3HA1A 3U8GA 3B8VA 3PPFA 3UGVA 3DI1A 9CGTA 1X8FA 2V6AA 2R82A 1CZ1A 2R8WA 4Z2GA 1M7OA 4J40A 5DANA 4D6CA 3LENA 3E1F1 2WZHA 4O16A 3W7GA 4BQ5A 2H3DA 4PODA 3TXZA 1YBQB 3R2GA 3IJLA 5D05A 1C7TA 3VMPA 4N9EA 2CIPA 4PR4A 4AQLA 3IJQA 1K03A 2VURA 1BEUA 4HCHA 3TU9A 3QV9A 1M5WA 1EFZA 3K13A 3SIMA 2Y8UA 2IPGA 3SRHA 3OPSA 3O6AA 3QY6A 1JRCA 4YHGA 1VPXA 4A3HA 4WF7A 2NUYA 2RDXA 3II1A 1RD5A 5I3FA 1TIWA 1THFD 4JNMA 2FHFA 1GOQA 1ZCOA 4B5UA 4JY8A 3VD7A 3W7QA 2FZDA 3LN3A 4PYSA 4W4QA 1UHVA 1UZHA 1YDYA 4JTLA 1LROA 1J6OA 2QT3A 3AO0A 2D3LA 1QPRA 1XIEA 3HU7A 3GFXA 2F6KA 3UR8A 3CLWA 4NNAA 4ROPA 4QQ3A 4YHEA 3S2LA 2OX4A 1E4LA 1UKOA 1UQZA 3W7RA 1XKYA 1VBRA 2YKKA 1D2KA 3VD4A 2ANUA 3G3MA 4X60A 3VCRA 3LTPA 4H9MA 1L2QA 4K39A 1W9BM 4JDBA 1KM5A 4GZIA 1TWWA 3N2BA 2INZA 2JFEX 1V6UA 3K30A 2J8TA 2WPGA 3BSGA 5D9OA 3DX5A 3BOLA 1C90A 1DIKA 5G2WA 3S3GA 2F84A 5CBJA 1JZ8A 1VF8A 1CT5A 1H1YA 3TQPA 1KFBA 3V0SA 4CU8A 1UJQA 1EF3A 3AWNA 3Q45A 4BF9A 2BVYA 3FVDA 5FACA 3H54A 3P81A 2QUUA 4YCOA 5E9XA 1LQ2A 1QK2A 1UWRA 1GOXA 3AUJA 1EJ7L 3GK0A 1J79A 5MKGB 3OHIA 3QC0A 3E38A 1B3VA 5FEPA 5JBDA 2OLSA 3V1HA 1O7AA 1WDWA 3QGKC 4J3WA 4LAMA 4RW3A 1RK6A 2WVUA 3WLRA 4N4PA 4A8RA 3C61A 2NT1A 3N1AA 3N13A 3HO8A 4HA0A 4O1AA 1GJUA 4UB9A 3GXIA 4B2DA 3VIPA 2HBVA 3W2NA 5FAJA 1ECQA 4GA8A 3GFYA 3IACA 1V6YA 5DT5A 1H0IA 1K8CA 2IUZA 4RZ6A 1LLWA 3FHQA 3ARYA 5CJMA 4IOTA 4KEMA 1DJNA 4HA3A 3RF9A 2ACRA 5XIMA 1ZP4A 5IM51 1VFUA 3R6IA 4DM2A 4M24A 1D8CA 5G4HC 1PCWA 4PH6A 4NAFB 3W76A 2W61A 1ISYA 3RCMA 2OOFA 3UETA 4A8LA 2O55A 4PZVA 3C0SA 3CJPA 4G1KA 3GR4A 2DW7A 4JHZA 1XDJA 3QW4B 4GINA 4H8UA 1BWVA 2DEPA 1GPWA 1GOWA 4GQRA 3LGGA 1KNWA 1WXJA 1FKWA 2JIWA 1XLIA 4HHLA 3W37A 2C91A 1NWSA 1E1CB 3ITVA 4ZODA 3CK5A 3BVJA 1O1HA 4UQEA 2V2HA 2X8RA 4JTAA 3W1MA 1FWGC 3R79A 4AIEA 1B57A 4XZMX 2PGFA 2R1KA 4JD4A 2ZUSA 1MWOA 4MUZA 2FZBA 5LKYA 3FYPA 5FESA 3SI9A 2D2JA 3M47A 3QRHA 4IP7A 4DO5A 4LANA 3CL7A 4XD4A 4IQDA 3XIMA 2E40A 3VKBA 2EO7A 2DU2A 1XLCA 4B3ZA 3WLTA 4NILA 3TTOA 3KRBA 3NQGA 5A5WA 3AHXA 4CNOA 4LAOA 3W82A 2W92A 4R7OA 4A3YA 2QPXA 2WHJA 3UNDA 3NOYA 4PC8A 2J7BA 3VUSA 4ZO8A 1PZ2A 1I6NA 4LSBA 3MMWA 3FW6A 2DZUA 1E15A 1CGUA 1G7VA 2AKMA 4HSHA 3B40A 4PULA 1VEPA 3BGJA 2OB3A 1UWTA 4LCSA 1DXFA 3DECA 3RJYA 1CWYA 2C19A 2GQ8A 4LYKA 2VXNA 3W7JA 1ESWA 3IGXA 3U4AA 4W85A 4JQ3A 2FTPA 2DPEA 1AODA 4ZSUA 3VKKA 4QLJA 5DLCA 2BXVA 3UU0A 2QCEA 4JTKA 4BEUA 2FB3A 2GLKA 4GRSA 2R91A 3PC0A 4L61A 3VKJA 1HP5A 5JH2A 1ODUA 3GDRA 1F2JA 4R9XA 1BFNA 4O12A 3VIIA 1BQGA 4IIHA 3R0UA 4H01A 1YPXA 3VIKA 1BF6A 3E74A 2QYGA 4TMBA 4XVEA 3NG3A 1ZRQA 5I09A 4H4IA 1TA3A 4EPDC 2X0SA 1W0MA 2ZRXA 1T8XA 5C2XA 1U33A 2YW3A 1JZ6A 3W2LA 2XYLA 4YN5A 4JTIA 5DXXA 3BXWA 1W31A 1ZJBA 2A7PA 3KOXA 4AY1A 4KKXA 3VMOA 3ITXA 1G0CA 3KS5A 1UKPA 3MWCA 1XSKA 3BV7A 5EKYA 2ZWZA 3RGTA 1JCXA 4ZR8A 4H83A 2J7FA 4EPKA 2VX5A 4PBGA 5JBEA 1XRSA 4REQA 5EB8A 2FMNA 1KLYA 4KCTA 6PTDA 1ITXA 2Q02A 3VIFA 2WCGA 4L1WA 5I06A 5TD4A 4AMCA 1ZAIA 4RE3A 1SZGA 4UQCA 1DWHM 2GVYA 1YDNA 4KIEA 2X2GA 2XSBA 3CT2A 3NXLA 4GUGA 3ZMRA 3NPXA 2VR4A 1I2OA 2FFIA 2PAJA 1W1IE 2E9MA 3BANA 1UOKA 1PHQA 4JTDA 1XUZA 2JKAA 4O0QA 1ZTVA 3IRSA 1W91A 2TMDA 4HPHA 3RPTA 3UCCA 3BPWA 2DJLA 3BAKA 3LOTA 2G5WA 2WZIA 5HANA 1CXLA 4QE1A 2OSYA 1KTNA 5JIPA 5ECVA 2ZC8A 2EKCA 2VUYA 3QZAA 5F4WA 1I0DA 4RV3A 4GUFA 3CZLA 3A6OA 1J0IA 2POTA 3R8RA 4NX5A 2E25A 4OOUA 3MB9A 3MUAA 2NUWA 1XG3A 3S4TA 1K9FA 3TYZA 3U2EA 3R11A 1F05A 3GRIA 1H49A 3NPWA 2QR6A 1FDZA 1LUCA 3WMCA 1A5MC 1AG1O 5CKSA 3V5FA 3GE7A 2OGJA 1K7FA 2OJPA 3S2MA 1UD2A 3WQDA 4C90A 1ICQA 3TXVA 3MQTA 4HHHA 4NF7A 4Q22A 4IJRA 3LB0A 5E1QA 4GNVA 2WK2A 4H9XA 2J79A 3VGFA 3ARQA 1XG4A 2RAGA 3VZZA 2P3EA 4WDTA 4BWLA 2WNWA 1A5CA 3L23A 2EPNA 3W85A 4Y9NA 1FOBA 2V38A 2ZTJA 4XBJA 5CGQA 4BZYA 1OHLA 1Y5WA 3LM7A 3WENA 5IBXC 3T0DA 4HZ7A 2GVEA 3C2VA 1EX5A 5CC6A 3LCLA 1TTJA 1KFCA 5J04A 2UV8G 5FKYA 1X1ZA 1VQTA 1BG4A 2XGZA 1KM4A 4XD6A 5EBAA 4MOZA 4C6LA 2W6RA 1IEVA 3I4EA 4GZ7A 3BUVA 4X9SA 1EPXA 3ABXA 3A12A 4YLWA 4NJKA 2CCRA 1XUUA 2HJPA 2QNEA 3OIXA 1PKNA 1D8WA 2WAGA 4TMCA 1OABA 1OX4B 4Q33A 4XAGA 3CUFA 4JKLA 3I7QA 1F61A 4I5RA 2FB2A 2FH8A 2VFGA 3GTXA 4P7LA 3RYSA 2XM2A 4HYWA 4F9JA 5IRPA 4QEHA 4CVWA 2Y62A 1VPYA 3WDPP 4JQAA 3EDKA 4E3TA 1EJVC 4R53A 2G8ZA 3UYIA 4XTDA 3CHEA 3WL1A 3KE0A 5L6UA 5DBUA 2WMIB 3TQ0A 3WH7A 4QISA 3OLEA 2ZXAA 4Z2KA 5CPTA 3U48A 4AXKA 3UJEA 1E70M 2YZ5A 4DYKA 5T26A 2VEIA 4QX4A 3URNA 1M6JA 5F2GA 4M3PA 2FVLA 2X1RA 1LL7A 3KBWA 3EX3A 4HK6A 1A4MA 2G41A 2JGYA 2PLJA 1GVEA 4H3DA 2NLIA 5CZJA 5JMUA 2R9RA 4MDOA 3ALGA 3NQVA 1MUWA 3WIJA 4JX4A 1NOFA 2ESCA 4K1GA 4PRRA 3I6TA 4AY8A 3H7RA 4Q7IA 4E0CA 2A3BA 3S5OA 1X97A 4U4MA 4FXJA 4C6KA 5T9CE 4N6FA 4R85A 3A23A 2A0NA 4BI7A 4NU7A 2A6LA 3UZXA 