4FOKA

1.8 a crystal structure of the fimx eal domain in complex with c-digmp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
VSIYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding
total genus 96
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fokA00
3PJWA 3GG0A 3PFMA 2BASA 3KZPA 4Q6JA 3SY8A 3HV8A 3GFXA 4FOJA 4ES4A 4AG0A 4RNHA 4Y9OA 4HU4A 3GFYA 3GFZA 4RNFA 3S83A 4Y9PA 4HU3A 5M1TA 4FOKA 4HJFA 2W27A 4Y9MA 4LYKA 4AFYA 3U2EA 4Y9NA 3GG1A 4F48A 4FOUA 2R6OA 3TLQA 3HV9A 5MF5A 5MKGA 4LJ3A 4RNIA 4KIEA 4RNJA 5MKGB 3PJTA 4J40A 4Y8EA 3PJXA 4F3HA 3PJUA 3N3TA
chains in the Genus database with same CATH superfamily
3LN3A 2PP0A 1XGEA 2F8QA 5DQPA 2NV9A 4Q4MA 2V9DA 3U0HA 1VCFA 2R9RA 1SO6A 3UJEA 2HDJA 1UP0A 5GNYA 4GZIA 3ZJ7A 5CQ1A 1CXHA 2W92A 3GRIA 1UH2A 3WH9A 3STEA 1G5AA 1LLZA 4D8ZA 5JH2A 5LNSA 2ISFA 4AVOA 1TJ2A 3V35A 2BXYA 1F8MA 1RD6A 2Y7EA 1S2CA 3EXRA 1FFRA 3GB6A 4HU3A 1H62A 3TN6A 4H9MA 2Z2UA 2A3CA 4GYKA 4Y96A 1VQTA 4H4IA 4XWUA 1PPIA 3DN5A 1F61A 2FVMA 2DSWA 3W6YA 1Y8BA 1VLWA 2BBFA 1VEOA 2FVLA 4JYEA 3PFRA 5F7UA 4O1FA 3QEZA 1AZ2A 4R9OA 3R7MA 2XN1A 3UPBA 3TP4A 1NOFA 4J3TA 3WDQA 1SVDA 1CI1A 2Y61A 3MPGA 4KPLA 4ZO9A 4JTFA 3CPGA 1T41A 3G1FA 4XZMX 2GQAA 1V0KA 2EPOA 3LGGA 4MJMA 2OCZA 1OFPA 3TNOA 1GOMA 3MT1A 1AZ1A 1NF7A 2FJUB 2WMFA 4AMAA 5F1UA 2Q8ZA 1O4UA 1EJSC 1CT5A 4KBXA 3MA8A 1RSCA 3NVTA 2DZVA 4P7NA 3WDRA 1DWJM 3TN3A 3LCGA 2YR1A 1AL8A 5LIYX 5BROA 1LCOA 1LL4A 4W85A 2YW4A 2FFIA 3QHOA 1V02A 3Q45A 5A3HA 5F2MA 4L61A 2WVTA 1RA0A 3CNYA 4UQAA 4MF4A 2PAJA 1VAHA 2PCEA 5CSUA 4LT9A 2OG9A 2I57A 1H1ZA 1GNXA 4H83A 5F2LA 4A3QA 2WHMA 3GG8A 3LEPA 1Q6QA 3GD6A 5B80A 5EMLA 1BWVA 4L7ZA 3SUTA 2OT0A 4Q4OA 1PAMA 4IP7A 2INEA 1PIGA 3O06A 3QVQA 1OK6A 1XR2A 3OLIA 1C8XA 5DCBA 1EZ2A 3B4UA 4U3AA 2OFJA 2JQXA 1A3WA 4LVAA 1Z48A 1FWBC 1GZGA 3IK4A 3PUGA 1SR9A 2ZICA 2WPGA 2WMKA 1TQXA 3VNYA 1U83A 1B3WA 4OJYA 3PZOA 3QQ0A 3UFYA 1AJ2A 1V8EA 2GQ9A 5D30A 1YYAA 3V0SA 1E6ZA 1MXDA 4DJEC 5LXEA 1BWKA 3B9OA 1JCXA 4ACZB 1M1BA 4ZOBA 3NQCA 3QLLA 1O60A 3KL0A 1NELA 3CHEA 4RDZA 1OD0A 3IVSA 5LNRA 4BY3A 1K9DA 3LK6A 3M41A 1KGUA 1H5VA 3DI1A 4YMZA 3IGXA 2Y24A 3EEZA 1SW0A 1ICPA 1EBHA 1F73A 1EDGA 2JIWA 1XIHA 4QISA 4PMYA 3RF9A 4EWND 3SECA 4DY1A 3E2VA 1CBGA 2OU4A 4TQTA 3Q94A 1W6TA 1X6NA 3REQA 4ZEPA 2VEKA 5HQEA 2QHAA 1NWRA 3ZJKA 1MW3A 2I56A 4QSHA 4TVCA 4HNOA 3BW3A 3EKLA 2XN0A 3USZA 4ES4A 2NQ9A 1WE5A 4NNBA 3N14A 4EXBA 1FOBA 3MWAA 1XYBA 3V1PA 5FF0A 3VUSA 1I60A 1CNVA 1OFOA 5IM51 3ONBA 3AS3A 2WMGA 2VX5A 3B8IA 1ZGDA 1W9XA 2VEIA 2NQLA 3V7PA 3IWPA 3ID7A 4N02A 2BY0A 1PHQA 3IVUA 4P2VA 4KGJA 4Q6XA 4XZLX 3IANA 4DJFA 4UMAA 2UY5A 2XIMA 4BEQA 3M43A 2E6FA 1JULA 3B05A 4CNPA 4PL2A 4C1NB 1OFDA 2D20A 4DB7A 1OFRA 5I3DA 2Y8VA 1XKJA 3G1RA 1WOAA 3QF0A 2QDDA 4AW7A 1K9FA 4MNJA 2VCCA 3VGHA 3SUUA 2WKLA 1G4EA 3MSRA 1XX1A 2QJMA 3H22A 1B1YA 3L23A 4Y7EA 2WCAA 2GDQA 3KOWA 3NZQA 3H2OA 3GDKA 1VP5A 3WK1A 4Z0JA 1Y5VA 2PWHA 2XSBA 5LHEA 1LQAA 5LNVA 1SR0A 5FJTA 1C92A 3EGJA 3NAVA 3SO7A 5ABFB 4PSPA 2R91A 2YBVA 1EIBA 3VVGA 4JHOA 3C5QA 1PX8A 4F0SA 2Y5JA 4B5WA 1KBLA 3P8JA 4NJIA 3RMJA 1VPXA 5G4WA 2E77A 3RPDA 5TIMA 5AHIA 2FYMA 3H70A 1CLVA 1QFEA 1KXVA 5ABGA 1YRRA 1YXDA 2BY2A 3PNUA 5HNRA 3OO2A 3RLGA 5D9PA 2VRJA 4XK2A 2FZMA 1CPUA 1QNRA 2XM1A 4ADSA 3AI0A 3CLWA 3R8RA 1TR9A 4KWOA 4M82A 1W3LA 2ZUUA 4GGHA 3MDUA 3M44A 2V68A 2A3EA 1UHVA 4O54A 1FWCC 1JGMA 1K7FA 1VC4A 3DIPA 3I10A 3OA5A 3K4DA 4LH8A 3EKGA 4IM4A 4TV5A 3U2CA 1LRQA 2QUUA 5CGQA 3W24A 1LTDA 5T9CE 2PDNA 4RX0A 4LC6A 4NX0A 3WJXA 2EKGA 4A05A 1V6WA 2A0NA 3QMRA 3VMNA 3EEGA 2YW3A 1QNSA 1FH8A 4KQNA 3UXKA 1M01A 2H3BA 3V0UA 3URBA 1K7XA 4S23A 1LQ2A 3B8TA 2BTMA 2OEKA 4ATDA 2XIIA 2KZHA 4MNLA 2CESA 2HMCA 3PZQA 4XZBA 4MADA 1O5QA 3N19B 3WG6A 4D6JA 3RIKA 4LAOA 2J77A 4YVXA 1SZNA 3QYSA 5CKSA 2CZVA 3LHVA 3M0VA 6XIMA 3BJFA 1XC4A 4KW2A 2EF9A 4GINA 3CUJA 4N6FA 1UUOA 1UR1A 3WD4A 5FSEC 3DEQA 3KOFA 4ZOEA 1SPQA 5HMDA 3L4VA 1X6UA 1GOWA 3RPMA 3ONCA 2D2HA 2ZA2A 2X05A 3PVFA 3PPCA 2P8CA 1LORA 2IXVA 2PRMA 3SGGA 4UTJA 3LX9A 4C6QA 1O1ZA 1B9BA 2DVXA 3GNNA 3F4CA 3UJRA 3VGFA 3C8FA 3GVWA 5HMEA 3GS6A 2QCLA 3C0LA 2OLAA 4AQLA 3T55A 4FSAA 2XVKA 4AZBA 3CV6A 1A5AA 2IKHA 1E4MM 1TRDA 3I4KA 2EG6A 2FB2A 4NXSA 5JIWA 4NL1A 3IJ8A 3E38A 4TOQA 4Q4SA 3QH2A 2WVSA 1LYXA 2AQOA 4XZNX 3L5AA 4PUEA 1TWZA 3N4AA 4W5UA 2GWGA 4MJZA 1QASA 2XVPA 3C3NA 2O9PA 3LI0A 3L2IA 2PSNA 2OKTA 3MANA 1Q6GA 3NQMA 5IOBA 3QSTA 3ZR4A 2WLYA 1K6WA 2IXUA 4HNCA 3UR8A 3T6CA 3TYEA 3CV1A 3GC4A 1QNQA 3LENA 4GI4A 1J93A 3DDMA 4B5TA 3H2EA 1P0NA 5E9AA 2QIIA 2DT2A 4UNLA 2FFCA 2P76A 1V02E 2OODA 1SGJA 3WD1A 1XI3A 2DZXA 2FMOA 5KZMA 3WLLA 1JDCA 3PTMA 4M19A 1GZ1A 1GGOA 1SJDA 3POHA 1B4KA 1XSKA 5HAOA 3DBPA 2XJ7A 3MHFA 1X1ZA 3KL3A 4BR1A 1PZ3A 3PZVA 3G1HA 2V63A 3WBAA 5AB3A 3WLRA 4WVXA 3VOJA 2VR4A 1EF3A 2DP3A 2AMGA 4W86A 1UD3A 5FEXA 4UNIA 2FQIA 3N18A 2J7CA 3PTQA 2C1IA 3Q58A 4UFHA 3PBUA 3W75A 4L1GA 4ZSUA 4UFKA 5G2IA 4UTIA 3BARA 1KM3A 4K39A 4XBJA 1XIFA 1D8WA 1PSCA 3FOKA 1A4MA 5KSWA 4AC7C 3GLCA 2E7FA 3BO9A 1T7LA 3GFZA 3S2MA 1R3VA 4I8DA 6TIMA 2NX9A 4HZMA 4XZWA 4UFMA 3VKAA 1U5JA 2OJPA 