4FOLA

S-formylglutathione hydrolase variant h160i
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
299
structure length
283
Chain Sequence
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQRIPTVFYLSGLTCTPDNASEKAFWQFQADKYGFAIVFPDTSPRGDEVANDPEGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKLDFLDNVAITGISMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPWGQKAFKGYLGWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords S-formylglutathione hydrolase
total genus 91
structure length 283
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4folA00
5AM2A 4B0PA 4X94A 5SYNA 2Z8XA 4B85A 3A70A 2DHEA 5KWJA 4ZRDA 3PF8A 3W05A 3HC7A 5IH7A 1IVYA 1DTEA 2AJCA 1EDDA 1UK9A 3RM3A 4J0HA 1W1IA 3H17A 1WHSA 1KU0A 5AKJA 4H35A 3WA7A 3WKCA 4G4JA 1MX5A 5CTAA 2XUHA 5D6OA 1AC5A 5K3FB 3VJMA 3IVMA 4HXFB 3L1JA 4CIAA 2HA7A 4E15A 3DCNA 2ECFA 4N8EA 1G42A 2OG1A 4J0IA 5FP0A 4MYDA 1GGVA 5HF5A 1CR6A 5KREA 2ZYHA 4ZGBA 4FOLA 4J0CA 1EVQA 2PSHA 2HIHA 4EHBA 3B5EA 2FJ0A 4OU5A 4YX9A 3GZJA 3RK4A 2PUJA 2VJCA 3ICVA 2PL5A 2QT9A 7YASA 1DT3A 5K3AA 5T4BA 4FFWA 4GW3A 3D2AA 2B61A 3DL4A 5EIHA 1WOMA 1MNQA 2XQIA 1AX9A 3VDXA 1UKBA 2CUTA 1X2BA 1XKLA 1CUJA 5C7YA 2W6CX 5SYMA 2AJ8A 2VATA 1CV2A 1FFDA 2QJWA 1ETHA 3V1KA 2HA5A 4FHZA 2QTBA 5HKBA 3I1YA 4BB0A 5HFNA 3BWXA 1EK1A 4ZV9A 3IULA 4TGLA 3C6ZA 1J1IA 2HHAA 2OQIA 3FVTA 4UHHA 5AHXA 4L72A 2XMSA 3WWPA 4Q05A 1BN6A 2JBWA 3UUEA 5AK4A 1BN7A 1QIIA 4MYSA 3AZOA 1EVEA 1ZD2P 2OCGA 3QH4A 3C6BA 3TRDA 1GKLA 3OG9A 4B80A 5C8VA 4ARBA 1O6FA 1XZHA 3F8SA 2WIGA 1XRPA 1A8UA 4GXNA 2VAVA 3C5WP 3RKSA 4Y9SA 1YAJA 2AJLI 4ZV7A 4JYMA 4LYEA 3G9UA 2WU4A 4OPMA 5AI4A 4MQLA 1D07A 2BGRA 2PSEA 1FSSA 3M83A 4Y2PA 3FBWA 5DYWA 3I2JA 2PU7A 3K2IA 3I6ZA 2XMQA 1UK7A 3DNMA 1LPOA 1NX9A 4XWGA 1UOQA 1MO2A 3IUMA 3ZPXA 2XI4A 3O95A 4C4ZA 1AGYA 3QVMA 5HF6A 3WJ2A 5AK3A 1MX1A 2CJPA 1W6RA 4KRYA 4OB7A 4WJLA 1RYYA 4BE4A 4CG3A 5AKHA 2Y2UA 5CT6A 5AKYA 4N5IX 5E4YA 