3MDUA 1KD0A 3SCQA 3GXNA 2A6NA 2ZUUA 1U1HA 2WC7A 1ONWA 2PD5A 4ACZA 2F2HA 1H63A 3LLXA 4LAKA 3IGHX 2PDIA 2AGTA 2PWGA 1FWDC 2H90A 2HXUA 4GI8A 3LERA 5IFTA 4BI5A 3ME3A 2C1HA 1V6VA 3E12A 2G37A 3HQNA 4QJ3B 1ISWA 2WBKA 4P7QA 3QR1A 3ZT5A 2O92A 4CVUA 2BGSA 3AZSA 4PRTA 1A3HA 4PTWA 3AIEA 3M6YA 4DJDD 2V69A 4AXNA 3IWPA 4MSSA 2VCAA 2Z2BA 1U30A 1T96A 1JFXA 3QPYA 1R2RA 4RDZA 2PDNA 4MY8A 2GUUA 4LALA 4HTBA 4ZL1A 3FSTA 3OVQA 3A47A 4PTVA 4DX3A 1AZ2A 2WXDM 2YR1A 1WAUA 3W83A 4G7EA 5DXYA 3T81A 2OQYA 4NY2A 3CIXA 4FLRA 1F07A 3APTA 4HK7A 4PCPA 4CQ9A 2PUZA 3USBA 4A05A 3OZPA 1IXOA 1WA3A 1TVLA 1BXNA 3C6CA 4HOWA 4ZO6A 5HJLA 4ZFMA 5D02A 3UWEA 3TONA 1QBAA 1LYXA 2ZX7A 4QGCA 5FJJA 1DJQA 3WUEA 4YWSA 2PWVA 5I79A 3L0GA 4ONVA 1GORA 3LZ5A 2TYSA 1TPEA 1EPVA 4PBFA 2CZVA 3WO8A 1ECEA 1D7KA 1FFRA 3GDBA 3STGA 4E8DA 1V0LA 2VVNA 1R87A 2JF6A 3BQ5A 3O07A 4Y8EA 4MB4A 1JYWA 3N4FA 2L5HA 4I9AA 3RX4A 1EC9A 3NPUA 4WX2A 4DBSA 3BCJA 3AIWA 1QTWA 4UFJA 5KETA 1PB0A 5A8NA 3H2MA 1Y65A 3VM5A 3AMGA 4ZQPA 1EBHA 3VC6A 4OV4A 1R9ZA 4IPNB 4Y7EA 5D33A 4H1ZA 4JICA 1AA1B 1DJWA 3TLLA 4OQVA 2WC4A 3ICJA 5C71A 1XD0A 1EO7A 1IQ8A 3MCMA 5AN7A 2QJGA 3AOFA 4GC4A 1QOXA 4AD4A 1TMQA 1XLFA 4ALDA 4UCGA 3WQ8A 4GY1A 1WQ5A 2WZMA 4WY0A 2AAAA 3W27A 1JUEA 4BKNA 3FLUA 4C1NB 1NDWA 2JKPA 3IK4A 1KFJA 1JEZA 3CASA 3S47A 3SO7A 4NI8A 2I9EA 2WZEA 2V81A 1ZAJA 3EX2A 1POJA 2OXNA 5BXSA 2Q3RA 1QNOA 4KEUA 2P0OA 5TF0A 3W70A 1WXYA 3LG3A 3AIBA 3WK1A 4WR3A 1ONEA 3MHFA 1WDQA 3ITYA 4EAMA 1CXEA 3SY5A 2GQAA 1WKYA 3OZYA 1OFBA 5KZEA 1E55A 5DMYA 1RLDA 2OWCA 1IT7A 2WOQA 1XIJA 1VFHA 1SJCA 3NYZA 3OZMA 3BWWA 2V82A 2E6AA 2I5QA 3OBKA 4UQAA 3GH7A 1OF8A 2XSXA 3LQGA 2Z00A 4J27A 1TQJA 2VD8A 2ZICA 3NL6A 1PVNA 1Q6RA 3POHA 3SY8A 3NSMA 3NPVA 3SW6A 3DFNA 1PXGA 1P7TA 3W1TA 4KEVA 3K1GA 2VRJA 1XHGA 4LRSA 2VENA 4O17A 2ZUWA 3QH2A 1X98A 1QI4A 3AYSA 1NWTA 1CLVA 4IGHA 4MJMA 5CBBA 2A1YA 4Q8MA 2WM1A 4LUSB 3S1XA 2PD9A 5ABFA 4XSMA 3L12A 4J35A 4M56A 4GXMA 3WD4A 1NVMA 3WFZA 1SPQA 3QXBA 2ZUTA 3A3HA 3TVAA 3HPXA 1IT8A 1EDGA 1S1RA 3TN6A 1OGSA 3UT0A 1T40A 5DCDA 1I1WA 4U5IA 1H7WA 3DESA 2QDHA 2ZZ5A 3KOZA 4LAUA 1DIEA 4R9OA 4DYJA 5DN1A 4IQJA 4WK9A 3SGUA 5AC8A 3KBNA 5D2WA 3EDEA 1RR2A 4GC3A 4HNLA 2W5FA 1W1B1 3NQ7A 4JHMA 1W54A 1POKA 2VOTA 2WVVA 2VTFA 5F4SA 3GSMA 1LL6A 4DLMA 4RDVA 3TWAA 5ABTA 5C9UA 3T08A 2XFRA 4R7JA 3TN3A 3PJTA 1EC8A 2VL4A 2AL2B 4KFPA 3L4YA 1MQRA 3O15A 3FHAA 1RLCL 1A47A 1Q13A 1US2A 5KEZA 2P5NA 1HL9A 2XJ7A 4MJ2A 3EA3A 3M7SA 4W9TA 2O0TA 2V3GA 4LYRA 1JYNA 1K9DA 1HKVA 4M81A 3E2VA 5DFAA 3GY1A 2I17A 1W2VA 1G1YA 2JF7A 1JF5A 3KEHA 3HJEA 3KVKA 3UWVA 3IVSA 3FDKA 4PUWA 2B81A 2ABAA 1W32A 1LRQA 4JTSA 5A69A 1GQJA 1E6NA 4N6EA 1JZ4A 4RR4A 5CJNA 5DX7A 4L65A 5LA0A 3ITLA 3MY9A 1G4SA 4HNVA 1XWYA 3QOKA 4D6DA 2ZCGA 2ONEA 1VEMA 1HJXA 4UFKA 2ZWYA 1DHKA 4JBRA 1UPPA 2CXGA 1F7BA 1FTXA 3BAWA 4Q8TA 3RCNA 3LV6A 1PDZA 3DG7A 5AHLA 4I5XA 3GHRA 3CQIA 3BLFA 1M7PA 3U7VA 2Y70A 4Y6GA 4B9YA 5B7YA 2Q8ZA 3GNXA 3TE9A 3NO1A 2OQLA 4P61A 1ODZA 3VABA 3CPGA 4XZBA 3TFXA 1UKQA 1XR2A 2HVMA 3M6DA 1T6MA 1B3OA 4GGBA 5C5YA 1E6XM 2Z6IA 1X7IA 4K68A 5A6BA 2PC4A 3BW2A 5H8UA 5HNTA 3O63A 3T05A 3PTDA 4ICNA 4FMVA 3OVRA 1WXZA 1RCXB 1KXHA 4LPCA 4B5VA 3T55A 3I3DA 3MYOA 1MYRA 2BOGX 2WMGA 3U2OA 4YTTA 4N9DA 3WF1A 4KGJA 1DXIA 4IUGA 1TV4A 4GUIA 5FF7A 4MLRA 3WL0A 3N17A 1DWIM 3R94A 2BHZA 3ES7A 3PBMA 4HMDA 1UP3A 4UTTC 3GM8A 3SCSA 2PE4A 5A8MA 1TB3A 3LU2A 4CN1A 2DFAA 3GDKA 3AC0A 2DZAA 2PDJA 5C2GA 3MUCA 2RHGA 3HMJG 3AS0A 3UJ2A 1Q6DA 2AQVA 2CLHA 3TOPA 2YCLB 4DYEA 1N8IA 5A6TC 4FLQA 7TIMA 3KP1A 3CHDA 1HT6A 1LLZA 1R47A 1FVPA 4ADSA 3WSUA 1K70A 2Y63A 2YPIA 1YNQA 4UC5A 2J8FA 1OZMA 5DMLA 1CPUA 3O6CA 1R9YA 2RDWA 5HATA 3NQBA 1GHRA 3RFAA 4D2JA 5AHMA 3I3BA 2FTYA 2ZDRA 2NSOA 3B06A 1JAEA 1MEWA 3WH8A 1QPKA 1DQWA 2PDGA 4OBRA 1UC5A 2W67A 1RPXA 4QIUA 3EMZA 4JIRA 3P61A 4TVCA 1IXQA 3M4HA 4FF5A 4OTKA 5B80A 4TVDA 2FZ8A 1OFDA 1XYCA 4UQBA 4F9DA 2I14A 4REQB 4AHQA 3G0UA 3DIPA 3D3AA 1P0NA 3PAJA 3INPA 1W3NA 4ZEPA 1V02E 3EX6A 2EKGA 1YTEA 2D0GA 3EPNA 1TREA 1VR6A 4IPPA 1DEDA 1QNVA 3WH5A 1J0ZA 4F0KA 2F6XA 4UTMA 5J5RA 3EKZA 4IICA 3W1UA 1OC5A 4HZMA 4EKJA 5F2LA 3NURA 1W3TA 3ATZA 2HPIA 1UMLA 4G9PA 4DF2A 1EZWA 1FY6A 3JW7A 3QSTA 3ZJ8A 1DJXA 1H62A 4PMQA 3WBYA 4FOUA 1KA9F 1V02A 5LIKX 3DCPA 3NZ1A 4IMEA 3VNDA 2PSNA 2P10A 4EPBC 1BWKA 2EXOA 3SADA 3MUXA 3NSNA 1K8YA 1PBGA 4UMCA 5LA2A 3BH4A 1JFHA 2PPGA 3K1DA 1V3MA 5DCEA 3A4JA 1JDFA 3GIPA 4I7VA 4LY8A 2GOKA 5D2VA 2WWDA 1N55A 4B9ZA 3GZAA 3A4WA 3SUVA 2GWGA 3I7SA 3D0CA 4CN4A 1C8VA 2HK0A 4LYPA 3ZS4A 2BTMA 2QGHA 4NQ1A 5GVJA 4IUOA 2AQOA 3W28A 3OVPA 3BLLA 1QW7A 3EWDA 5F4XA 4NT0A 1R5YA 2Z28A 3VE7A 4YYFA 2WSPA 4FPSA 2HQAA 5REQB 1VFTA 5C54A 3RPDA 1FWIC 1FDYA 4AHPA 3KM8A 