2QV4A 4AY7A 2DY3A 1K8XA 4YJ5A 2V30A 1OIFA 3VKDA 1OEPA 3VYLA 1R7OA 3H4XA 4PCNA 5D8WA 5A6TC 3TQPA 2I17A 4LANA 4TUFA 1RCOB 1I9CB 1H2JA 5DEZA 3IJ6A 1GJPA 3QR1A 3ATYA 4A2SA 4Z2GA 1XIGA 1FP8A 3NJ3A 1IXQA 2VP8A 3VOFA 1J0YA 4WKAA 1VIWA 1WKEA 1OYAA 3QR3A 1UUQA 3A4XA 3OGRA 4GVIA 3DX5A 2BGNE 4XISA 7REQA 3DFQA 1XH0A 1XL9A 2J24A 3EOEA 3IJIA 1RHCA 1YW1A 1UPPA 3VNJA 1R5YA 3T4CA 3NFUA 1Y0EA 3T0AA 1ADDA 2Y8KA 4XZ9A 4LJ3A 4DN1A 2TODA 3H26A 2QF8A 2PGFA 4FZIA 1WDPA 4E2VA 1TV4A 2ZZ4A 4OWGA 1PS9A 4C5YA 4Q6JA 1Q6LA 4NZ3A 5I3HA 5EFFA 1GT8A 2J66A 1SFJA 3MMDA 3N2MA 1WDSA 3O7UA 3UA4A 1UC5A 2FPVA 3EWWA 3W01A 3HG2A 2QIWA 3SURA 2NZLA 3GNPA 5A95A 3KRUA 2ZC1A 2H9AB 1O94A 4YTRA 4YTQA 3LI1A 1IEIA 5LA2A 3W88A 1RH9A 1BLIA 3J7HA 4B15A 1QCWA 1C8VA 4DI8A 4L9YA 4GCAA 3PP7A 3P74A 3UCCA 3CTLA 2YL6A 1E6NA 3T42A 3DOPA 4K3ZA 3EX1A 3NR0A 2XN2A 2TAAA 1CLKA 4F8XA 5FJRA 1L8NA 1A4LA 4HNLA 3AZSA 4A8NA 1ONEA 1XLAA 4JKLA 3T07A 1OFBA 4AZIA 2VFIA 2Q8XA 1I0BA 3B0VC 4LBUA 3H7VA 5GJMA 2QR6A 1R2SA 1NDVA 3ZSTA 3AMDA 2ZTKA 4Z2KA 3F1QA 1FX6A 2BP1A 1OK4A 1PKNA 4GQQA 3QW3A 3CWHA 2FPTA 3WQ4A 1HG3A 4JCMA 2ZXQA 5EGRA 4GE8A 2D0HA 3CWNA 1Q4WA 3K8LA 3GAKA 5CBBA 4UR9A 2VC9A 3IS4A 5AC5A 4DELA 2A6NA 3L4TA 3IIPA 3PK7A 3UR5A 3FA4A 5I02A 7TIMA 1GVIA 3I3DA 3AIUA 4ZB5A 5FOOA 1KA9F 3W4RA 2PWUA 1J18A 3TR9A 3EWDA 1XLDA 3K4WA 2Z1VA 3DFOA 2O7QA 2MUCA 2OSXA 4CD7A 5HNUA 3ABSA 2B31A 5FEWA 4Z2HA 2WVUA 4QXIA 4A3HA 2TYSA 3W7DA 3D6NA 5D03A 1NVMA 1Q2RA 1OC7A 1NSJA 1J0ZA 4IWWA 2YB1A 5C9ZA 1EX1A 1BXBA 1E71M 1BD0A 1SO5A 5E1QA 5ECUA 1QATA 1EPVA 4MPKA 1X97A 1Q6OA 1JCJA 1P0DA 1W9DM 4O52A 3MC5A 4JYDA 4OUIA 4HPXA 1SUXA 4Z2IA 1UG6A 3CUFA 2BLEA 5BU6A 3CU2A 3IIOA 4ADTA 5AOUA 1YTKA 2HE8A 2P8BA 4IGHA 4HJFA 2VFDA 3BZJA 2PDBA 2VDIA 3SADA 3F4NA 1WO2A 1A0CA 1CXIA 2G95A 5CCZA 1JYWA 4KS0A 2RFGA 4O15A 1UIOA 5EB8A 2HISA 4EANA 2C3ZA 2P3ZA 3SAZA 2OOGA 2CC0A 4RE0A 4QG9A 3JW7A 4XZIA 3OYXA 3EB3A 1PUDA 1QWKA 2CU0A 3GR4A 1D7KA 4ZTXA 4LV4A 1KM4A 3AXMA 4AISA 2PU0A 2OWWA 2QVHA 1V03A 8A3HA 3IIZA 4EE9A 1XBXA 3VD4A 2NV1A 1NOWA 1W9VA 4M8UA 2WV8A 2J9YA 4X22A 1T40A 4Z1CA 2DIEA 5HR7A 2C8NA 2IKGA 2VGFA 1N8WA 1Q4NX 3E0IA 4GIEA 1S5VA 2NV2A 2HEJA 1VFHA 5L6UA 2ZTJA 3I68A 3TC3A 4Q8MA 5IHSA 2F84A 3BJSA 4J3SA 3PS7A 4JTLA 1ZHAA 1W3KA 4N2YA 1UQZA 4O10A 4AZ5A 2EPKX 4HNVA 4FR1A 4RUBA 1KXTA 2V38A 3H54A 3W1TA 6A3HA 1MXGA 1WCGA 3F5JA 1KFBA 1U1HA 2NSXA 3NXLA 2C0AA 3RCMA 4M56A 4TVUA 2ZBTA 4LOCA 1B90A 1OF6A 2FDSA 5IFTA 3FX4A 4CCDA 3CYVA 2NXGA 2VURA 2J25A 1KR1A 1E9YB 4FOKA 3T78A 2EBNA 3TE9A 2C0HA 3FAWA 5A6SA 2E8ZA 1WB0A 3W6MA 1GG1A 1E9ZB 3G1XA 3W7JA 4GXMA 1V7YA 3NQ7A 2BHYA 1IWAA 4NAEA 2X7WA 3RYSA 2ANUA 2Q02A 5D37A 3QN3A 4I7UA 3D0CA 1MEWA 4S3KA 1QBBA 2JKAA 4YHGA 4QFUA 4GJIA 3RPTA 4N9CA 5CBJA 4DUOA 1E15A 3SJ3A 5CZ0A 3NUKA 2X42A 3P14A 4B9YA 3QZAA 1BSLA 1HTIA 3FGCA 4D71A 4O8RA 3SR7A 4PMQA 3N1AA 1M3UA 1Y5XA 4UZUA 2OYKA 1FA2A 2UY2A 3V4BA 3N2XA 4WF7A 3H6OA 1MSSA 3TZNA 2G96A 3KCLA 3GG0A 4A29A 3VIOA 3PSWA 2PDXA 1DQWA 3CLMA 3C86A 4EOUA 3H2FA 1ZCOA 4ZR8A 3PC0A 3W7GA 1R6WA 2Z24A 2VT0A 1OY0A 1C90A 4PZVA 4LAZA 1SFTA 2NUXA 2E25A 1NU5A 2OPJA 2XZ7A 2YL5A 4CCEA 3OYZA 4GH1A 1JCLA 3H53A 1NDWA 3RO6A 1KFLA 3VIPA 3LHYA 2V3DA 4I5XA 4AF0A 1W2VA 3CT7A 1GORA 4UIOA 2E6YA 1POJA 4G7EA 7REQB 1MFVA 1O12A 2DH2A 1LWHA 4YIWA 4V28A 3STPA 1A5OC 1AQHA 4DNHA 4CQ8A 4KWUA 1UD6A 1US0A 4W5ZA 2XFRA 3Q37A 4JYFA 3AIQA 5FESA 2VOTA 1JXJA 3HU7A 3S1GA 2WMIA 1WDDA 4OVXA 3A21A 4JTIA 4CN6A 4TXEA 4UWMA 3RXZA 3KZSA 1GHRA 1J0JA 4QITA 3E5BA 3ZQ9A 2VEMA 1QPOA 3QLDA 2PC4A 1JFHA 3BLPX 1K1DA 1SZEA 2O7SA 4CGTA 3CHCA 4DAIA 3WLIA 4R27A 4K37A 1FWDC 3AYSA 5FA5A 4G1NA 4MY8A 3IGSA 4MAZA 1UA3A 4JNMA 2PDJA 1S5MA 1UQYA 1XICA 2V2DA 4JTEA 3ZS4A 1M04A 2ATSA 1NFBA 2OZTA 3VD7A 4QE5A 3KW3A 5LNUA 1XRTA 6CGTA 3NOYA 3KVKA 4CN1A 3TUUA 1TPFA 1W5QA 3Q4DA 3C56A 4MDPA 2JALA 3RLHA 3GNDA 3LHZA 3WDIA 5DMNA 4JY9A 1BG4A 1IIHA 2R1NA 2PD5A 4OECA 2GVJA 4DZHA 1JZ5A 4EPKA 4Q8VA 4F3HA 1P48A 4K2SA 1NWSA 4O1BA 3GH4A 3IAQA 4PUKA 3VILA 1JGIA 4WY0B 4KRTA 4XSMA 4WXZA 2ZE0A 2CWNA 3DGBA 1M41A 2CXEA 2Z1XA 1EHAA 5CXPA 1UB3A 3LOTA 4XX6A 4HD5A 4W93A 5BYWA 4WCJA 1KBJA 5GPRA 1AK5A 4IFKA 3IV3A 4W87A 2PTWA 1QNPA 3BCDA 4K6AA 4JBRA 1J10A 2ISWA 2O9RA 1GJUA 2PF0A 3OBKA 4PTMA 3IEBA 1KFEA 3EDDA 1JQXA 2ZUWA 2VEFA 3JUGA 3AS1A 4K8EA 3GTFA 1IIGA 1DTUA 3HURA 4JICA 3NZGA 4EXAA 3H8AA 3NO3A 5G1YA 4IPLA 4OBRA 4IP5A 1A3HA 2VUYA 2VRKA 3O3RA 5HULA 4NXKA 1KO0A 5LKYA 4FNQA 2A1YA 2CBVA 2I1OA 1CLXA 4WX2A 1Q8AA 3STFA 4XSLA 3HMJG 1P7TB 1A3XA 2NLYA 5D2YA 1ZBWA 3G3MA 4I8YA 3BG9A 2VCBA 2OXNA 1UMLA 3AOFA 3W7QA 4X60A 2B7OA 1QHPA 4LTSA 1OCNA 4M51A 4AZHA 3LRKA 4W88A 5CC3A 5MHBA 1KCLA 1QOXA 2FHBA 5AYZA 3FXGA 3E2QA 3ME3A 1MVYA 3QRHA 3WLKX 3WQWA 1XD1A 1EXPA 3MSGA 4DBUA 2DZUA 4A8IA 3M0YA 1RY0A 4JEJA 4PRTA 3P80A 4D8AA 2UBPC 3VDAA 4L1WA 3ZXWA 1U5VA 2HE5A 5E9XA 2WNWA 3LQLA 3BCFA 3UERA 2QUVA 3TONA 4C60A 1TZZA 2VEPA 3KWSA 1WQ5A 1KV8A 3NOEA 1O66A 4IJBA 5G1TA 4MYXA 4EK7A 2WANA 1F6YA 3PJWA 3U5YA 3MCNA 4FNRA 5I3IA 3WIJA 4IIDA 2KX9A 3N15A 1B2YA 4MWAD 3R79A 2HBXA 3D5HA 4AHQA 2A3LA 1R38A 1HQTA 5G2WA 5J5RA 4HTBA 4PGLA 1E9LA 5ENLA 1FWHC 5FF7A 2EG7A 4NNCA 5KZDA 4IIHA 2NQHA 3KLKA 5AC6A 4IPIA 4OU1A 2G4JA 3A4WA 4ZFMA 1JAKA 4OBSA 5LSMA 3ZSSA 3CAVA 3E2SA 1LLOA 3AXHA 3WYZA 3QPEA 3TC7A 2RJGA 2EPLX 1RQEA 1H41A 1HO1A 2PP3A 3C52A 3ABQA 3RAOA 4LUTA 3I4EA 4WEVX 4JOMA 4D2JA 1TPH1 4Q8QA 3UD6A 1LROA 3EX3A 1ITCA 5CPQA 4AVFA 1X39A 3CO8A 4O13A 4RZ6A 1EJVC 1IR2A 1GQIA 1O1HA 3K5XA 4R9XA 1P1XA 1IXNA 4PE8A 1D3CA 3S6DA 3NZ1A 4GIAA 1IHIA 4C65A 3BAXA 1D9EA 3PZMA 2CXGA 4Y9MA 4HNUA 1I0DA 3E0FA 4DXVA 2WLZA 4BWLC 4OOZA 2CWXA 2AL1A 2VL4A 4GYJA 2X41A 2G0WA 3MI6A 3ZLGA 5M3WA 4JQ1A 4LUSB 2P88A 3DFSA 3M0IA 3FGCB 3DERA 3EBVA 4KH2A 3B0PA 2BOEX 3P61A 1WNOA 2E68A 5AHLA 4L6DA 3EDFA 4IIGA 4R7WA 2O9OA 3WJYA 3T0BA 1UKQA 4JTGA 3I7SA 3G1YA 4YYCA 2HWGA 1Q13A 2DSKA 2VX7A 1ZSXA 4FLSA 3W07A 3SY5A 3GYCA 4JDBA 3H4WA 2OZ0A 1TWSA 4IMAA 1ME7A 5RUBA 1DE6A 3PR2A 3C8NA 1FP9A 3LRMA 4ACYA 4ATLA 5BMXA 3LERA 4DJDD 1DJXA 1E6QM 4P7LA 1R7AA 3M6DA 1FY6A 5DY2A 1KTCA 4Q7IA 3G1DA 2Q09A 3GC5A 2J7GA 1GOOA 1H60A 7ODCA 1CEOA 1EOKA 3SCPA 2YL9A 2JKEA 3VKKA 1KM2A 1S1PA 1XH1A 4RL3A 5IBXA 5C2GA 1JAEA 4ZCWA 3R13A 3W1MA 1KW1A 3UXAA 2PLJA 3IARA 3OHMB 4XD4A 5BW6A 4PH6A 2IKJA 3USBA 4CUCA 1FBAA 3HG5A 4GPNA 1PHWA 1NQKA 2CZDA 3U4AA 1S46A 3OZYA 4PMRA 1NEYA 2GGJA 1EJXC 3NNTA 1AMKA 1TTPA 2PGRA 1XCFA 2XTKA 4XUGA 1MQRA 1FXPA 5XIAA 3WQDA 1OX5A 3M0KA 4FXRA 4IJRA 1FWRA 3LM3A 3GYEA 3G1SA 3TXZA 1W1IE 3KTXA 2E5BA 4ZXLA 4GZJA 1OX6A 3MVIA 2HV5A 4HNNA 4WDTA 1JZ2A 5FEZA 2IPGA 4M0XA 4PTDA 3C2RA 1XYAA 4X63A 3S1UA 1L9WA 1UZ1A 4MSSA 4J3ZA 4XD3A 3FKKA 1EBGA 2X1SA 4ZE5A 5LA1A 2J47A 1ONXA 3NEVA 1QNVA 3QGVA 4QE4A 3L68A 4CQBA 4DWSB 2DH3A 1V4YA 1XLMA 2RGLA 1TE1A 3U3HA 1PX3A 5D8ZA 4U31A 4BF5A 4X9SA 2QCDB 3A3XA 5T91A 3ITTA 5CZTA 1ITUA 1JL8A 2PDMA 3VU2A 4K7VA 4IFKB 3T7VA 1TX2A 3W2JA 4DXXA 2PDWA 3GXMA 3ZMRA 1ZUAX 3RUBL 3VE9A 3ARQA 3BLEA 4IGNA 1ZP4A 4WKHA 4K8GA 4C6IA 1QBAA 1XRVA 4WDUA 5AKQA 4AAJA 3FJLA 2V6AA 3EWBX 4P7RA 1UR8A 1TPEA 3CXOA 4TTUA 4JL2A 1A80A 2GUBA 1ZPTA 4E3TA 3HGOA 2H3DA 3CIXA 4RPQA 3R0UA 2AGTA 1C29A 1KTNA 2UV8G 2IPFA 1XIJA 4H7ZA 1I2QA 1YTDA 3NO1A 2WKJA 3IUHA 1A5CA 5F4XA 5HJXA 1FHVA 4IP4A 2WZHA 4C1KA 4EWJA 3PF3A 2P10A 2ZUSA 3MHUA 4LRTA 2W3ZA 3LSBA 1F4AA 2J13A 4CEXC 5FJIA 1V0NA 2VR2A 2EAWA 3PUOA 1ISZA 1VLIA 1XLHA 3U6WA 1UMYA 1VHCA 2EXOA 3ECQA 2RDXA 3KBMA 3C2EA 4HB7A 3U2OA 3CB3A 5AC7A 1E6PA 3CAQA 3N73A 3B97A 3GQYA 3WL0A 4ZB2A 2QV5A 4WD0A 3O15A 1BQGA 1HP5A 2WC3A 3JR2A 3UW6A 3CZJA 3QZ6A 1GONA 4FP1A 5U7SA 3CPUA 2GFTA 1Q6EA 1J5TA 1JPMA 4QDWA 1Q65A 1IQ8A 4KRUA 4DF0A 3BTNA 1XYFA 3B03A 3EAUA 5DRCA 2W5FA 2C91A 4J3WA 4K36A 4XAFA 1JCMP 3EXSA 4HVXA 3DYMA 2YYTA 1K03A 1G0CA 4JQ3A 1TTQA 4E4PA 3OTRA 2FHFA 4JY8A 2PDPA 4DBDA 1KKRA 3PSVA 4IPJA 1RAKA 4QNWA 3VDHA 2E09A 4U5KA 4ZMGA 3EKZA 3QKEA 1JZ6A 2WC4A 4POCA 4IOTA 4FNUA 2B7NA 1VH7A 3LTYA 3BXWA 4O8AA 3GAYA 3T9PA 3VC5A 4C6JA 3TQVA 4H9XA 4D72A 5DT7A 2BY1A 1ITQA 3W2UA 1JZ8A 2AL2A 1XIIA 3MI2A 1SSDA 3TYAA 4IMEA 1RZMA 1NTHA 3M5ZA 2J88A 4RV8A 1V0MA 3T2PA 5LIXX 4MUPA 1FWJC 3MDWA 1AW2A 4LUTB 3XISA 1MUMA 2D1ZA 4ALDA 3C0SA 1XLBA 1JXKA 3K8KA 2W4XA 4UOQA 1GCYA 3C2VA 3W2LA 4R33A 2OZ8A 2XFFA 1Y65A 5J8LA 3OG3A 3GDLA 1VF8A 4LVBA 3RLUA 5A2CA 3E0WA 1TQJA 4L80A 1EC7A 2E9BA 2DT3A 3WCZA 4JTRA 3WSUA 4NUWA 1O5KA 2OT1A 3NL2A 1H3GA 3RCYA 1WP6A 3W76A 2C79A 3QC0A 3QSRA 5DXXA 2PWDA 1KRBC 7A3HA 2Y89A 2VVNA 1F3WA 4GJJA 1SYTA 5HK4A 2G5WA 3RG6A 4I5RA 1AQMA 3O0KA 4O50A 5A8GA 5I79A 2GUYA 1V93A 5I07A 3PFMA 2WCSA 2OGYA 1BF2A 3TW9A 3TR2A 4GQBA 1QI5A 1MWOA 2OWCA 1HXJA 4ZTYA 1OSEA 2VD8A 4M6VA 3UT0A 1OQFA 2QYGA 4CNNA 4ML4A 2FZNA 2ZUNA 3VCCA 3UZXA 4JTDA 3LCWA 4LS1A 4MGGA 5CJ5A 1RY8A 1Q66A 4R5EA 1W1VA 4DYKA 3YPIA 2YCEA 3W26A 4I9TA 4UC5A 3G1AA 3ZWSA 5BMWA 4LYQA 2DT1A 4OUEA 4QR6A 1HJUA 2YFNA 1BF6A 4JHZA 4AG0A 1Q3NA 3LRLA 3EOOA 1B3OA 3WLNA 1JUKA 3R0DA 3S1VA 2RDUA 3B8WA 2FH8A 1JQVA 1FKWA 1BRLB 2PBGA 4RPPA 1ZQ5A 5D9NA 5LA0A 4C6PA 3KCJA 2VC7A 1V79A 2X30A 5AC4A 3TC6A 1OVDA 2XUCA 4MYAA 4CQAA 2VFHA 2A2IA 4UTWC 1OX4A 2PP1A 4L6OA 1BYDA 3UNDA 4J35A 3L67A 2DZPA 4ERIA 3L0NA 3WDJA 1FH9A 2YXOA 2ZFAA 1MO0A 4DZIA 3GHSA 3RX3A 2PPGA 1ZBCA 3IRSA 3NQEA 2ZZ1A 4IHCA 3VZYA 2AKZA 3SUSA 4S38A 1QW9A 3F5KA 4AUBA 3WMCA 3WNOA 3F4VA 1DIOA 2QUNA 3PG8A 3P82A 3UNTA 1I2PA 2FJKA 2VGIA 3NSXA 4JQAA 1CGVA 3EWCA 4A2RA 1WXZA 2WJFA 1KV5A 3HQPA 3C2OA 1TV8A 3WLQA 4RJEA 1CECA 5T26A 4LB3A 5KZ6A 1UROA 2ZRXA 4FHAA 5GNXA 1PWLA 1ISYA 3O6YX 4DQWA 4C6DA 4MMWA 4C6LA 2E1WA 3W86A 1LWIA 3WQ8A 3V5FA 1VBUA 5D4YA 5K9CA 2GK1A 2PRLA 4GWEA 5FF4A 3N9KA 1JPIA 2NQZA 1N7KA 3E0LA 4N42A 4CEUC 1DIEA 3R43A 1O5XA 4KESA 5D2WA 1DXEA 3KHJA 3LTSA 1GOKA 2WXDM 1NF0A 3CUZA 1KLYA 2G4FA 2ZA3A 3G18A 3DKJA 4NQ1A 5EMKA 2QPSA 2OELA 1PV8A 3I6TA 2ZRUA 3THUA 5FF3A 2YL8A 1I1WA 1UD2A 2F2HA 4Y8EA 4YL2A 1GYLA 3N9RA 3FN9A 2XU2A 3BMXA 3RGTA 3MBFA 1DJYA 1VJSA 5HWMA 3JRKA 1FWFC 3LU2A 4L9XA 2JIEA 1ENUA 1A0EA 2D0GA 3WK2A 3WK0A 4Z1DA 1KC7A 3KTSA 4LSBA 3C6CA 4IIBA 3B9EA 3B8SA 2QUMA 3OJGA 4GI8A 4ZFCA 4JFWA 2VX4A 5FD0A 4Y9PA 4Q3MA 2AGKA 4FA3A 2QAFA 4DJFC 2YZ5A 3QQ1A 3S5NA 1JPHA 3P0XA 1OIMA 1XLJA 3L4YA 2DIJA 2QJGA 4CLMA 3SB0A 