1TZ7A 3NOEA 1UD5A 2Y8KA 4QR6A 3ZWSA 4MNKA 2A4AA 3OLIA 1XIBA 2C14A 4OOZA 1J18A 1EP2A 4KWSA 1Q2SA 1ITCA 4M6UA 3ABOA 4QLKA 1S5VA 3OB8A 2J78A 4AHOA 2YJQA 4MADA 2Z1BA 2PDBA 3GDLA 5C9WA 1N7KA 5D09A 2O56A 4NJGA 2HE8A 1E0TA 3AMDA 4LGXA 4QBXA 3UPWA 4HU0A 2IKJA 4K7YA 3CB3A 5KZMA 3MS8A 3W1XA 3NZGA 5C8BB 1H2JA 4DWSA 1D3GA 4W84A 3T4WA 4ML4A 2BLEA 1OC7A 3DFOA 3ORWA 4YVVA 3I7RA 4RE2A 1TG7A 4FNPA 2ODOA 3OLDA 2FTWA 1EDTA 1UUMA 2DQWA 2EPMX 1TZ9A 1JPKA 3OGRA 4C6BA 1XI3A 4UTJA 3M0HA 1AJZA 3ALFA 3P0WA 2B0MA 1CB2A 5D8ZA 4MG4A 5AZ0A 4MKVA 3MP3A 1HVXA 1WKFA 1QW8A 4KWWA 2ZX5A 1YE4A 3C56A 1HXJA 1NARA 2WO5A 3EKGA 5LIYX 1XPGA 3ABRA 5FAGA 4GIEA 4OUIA 3IEBA 3OA5A 3VC5A 2YDAA 1WKDA 1JDAA 3PBVA 2GDUA 3ZXWA 4DJFA 3WLHA 3C86A 1KR0A 1C8XA 3E02A 3QMRA 3G1XA 1KB3A 2DH3A 1RBLA 1J4EA 1A53A 4QSFA 1VP5A 3IUDA 1IZKA 3HG2A 1OIMA 1TYGA 4C60A 3SJNA 3L5MA 1TTPA 1VBUA 3RO6A 1PYMA 6TAAA 4DO4A 2FFCA 2PURA 1CYGA 4Z1CA 3DG3A 2VFFA 2CLIA 3R0KA 2FIQA 5DQPA 1I2RA 4D1IA 1DIOA 4HMCA 1E9LA 1KBKA 3N25A 5AC5A 4P8VA 3GU2A 2XG9A 2GJXA 3PZNA 3ARSA 5I77A 3FA4A 3WD1A 3AHYA 4B4FA 3O16A 4PUKA 4LOCA 1JPMA 1E51A 4YTRA 2RGMA 3KZPA 4LEQA 2DY3A 4KQNA 2H9AA 3AUOA 3J7HA 3DFPA 2SFPA 3FY1A 4ML9A 4C6OA 1JDEA 3N4AA 3C2FA 3VIHA 3PFRA 3EYPA 4G2DA 2QUMA 3H8AA 2YB4A 2NX9A 3LRLA 2Z6JA 2BOEX 2BNJA 1LP6A 3OO2A 3WF0A 3NL2A 4IGNA 4LAZA 4ZBCA 3ZZ1A 1LQAA 2O9OA 3TA6A 5TIMA 4O1DA 1YXDA 2VVSA 3IPWA 1SFJA 1SO5A 3D3FA 3KL3A 3QC3A 1I8JA 5FF3A 3FXGA 1NQ6A 2QDGA 3M0ZA 3BJSA 1F3XA 1JD9A 1TV5A 3T4CA 3WNPA 4L6DA 3TR9A 4N4QA 3S46A 2INEA 4RW5A 4TX9A 4NASA 4Z1BA 3MSRA 3MMTA 2JQXA 3QQ1A 3ERPA 4G7EB 4AZBA 1A50A 4XKYB 2F6UA 6REQB 3PK7A 2PLCA 5CSSA 3ZLGA 4DPPA 3H21A 4IIBA 2UWFA 4GJJA 1AD4A 2YL8A 1VBJA 4IXHA 1GG0A 4PB3A 5BWFA 4NX0A 1E1FA 2YA1A 4MDPA 4PA8A 1UZ4A 3BZGA 4DNHA 3MUY1 1MEHA 3NEHA 2ADAA 1EC7A 1P0EA 4X3ZA 3QR3A 3KXQA 4EXQA 1ZBVA 3PTQA 3NYDA 4XTIA 5HQLA 3LHZA 4MZYA 1SGJA 5I6SA 1Z69A 2WNZA 2HXTA 5C9ZA 1XCXA 4NHVA 4UNLA 3M46A 3RU8X 3LHTA 2YCJA 5BRQA 2WANA 3WQFA 4NRSA 3MO7A 4GX9A 3WBWA 2OSXA 4AZCA 3SUWA 2JKEA 4WCJA 1R9XA 2WKGA 2FZNA 1MW1A 1Q85A 1M04A 2X2YA 1CENA 4Y8FA 1PX8A 3AHZA 1DWGM 5XINA 1SMDA 1V0MA 3GU1A 4DELA 4MIMA 1GZGA 3UWUA 1G5AA 4A4AA 1S5TA 3PBWA 4EVZA 1BPLB 1S2UA 3HV8A 2ZUNA 1MFUA 2Z1XA 1VFOA 2Z26A 1Q6QA 1BYAA 3HOJA 4EWJA 1S3TC 3LCWA 5DRIA 3D6NA 4AU0A 1VBGA 5M17A 1XQKA 4JTEA 3VKAA 1RH9A 2VZUA 1EJSC 3CZKA 2BP1A 5M3WA 1YPIA 3TC7A 1XGDA 3LGDA 4Z1YA 4DPQA 2WMFA 4KPLA 4O28A 3KAOA 5LHEA 3CNYA 1TELA 1E4NA 5A8GA 2CZFA 1B0IA 1CCWB 4I6KA 1EXPA 2PDPA 2CNCA 4H9UA 3O05A 1G7UA 1V51A 1E5JA 3FOKA 2C7FA 4Y9AA 3F03K 3F4VA 4Q7BA 1CNVA 3ES8A 3BG3A 3VDCA 3VX0A 5CLWA 1OCBA 4RPQA 1B9ZA 4KRUA 4B92A 4RNIA 3CMJA 1SYTA 3LNPA 5K3VA 3O06A 1GYLA 2RJGA 5TQLA 4L9ZA 1WDDA 2B7QA 4CD4A 5D9MA 1S39A 4HU8A 3I65A 3REQB 4LS1A 3O2LA 3IARA 5HMSA 4OHQA 3B9EA 3HG3A 4ZOEA 1XX1A 1ELSA 1A5OC 1OT2A 3CU2A 3BURA 3IJ9A 1BQCA 3C52A 1E9IA 1S2AA 4PTXA 3MI6A 1BF2A 5L9FA 4CQCA 1UP0A 2IS7A 4X61A 7REQA 3T42A 5HJXA 1PKLA 4HVXA 5BU6A 3H2AA 2IQTA 2OG9A 1W5MA 2VR2A 1OGBA 2LLEA 1PIGA 2YW4A 3KLKA 1YTDA 2ZC1A 3QOMA 4FF7A 4MGGA 4LCQA 1FBAA 1TJ1A 5GNXA 3PS7A 3LGEA 4PSRA 4QDWA 4D71A 2PP0A 4XZWA 1BWLA 1AJ2A 3MV11 1CECA 4O8AA 1E0VA 2XUCA 1JCTA 2YDQA 4RNJA 3GO2A 3PJUA 3LK6A 3VOGA 1O94A 1H1NA 1IWPA 1JVNA 4NAEA 4HB7A 2TODA 2A3LA 5ECUA 1PCKA 2V5KA 1UMYA 5CZKA 2XZ7A 2V9DA 2BB0A 1E6RA 3TIMA 1V6WA 1XLJA 4D8ZA 3F2DA 5BYWA 1HKIA 3FNDA 2ZBTA 4B3LA 3QZEA 3EPMA 2PCQA 4H2HA 4ZZ9A 1CW2A 2ZXDA 2YXOA 4CU6A 3MJYA 4DJEC 3B8TA 1UZ1A 3B4UA 2YB1A 1GQNA 1HJSA 3IK2A 4QLLA 1M7XA 1RZMA 2J7GA 1IEWA 4ERAA 2G50A 3BOXA 2BDQA 4JFWA 3H4GA 2C1GA 5ABEA 1OFRA 2CPUA 2HRWA 5DY3A 3W1RA 1XBXA 4LX4A 3CV2A 4TV5A 1MFVA 3WMLA 4LB4A 2RFGA 5B7ZA 4C6PA 3LSBA 2IPFA 1XM3A 1C8QA 4GKTA 5EBUA 2NXGA 1S2VA 1KFLA 3P8IA 4WRHA 4FO4A 1M1BA 3L67A 1DIDA 2D22A 1V6TA 1RJQA 4AEEA 2V5CA 1XKJA 3DEQA 2C3ZA 2POZA 1QFEA 1M01A 3KCJA 1BKSA 1CXHA 5D2TA 4L7ZA 3W7KA 1AL7A 3LEPA 3WUGA 3NL5A 5CH9A 4XKMA 4PCFA 2RKXA 5FD0A 4KRTA 1HW6A 3AROA 3CTTA 3VIOA 1V8EA 2OEKA 3EOUA 3QV7A 4I90A 4QP0A 1TWSA 3CT7A 4IQEA 3B8DA 1OFPA 2XIJA 3UFYA 2XDFA 3K8KA 1GGOA 3W7CA 5A8OA 4AYGA 3SZ8A 4L4OA 4AX7A 5LXXA 1XBVA 3GW0A 4FX6M 5CG7A 1W6TA 2FZ9A 3UVAA 2J74A 1EX1A 5GNZA 1O68A 2FJKA 1BRLB 4JDYA 3NGJA 3JVAA 1JYVA 1B3WA 3WLKX 4Q6JA 4I8YA 1AW2A 2ATMA 1JI2A 1TPC1 4PE8A 1A5SA 5I3HA 4LUYA 3TJXA 1T8QA 1VGAA 3PBGA 1GTHA 4A3RA 4AZ5A 4C6QA 1H7PA 5TNVA 1RBAA 2PDLA 2PFHA 3L4ZA 1XDMA 1K6AA 5MKGA 4TX8A 3WD2A 2DUXA 3LI1A 4L80A 1F73A 2X09A 4B5SA 4KWVA 5MHBA 4GQ0A 2OSWA 2QUTA 5FEXA 4CQ8A 4FEZA 1UIPA 2V5LA 4HD5A 3ZLHA 1AW5A 1EUAA 4DJFD 5C2CA 1Q4WA 3WLNA 1XF0A 4L4MA 1HUVA 3WDIA 4CD6A 4G5DA 2VT0A 1VFLA 3CWNA 1UC4A 4R34A 1XCWA 