1OYCA 2QCHA 1DHKA 1P0EA 3EDKA 4MHBA 1O6IA 2CLKA 4DUXA 4QP0A 3GBDA 5BWAA 3MUCA 2UWFA 4FNTA 3I7QA 4NZ4A 5BXPA 2XDFA 4NSBA 1E0TA 1R3YA 3ABOA 5GJNA 4BFAA 3ITOA 3B40A 4EX4A 2V5CA 5IDZA 3BLDA 1D2KA 4BWLA 2PDIA 4MLRA 2DUZA 5BZAA 2ICSA 1MDLA 2ZVRA 1XG4A 1Z32X 3OZPA 3N9SA 2PF8A 2ZXAA 3E49A 4AZGA 4NJKA 4JTAA 2D24A 8XIMA 1EOMA 4JTSA 5D38A 3BOLA 1KQYA 3UETA 1C9WA 2FKPA 2P50A 2ACRA 3AIEA 1YNPA 3F2DA 3FJ6A 3TYBA 4M5PA 5D05A 4AD1A 2A21A 3MV11 4Q8WA 1XINA 2PTXA 4AH7A 1W3HA 4B4FA 1V3MA 3B06A 4D6DA 3SCUA 4L1XA 4W7WA 2B81A 3KP0A 2A5HA 1KD0A 4GBDA 2Y2WA 4AYSA 2CCRA 1SQ7A 2WB5A 4UXDA 5M03A 1RVGA 2PFHA 3S2CA 4U2YA 3SSZA 3TW7A 4QJ4B 2DUXA 5CZSA 3PPFA 3OZOA 4BF7A 4IG2A 2QKFA 4UB9A 2BG5A 2YOCA 4Y6GA 2PTYA 4H8UA 5AC8A 2WZMA 5ABEA 1E5JA 1EWEA 1S2UA 1VYPX 4UQBA 1ZP3A 1R2TA 3HV9A 4ROPA 2GJRA 1H7WA 1AH4A 4LB4A 2D3LA 4W8BA 1JPKA 3TQKA 3EB2A 1ISXA 2DU2A 3TTOA 4IIFA 3W74A 1YKWA 1E0WA 2RH9A 1QPQA 1X1NA 1E4IA 2PU1A 1R3TA 1E72M 2WQDA 5H2ZA 4E4UA 2ALDA 3BV4A 3CAKA 4P7QA 2XISA 4M1RA 3RMEA 3W29A 5I3KA 2AL2B 4PFMA 3H55A 4PBGA 3WJZA 4AIEA 3QOMA 1H1NA 4HA3A 3FNDA 1VHNA 4PTVA 1FHUA 1X1OA 3M5YA 1ICSA 2DUAA 4HKPA 4W8LA 4MFDA 5D2XA 3ITGA 3K30A 4HJWA 4JIPA 3P93A 4KEVA 1EWDA 1JNDA 1YDVA 1FWGC 4C91A 4H6RA 4O28A 1EGVA 4AWSA 4C6FA 1YMYA 2WHLA 3RHGA 4NF7A 4MKNA 3H2AA 3I7RA 2E5CA 2QZRA 4K1GA 3TJLA 5BWFA 3UG3A 2QQ6A 4MFEA 3ITXA 4ACZA 4BCEA 2E28A 4US5A 4HSNA 4BF9A 4LPCA 1EGZA 2PDCA 1WAWA 5EMUA 3OODA 4X0NA 5MKGB 3GW0A 5HINA 1W17A 4UTMA 4WOZA 4E8GA 4MUZA 5CGTA 3VIIA 4H8NA 4FEZA 4MJ2A 1FDJA 1P43A 1UR4A 2QJJA 1UOKA 1H50A 1HGYA 5KITA 2V69A 3W23A 3TYDA 1S2AA 2CLEA 2HCVA 1V5XA 4NZFA 3EA3A 3PPHA 3BOFA 2Z2AA 3KEHA 3KS5A 3S5SA 4HHHA 1SZGA 3WFZA 1SW3A 4MB3A 4ICCX 3VD3A 2PDYA 4OIFA 4GISA 1GOIA 5CLWA 3F4WA 1YPIA 3WJSA 2DEPA 2QVNA 3VK5A 4GUFA 4LQ1A 4HPJA 3VE7A 5D9OA 5K7JA 3VIGA 1XIEA 2ZX5A 1G4PA 1W1B1 3VOCA 1NIUA 4AIUA 5CZJA 3RX2A 4E2DA 5U4NA 1P6BA 3AZRA 1W2PA 1OG0A 3CHDA 1XCWA 3W81A 3UY7A 1C93A 3TYZA 1XSJA 1TX0A 3EMZA 1EUAA 2Z1WA 1ONRA 2CLHA 3S6TA 1XP3A 1X96A 3G6MA 3GKAA 1FH7A 2WQPA 1AJZA 2QT3A 5JVLA 2G8ZA 3OA3A 2BB0A 3B8UA 3ANUA 3BGGA 4C1NA 2Y5EA 4O53A 4MPQA 5FAJA 3QR0A 2NT1A 3T1GA 2QW5A 1Q2SA 1E0VA 3MO7A 1SJAA 3W7KA 3H23A 4TTGA 6PTDA 4JEQA 2GSJA 2I5QA 1TZ9A 1S2WA 2FH6A 2GDVA 3U4FA 2X1IA 2G3MA 4PBEA 2NQJA 1BKHA 3TSBA 1P6CA 4S3EA 3SQMA 2ZDSA 2HZGA 1KGWA 2ABAA 5A2BA 2JBMA 1EX5A 3LV5A 2ZYFA 2GZXA 5J04A 1EP2A 1ZJIA 3ICJA 3LCHA 2VENA 3GUWA 3EX2A 3E3HA 4MTVA 1UUMA 1QUMA 4UTLA 3ZFHA 2JFEX 4NRRA 3ARWA 5JMUA 1TA3A 3UWQA 4KEZA 2MNRA 2WW5A 1ME8A 1RQHA 4JFSA 2GK1B 3U7VA 2G41A 5LIWX 4UTFA 3B0XA 4S2CA 3UXLA 5FIPA 1XHGA 5JQ9A 3N11A 3VC6A 2P53A 1EQCA 3KWXA 1W5PA 3ZM8A 1UH4A 4H2HA 3W22A 4UQ9A 2F6UA 1T99A 3K46A 4UFJA 1TPVA 1Q7ZA 3OZMA 2YPIA 2F2KA 4J2PA 4Y8FA 2Z1BA 5EBUA 1CCWB 3GDMA 1HP4A 3LNMA 3DHDA 4PUDA 2UY3A 1TVNA 4YS1A 2NSOA 2GJNA 3I6RA 3BGJA 1J8VA 3N13A 5D33A 1PZ1A 4DRSA 2QPUA 2E1DA 2OLHA 2OZ3A 3MMWA 5K9DA 1K3UA 3AHVA 3GW3A 1H7OA 3EZ4A 4HA1A 4RZ5A 4CCZA 5TF0A 1TPC1 5EL1A 3LBCA 2WJEA 2OWXA 1QO5A 1DEDA 2GJXA 3MUXA 3I6EA 1YBQA 4US6A 2OEJA 2QCEA 3TVAA 3CUHA 3U2EA 3G0SA 1Q6DA 4BJHA 3RO8A 1H51A 1V6VA 3TX9A 4GYFA 3A9BA 1Z41A 4LRSA 5DANA 3HM7A 3R8GA 4CNSA 1JNEA 3AYTA 1IT7A 3CEUA 1JF6A 3R11A 3DHUA 5DRIA 5CJMA 3SCRA 3DC0A 3DENA 3BK0A 3NQBA 1TMHA 3CZLA 2R14A 3MBDA 3N3MA 5EPDA 2NW0A 3WLOA 1NWUA 4AMCA 2YA0A 3GKFA 4JN8A 5LYRA 1QRQA 3ISIX 4E0CA 4UMBA 5C9XA 2JE8A 5LXXA 4PUWA 2X1TA 1J6PA 3BICA 3M9YA 1ME9A 1GVRA 2R24A 2PZNA 3DG6A 1EJRC 2HVOA 4ZENA 3NGJA 5L9FA 5F4WA 1UH3A 3OVRA 5KETA 1F3EA 1A5UA 1ZAHA 2A85A 2XSAA 2ZADA 2TMDA 4O14A 4Y2WA 2WZEA 3FK4A 4FO4A 2Q3OA 3O6AA 1VB9A 4URIA 4QSFA 4QEHA 1GKPA 2HK1A 3A9IA 3HJZA 4ROQA 7TAAA 3VGGA 3FJNA 3VMOA 3I65A 4I7WA 1QOPA 1V77A 2OYMA 3N4FA 5H8UA 2DSUA 1IE7C 2EHHA 2GL5A 3F5LA 1UWQA 1U2YA 1M65A 4RK8A 5AYXA 4JTQA 4JTKA 3NSNA 3GNOA 4GQ0A 2W66A 4TR9A 1OGSA 2V5KA 1KXHA 4AEEA 1GJWA 4JL1A 2EEXA 4IG2B 4GVHA 3PN8A 3W85A 1WUEA 1F6PA 3TLQA 3RFAA 1EH9A 1MEIA 3FJ4A 4LF1A 2I16A 4UBPC 5I7GA 2ODOA 2VD9A 1DP0A 1KKOA 1EIXA 2YXGA 3HPSA 2PMQA 3HB9A 3CHVA 1LT8A 4Q4RA 3G1VA 3C4UA 2Y88A 2C18A 3BURA 3SDOA 3NVDA 3WH7A 4UFIA 2Q01A 4UTWA 5A6AA 3L65A 2I7GA 5M5DA 5IXEA 3CS2A 3WEMA 4WHBA 4QDMA 1Y5WA 1VJIA 4LU0A 2HJPA 4P8UA 4J5NA 2W27A 1F05A 2VNCA 3NURA 5KZEA 2VUNA 3WQOA 1YDNA 2HVMA 2E3ZA 2PTDA 4QJ5B 4PMNA 3W83A 3MUAA 4DIAA 2ZX9A 4JIHA 1OT1A 1MI3A 2ZX6A 4MJ4A 4OTKA 4CCCA 3TJIA 3OBEA 3OEXA 8TIMA 3ERPA 1UWUA 3L4XA 4N9BA 1LUCA 3WQFA 4WIWA 1AH3A 3EX4A 3U2ZA 3MP5A 2J27A 4AZ7A 1HUVA 1XM3A 3FVMA 3WUFA 3KRSA 1B3VA 2WNZA 2DDXA 3GTHA 2YLAA 1XYMA 3VA8A 3WMBA 2JGQA 2FZDA 3CMJA 4ZSTA 4XAGA 1N82A 2QXWA 4W7VA 2CYGA 1A50A 3F2CA 3FS2A 1JYNA 2A6LA 1VFOA 1R3RA 3FDGA 4DF1A 4KF1A 1HT6A 4PN2A 4XAPA 2V3FA 4WJXA 4ZQCA 3N2BA 3HGSA 3FAXA 1FUYA 4XIAA 2YBUA 5A69A 1B30A 5C5YA 1T8XA 1WDWA 1QR7A 3W2KA 4D6HA 3UBPC 4Z0SA 7XIMA 2ZUVA 4I9JA 2WNNA 4NASA 3GNXA 1T0OA 3FA3A 3KP1A 3WH5A 2JEQA 3QBUA 4NKCA 3UZZA 1J79A 4QROA 3SJNA 1HJXA 3AJ7A 5CEWA 3INPA 2ALRA 2NT0A 2QDEA 4PYSA 3TAKA 3IJQA 3WFLA 1FWAC 3P6LA 4G1KA 2EPNA 2EQDA 2WMHA 1KB3A 2CBIA 3F7JA 2H9AA 5G5IA 2YSWA 3WEZA 3THCA 3RCNA 4WZHA 4YWIA 1JD9A 1JIBA 1QW7A 1Q6RA 3THAA 1MQPA 1JYVA 3S9ZA 2BV9A 1XQLA 4F48A 4QHRA 3QKZA 4CD6A 4YTTA 4PCTA 2A7RA 4A3RA 1CYGA 3WBXA 4QNEA 3W7MA 5B7YA 1Q85A 4RZ4A 4K8HA 3VNZA 1BYBA 1XF0A 4KKXA 5HPOA 4HHPA 2Z29A 4D6CA 3WQGA 1DXIA 2DW6A 2VO5A 3BLIA 3VDBA 5I3FA 3E02A 3S5ZA 3C2FA 4GA8A 3W1UA 3PTDA 5AHMA 1RUSA 4BQ3A 3MZNA 4DXKA 1AQ0A 1ADSA 4Z1AA 1TA3B 3AFBA 2POZA 3NG3A 1LRNA 3DUGA 1AMYA 2NVAA 1PKLA 3M0JA 3PTKA 1DWAM 1RD5A 1G1YA 3WQPA 3QV9A 4IGMA 3SGUA 1RJPA 2FPYA 3DAQA 3WF1A 3PPGA 5HJYA 3BH4A 4J40A 3CQKA 2NQ5A 1V6YA 4Q8OA 1W1TA 3RILA 3WQCA 3SFWA 3WD0A 1J96A 1EHNA 1GQNA 4TX8A 2A7NA 3L5LA 1NJJA 3E2RA 3UWUA 3N17A 4GK8A 4HCLA 1SSGA 3UZYA 4X3ZA 3PAOA 1WDRA 3E6EA 1W9UA 2YLLA 1E6RA 4LVDA 1UR2A 4MB5A 3TK7A 3RJYA 1DQXA 4Z2LA 3CJPA 3VKCA 3ZJ8A 3S5OA 5HQLA 3KOZA 4BHYA 4FXFA 1V0LA 1H4PA 1HKMA 1HX0A 1Z42A 4QCFA 1W8GA 3BAYA 1UIPA 3A64A 3WY1A 3T81A 4G5DA 4RW5A 2J7EA 4UCFA 2VOMA 4LV9A 1BGGA 4DUVA 2WHJA 1G4TA 4V1XA 3TV8A 2PWEA 1JDDA 4QX4A 1VEPA 4V2XA 3ZZ1A 2GJXB 2O0TA 3L5MA 5AVNA 1HKWA 5LZLA 4ZA0A 1YBQB 1R3SA 1GOXA 2ZZ6A 1TMLA 1WOBA 4WQ6A 1E43A 1TE6A 1IWPA 2QLYA 3PZUA 1QI4A 4ZQNA 1I75A 4FPSA 1KCXA 2FVKA 2W67A 4LUYA 1GHSA 1DJNA 2POTA 4S3BA 4OGZA 1W3JA 4N4PA 1TTJA 1RPKA 1XUZA 2WNQA 2ZC8A 2HXTA 2ZVIA 3WH8A 2V82A 4NX5A 3V16A 3AXIA 5HXMA 5EFDA 1ODZA 5I77A 1TSIA 4X61A 4YWSA 3H2MA 3TTQA 1D3HA 1XRFA 4Q7NA 3PZTA 4AC1X 1UR9A 2XFWA 4FX8A 4L6HA 3DHPA 1VBRA 4Z42C 4OT7A 2VEGA 5FF2A 3SW6A 4DWSC 3NYZA 4F0LA 1KGXA 2XZ9A 3OLEA 4CNUA 4GBUA 3TTSA 1FCUA 4XAZA 4Q7BA 3PUDA 3CYJA 1L6FA 5LNWA 4L5ZA 3U5UA 3CAWA 3PJXA 1PCWA 4F40A 4BQ2A 1BTMA 1YEYA 4K68A 2TSYA 4LBSA 4MWAB 4AZ6A 3EB4A 1XBZA 3GDBA 2QGYA 1E56A 2XH0A 2EJ1A 4D6IA 1QAPA 3O1NA 3BQ6A 2BNJA 1XQKA 2WAGA 3WNKA 8CGTA 3AAMA 3CL6A 5DFAA 1LOLA 2J75A 1YTEA 4RLIA 3DG3A 4MIMA 2CKRA 4GFSA 1DQUA 4EAYA 3H21A 1JEZA 1JCTA 3MMUA 3L4ZA 1VFLA 3UWYA 4D8LA 3O6DA 4WUIA 5CPSA 1NARA 4XBSA 3MS8A 4TO8A 2XINA 3E1F1 3WNLA 1WXYA 3BW2A 4ILSA 2GQ3A 3GZ3A 4B5NA 2ZRVA 4BEUA 2SFPA 5K2ZA 3UYCA 2DZWA 3KDOA 5JXQA 5D02A 4LNCA 4IQEA 2YCLB 4XKMA 2PD9A 2P0OA 2ACSA 4L9ZA 3W73A 3L2MA 3KOXA 1U1UA 4ZL1A 1D7FA 5HNTA 2GGIA 3IJLA 3CMFA 3WLSA 5C0QA 3W7OA 3VOGA 3FKRA 4BKNA 4MOZA 3PB0A 3MUY1 3TOPA 1XDJA 4LS0A 3GNRA 4HN8A 4Z17A 4YHEA 3CQHA 2DPEA 1XIDA 3WF3A 4IL2A 4B3KA 1ELSA 5FJOA 4ZO7A 3A4AA 5C9WA 1X8CA 1MYRA 2B7PA 2PLCA 4KCWA 1NH6A 1XIMA 4MNKA 4DJED 1SJCA 5EMYA 4GACA 1A47A 5BOEA 3AMKA 3PUEA 2BZNA 2EJAA 4C5ZA 1LUCB 1UP2A 3W7RA 3QHMA 4MZ1A 1GVYA 1XLEA 3MWCA 4ERAA 1R2RA 3W7HA 3TIMA 1TWWA 2VZTA 3UVAA 4W84A 3W7IA 1VFUA 2VFGA 4RR4A 2D2OA 1W1A1 3MCOA 1UWAA 5HNNA 4RV3A 2C1GA 3LYEA 1GWJA 1XISA 1F6KA 4A3YA 3MKVA 3BDKA 2RKXA 2V3EA 3VNMA 3P8IA 3GH5A 2Z4GA 1EB3A 3IJ9A 4YVVA 1R3WA 1DWIM 4HT3A 1B3XA 2P3EA 3BAJA 1FTXA 4PFHA 4PULA 3WL1A 5CAKA 3T0DA 4DBEA 1NFPA 4QDPA 4RZBA 5A5WA 4M3PA 2ZZ2A 3WENA 4FIQA 3CIWA 4C6NA 4FB7A 1IGWA 3TYCA 4WSKA 4Q32A 3EPNA 2ISVA 4P8VA 3ZJ6A 1ZFJA 2CZEA 1R9XA 4H00A 5D32A 2OO0A 4FMVA 3EOUA 4NILA 4NIRA 1S3TC 2C15A 9RUBA 3I3EA 3KVMA 3QV7A 3NM1A 1QWGA 4MB1A 1IYXA 3WBWA 5JBEA 4DLFA 3SI9A 4TX6A 3LHWA 3R2GA 3KDNA 1AQFA 3WFAA 2WSRA 3GO2A 3PZGA 3VNIA 5I03A 4OE7A 3VMPA 4ML9A 2Y0FA 3NQAA 3UG4A 1E0XA 5J5DA 2DW7A 1EJWC 2QNEA 1PJ9A 4V15A 3VKBA 1DV7A 4MG4A 5C71A 4HN4A 2VJXA 4DO4A 3VNKA 3S4TA 1FXQA 3LZ3A 4ONVA 4J3XA 2WVVA 3SRKA 3DFYA 3AUOA 1V7AA 3UY8A 4WY0A 4DPQA 1IEXA 4U4MA 4HU4A 3CZGA 4I7VA 3VINA 1ZCCA 4QGCA 1FWWA 1HJSA 3KUMA 2XGIA 3SIMA 3DZ1A 1SMDA 3TMLA 4NJHA 1FWTA 3SCWA 4MKVA 1SU5A 1TJ0A 3FY1A 2WBGA 4AIOA 3R1ZA 1GOQA 4JTJA 4LYRA 3A3WA 3HZ3A 4W4QA 6ENLA 3NL5A 1OG6A 1T8QA 5CPOA 4IICA 5A6BA 3VIHA 4INFA 1VFSA 1RQBA 1XD0A 3R12A 5CH9A 4AHPA 3UGVA 1XPYA 3GXIA 4HPNA 3UWVA 1J5SA 4B5XA 3PHAA 5C2XA 3VIJA 1UKOA 1K8CA 1QT1A 1G67A 2WBKA 2Q6ZA 3LMYA 1XRSA 2XFYA 5IBXC 4P8XA 1A0DA 1FCVA 1SFLA 1SO3A 3LPFA 4W7UA 5I3JA 1PTGA 1P7TA 4IFRA 1SZRA 3HV8A 4LFYA 3NGFA 1YE6A 1V3HA 3UG5A 4XO7A 1E1FA 3AJXA 5AZ1A 1L6SA 1DL3A 4XTDA 4QTGA 3AHZA 2PDKA 6TAAA 3WNPA 1B5TA 4M1BA 1NQ6A 4ZGYA 1ZBVA 3KHDA 4JS3A 1EYEA 4ZBCA 3UJFA 1JZ4A 4U5IA 5C9UA 2YA1A 4LYKA 2Y4SA 3NIYA 2NX1A 2PDLA 2OTDA 1B3YA 4NZ5A 3URNA 3IGUA 3KBNA 1ZALA 4OKDA 1FWIC 5TQLA 1YDYA 4K1WA 4BI7A 3E12A 3V75A 1Y7VA 4FXJA 4M80A 2HRWA 1E1EA 3CHFA 1UWRA 2VELA 1GVSA 4M29A 3RRXA 5AFDA 2W79A 2ISSA 5XIMA 3TWAA 3EA1A 3TU9A 4ENLA 1AODA 2FGZA 2Z2BA 2NVCA 4CD4A 5F1VA 1EFZA 5AVHA 3GXNA 4D1IA 4HZ6A 2VHLA 2C19A 4RKAA 3DCPA 1TIWA 1REQA 4LWWA 1H7NA 1ZJBA 1TTIA 4IUOA 4QS5A 3VIMA 4JIEA 1MUWA 4GYPA 5LIUX 3RLVA 8XIAA 2J62A 1LBLA 3QOKA 3UZ5A 4XZHA 5I3GA 2YYUA 1AH0A 3ES8A 4F0HA 3QXBA 5AYBA 3FHAA 3EMCA 5IRPA 4B16A 2B0MA 4C90A 3GU2A 3UR7A 1K9TA 1QJWA 2V5LA 4WR3A 1FHDA 4D1JA 4S3GA 3SQSA 3N29A 3WNNA 3A24A 4S1FA 3F03K 4EXQA 3OBAA 1GEHA 4XD5A 5HJLA 1WKFA 4PTNA 2PRHA 4TVDA 1EDQA 3S1XA 3HQNA 3M64A 4O19A 1CZ1A 2PS2A 2AQVA 4N9DA 1SMAA 3L4WA 3WLPA 3MV01 3LG3A 3NZRA 3UJSA 1BWLA 3LTPA 1PO9A 1EJ7L 3VX1A 1SO4A 2YXXA 3T8LA 1UWIA 5AHEA 3HQOA 3G22A 3GXFA 2VCAA 5FKYA 4AFYA 4HNTA 2QUTA 3L0GA 4HA0A 5EMJA 4B90A 1TV7A 1KFCA 