4CGTA 5IHSA 4QITA 3PNZA 3EWBX 2DIJA 3UG4A 3LMZA 3G22A 4J9JA 1P43A 5I5RA 5D32A 2XPKA 1TFVA 3SIZA 5I07A 1H5YA 2H6RA 5H8MA 3L66A 1XXXA 1O4UA 2OYKA 3BAYA 3W7OA 4E4FA 4NAFA 2DT0A 1PEZA 3AXKA 4O14A 4Z2JA 4E2DA 3QLLA 3Q94A 3WLSA 3MI2A 3WJWA 3L2MA 3W1NA 5D03A 3IJ8A 1AQFA 4MUPA 4ZB0A 3B03A 4ZXLA 3WLPA 2DT3A 1GKPA 4ZFCA 1QBBA 3PWAA 3TN5A 5LGZA 1FCBA 3OW1A 3MCOA 3MHGA 4IIFA 5CC7A 3KL5A 4HK5A 3WZ0E 4AD3A 5K9CA 3RM4A 2V30A 1E1CA 4B3KA 3PBUA 1VEOA 1YNPA 2V67A 4A29A 1KWKA 2XVGA 3S2NA 5CGTA 1JPIA 2C0AA 2HBXA 1US3A 3MW7A 1AQHA 3VIMA 3L7RA 3N29A 3AWOA 2XN1A 5RUBA 1GOMA 4HJFA 2CKSA 1X6UA 1TZZA 2FHCA 2PDHA 2WHMA 5G4WA 1XLHA 4AC1X 1GQLA 2OELA 4M29A 4AFYA 4NI3A 3TN4A 3EB2A 3UEQA 1A5BA 1WZMA 4KS0A 5I78A 1IWBA 4E6MA 3U57A 3KX6A 3VCCA 3D5HA 4N9CA 1XC4A 3JUGA 3F5LA 2NWRA 1FWRA 2DSVA 4GYPA 1REQB 1XV8A 3BE7A 1YNYA 3MHUA 3B04A 4KBXA 5HPOA 1KBBA 2VRKA 3RM9A 1T5AA 2BY1A 3GTFA 1X1NA 3EOOA 3VNKA 4TX6A 2J7EA 3STCA 3U7BA 3THDA 5CC5A 3AIUA 3TW7A 1XLLA 5BOOA 2DZTA 4O50A 1U2YA 2XZ9A 3DFSA 5A6JA 3UPMA 4J3VA 1CXKA 4MAZA 1IYXA 4WJEA 1VBHA 4IIGA 1A3WA 1EGVA 2ZUVA 2X41A 3K4DA 2QCCA 4ILSA 3V18A 3WN6A 5FJPA 1Q66A 4C1LA 1F76A 4GXPA 1R3WA 1B1YA 1XSJA 3WK2A 3VFCA 3VUPA 1IGWA 3W38A 3MBDA 4PTNA 3E0VA 3ZR4A 4FALA 1GYMA 3TC3A 4B91A 4WY0F 3DZ1A 2A3CA 2MUCA 4D6EA 2KX9A 3RMEA 3AS1A 1WP6A 2CZ5A 3DU0A 1RBOB 1JPHA 1M53A 4O10A 2OX1A 4ORIA 4BF7A 4RDWA 2DIKA 3CWHA 3K4AA 5K4XA 2V3DA 3P74A 1TR9A 3ZM8A 3M0KA 5CCZA 1WB0A 1NM9A 4TIMA 1OC6A 3BLEA 4ZSTA 4ZTXA 1GHSA 4BWLC 5CAKA 3CAVA 3EA1A 1JPDX 3E96A 1M3UA 3AFBA 1J0JA 3WJXA 2PDKA 2Y1HA 4NVTA 4P5UA 5BROA 2CZDA 4A35A 3M9YA 4CQAA 3UW6A 3RJXA 5LA1A 3QM3A 4EXAA 4C6FA 2WCAA 1O5RA 3FCPA 3CZEA 3FYYA 1E4IA 3S9ZA 5I3KA 1B3YA 1EP1A 1FWAC 4BK9A 2V8ZA 4AWTA 1P6BA 4I9TA 4AWSA 3CM4A 4XAPA 5EFFA 1YLVA 2ZZ7A 1H7RA 2QCLA 3HFTA 1OJXA 4GXWA 1DJZA 2QJJA 1EOKA 2D0FA 3AS2A 5CZ0A 3FGCB 1TCMA 4LS0A 2WPBA 3EZ4A 4O18A 4DVOA 4N42A 1RD6A 3NL3A 4AB4A 1X7FA 3SSJA 4A3QA 4I8DA 3OBEA 2J6VA 3M64A 4FOKA 3LNMA 3VOFA 2WC3A 3POCA 4FLOA 1MSSA 2ABBA 3M5VA 2J7HA 3GS6A 4XZHA 1MW0A 3QR0A 2Z25A 3KOFA 3G24A 4EPEC 4DIAA 5BOEA 1L2UA 4BCEA 1XC6A 2PDCA 3KHJA 3L5LA 1VFFA 4ZTYA 2CESA 4C6CA 5KITA 2VFIA 4JTFA 3BO9A 2D2OA 1EWDA 2RUSA 1G9HA 5G4EA 3IIXA 2HDJA 4LTSA 2CLFA 1O5KA 1R30A 2Z1WA 4QHRA 3LLFA 2IMRA 1I2NA 1NIUA 2R6OA 6A3HA 3KTSA 3AIVA 2D3NA 1WBJA 5HBFA 4B5NA 4X0VA 2WWCA 5A6LA 2J9XA 3E0LA 3A9BA 4O53A 2WVTA 2EG6A 2NZLA 3IJ6A 3FXYA 3CQKA 4DZAA 3TAOA 3ITGA 1BD0A 1W9VA 4O1BA 1NWUA 1SUXA 3PTMA 1EJUC 3GH4A 2BFGA 4XZLX 1K4GA 1WDPA 4K36A 3C8FA 3QW3A 5C9RA 4RZBA 3TWBA 5BRPA 2PBOA 2XH7A 4HNTA 5A3HA 1TV8A 3S5ZA 1B4KA 2A21A 4Q4QA 3UY7A 1ZJAA 2Q8LA 4W7VA 1NTHA 4M80A 2QUNA 4TTGA 3QY8A 1DXEA 4LVGA 4OFCA 3PBYA 2XVLA 1FH9A 2VGGA 3B0UX 3WNLA 3QHOA 3SQSA 4QJ1A 4C6IA 3LZ3A 2F2KA 1PJ9A 3MSGA 4W87A 1I45A 1PTGA 4PL2A 1V93A 1Z8AA 4XB3A 2PODA 3E5PA 1W37A 4UBPC 5F1UA 1HJWA 2AKZA 5CC3A 1OK6A 3GNNA 2QZRA 4HNUA 4Q8OA 5IDIA 2F7FA 4GVGA 1WDRA 1OG6A 3P80A 1TVNA 2GGGA 4ROQA 2EQDA 2HEJA 1YEYA 4FIQA 2WYSA 2WQDA 1QAPA 4QM1A 1C3FA 1HJQA 3CIWA 1VC4A 5LHFA 4KH2A 3NZQA 4XBKA 3MSYA 2ZX8A 1OX4A 4P7OA 5KZDA 3O6YX 5I24A 2PWEA 1E6PA 4KCVA 2ZZ3A 3H24A 3QJAA 3TK7A 3QMSA 1XYAA 1QI2A 3OBAA 5LNWA 4HT3A 3GIYA 1I9CB 3W7LA 2ISSA 4NZCA 2CHNA 2VFEA 4JZ5A 3N18A 3NQFA 4JIPA 1HGYA 2WMIA 2ZRWA 3ECQA 3HJZA 1MQQA 2YLAA 3FJNA 3C0JA 3KBSA 5DRCA 1NF7A 3W72A 4HZ8A 3UR7A 3T09A 2Z0IA 4S3GA 4L5ZA 2BODX 2WSRA 4ZE5A 1F3TA 1D7FA 2FZMA 5A6MA 1A0CA 2HNEA 4JGDA 3S2JA 3DERA 3ZVHB 1HO4A 3W2MA 4EANA 2VC6A 3ZJKA 4Q4KA 4XAFA 3W2KA 4PUNA 3KTXA 2C16A 3B0XA 1QI0A 2X7VA 3N14A 4MPQA 4I9JA 1PSCA 1HO1A 3NQ8A 4UTUA 1VPQA 3KCOA 3IANA 3TEVA 2HZGA 4UFIA 2E5CA 1OFQA 3GVGA 4D6JA 4F40A 4UMBA 3HBLA 4ZVJA 4B4HA 3B9DA 4PEEA 2GDQA 2X1IA 4HA1A 1OT1A 3MTWA 3BDKA 2D69A 1V6XA 1ZGDA 1J10A 1I0BA 1EF2A 1KQZA 4YYCA 4V1YA 4BR1A 3D46A 4TQTA 3SB0A 2NQHA 3ZFHA 3WQWA 1DKWA 3DFYA 2OYLA 5EFDA 1AH4A 5CAHA 4KCUA 1BVNP 3JU2A 2NVDA 2VM8A 3TOYA 1GQKA 1DYSA 1Q5MA 3ITCA 1UH4A 1SM9A 1JCLA 4IMCA 1OGGA 1VJIA 4H9VA 5AHNA 3A3WA 4O15A 1Y0EA 2YCEA 3HM7A 5CSYA 1GVIA 1MDRA 5HJYA 2OZ0A 1FHLA 1SZEA 2X05A 3DYMA 4HPGA 1F5ZA 3TMLA 3GB6A 4AD1A 5HA7A 2BS9A 2C13A 3EWXA 3MC5A 1I2QA 3PZUA 4GBUA 4R3UA 1KKOA 3R8GA 3VPLA 1JCMP 1EGMA 1ME9A 5CQ1A 3NZRA 3TNOA 3EMQA 1FH7A 2NSXA 4OBTA 5IBXA 2OVLA 4FB7A 1JCYA 3P7YA 1CGYA 4M6VA 4L6HA 3WQ5A 1OK4A 3WBEA 1LL4A 3P14A 4QFUA 4J3ZA 1YRRA 1UH2A 4ASTA 1EGZA 2Q09A 2DW6A 4DF1A 4ZQMA 2GSHA 2ZX9A 1X1OA 2JIEA 4XAZA 1EHAA 3TMQA 2DGAA 1JR1A 1H41A 3ONBA 2VOMA 2O4MA 4DXXA 1TE1A 1FP8A 4U28A 1HKKA 4CCCA 2PI6A 4MAVA 3W9ZA 4V27A 3T9PA 1NFBA 2PTDA 4F2UA 6XIAA 2FGBA 2NWSA 4WKFA 1A5AA 3OQEA 3CV1A 4O13A 2Z2AA 1B9BA 3N2MA 3R58A 3HFYA 1FA2A 