4GVFA 4HK6A 4PEKA 3M6YA 2CLLA 3VNLA 2VDGA 3VDCA 1UZHA 4JIQA 2WJDA 1M7XA 3MQTA 1ZU8A 6REQB 3KVJA 1BYAA 3EPOA 4HYWA 4LAMA 5A6KA 4ERGA 1ZENA 4U3CA 4CU6A 3BUVA 3VNDA 2P0IA 4XB3A 1HKJA 3CQJA 1JR1A 3S0CA 4U33A 3LS9A 4LUSA 2TPSA 1K4GA 2VZVA 4AYGA 4DWDA 4P5UA 1WZMA 1VFMA 4BQ4A 5BRBA 1XIBA 1MRQA 4BI6A 1FVPA 4Q4QA 3TFXA 3ANYA 2Z0IA 3ZYZA 4M6PA 4GNKB 4I9AA 3WUBA 2X0YA 4NHVA 1BVNP 1P4CA 5HR6A 4IXXA 4LAUA 3MTWA 1R86A 3GDRA 3UR2A 5D04C 4ZO8A 1UASA 2HVNA 3DH7A 1V3JA 1MNZA 3LB0A 2A3HA 4LEQA 1G6CA 3ARUA 4IQDA 3ZR5A 5IFPA 4AX7A 1OF8A 2EPHA 2NXHA 2BGQA 3W7PA 2UY4A 4YU1A 1SZFA 2FB3A 4BI5A 3DI0A 3HMCA 3V36A 1I45A 3ARYA 1EYWA 4RNFA 1CWYA 1GEQA 2G50A 4C6KA 2W91A 4NZJA 3N12A 4GKTA 3KL5A 2E5DA 4PCPA 5HUOA 1KQZA 3S9YA 1TO3A 2YX0A 3HPAA 3W71A 3P7YA 4UQDA 5K9XA 4QRNA 1UD5A 5A6LA 2GGEA 1W1PA 4RDYA 1JI2A 3SM0A 5AHNA 1W31A 1DIDA 3BGAA 2ASHA 2GDUA 4AZCA 4EVZA 4Q33A 1V6UA 3GHTA 3UXDA 3ZIZA 2C13A 1GQJA 2OQLA 4DAFA 5BOFA 5A2AA 1QPNA 5M2FX 1X6LA 3EA2A 1POKA 5D2VA 2QJNA 3QJAA 1W1YA 4GQRA 4C6MA 5JBFA 1QXLA 3W1RA 4JX5A 3RM8A 4IXHA 5C8BB 5SWUA 3NQFA 2GVEA 2VFEA 2NUYA 3QYQA 1U5HA 2WSKA 1R9ZA 2WYSA 4JXCA 4NYYA 3P2VA 3TEVA 4L65A 5AY7A 1ISVA 5DXYA 1A5KC 2VWSA 1UBPC 3VFCA 1JI1A 2O55A 3CK5A 1MXSA 1L6YA 1VJZA 2X8RA 1TJ1A 3K13A 4ZODA 3KRBA 2J6VA 1AVAA 3ARZA 1V6TA 3IUIA 3WF2A 2WWDA 3ORWA 5I24A 6XIAA 3BW4A 2BOGX 1W91A 3FIGA 3A22A 4M7TA 2J74A 2WVVB 1HL8A 4XV0A 4G56A 3LBMA 4QM1A 4DWSA 4Z1YA 1NWTA 4PMZA 3TA9A 4HU0A 3TROA 3LV6A 3G0UA 2CLMA 4OZOA 4AD4A 1ECEA 4ASTA 3BQ5A 2QCDA 4A4AA 1RLCL 1VBHA 3AYRA 2KAUC 2VI0A 3L7RA 2H8ZA 3HGRA 4V27A 3W7LA 4PMDA 2CBJA 4M6QA 4GMEA 4CQDA 3A23A 1G01A 1AD4A 5LIKX 3LNPA 1I2NA 3F4DA 2F6XA 2V67A 3TOYA 5GJPA 1UPMB 2HS6A 2VDHA 4DM2A 4YTUA 2FZBA 3DFNA 3W3OA 2DIKA 3TFCA 1DWFM 3OVPA 4DX3A 3ZVIA 4NVTA 3W27A 2WZTA 4EP8C 1E6SM 4E2OA 3S46A 4HZ7A 2Y8UA 5AYYA 1TFVA 3MCMA 2Y7FA 2EPMX 2GSHA 4UR7A 5B7ZA 2IPJA 5E6YA 4CVWA 4A8RA 1F8IA 2BFGA 3LXBA 5A1AA 1KWKA 3WX7A 2ACUA 3PG9A 1JG9A 2Z6IA 4FIRA 5BRPA 1KTBA 3ITCA 2QJIA 1W37A 5I0DA 4GI6A 4FS9A 3T2QA 4HZ8A 5DO8A 3APYA 5KMYA 3W9ZA 3AU6A 4QJ3B 1VKFA 1GVEA 4A21A 4O18A 3V1HA 4NZ1A 4WY0F 1F2JA 3SQLA 4FF5A 4D6GA 1L2QA 1WKDA 2AQWA 1H49A 3ALGA 2Y70A 3RU8X 1LLWA 3LLXA 2ACQA 3W7CA 2D73A 3URQA 5H8PA 4G2DA 1CW2A 4ZQMA 1TPUA 1TWDA 1HJQA 1L6WA 4ZE4A 1LOSA 4GNVA 1A5LC 1E70M 1TR1A 1XBYA 2VQUA 4O11A 4Q8UA 5HMSA 2ADAA 1TVPA 3OIHA 1QPKA 3UP8A 3N3TA 4HMCA 2CPUA 5C2CA 1YXCA 3CL7A 3FV9A 1H5YA 2PE4A 4PODA 4QS6A 3SCVA 3AISA 4HPGA 1QMLA 3GHRA 1REQB 3TKFA 2GQ8A 4OOUA 4CNOA 1Z8AA 1OYBA 1IEVA 1W32A 2J7BA 4DYEA 2L5HA 2VTFA 2VC5A 3U7BA 5HOSA 4X0VA 3KOYA 1S5WA 4O1AA 4R3UA 1L6GA 1TELA 1KCZA 3UYIA 1C8YA 1W3NA 3R4IA 4IIEA 3CZ8A 4XIMA 3UEQA 1KNWA 1EC9A 1MFUA 2HSAA 2D2GA 1H7RA 3AQUA 1A5BA 1N55A 5H91A 3NQ2A 1H7XA 4EACA 5AYIA 4I6VA 2X2YA 4FALA 3PULA 1BGAA 5D2TA 3LQGA 3G8EA 4J2MA 1FFQA 3M7SA 3SZ8A 2ZE3A 2DZTA 2D2JA 1KM0A 3PJTA 2YA2A 3VCNA 1LM1A 1TYGA 4JX4A 2NLIA 3QQWA 3NL6A 3QC3A 4OQVA 4RDWA 2BS9A 2YCJA 4JFUA 1I2RA 2WK2A 1LG1A 1HJVA 1K6AA 3TLLA 1KM6A 2CHNA 3PBGA 3P0WA 5CPLA 3H2NA 4NY2A 1HKIA 4KFPA 3WLHA 3L21A 3O63A 3H12A 2OB3A 4MVAA 1VBGA 2YKKA 3FXYA 5CC6A 1PDYA 3T09A 3MB9A 4IUGA 1R3QA 2WM0A 3VM7A 1XLFA 1F76A 1EL3A 3S6OA 3T8QA 1Z44A 2FZ8A 2OEMA 4QE1A 5A6MA 4DO5A 3UZWA 1IF2A 1LT7A 5CPTA 2INZA 2GYIA 3R25A 1TJPA 1W9PA 3RU6A 3UPWA 3ARVA 4WDWA 4NYUA 1TCMA 4B91A 2Z7GA 1OABA 3CUIA 1TPDA 5I09A 4EPDC 5M17A 3CH0A 3IAPA 3APTA 1OFAA 3SCQA 3R6IA 3WH6A 1HN1A 2G37A 3PBWA 2X7VA 4RDVA 3TSMA 3RRAA 1EJUC 5EY5A 1NAL1 3GDTA 3E96A 5A8NA 1PZ0A 4WGXA 4LYPA 4MLJA 4NT0A 5H8MA 2DT0A 3TXVA 1VZWA 3NPXA 1M7OA 4M6UA 5BNKA 1B54A 3L66A 1WA3A 1Q45A 3P3BA 4H9VA 4B5SA 5KEZA 4HHMA 3HG4A 1J9YA 3M0XA 3NPUA 3LBOA 3W2MA 2AAAA 2JF6A 3R94A 1W5MA 2ONEA 3HGJA 4AXKA 1H09A 3EPMA 1BRLA 1PYFA 3BCJA 1Z69A 3M16A 3QV6A 1CDGA 3IV8A 5CC5A 1PE1A 3S3GA 2RHGA 1FKXA 3DYOA 1OFEA 3DECA 4AD5A 4Q4PA 5KINA 3C2YA 4B2DD 5F2IA 4EIVA 4JTCA 4PTWA 1G7UA 5ABHA 1JRBA 3HTWA 3LLDA 5C70A 5DMLA 1CTNA 3VFLA 4NRSA 4TV6A 1M5WA 2GUUA 3ABRA 3P5YA 5JU6A 3T0TA 1EQPA 4HYRA 4BS0A 2W6RA 3CWOX 4WOQA 3BAIA 4AZCB 3M1ZA 2XIOA 3CT2A 1BSIA 1CGUA 3QM3A 1RLDA 1EC8A 1TV3A 3DESA 4E38A 3W1XA 1WBHA 1TCDA 7CGTA 2V5JA 4G9PA 3VXGA 3C0JA 4RXFA 3S42A 1AJ0A 2ZUTA 5EA9A 3TYUA 3GU9A 2Z25A 1XYZA 4H1ZA 4KCUA 2VGBA 1AUSL 1BKSA 3S2LA 1S2TA 1C7SA 3AROA 3KAOA 2ZKMX 2PGWA 3SCOA 4IF2A 4PRRA 5EYWA 1WZKA 4IZGA 5CG7A 1RR2A 1ZL1A 1PKMA 1NP0A 5G1MA 3IIXA 4WSJA 3IVTA 1F3TA 2W61A 3O07A 2V5BA 2XIQA 1BQCA 3TJ4A 1O95A 4KWSA 3W1PA 2PUZA 3MVTA 4K38A 3IRDA 3KXQA 4DUWA 4K7YA 3N2CA 3GXDA 4XQ6A 1S1RA 2Y85A 2ZOXA 2Y6ZA 3V5CA 3G2GA 2XGBA 3BVJA 1UD8A 1FWSA 3PWIA 1JDAA 2WWCA 4F9DA 2G3FA 2YDSA 1WPCA 3VD9A 3C61A 4MDOA 4JIIX 4LF2A 4R88A 1EO7A 1FRBA 1QHOA 1RALA 1MMFA 1W3TA 4XUYA 2VQTA 4WKFA 4RW3A 3ARPA 4PR4A 3S1WA 3VUPA 3ANVA 3REQB 3AIVA 1PKYA 4H9YA 1KXQA 2XG9A 3AMGA 3VOIA 3CL8A 1UP3A 3G5EA 4GNJA 1IXOA 1R87A 3IIVA 4KRZA 3WLJA 5HBFA 1JVNA 2ZZ5A 3N6HA 3BC9A 3LM7A 4JCLA 3VCRA 1XLLA 2O4QA 4JN6A 2Y7DA 3EOSA 4R7JA 3WZ0E 1P0KA 5GVJA 4IGSA 5PTDA 1HO4A 1IZKA 2XIJA 5E09A 1D3GA 4LW7A 5JBDA 5CG0A 2DZSA 3Q65A 1C7TA 1E6XM 1HKVA 4NAFA 4KEMA 1FDZA 1I6NA 3JZEA 4EPEC 1VEMA 1L2UA 5CPNA 3AXXA 3NYDA 4UCGA 3TN5A 4BQ5A 5HQMA 2RUSA 1E51A 3BJTA 1Z9AA 1FWNA 2FGBA 3CPRA 3AZTA 1QI3A 4PEEA 4ECLA 4O0KA 4PB5A 2PI6A 1XGZA 3CV7A 3GTXA 2A79A 1KLZA 5CSRA 4KWWA 3W00A 1PB0A 1AA1B 1DOSA 3W53A 4GX9A 4QEEA 1EEXA 5HUPA 4L56A 2ATMA 1GVQA 3AICA 3S9IA 4XAYA 5LGXA 4HBKA 3VIFA 5LHFA 3W6LA 3OW1A 3W7EA 1GUVA 4BZYA 1DPMA 4GC4A 3LCLA 3RNDA 4IX2A 3QZEA 4AHOA 4C7DA 1RBOB 4HOXA 2ZZ3A 2JKPA 4GC3A 2PWFA 3A6OA 1LQ0A 3KRZA 5E0CA 3FLUA 3MO4A 3BAKA 3NL3A 4AVNA 3ARXA 4H6EA 1CGWA 3RN6A 3NDZA 3VGDA 2XVNA 2J79A 3CV2A 3KBSA 4I6KA 4E8CA 4EF9A 1XSIA 3OOQA 3L9CA 1XBVA 2VKZG 3PZ9A 1DORA 2I14A 2QULA 4AD3A 2YGYA 1QNOA 3EWYA 1CXLA 4ADUA 5TAOA 1WDQA 3VM5A 3HF3A 1WKYA 4DBWA 5E70A 2OSWA 2R1LA 1GVFA 3G0XA 1VFTA 4LALA 4ZOCA 1I4NA 4HSOA 3CM4A 5BRQA 1HIZA 2Z27A 4DZ5A 3A4JA 4PCFA 2PDQA 1XCXA 2XWDA 4LY8A 1OINA 2ZZ7A 4WDXA 3GM8A 4F66A 4H2CA 4J1OA 5DY3A 3VAVA 1C8QA 4UNKA 1DJHA 3OGVA 5FL0A 1P6WA 1J0IA 3W0KA 1L0PA 3UPMA 4QIUA 3U9IA 3BLKA 3AIBA 5HWJA 2JGYA 1RK5A 2X09A 3WDHA 1BHGA 4GUHA 3WBYA 3BAWA 3UWEA 4WXYA 4HMNA 2E9LA 3W25A 4PRWA 3QGAC 4H8VA 3RM4A 1PYMA 3R8HA 3OHIA 4UQEA 5IDIA 1R8LA 3NQ8A 1JPDX 3TTYA 4Q8TA 5MKGA 4RCXA 3QHNA 2C14A 3L2LA 5JIPA 3NDYA 1TVLA 2RDTA 4G6CA 5HATA 4DI9A 3N4EA 1JZ3A 5FACA 1I1XA 4CQCA 1J2BA 4GX8A 4QQ3A 4RXGA 4AXNA 3PWGA 4DJEA 3BWWA 1F7BA 2PGEA 1YE4A 5REQA 3C3UA 1JDFA 2VR5A 1EP1A 1X7FA 4MWAC 1W5NA 5GNZA 1XDMA 3STGA 4FOJA 4IX0A 3UF9A 5DCEA 3ZOAA 3VABA 1XPGA 2Z26A 2FGLA 3GY1A 4KGLA 4GXWA 2TRSA 4H9UA 1B4EA 4WJEA 3ZO9A 1OC5A 1RK6A 3H7RA 2V5DA 4GY7A 1SM9A 2Y7GA 1Q6FA 1O5RA 1GTEA 3JU2A 1GK8A 3N04A 1E9IA 1CGXA 4V1YA 1BTCA 1PXGA 2D69A 4F0RA 2R1KA 3RK8A 3LCXA 4GIRA 2J7HA 4H3DA 1AW1A 4NNAA 3G24A 3BZGA 4XG1A 1DWGM 1S3HA 2WPBA 2GSEA 1PVNA 1OZQA 4WSHA 2BGSA 1KRMA 4DEFA 3FEMA 3MKCA 3AWNA 3MP4A 1WYIA 4ATWA 1XDLA 3B0YA 6ALDA 1ZJHA 2IS7A 1JCNA 1UD4A 3GVQA 5I6SA 4LXFA 5ECVA 1MUCA 3LLFA 3M47A 1N8IA 1VYSX 4H41A 3OQEA 1RVKA 3M7WA 2I9EA 2YZRA 4MM1A 2R1PA 2BHUA 4UOZA 3OVQA 1LL7A 3RX4A 1VIZA 3SBFA 1DXFA 1X38A 1IXPA 2HPIA 1HKKA 2E6DA 5EBAA 3WKZA 3GIPA 4WRHA 3SY1A 1V08A 1J2WA 1KWGA 1B31A 5I23A 4YCOA 2CERA 4AD2A 1GYNA 5GQBA 3RITA 5DMYA 5E6ZA 1MDRA 4B3LA 3T2OA 3EWUA 3GVRA 3BE7A 3MP3A 3FVDA 5BOOA 3TAOA 1LWJA 3W84A 3DKLA 3WQ6A 4US5D 2CHRA 1OADA 4KFNA 2CETA 1UR3M 1HF6A 3GH7A 3HN3A 4EPBC 1X98A 1MZHA 4KCVA 2IUZA 3LXAA 1TJRA 3MUIA 3WF0A 1OFQA 3LPPA 3AWOA 3GR8A 4PCSA 1Z3NA 2Y63A 4TIMA 4YCPA 2DVTA 1FHLA 1CXEA 3WDPP 2REQA 5HA7A 2DV0A 3GK0A 4PUMA 2PDHA 3S5YA 1R9YA 4JKMA 4DJDC 1E4NA 3FYPA 4I9MA 4Q8NA 4RE3A 3W2NA 1ALDA 2IQDA 2PDUA 3HJEA 4MB4A 2XSXA 2ZIDA 3EWZA 4XKYA 4O0ZA 1FWEC 4GIYA 2OLSA 2VM8A 1VPYA 2XH2A 1NFGA 1RP8A 1XFCA 3P84A 2P5NA 3U8GA 1TPB1 4E8DA 3RJXA 3ZT5A 4DM1A 2Y5SA 3CBWA 3WD2A 4YYFA 2E4TA 2YDRA 2G97A 1UJPA 2D0FA 3QW4B 1UWSA 4ORMA 4IH3A 3KCOA 3CZEA 4JZ5A 3SCNA 3II1A 1PTAA 2DSVA 1JUBA 5EMMA 9CGTA 2J4GA 4FLOA 4YTSA 3GUGA 4J3VA 4KIRA 3GTNA 3B8DA 4IJCA 4B92A 4O57A 4U28A 4NAFB 2OQYA 3L0KA 4LC8A 3H4GA 3BLFA 4Q8PA 4HMDA 2CKSA 3FW6A 2W63A 5I78A 3QFEA 3PBVA 4PUJA 1LOQA 2AKMA 1XLCA 3MY9A 5A8MA 1VS1A 3LUTA 2O56A 3NDOA 3EXTA 3WUEA 1TMQA 3LGEA 4AX6A 4Z2JA 5FL1A 1KBBA 4NZCA 4JFVA 4CN4A 2VYOA 2WM1A 3GG1A 5T9BG 4NP7A 3K8MA 4KERA 1ZAJA 2NWSA 1JUEA 4E6MA 3JVAA 1VD6A 3AS0A 2FTYA 3V3WA 2HPMA 4EF8A 1IR1A 1MRAA 1LBFA 3SN0A 1FQ0A 1QO2A 4DBSA 3MKKA 2F7FA 4UFLA 1CB2A 5EU9A 4FNPA 1UKTA 4M24A 1WBJA 3L12A 4A35A 5FCZA 1B3ZA 1HNYA 4ICNA 4P61A 4L4OA 3GXTA 3QGKC 3GTIA 3NCOA 3UESA 4B4HA 1JCYA 1B0IA 1QVBA 3AHTA 3GU1A 1ESWA 4F0KA 3PZIA 2X1RA 3SRHA 2R6OA 2VFFA 1N2VA 3NPVA 4IMGA 3AIWA 1SFSA 3ITYA 3ZT6A 2B4GA 2BMBA 1EP3A 2CZ5A 3DYPA 3LPGA 3EOLA 3IACA 1IEQA 2E8YA 4V33A 1VENA 1Q5MA 1VRDA 1UKPA 4O16A 3CH9A 2J8GA 5CJNA 4FAMA 5FJUA 2OQHA 3UWWA 3ATZA 2BXZA 3KX6A 2VMFA 3BMWA 2HS8A 3QTGA 4AWUA 3SUVA 4JQ4A 3G3DA 3QTPA 5I5RA 1VCGA 1VBJA 3LHUA 4QQUA 2QDHA 1S2VA 3GVVA 1DBTA 1BYCA 1JD7A 1ADOA 5D9MA 4GZEA 1RBLA 1M6JA 3NSMA 4IPNB 4AIBA 2JF7A 4F4RA 2VZUA 5D09A 2ESCA 3GHUA 4DZAA 2WHKA 3B9DA 1XXXA 4S3AA 1NP2A 1GPFA 1WAUA 5BXRA 1FCQA 3QY7A 3R10A 1F9CA 4MZYA 2OKOA 2VVSA 4F2UA 1IZJA 1OT2A 1E40A 1IZCA 2V0TA 2NUWA 3WNMA 4ZQOA 4WLCA 4ZQPA 2F61A 1E55A 2YCIX 2CEQA 3W02A 3OP2A 1LRTA 1PCKA 3A5FA 1MNSA 3ABZA 3DGRA 4HPHA 4NJJA 3WEOA 2DZAA 2QPXA 3XIMA 3GE7A 4IMFA 4R85A 4XD6A 3OLGA 5LGZA 4GGBA 3KZPA 1ZAIA 3NA8A 3SCTA 3W82A 4H8HA 8RUCA 4FLRA 1K8YA 2YDQA 4X9YA 5CSSA 4O4VA 3SRDA 2QAPA 4PMVA 2R82A 4L64A 1IT0A 2X16A 2ABBA 5REQB 5E93A 3BL3A 4QBXA 2FHCA 1C3FA 3O05A 3LCIA 2HK0A 2XYLA 3TCEA 4HCDA 4NI3A 2FTWA 4XBKA 1KRAC 4IPPA 1KM5A 5XINA 4HOZA 2GWNA 2ZCGA 3TNBA 1YADA 3N6QA 1RP9A 3OG2A 1EJTC 2GVGA 1WX0A 4O4WA 4PTXA 1H11A 3AHXA 3LMZA 2A7PA 1OD8A 4HU8A 4U2ZA 1K02A 2GPTA 4GI9A 3S83A 4H7CA 3PBMA 4ZQRA 4IT1A 1ZRQA 5H1WA 4P7OA 1G9HA 3VGEA 2XHYA 3NTYA 4C7FA 3OGSA 2VWTA 4FX7A 2R94A 3GFXA 4QG6A 2W9MA 4OV9A 2VGGA 5DT5A 2W62A 4OFCA 4YN5A 1RCQA 3RM9A 3WUGA 1LP6A 1PL9A 3GIQA 3AU2A 2BX7A 4NG3A 4OBTA 1M7PA 3A5VA 1EZWA 2Z00A 4ZO6A 1GQLA 4UUIA 4QLLA 5IHRA 2UZ9A 