5AC6A 1QOQA 4AZ6A 3NUKA 1GTEA 3CPRA 3FDGA 1EJXC 4AZHA 3MP5A 4FNTA 5I3DA 1AD1A 2O9TA 1RAKA 5BXTA 1FFQA 4DUOA 1ICPA 3IIPA 5E70A 1UKTA 1V0NA 3AAMA 3GNRA 3VAVA 4WXZA 8XIMA 1YHTA 5BZAA 4C1NA 2E6DA 3V36A 1PX4A 4F48A 3RXZA 1ZCCA 4AEFA 1SJDA 4UR8A 6XIMA 2VZOA 1AFSA 5A2BA 1HL2A 1W3KA 4KFNA 1BYCA 3LCGA 1PPIA 4I9MA 1AH0A 1WPCA 5FF4A 3IVUA 1YMYA 3WNKA 5H91A 1AL8A 1CX9A 4LJ3A 3VINA 3G1AA 3I6EA 4FAMA 1EZ2A 3FN9A 4XO7A 1LDCA 3EAUA 4ZO9A 3VDAA 5FSEC 3UPBA 4UR7A 3BL3A 3T0CA 2PDMA 4BFAA 1E0UA 4MNMA 4Z1DA 4HNOA 3MV01 4LBUA 1F6PA 1XPYA 4GUHA 3W2JA 2Z1KA 5D2XA 5ABHA 5HNRA 3AYRA 4A3UA 1PHWA 2FH6A 4UTWC 5DY2A 3TDFA 1OZQA 3LXCA 4ZB2A 3LPFA 4NZ1A 5DMNA 4G1NA 1XFBA 4MPKA 2YCIX 3PHAA 3WDJA 3T0BA 3OLGA 2UY3A 3DGBA 1TWZA 2ZX6A 3T0TA 3DN5A 3FFSA 3CQ0A 1JJKA 4LUSA 2HE5A 3NEVA 1OCQA 3B0PA 3A3XA 4R33A 1BAGA 1OD0A 1VLWA 1HL8A 3AJXA 1PS9A 2PMQA 1RVGA 3LD5A 2ISDA 1BSIA 4E2OA 1PL9A 5H1WA 1J2BA 3P2VA 3OVGA 1VIWA 1L6WA 2X40A 3QPZA 3PSWA 1FWBC 1R86A 3KWXA 4I7UA 5CPSA 3T78A 2NV2A 1XW8A 1OWQA 4DJDA 2DQXA 3RLUA 3GXFA 2VEPA 4AMAA 3R0DA 4FS9A 4IWWA 1YDOA 1JGMA 4AIUA 3GTIA 3WX7A 1V79A 2AL2A 3MPGA 1PZ1A 2A85A 1HKWA 4V1XA 4S2CA 2DIEA 4V15A 5AC7A 2GWNA 4HZ6A 3L4VA 1RV8A 2DSWA 3NNTA 3NXFA 3S42A 3CUHA 3TX9A 1QHOA 1E43A 4PMXA 3GZ3A 1PAMA 2YGYA 4UFHA 1QXLA 2ZVRA 2E1DA 4AWUA 2E09A 4B5TA 4WXYA 3LY0A 5DCBA 1ADDA 1H50A 5I02A 1UR9A 1R3RA 3R25A 1UD8A 3JR2A 4O0KA 3TSDA 5CEWA 2GGJA 2ZXQA 3VGEA 2V3FA 2W91A 2OMAA 1LOQA 3IS4A 2PRHA 3GVRA 4U2ZA 3F2BA 3W26A 4S3CA 1DORA 4M6QA 1FCQA 3GX9A 3RLGA 2FYMA 3AALA 1L6YA 3P5YA 4DB7A 3LBOA 4C1KA 3WQ4A 5HR6A 1UUOA 4IG2B 1UR1A 3CAWA 3ELFA 2CLEA 1S5NA 5FJRA 2FKPA 2WBGA 1F4AA 1YKWA 2QULA 4WDXA 3ZLFA 3SQLA 4LV4A 4PB4A 4XD3A 3SSZA 3VOCA 4JEJA 1VYPX 4L56A 4IL0A 3LHUA 1YTKA 5CXPA 5HR7A 3N15A 3WKZA 2PDYA 4ZGYA 3MMDA 1AQ0A 2H8XA 4U5KA 1LJYA 2EG8A 4FXSA 1PV8A 3DHFA 4W89A 2O9RA 3ARVA 2GZXA 5FL0A 4A8NA 4HNCA 4JTGA 5K4ZA 2VEKA 1KBJA 1RY8A 1W1YA 4YTSA 2VMFA 4FZIA 1LBMA 1R2SA 3V1PA 1FKXA 2B4GA 1TCDA 2XGIA 3UESA 1F9CA 1LQ0A 1OADA 3M44A 1TSIA 4O1EA 2QCGA 3M41A 5LNVA 3UA4A 4NNBA 4OKDA 1GVSA 3VNZA 2XIBA 1ADOA 3W75A 4D8LA 5HULA 1LORA 4US6A 4D6GA 2BHYA 8XIAA 1NP2A 5LIXX 2WLZA 1LWJA 2YCLA 2FPTA 4LNYA 4S3KA 1LCOA 5HOSA 3L9CA 1JYXA 4HMEA 3S5YA 1J0HA 4Z1AA 2OT1A 2EBNA 4WDWA 5FCZA 1I4NA 3T2QA 1UROA 3BMWA 1X6LA 3DFTA 3TKFA 4P8XA 4GO9A 3FV9A 3TW6A 3O9NA 5EMYA 3KFTA 3B4YA 1OFEA 3H26A 1BVWA 2VGBA 4XZ9A 1W1VA 3DC0A 3PUOA 4GLEA 2B7OA 2X1TA 2OR2A 4O0ZA 1PWMA 3UG5A 1KQYA 1J6PA 1KXQA 3WEOA 2PU1A 3PB2A 3APGA 3P93A 4YTQA 1GWJA 1UWSA 5CG0A 5KINA 3G1SA 3PZ9A 3C4UA 2EF9A 5EGRA 4DUWA 1ZJHA 4GG9A 2X1UA 3U0HA 5CPOA 5HNUA 1OM0A 4FX7A 1NH6A 1FCVA 2PB1A 3G1YA 3PM6A 1T0OA 1WOAA 1GW1A 4P2VA 1XH0A 1Y5XA 2ISFA 2CBUA 1R3VA 1XYBA 2HMCA 1V3JA 1A5KC 1HKJA 1LG2A 2A5HA 3T40A 3RILA 2W27A 2DH2A 1XS2A 2DORA 2ATSA 2GFTA 2XU2A 3V5CA 2UZ9A 3KL0A 1IHIA 3M0YA 5CLTA 2QAFA 4GX8A 3SAZA 1H7NA 4RCXA 2VP8A 4L64A 3W24A 5D2YA 1G69A 4OBSA 3L0KA 2XN0A 3KRSA 3WF2A 4B15A 4WKAA 3VDGA 4GQQA 5AECA 1XIFA 5LIUX 3QN3A 3CV6A 3R8HA 4H7VA 3UD6A 2E77A 2TPSA 3DBNA 3RK8A 3M0MA 3NIYA 5GPRA 1M41A 2YDRA 1QWKA 1NU5A 3FKKA 4K1WA 5G1MA 4HGXA 1C9DA 3VDHA 4MYAA 4OU1A 4J3TA 5BWAA 1E4MM 1X96A 4J2PA 1W9DM 1R7AA 1EHNA 3P84A 1J12A 3FYOA 3RMJA 1JGIA 2CWXA 2V5JA 1TX0A 5E5CA 1UW9A 4Q32A 3VNMA 1BKHA 4BQ4A 2QHAA 5FJTA 5REQA 4MHBA 3TQVA 2HCVA 1E71M 4NXSA 4DNMA 1S5WA 3VZXA 4YCPA 3CMGA 3EWYA 4J4KA 1EEPA 3V4BA 3W53A 3PF3A 3TQKA 1A4LA 1GG1A 1GVOA 1O1ZA 1EB3A 2WJDA 3BW3A 4V33A 2IW0A 1MI3A 1NOWA 2DZBA 2QVHA 2BGNE 4M8UA 4YMZA 2XIOA 4HPXA 2VCCA 1KFKA 4PUJA 3C0QA 2C15A 5AHEA 1EXBA 1RVKA 1QDSA 3H2EA 3W25A 2V3EA 3C0LA 2NV1A 4XV0A 1UD3A 2DUZA 3IIOA 3LCIA 2VFHA 1QNQA 1VLIA 3IJIA 2XVKA 2PZNA 4XISA 2FDMA 4LWWA 4DZ5A 1W9UA 2YXGA 4UMAA 4W5UA 5BU9A 4JN7A 3PZQA 1FWCC 3KWSA 1KBIA 1IEQA 1O5QA 2GQ3A 1FDJA 3E9AA 2NV9A 5KSWA 3OYXA 1Z32X 4GH1A 3VE9A 3EXTA 1RQHA 2BY3A 2QCNA 3T1GA 5I03A 4JR5A 3G1DA 5LIWX 1GNXA 3L0NA 3RR4A 3MSDA 5PTDA 2QW5A 2HTMA 1Q8AA 3WQGA 4XSLA 2PDUA 4IIDA 3PWIA 1XYLA 4PFHA 4QCFA 1KXTA 1TPVA 1KBLA 2Y7FA 3VNYA 3KRUA 5H8PA 2CERA 4JQ2A 2YYUA 1BG9A 1ZENA 1W1A1 4Y90A 3TH6A 3TAKA 3W00A 5KTLA 1I2PA 2E6FA 5BCAA 4LU0A 4GY0A 2HWGA 4WSJA 4MVAA 1TE6A 1TPH1 3S1VA 3VKDA 3AMLA 1GVQA 4IP4A 4Q8UA 1R7OA 4WEVX 3SRFA 3TJ4A 2R24A 3NM1A 3ANVA 3KBMA 2VJXA 3CH9A 1R2TA 5JBFA 5TAOA 5LNUA 3MKVA 2ISWA 3FJ6A 4DUVA 4H2CA 3WEZA 2ZXBA 4K37A 4B5XA 4RZ5A 1T99A 2G0WA 5FI8A 5A6KA 2QCMA 3GUWA 3VD9A 3NM3A 3TTQA 3ABZA 4JYFA 3HGOA 1K7XA 1ONRA 3LLDA 5D30A 4Q4OA 3UXAA 1OQFA 3W1PA 2I57A 2A3AA 1HGWA 3GKAA 3M0XA 2JGQA 1O66A 4MKNA 1SFLA 3OOQA 3LDVA 1UH3A 4GD0A 4JYDA 4RDYA 1XLGA 1DTUA 3CL8A 2J9ZA 3HGJA 2ZRZA 4YVXA 1J0KA 2IXVA 3QV6A 1UR2A 