4A8LA 3ES7A 2HXUA 5C9RA 3JZUA 3VO0A 4O1DA 4RE4A 4AD0A 3R5EA 5CPMA 2NX3A 1OB0A 4B5VA 1W1ZA 4J7RA 3ZVHA 3UVIA 1XUUA 5A8QA 2GGHA 2Q71A 3ZR6A 1TG7A 2QEZA 1VYRA 2QCFA 3UU0A 1K9EA 5CZKA 3GIYA 2XVLA 2CIPA 4NAEB 3EDEA 2PBOA 4DYJA 1HFBA 2G3IA 4R34A 4JGDA 1W56A 3WBEA 1BPLB 4DVOA 4KFOA 4CVUA 4QAIA 1QI0A 1YPFA 3FFSA 2DFAA 2G3NA 1GZJA 3TA6A 2WSPA 1H1YA 2J8FA 2BODX 4E4FA 1TPWA 1H7PA 2ZWZA 3GR7A 2OMAA 1GKRA 3ABXA 3TMQA 1S39A 1E0UA 5C7VA 3T0CA 2HQAA 1HVXA 2WKGA 2QMKA 3HIJA 3P67A 2FDMA 2LLEA 3LHTA 3DXIA 4N7QA 4G7FA 1W54A 4H01A 1UZ4A 2ISDA 3BOXA 4MKSA 1HZYA 2IW0A 1XLGA 1ONWA 3NXFA 2E0PA 2REQB 3RDKA 3QMSA 2RAGA 1XWYA 3KBJA 4CNTA 4O0QA 3DFTA 2XM2A 1MEHA 1RV8A 5K4ZA 3B8VA 4GZ7A 1RA5A 1GKQA 3U48A 2RJHA 4XKYB 3NQVA 4AF0B 2HTMA 3ARSA 4UTHA 4RE2A 1KM1A 3AMCA 4F2BA 2ZWYA 2V8ZA 2BVYA 4L4MA 1DJIA 1E5NA 4N6EA 4S3CA 4G7EB 5TNVA 4YXGA 1GG0A 5CLTA 3TW6A 2XIBA 3BV7A 4PMOA 2FZ9A 3E0VA 1V3KA 3WN6A 2RDWA 1DJZA 3NWRA 1D8CA 3VDGA 4JQ2A 2V3GA 1A5NC 2WMIB 2QDGA 4XTIA 4HGXA 3WK3A 4DJFD 1KR0A 3KBVA 3CB8A 2A4AA 3TCSA 3OVGA 5AHFA 4PL1A 3MYOA 4LVGA 1DJWA 1YQ2A 4PUNA 4PA8A 3S8HA 2H8XA 1XYCA 3R0KA 2PDFA 3AO0A 3TJXA 2XWEA 2BY3A 1F3XA 2GVLA 4O1CA 1E3XA 1QK2A 1HL9A 4FXSA 5DLCA 4X2RA 1NY1A 1OCQA 4H04A 5EKYA 1IGSA 5HANA 2GLKA 1U30A 1XH2A 4LBRA 4WGHA 1OWQA 1GYMA 4AEFA 3EWXA 5DN1A 7ENLA 2R1MA 2G3JA 2EG8A 1AL7A 2QCNA 1SW7A 1TRIA 3POCA 3QPYA 2GJLA 4CD8A 4MWAA 3PBYA 1XLKA 1E73M 1KBKA 2CHOA 3FCPA 1SJBA 4Q22A 3K1DA 4JX6A 1S5NA 4QLJA 2Z1KA 1AD1A 2ZX7A 4GABA 4HA4A 2YBTA 4H6KA 1IWBA 1TREA 1QHZA 1ICQA 1XS2A 1ITXA 2BXVA 1PDZA 3K2GA 1BG9A 2PTZA 4DO6A 2GOUA 3TN4A 2I5IA 2ZRWA 1TV2A 4Y9AA 2D23A 3P62A 1M53A 1IEWA 4S2BA 1WXJA 3H24A 3W72A 1TIMA 2PB1A 4M7SA 1NDYA 2D3NA 4PUUA 1KFWA 1J6OA 1G69A 4UTUA 2OX4A 4CU7A 4OHQA 2XH7A 1MW1A 3SY8A 3W28A 3WLMA 4GCXA 3IPWA 5DF0A 1DVJA 3KFTA 3XINA 5CC7A 4DPPA 3WQEA 1A5MC 4BA0A 4QG8A 4B5UA 2NXIA 2ZDRA 4GG9A 4W89A 1B9ZA 2YCLA 1HGWA 1DKWA 2QF7A 2XPKA 4LAKA 2Y1HA 3CUXA 2PZ0A 4MNMA 3OQ8A 1TKKA 4FR6A 4HIBA 5FEPA 4IISA 3GZAA 1R85A 1V51A 1PTDA 4L4PA 5BCAA 1DJGA 3QFWA 3GSMA 3R89A 1BXCA 2CFFA 4Z08A 1F74A 2WSYA 5FI8A 2H90A 4UMCA 1R47A 3FYYA 3VD5A 4I3GA 3SSJA 1S38A 3THQA 1CIUA 3AC0A 4AB4A 4UTKA 4EAMA 1IT8A 4FX6M 3B3DA 3K4AA 4LY4A 4GO9A 2VZOA 3IJ7A 3TTEA 1QU4A 1RJRA 2F38A 1UZDA 4F79A 1C9DA 3FSTA 4C6BA 3D47A 1GPWA 1UJQA 2PEVA 2J78A 1J0HA 3WF4A 2HNHA 1ZNNA 3UWZA 4UZSA 3MJYA 5HWNA 3DU0A 3ZLHA 2J6XA 3N2TA 1K70A 4GLEA 1OHLA 4IFOA 2DQWA 3R58A 1CGYA 2OR2A 4ORIA 3N2OA 5A8OA 3NO5A 3BMVA 4S3FA 1MQQA 4WK9A 3AXKA 2AAMA 1VGAA 1EA9C 3WMLA 4HMEA 4GYPC 5E5CA 3FEQA 1S5TA 2BHZA 3ARRA 3AYVA 1P1MA 3WJWA 4JPGA 4C1LA 1XLIA 1W9BM 1H0GA 3MMTA 3K1GA 4LCRA 4ZZ9A 1XJBA 1Q8JA 1ZLPA 3TZFA 1G94A 5HDRA 3TH6A 4B3ZA 3HFTA 3ZLFA 4Y90A 3ZT7A 3THDA 2O9TA 2QCGA 3OB8A 4GJ1A 3SN1A 1EO5A 1R46A 2YDAA 4REQA 3MSDA 4DJDA 1BAGA 3W1LA 3NQGA 1TZ7A 1LJYA 3BG3A 2XH4A 1LBMA 1J11A 1THFD 4JNZA 3T4WA 1EGMA 1YIXA 4J27A 4B2DA 1MW2A 1JZ7A 1JYXA 1DYSA 3QMTA 3S2JA 5CGMA 1W5OA 2R8WA 1V3IA 3VX0A 4F9JA 3OPSA 1YHTA 1O7AA 2PA6A 3VGBA 2CLPA 4PMJA 1K8ZA 3DC8A 2E67A 4W8AA 3WLTA 3UG8A 1A49A 1U33A 4NU7A 4QAWA 1JF5A 4UTTC 3VPLA 5A6JA 2NVDA 4ZOAA 2C7FA 3V0TA 4D6EA 3P81A 1YNYA 2Z28A 3Q2DA 4C6OA 2QCMA 3BSHA 1Z6KA 1OGGA 3UZJA 3UGRA 1ZTVA 1P5BA 3CMGA 1XYLA 3VOHA 5F4SA 4GUGA 1KFKA 3NQ6A 3ZVHB 4YLWA 4CQ9A 4RNJA 1EEPA 3GC2A 3BLLA 3SIZA 1PIIA 3O0FA 4MY1A 3GXPA 4N0RA 4GY0A 2PCQA 2ZX8A 3NM3A 3MZ2A 4GOAA 3WELA 1Z89A 3TWBA 1Q7MA 1U1JA 3AMLA 3MUZ1 1LF1A 4AWEA 3WD3A 3O2LA 5I2UA 5AZ0A 4JHMA 4AY8A 1EPXA 4CD5A 1Z7AA 3DFPA 3W38A 3GVGA 1VFFA 1NOUA 1YLVA 2BVWA 1DWHM 2WSQA 2Z6JA 3N6JA 2J7FA 4JTTA 4R53A 2BSLA 3M4HA 2BASA 3UCDA 4DF2A 3VZZA 4HCHA 2WZIA 3AHYA 1T5AA 1E1CA 3QY6A 1TUFA 1VCVA 5E0KA 3WQVA 4TMBA 4QLKA 2J9ZA 1XFBA 2ZQ0A 4GRSA 3SEPA 2VX6A 4G8TA 2YFOA 4JN7A 1UYQA 1FDYA 4DHGA 1BFNA 1PX4A 1T6MA 2YB4A 4GH3A 3TSDA 4KEUA 3LXCA 2QMJA 1IV8A 1ECQA 5CBIA 3DFHA 2Q8LA 3JS3A 1ML1A 2HBVA 3M0MA 2QGHA 4ICMA 1DJQA 3BSMA 1OCBA 2OX1A 4A3UA 2OOFA 2PLMA 3CQ0A 4JNYA 3LGDA 2EGZA 1Q7QA 3FA5A 4XVDA 4GY1A 1E3ZA 2EKCA 4U10A 1A5SA 5FJJA 3M0ZA 1NM9A 4JFTA 4KCTA 1EUNA 1QW8A 3B9AA 5DBTA 3PJUA 4LEFA 1AFSA 4XO6A 3BSGA 3IJDA 1XV8A 3G8RA 3GFYA 3GG7A 3IGHX 2DJXA 4Q4KA 2OSYA 1NDZA 2CZFA 1H61A 3HA1A 4PBFA 3M46A 3BG5A 3FDKA 2ZRZA 4LX4A 2ZA1A 4XVEA 1QDSA 1TB3A 5DCDA 1B57A 1M68A 3KLLA 3MYPA 2A3BA 3COTA 4IQLA 4FF7A 1JJKA 3M5XA 3EX6A 4AU0A 3SGZA 1XGDA 1KBIA 2H6RA 4F0MA 1OJXA 3NZPA 1ISWA 4ZXOA 2J8TA 2DORA 1RPXA 3MJMA 3W70A 3IK2A 1PEZA 1ZS2A 4A6GA 5BU9A 1GW1A 4CKQA 3CO4A 1A53A 4AEOA 3H7UA 3HPZA 1DHPA 3GX9A 1V3LA 5T8GA 2YCKX 3IUDA 1OGBA 3PB2A 4DLMA 4HSHA 3BANA 2WOQA 4PSRA 5A8PA 4FI4A 3PM6A 2AOSA 2VC6A 1UWTA 4L4LA 1OCJA 2OO6A 3G6LA 3B04A 1MW0A 3DBNA 2EO7A 2V2CA 2CLFA 5G2HA 3VZXA 1RJQA 2WCGA 3LZ5A 2BVTA 1CGTA 1CB7B 4MWAE 3CUGA 4HYVA 4E5TA 2IKIA 2PLKA 4B9ZA 2IMRA 1CXKA 3CASA 4GQGA 3V18A 3A12A 3KM8A 3ITLA 3CC1A 3RR1A 4S3DA 3S47A 4WJ8A 1W3IA 3GBEA 5A6BD 1GW9A 4HQVA 3HPFA 4LCQA 5I06A 4H19A 1VR6A 4DNMA 1TUXA 4I5UA 5G4HC 2X2GA 2JEPA 2WC7A 1JDEA 1OC6A 1WV2A 3TDFA 3E74A 5BXSA 1PZ2A 3VIKA 3D3AA