4M0XA 4GVHA 1CGWA 4Y9PA 2YXXA 1UD4A 4DRSA 4PMVA 1ADSA 3FA5A 1U1JA 4IFOA 3CV7A 2YIHA 3GR7A 4XIMA 1P1XA 3MJMA 3MVIA 4G6CA 3NTYA 1A5LC 2ISVA 2P76A 2HV5A 4L1GA 2F9RA 3M07A 2YSWA 3OP2A 4NP7A 2OPJA 3U9IA 4C6EA 2GGIA 3SCRA 3LHWA 3QGAC 1IR1A 2PBGA 4XKYA 1S2TA 2NQ9A 1GJWA 1E6QM 6REQA 3V3WA 2CXEA 5A2CA 3SUSA 2O7QA 3CBWA 4N7QA 3HQPA 1BGGA 2A2IA 1EYWA 4C6JA 1YADA 3TLQA 4YWIA 2PCEA 5FJUA 3T6CA 1VRXA 1Z6KA 4AD2A 1XL9A 3LX9A 1NDYA 3GNDA 5E0KA 4MB5A 4FA3A 4MWAD 3LRKA 3O6DA 2Q3OA 1PDYA 2WJEA 4YNGA 2O9PA 3IUHA 3S1UA 3OGVA 4EX4A 1W9PA 4F66A 3NQEA 1GT8A 1JNDA 3P82A 4RX0A 4GUJA 1OYBA 5T91A 3E3HA 1FHVA 2NT0A 3N04A 2B31A 4PMOA 3P5ZA 2GSJA 3RLHA 3W2UA 4H9ZA 2BX7A 4YL2A 2JEQA 1UD6A 2TAAA 4E2BA 3MMUA 1H3GA 3N6JA 1ZBCA 2BVTA 1DQXA 2AOSA 7CGTA 5C7HA 2X42A 5FA5A 1VRDA 1UQYA 1X38A 3WELA 1V3KA 5I0DA 4IH3A 4LF1A 2I1OA 4JTJA 1IE7C 3Q4DA 3H12A 4HQVA 1B3XA 4GHRA 1V03A 4R27A 2FVMA 4QEEA 3W01A 2AMGA 3HB9A 4ERGA 3RX3A 3L4TA 1QNPA 4MWAC 4ZXOA 1A0DA 1Z3NA 1SJBA 4H41A 3RPMA 1VHCA 1K8XA 1EO5A 2XINA 3SM0A 4Q4RA 2XFYA 4GJIA 4XVDA 4Q3MA 2ZQ0A 1LWIA 4NIRA 4KMQA 2QVNA 3NQ6A 3H23A 4HPJA 1UG6A 3B97A 1K8ZA 3V0TA 4R7WA 1RCOB 3AXHA 2WQPA 3C3UA 2B7NA 4H6EA 4XZIA 5DO8A 3UERA 3EWUA 1DL3A 3NQMA 2WVSA 3S6DA 2OU4A 3V7PA 3RRAA 2GUYA 1RJRA 3RR1A 4K7VA 3AYTA 2ICSA 2EEXA 3GTNA 1KGWA 3H53A 3UJSA 1ZLPA 3TA9A 2VZTA 3L4WA 3REQA 3V75A 3OEXA 2NVCA 3UZJA 1OINA 4RPPA 2E1WA 1P48A 4CNSA 1JIBA 3M7WA 1JDDA 2J4GA 2G97A 2WV8A 4LS2A 1NQKA 4INFA 4HN4A 2REQB 3HPFA 1MNSA 1EEXA 3VGGA 1O60A 4ADTA 2YFOA 3CZGA 1XRTA 2A7NA 1JXJA 2WCSA 4OECA 4LVFA 1WE5A 4IGMA 1MUMA 1TR1A 3R4IA 2HS8A 2I7GA 2P0IA 3WNNA 3WNMA 3GDTA 3UWQA 1S38A 2CLOA 2P3ZA 1XCFA 3DFQA 5AYBA 2Y2WA 2PTXA 1DQUA 3I68A 2INFA 5C55A 3UWWA 1UWQA 3NWRA 4GI4A 1V7AA 4C5ZA 3G1VA 2GVLA 3EWWA 3BAXA 3E49A 4C7GA 1OCNA 3G0XA 2BXYA 1XIGA 1WV2A 4MB3A 1Q65A 3WYZA 2PRMA 3HPAA 3KTCA 4LVBA 4QNWA 1L6SA 3WDRA 3GWQA 2DT2A 4JXCA 1U5HA 1ONXA 4PMUA 1U5JA 4E5TA 5K2ZA 3NO5A 4X9YA 1V3IA 4NL1A 4ATDA 2Y5EA 4EF8A 3FAXA 3PB0A 1FHUA 3F7JA 3AHTA 3WLLA 2Y7GA 1KXVA 3EDFA 1VIZA 1XLBA 5EMLA 2DSUA 2I5GA 2HPMA 1NWRA 3USZA 2WNQA 4S3BA 4PN2A 4PRWA 4XUYA 4S3FA 4CNTA 3NZPA 3CLMA 3GAYA 2R1NA 2AGKA 2RDUA 3L2LA 2CBJA 1VHNA 3WUFA 5HWJA 1AZ1A 4MWAB 1SO3A 2EGZA 1A5UA 3MP4A 4BHYA 3KBJA 2DZWA 4LUTB 2ZRVA 4GNJA 1I60A 3W7MA 3VXGA 1VENA 2OEMA 2GGHA 4D9PA 1NOUA 1PZ0A 4GY7A 4W8AA 1TPB1 2ZUMA 1LTDA 3PPCA 2ZA2A 2UY4A 3NGFA 1TV7A 3AIRA 2BWGA 1N2VA 2QEZA 1S3HA 1SU5A 1Q6LA 2AMXA 5H6HA 3PZVA 2QV4A 3MANA 4K8EA 1VJZA 3GFZA 5A94A 1KTBA 3A22A 1H51A 2E5DA 4JN8A 2EHHA 2GGEA 4G8TA 4WSKA 1PX3A 2PC8A 1ME8A 4Q4SA 3H4XA 3EOSA 1G4EA 3B0YA 3LCXA 4AVOA 3VOIA 5GQBA 1TTQA 4X0NA 2Q71A 2ZA3A 3L4UA 1TV3A 3AMCA 4XX6A 4AZGA 3L65A 4UUIA 1AJ0A 4GYPC 1M9HA 1W5PA 1BRLA 5CPLA 3HN3A 1H5VA 4NRRA 3MKCA 4ENLA 7ENLA 1CIUA 1VCGA 5I3JA 5LSMA 1AQMA 1E3ZA 3UXIA 2BY0A 4ICCX 4RK8A 3A5FA 4GCXA 3MU7A 2QV5A 1KV5A 2XSAA 1LBFA 3RIKA 2E5BA 3THQA 2YYTA 1J11A 3N12A 1ME7A 4FHAA 3G5EA 4S39A 1VYRA 4WJ8A 2J7CA 3TROA 1O6IA 2F61A 3VVGA 4U3AA 1UUQA 1OYAA 3OG2A 3BMVA 3PG8A 1UB3A 1SO4A 3CB8A 8TIMA 1LRTA 1LM1A 2VGFA 3C2EA 4FXFA 8RUCA 4AF0B 4PTDA 4RLIA 2GK1B 3LPGA 3EOEA 4QROA 3FA3A 1UA3A 5EY5A 4W88A 5LYRA 4K2SA 3NQ2A 3DYPA 1K1DA 3LCHA 4JY9A 2OZ3A 5FEWA 1B90A 3QYSA 3N3MA 4DJEA 3C2RA 3LPOA 1IGSA 4H9TA 2A3HA 4GE8A 2DJXA 2OTDA 1UASA 3B8IA 1VCVA 2I9UA 3H6OA 4B5WA 1JUBA 1ZUAX 2QCDA 3WNOA 1UOZA 2YLLA 2Y24A 3OTRA 3WJYA 4CEUC 4PUEA 5AOUA 1KTCA 4HOZA 3SRDA 4H6KA 4DY1A 4O1FA 4PCNA 2OO0A 2VKZG 1UR4A 4KF1A 4O1CA 4UCFA 3EB3A 5T8GA 2WZTA 3UGRA 1RP8A 4X2RA 1JAKA 4U31A 4RE4A 2CWNA 4NKCA 5BNKA 1MZRA 3NR0A 2D23A 3LI0A 1SO6A 4F0LA 4N02A 3S1WA 5K7JA 2CLLA 2VZSA 2ZE0A 4Z08A 1UP2A 2GYIA 1RALA 3OA3A 2BBFA 2D0HA 4AISA 2EPKX 3L2IA 9RUBA 1RA5A 3BG9A 3TYDA 1ENUA 4U3CA 2RDTA 1L6GA 2KZHA 4BQ2A 1R3QA 3R12A 5I7GA 4E3VA 2NXHA 2OGYA 4JTRA 4FI4A 1IIGA 2F38A 4PMZA 4H8VA 5C9XA 2Q6ZA 3LV5A 3N34A 1BTCA 3EA2A 3C8NA 4YVPA 4BJHA 1REQA 4UNIA 4XO6A 4GWEA 1TUXA 1TMHA 1TQXA 1NP0A 3PZTA 2V0TA 3EKLA 1P6CA 4KERA 4WJXA 2A79A 1VFMA 4RL3A 2JALA 4F2TA 1P0DA 1CB7B 3CXOA 3TCEA 1IF2A 2BASA 4U33A 4HKPA 1TMLA 4A21A 3T44A 1C91A 1HX0A 2E7FA 2OLAA 4H7ZA 2BMBA 3SCUA 6TIMA 1FWFC 3IGSA 3AU6A 1GEHA 4HNNA 1M65A 4M1RA 1S2WA 2E67A 2VC7A 1K9TA 4FX8A 2E4TA 3D47A 1NEYA 1R0MA 4IX2A 4ZA0A 1UR3M 2VUNA 2PGEA 4XK2A 1PWLA 2DZVA 1BHGA 2OQHA 3JZUA 4OUEA 4RV8A 1MMFA 2QKFA 3HG4A 1JZ3A 3U6WA 3CH0A 3KCLA 3PPHA 1TWDA 3CZJA 2VC5A 2E8YA 3PTKA 3UA3A 4CD8A 3TW9A 4DO7A 5LZLA 1EQPA 5E9AA 4IHCA 4V28A 2VX6A 5ENLA 2NXIA 1DV7A 4UQ9A 2IKGA 3PAOA 3PZGA 4JKMA 3WUBA 2PF8A 1WOBA 3QSRA 1TPDA 2EJ1A 1LOLA 2G3IA 1VCFA 2FHBA 3LUTA 3TSMA 1SW7A 4UFLA 3VD5A 4AZIA 1MO0A 2UY5A 1J8VA 3HG5A 2FLIA 3SRKA 4YTUA 4JX6A 5JXQA 3ENLA 1TUFA 4CLMA 3LM3A 2QAPA 1MDLA 4ACYA 1BGAA 4UQDA 4J2MA 3AISA 3NCOA 3VU2A 1FHDA 2XM1A 1VD6A 1Q7QA 5T9BG 3B8SA 2QXWA 3U5YA 2ZRYA 2X16A 2OFJA 4GYKA 3FGCA 1SZNA 3P6LA 3BZJA 1JG9A 3QQWA 2O4QA 4PCSA 3CQHA 4W8LA 3UWZA 1Z7AA 3ANUA 1EA9C 4IXXA 2DZSA 3MO4A 5DEZA 1FWJC 1SW0A 2QCHA 2IKIA 1DPMA 1R6WA 2ZFAA 4DN1A 3HMCA 3K8MA 4Q8PA 3GBDA 4WGHA 3SCOA 1ZJIA 5LGXA 4O8RA 2PDFA 4FXRA 1QOPA 5EU9A 5GJNA 3WK3A 3KZSA 3F4CA 3RN6A 4D6FA 2YZRA 3FIGA 3TUUA 3W81A 1NELA 1FWNA 1R46A 4IPLA 3TZFA 4PTMA 4H6RA 4US5D 3W22A 4NZ4A 1AW1A 2OT0A 3QY7A 3W6MA 4DBUA 5U4NA 4EXBA 1W8GA 3DKJA 3WQCA 1SJAA 3A64A 4QQUA 2VR5A 2FPYA 3NO3A 4Z2IA 2Z24A 1F3WA 2XWDA 3L4XA 3V5OA 1E3XA 2YX0A 4OT7A 2Z7GA 3G6LA 2XGBA 1A0EA 4K38A 1JZ2A 1HIZA 1K77A 1FXPA 5AYZA 2EPLX 3PJWA 4GMEA 2XISA 5EA9A 3U2CA 1OBAA 3BV4A 2BV9A 3P0XA 1B30A 3SUUA 1E5NA 2TSYA 2ZDSA 3SDOA 3S9YA 1TRDA 3HGSA 2DVXA 4ATWA 2NW0A 1Q63A 3BLIA 3BJTA 1EIBA 3ZOAA 1OIFA 3VA8A 4D6HA 1UJPA 1RHCA 2J8GA 3S2CA 4PUMA 3UBPC 2G3NA 4RZ4A 3MI3A 1GUVA 2W4XA 3VCNA 3RX2A 3TJIA 4DM1A 1GQIA 1KRBC 3HV9A 4NYUA 3ITTA 5FJOA 2QPSA 5AC4A 4QE4A 4CEXC 2BOFX 1MEIA 5I3IA 3HGRA 3DHUA 5CBIA 5HWNA 1SR9A 4LQ1A 2VEFA 4XIAA 3NA8A 3W73A 1Q45A 3Q58A 5HUPA 4GGHA 4H00A 4M1BA 5EL1A 4EK7A 3I3EA 3TCSA 6ENLA 4YXGA 1JZ7A 1BYBA 3H2OA 3W86A 4QDMA 4PMJA 3F5KA 4GQGA 3VFLA 3K8LA 5U7SA 4UTKA 3VI2A 4BS0A 4Z42C 4J5NA 4MFEA 5CSUA 3BCFA 3R13A 3DENA 5I00A 5DELA 2IPJA 3HIJA 1E6SM 1VJSA 3G1RA 3TYUA 4QRNA 3KRZA 2BGQA 3H7VA 1G67A 1FRBA 3DDMA 2J7DA 2Y8VA 3QFEA 1I1XA 2OOGA 1K4HA 3P67A 4HPNA 5JU6A 2E68A 1PKYA 4L9XA 4MMWA 5M03A 1U5VA 1N8WA 2NX3A 1GYNA 2TRSA 1L8PA 2WNNA 3ZVHA 2VEMA 1W8SA 3BARA 1J93A 1B54A 3Q65A 4G56A 1KGUA 1LF1A 2VDGA 3S1GA 2V2DA 2Q01A 2UY2A 2YBTA 1G4TA 3N9KA 3URQA 3ZJ6A 1JD7A 1ML1A 3ONCA 1FX6A 4AIOA 4GPNA 3H22A 3WY1A 1Q4NX 4Q4MA 3AU2A 5TBOA 1W17A 4Z2HA 4IX0A 3LBCA 3B05A 4K3ZA 3V35A 3UR5A 1XYZA 3VKCA 1PTAA 4UTHA 1D3CA 3EWZA 5AYXA 3HPZA 1KV8A 5HNNA 1XYMA 3DAQA 1DJYA 4DZHA 5HQMA 1SW3A 2FMOA 3VDBA 2Y0FA 2QF7A 3CPUA 4U10A 4B2DD 3Q2DA 2EPHA 1W2PA 3G6MA 1GZ1A 1EKOA 4NNCA 4LC6A 1NAL1 2UBPC 2WB5A 2GPTA 4HU3A 5G5IA 2D2HA 4DJED 5EMJA 3N11A 1OFAA 1L8NA 1ZAHA 1ZU8A 1XIIA 2WJZA 3ARPA 4F79A 2C71A 4J3UA 4MY9A 1DE6A 1HG3A 2CHRA 2ZIDA 2IKHA 2R1LA 3W87A 4MKSA 5FF2A 5DT7A 2W62A 3N73A 3DUGA 1ZL1A 1YE6A 5FOOA 2G3JA 1MXSA 4F0SA 4A8IA 3IGUA 3W0KA 5BW6A 1F6KA 3G8EA 5A8QA 4H8NA 4CCDA 1OX5A 4S23A 2PZ0A 3KLLA 5CPQA 1YW1A 3TR2A 5M5DA 2VCBA 4S3EA 3SR7A 4ZOAA 3VOHA 2QIIA 5A6SA 3W7DA 3KHDA 1DE5A 1LT8A 4XUGA 3M16A 3W3OA 3WLMA 3ZO9A 3NVDA 4BY3A 3CAQA 3S5SA 1BSLA 1X6NA 1H11A 1F6YA 1HQTA 4EP8C 1ZBWA 3LHVA 3S6TA 1H4PA 3EB4A 4ADUA 4DJDC 5E6ZA 1GONA 1QHZA 2A7RA 3QKEA 2Y61A 3AYVA 4QCEA 1PYFA 2NUXA 5FSDC 4LVAA 4OIFA 2ON3A 4GVFA 3I6RA 2VELA 1CGTA 1WUEA 4U2YA 3UP8A 5J8LA 2P8CA 4C91A 4EOUA 1CLXA 4KETA 3AMKA 2NQ5A 3CO4A 4XG1A 2QJNA 2ACSA 3F4WA 3GKFA 2PWFA 1MQPA 2DDXA 5E0FA 3GNOA 2Y4SA 3GUGA 5G1TA 3SBFA 1LWHA 4GQBA 3LSCA 1XRFA 1YXCA 1UA7A 2PGRA 3O0FA 2XVPA 3AICA 4S1FA 3C5QA 8CGTA 1R3TA 1IXPA 4QNEA 4JFVA 1MVYA 1MNZA 2CYGA 1EJRC 4PMYA 3FAWA 4IIEA 3T0AA 4QE5A 1M7JA 2YL9A 4H6QA 4WHBA 3S6OA 4KRZA 4UOZA 3MVTA 3CUJA 1SMAA 4BI6A 1X39A 3CO8A 1GVYA 3N6QA 4LRTA 2Z4GA 4F0MA 3R43A 4HU4A 1S2CA 1KRMA 4Q8QA 4MYXA 2J6XA 3VGHA 2J62A 1D3HA 3PR2A 3CEUA 2D73A 3I4KA 2FDSA 4Q8VA 2XN2A 3ID7A 3WCZA 4JTTA 4IPJA 3CUZA 1XISA 4DZIA 3AXXA 5AVNA 1X8CA 3B3DA 4J3XA 2I56A 4PEKA 3SFWA 4J3SA 2C8NA 3S8HA 1QJWA 1XIHA 2GDVA 5HMDA 4YS1A 3OODA 1FWHC 4GFIA 3UZYA 3T8LA 2WSKA 1BVZA 1GKRA 7PTDA 3RAOA 2PTZA 3QHNA 4LV9A 3EOLA 4A2RA 2VHLA 3E5BA 2ZRUA 3GVQA 1KM2A 4O57A 4BEQA 4J28A 3GTHA 1BXBA 2VYOA 3ZIZA 1WKEA 5KZ6A 2P53A 1AK5A 3WDHA 3KW3A 3NQDA 2NQLA 1CDGA 1KCZA 3GXDA 3CEPA 2QJMA 4GBDA 3P3BA 4N9BA 1H09A 4M5PA 3UZZA 4AVFA 2W79A 2A3EA 1J96A 3BTNA 5MF5A 1MXGA 3ISIX 4KW2A 2WSYA 4WIWA 2ZKMX 4J7RA 1EIXA 1EH9A 4YIWA 3C3NA 3WJZA 4ZQNA 5JH1A 4YPJA 3GG8A 1SR0A 1B4EA 3LXAA 3QEZA 4LYQA 3KOYA 4PCTA 4L4PA 4TUFA 4L4LA 3EDDA 3FK4A 1UYQA 2QCDB 2CETA 3L21A 3V16A 3WJSA 3PANA 3T2OA 4MNJA 3ZVIA 3S0CA 2CEQA 2RJHA 1GOOA 5IXEA 2XHYA 3VMNA 3EWCA 3MCNA 3SGGA 3MUIA 3RG6A 1TTIA 5HUOA 2Z1VA 5DF0A 3WMSA 4IMFA 3QLDA 3TTEA 4C7FA 3NDZA 1T7LA 1F4HA 3RO8A 1C8YA 2PP1A 1V3HA 3GXPA 3W02A 3LS9A 2PDQA 4Q6XA 4M82A 4TVUA 1PIFA 9XIAA 5XIAA 1PE1A 5E6YA 3GVVA 4C6NA 4MFDA 1Q7ZA 3QPEA 3PNUA 4DI9A 2HVNA 4W7UA 2FGZA 1OCJA 4JFSA 4RXFA 1W5OA 4JPGA 3N4EA 4IG2A 3F5JA 4RE0A 4CU7A 1XBZA 3ZR6A 2DSZA 3VX1A 3THUA 3GG0A 4LEFA 2IQ0A 5AFDA 2XVNA 4E2VA 5DBTA 4JIIX 4JYEA 3HF3A 4CKQA 1KCXA 4LFYA 4DXVA 2I16A 3H7UA 1XLMA 4ES4A 4IF2A 4H8HA 5AHIA 3RCYA 2GL5A 2WHLA 1AVAA 1XDLA 2QPUA 2X0YA 3TYCA 4UTWA 2FGLA 4EACA 2V2CA 1XIMA 4TU1A 1MW2A 4QDPA 3EX1A 3ARUA 1US0A 3HQOA 1HVQA 1Q7MA 3MT1A 4ICMA 4OWGA 5G2HA 5ABGA 3WQPA 4NYYA 4JTQA 5I3GA 3OGSA 1IV8A 2D2GA 4C7DA 3PFMA 1EUNA 3E2SA 3DOPA 5AYYA 3AI0A 4AUBA 2Z29A 2VRQA 1XINA 2GJNA 4XBSA 3HPSA 3VTRA 1B5TA 4KCWA 2X30A 1C92A 1HJUA 1G6CA 1ZPTA 1KFWA 1E9YB 3QHMA 3MBFA 3WQVA 3EMCA 4HTYA 1EDQA 4NZ5A 5CZTA 4IISA 2CHOA 4M51A 4EIVA 3GAKA 6ALDA 3QTGA 3G0SA 3BW4A 3QMTA 4ZOBA 4BF5A 2J24A 4M19A 1ZALA 3CWOX 1P0BA 3BOFA 2R94A 1KW1A 2CBIA 2YL6A 3S83A 3SN1A 1TVPA 2RGLA 4P8UA 3GR8A 4DWDA 3H55A 3ZQ9A 1V5XA 4G7FA 3LTYA 1PO9A 3K5XA 3WD3A 4RJEA 1TA3B 5CGMA 2HK1A 3P60A 3SJ3A 2VD9A 5GNYA 3R7MA 1OF6A 4Y96A 4CNPA 4P7NA 4WGXA 1MRAA 3E2QA 3O7UA 4H7CA 4UZSA 3AZRA 1N82A 1MRQA 3PZIA 4HYVA 4NJIA 2DP3A 1XBYA 1DWFM 3N19B 2ZADA 3CYVA 4O54A 4AC7C 3BMXA 4A2SA 3F2CA 4QG8A 1ZSXA 2NVAA 1RPKA 1CLKA 1QMLA 4M6PA 4UOQA 3BQ6A 1CI1A 3B9AA 3P62A 3PY2A 3B8UA 1L0PA 2IQDA 4UFMA 1XH2A 1RQEA 3IAPA 1XSIA 3GW3A 3RITA 1FCUA 4DAFA 1EYEA 4JTHA 3LBMA 3W84A 4IPIA 4IMAA 4KWUA 4QXIA 5HXMA 2NLYA 4DI8A 2PWUA 2G3MA 3CS2A 3CQJA 1V77A 1Z42A 1O12A 2EAWA 2VDIA 1UKSA 1UR0A 3IIZA 1JRBA 4NJJA 2J88A 4CCZA 1JCJA 3B9OA 1UIOA 1XFCA 2HVOA 1EOMA 3FX4A 4JFUA 5BOFA 2P8BA 4QJ4B 1CGVA 4QG9A 3ARRA 3SCNA 2V63A 3QFWA 3WG6A 3M5ZA 3WLIA 1LT7A 2HSAA 2E28A 5AHFA 3RLVA 4ZCWA 4HHMA 5FJIA 4OZOA 4AW7A 1HZYA 3W7NA 3URBA 3TSBA 3IJ7A 1IWAA 1KM3A 3OYZA 3UY8A 3PWGA 1OYCA 4TTUA 2VQTA 1W3IA 1XJBA 5E09A 3A21A 4IMDA 3ARWA 4AH7A 4GI6A 3MZ2A 1DHPA 4Z0SA 5AKQA 4AWEA 2GOUA 5I2UA 4LUJA 1DWAM 4MY1A 1M03A 5LNRA 1VS1A 3RDKA 2PF0A 1B31A 3G1HA 1Q2RA 1RK5A 3W71A 3M0IA 4JIQA 1W1PA 2WM0A 4KFOA 3G3DA 2PTYA 3M0JA 1LUCB 3AQUA 1HFBA 2WHKA 2E9BA 2AAMA 1PIIA 1R3SA 3BG5A 4JCMA 2NQJA 4EF9A 4Y2WA 1NY1A 2XIIA 2V5DA 4WKHA 3LTSA 4W8BA 4KESA 4OVXA 3QV8A 1HKMA 4KT2A 3ANYA 1XLAA 3F1QA 1P1MA 2WW5A 1KM0A 3EX4A 3WFAA 2YBVA 3DBPA 1ZP3A 3KS6A 3AZTA 2BVWA 3BGGA 1GW9A 5FEZA 3WFLA 2NX1A 2PTWA 4WQ6A 2D1ZA 3EEGA 5HDRA 3OIHA 4UIOA 4HP5A 1RQBA 1PTDA 3F4NA 1VZWA 1WDSA 1ISVA 1AH3A 3BLPX 3SCWA 4JOMA 4UNKA 1R8LA 4OGZA 1QPQA 2Z7KA 1W5NA 9XIMA 1WYIA 2MNRA 3LMYA 4PGLA 4PMDA 5HPCA 3GNPA 3S5NA 1W1ZA 2I5IA 1QVBA 5EPDA 2KAUC 3FSUA 3FEQA 2XIQA 2BY2A 2ASHA 2YCKX 2AL1A 4HBKA 4R5EA 5D9NA 1JF6A 3C2OA 1V7YA 5E0CA 4IQLA 1QHPA 3OHMB 3VIJA 1Z89A 1WAWA 3AXMA 3MA8A 4HSOA 5I23A 3GG1A 2OYMA 4JQ1A 4XQ6A 3SFKA 2Y7DA 4JFTA 4QSHA 1P0KA 4HIBA 4FNSA 1L9WA 1CTNA 4CNNA 2BVDA 2PU0A 3ARZA 1CXIA 3AJ7A 3BGAA 4WD0A 1EL3A 1KM1A 2FJUB 2J13A 7XIMA 2IXUA 2BHUA 5D4YA 4GO8A 4CN6A 4LVDA 4MF4A 1BXCA 2V68A 1XGEA 2YFNA 3SQMA 4CCEA 1IR2A 2D24A 1PZ3A 3LCFA 4GYFA 3AHVA 4IFKA 3QBUA 4HOXA 4LNCA 3TV8A 5CSRA 3CGTA 3K46A 4ATLA 2CU0A 1CXFA 2DV0A 3R1ZA 2X7WA 4YU1A 1G01A 4IGSA 2J25A 4FOJA 1RJPA 2V5BA 1XICA 1KKRA 3GYEA 5BRBA 2QLYA 3WH9A 1SSDA 3ITOA 4LXFA 2OZTA 4ACZB 3GC2A 1Y8BA 3BSHA 2GSEA 4AEOA 4JX5A 3E0WA 3UXKA 1F3EA 3TYAA 3GC4A 3BAJA 4HA4A 1RXOB 4UXDA 3VD3A 3TYBA 4DO6A 3EXRA 5GJPA 3W7EA 1M68A 1RA0A 1WZLA 1G94A 4TXEA 2VO5A 1JDCA 1Q6CA 3O8AA 5A8PA 2ZYFA 4L1XA 3PUDA 2EG7A 4NSBA 3L68A 3TYEA 4AZ7A 3UQNA 1Q6EA 4E4PA 1DJGA 4GYJA 2MANA 3M5YA 2XTKA 4WVXA 4UTIA 1C7SA 3UJFA 3GC5A 3S9IA 1B3ZA 3BK0A 1LLOA 2W3ZA 3NDYA 3WBAA 1KRAC 2DZPA 1LRNA 4ZQCA 2OKOA 2CLKA 4TV6A 4KWOA 2FPVA 2VI0A 2YBUA 2PEVA 1WO2A 3O0KA 4RKAA 2ZTKA 3CUGA 4FIRA 4AD5A 3WBXA 3UZWA 1LOSA 5AZ1A 1HP4A 1ITUA 1GJPA 4TR9A 1I75A 4S38A 3UJRA 3GU9A 3TZNA 1VYSX 3GVWA 5FL1A 4C65A 4X22A 3NJ3A 1TO3A 4HCLA 5A95A 5K9DA 4LB3A 4HJWA 4YJ5A 3QVQA 3L5AA 3DH7A 2WMHA 3PJXA 2R1MA 3W6YA 2QMKA 3UCQA 4IJBA 5D9PA 1QO5A 5C6MA 2JEPA 1KR1A 4GZJA 4X63A 2G96A 1F8MA 4PUDA 2YA0A 4GH3A 3JS3A 4Q8NA 1EQCA 5BXPA 2VFDA 1A49A 1S1PA 4QJ5B 3AXIA 4M7SA 2OWWA 2W9MA 2Y5JA 5CZSA 1E6ZA 5A6BD 4RNHA 4WY0B 4JCLA 5D38A 1JZ5A 4PB5A 1V08A 2DSKA 2W0UA 4JTUA 1ZNNA 3ZWTA 3BAIA 3UNTA 1ITQA 1OY0A 4IL2A 4DLFA 3EXSA 2X0HA 4XWUA 1IZCA 1UZDA 2JBMA 3PUEA 5IDZA 3DHDA 3H4WA 3E0FA 3UVIA 2J66A 4ORMA 4J1OA 3W6LA 4URIA 3CUXA 3PZOA 4FNQA 1FWEC 1TJ2A 3HTWA 3W29A 4UTFA 1H7XA 3TFCA 3THAA 1FH8A 4A6GA 4DAIA 4DF0A 3GHTA 5EMMA 3QF0A 3UF9A 4GISA 1P7TB 4ERIA 3BLOA 4CD5A 4CD7A 1KLZA 3DGRA 1H7OA 2VEGA 2REQA 3RU6A 3WMBA 4F2BA 1QO2A 1DTNA 3GXMA 3PG9A 1LZOA 1KCKA 4NUWA 3N9RA 5CPNA 3ZR5A 1TWIA 1QW9A 4QAWA 2QIWA 3UCDA 5E93A 2B7PA 3WD0A 1Z44A 1DBTA 4DBEA 2ZE3A 4JHOA 2CFFA 6CGTA 4XD5A 4WOQA 5ABFB 3KP0A 1KRCC 2C79A 2WMJA 2XH4A 3HURA 3TJLA 4LW7A 2GQ9A 1TJRA 2D20A 3N2OA 3MUZ1 2RH9A 3WF4A 2Y6ZA 1HN1A 4PSPA 5F7UA 3H2NA 2E9LA 2VNCA 4OE7A 3W88A 3CYJA 4D1JA 3EDJA 5D8WA 3VGBA 4Q8WA 3XINA 5JVLA 4GIRA 4O52A 1NFPA 2E6YA 3CTLA 3KVMA 1T41A 3NAVA 4FP1A 3GLCA 4MNLA 3SURA 5K9XA 2JE8A 2WVVB 1ZY9A 3UZ5A 1K02A 2G4FA 1NJJA 4O19A 1GKQA 1H1ZA 5HMFA 3BICA 1K3UA 2W66A 1TRIA 3WF3A 3M5XA 4MWAE