2HM7A 4BAUA 2O7VA 1L7RA 3C45A 3LIIA 2ZSHA 1DQZA 5ALEA 1WPRA 3STWA 4Q3LA 1R9NA 5LZ4A 1XLWA 2YYSA 1QO7A 4L9AA 1CUHA 4KAFA 5EIEA 1VA5A 3MUNA 2V97A 3KSRA 3HABA 4X90A 2WFMA 3AUKA 4AZ0A 1QONA 3LLCA 4H7DA 4ETWA 5A7FA 4H7EA 3WWDA 2O2IA 4PW0A 3G0IA 1QZ3A 1GQRA 4FDMA 1ZD3A 3KWJA 4J0JA 2PUHA 3C5VA 1BEZA 1QLWA 3I2IA 1OCEA 3WA6A 1TCBA 1ORWA 1U8EA 4WDQA 5AKKA 3ZI7A 1H22A 1HLGA 1B6GA 3ICWA 3FYUC 3DEAA 4BCCA 3BIWA 1Q0RA 2XMCA 1L7QA 1QE3A 2WUDA 4M0EA 5JAUA 4FLMA 1QIGA 4EY6A 4F21A 4PSCA 3V1MA 2DQZA 3ZLTA 4BZZA 1X2EA 1F6WA 1J07A 3WK4A 4YASA 4QLOA 2WHQA 5AKGA 1ZIXA 2VT6A 3FCXA 2OAGA 2YXPX 3SK0A 4MWSA 5HK9A 4GI1A 4TPKA 4G1FA 3G0CA 3D2BA 1U4NA 1IUPA 3FSGA 5ALVA 5FKJA 2Z8ZA 4PO3X 4H7JA 1XROA 4ARAA 4QZVA 4HXEB 4Q34A 1HKHA 1H2XA 3A2NA 4C01A 1A88A 2BGNA 3NWOA 3H2HA 1VZ2A 5ALIA 4RGYA 1CUXA 1ZGCA 3IA2A 2HA4A 5JIBA 5HK8A 1Q0ZA 4G4GA 4A5SA 2XT0A 1XQWA 1EA5A 1XZLA 4EY8A 4UBIA 3FLBA 2HA6A 2JGJA 5ALQA 2PSDA 4W1SA 1R1DA 3DJYA 5ALTA 5CT4A 1UT6A 2W22A 5D7BA 1LBSA 2B4KA 2K2QB 5FUMA 1ZI8A 4YPVA 3R3WA 3FAKA 5AM5A 4CIBA 3WI7A 2VJBA 1EHYA 4HAIA 4AB1A 1R4ZA 3OC0A 3O4IA 3WK9A 5HFAA 3A6ZA 3EQ9A 2PKYX 4GEGA 5AI6A 2EDCA 1WCYA 4Y2RA 4EA6A 3ED1A 3D7RA 2I03A 1OILA 1QIHA 5JADA 2WJ4A 5DJ5A 4BDSA 4BRZA 5HQ3B 4QEKA 5LYYA 5LZ5A 4PNZA 4GBGA 4MQMA 4PQEA 4BZWA 5ALSA 1USWA 3IUNA 1LPSA 5EGNA 4E14A 2D0DA 1N8SA 3HEAA 4C4YA 1ZI9A 2XUPA 1BRTA 3IUJA 4LXIA 5T4FA 4IH1A 5J3JA 2G63A 4JYPA 1K63A 1A8QA 4C4XA 3GA7A 1NU6A 1UKAA 4MEBA 3K9BA 3CCCA 1CUIA 1LPAB 1IMJA 4J03A 4LIPD 4HRXA 2FJPA 2XMDA 2VT7A 1K8QA 4D9JA 2G5PA 3AZPA 4J3JA 2GZSA 1XZJA 1VA4A 4F5ZA 1AURA 5A7GA 2WG0A 2R8BA 4H7IA 3HI4A 4BRSA 6YASA 1ACJA 2WSLA 2DSNA 1ZI6A 3BDIA 2UZ0A 4B0OA 4M0FA 2QR5A 1QFMA 4J0KA 1GPLA 4PSDA 3AILA 1GZ7A 2ROQA 4H0CA 3IUQA 3WYDA 4BC0A 1EXWA 3IIIA 2FX5A 2CEKA 1R50A 3H2JA 1GPKA 4YK7A 3FNBA 3MUOA 2YH2A 5EHNA 4JUIA 2R11A 1CUSA 3E0XA 5ALRA 4N8DA 1XLVA 5AM1A 2HA0A 1RP1A 1GKKA 3LCRA 3ANSA 4WFKA 1MT3A 4Q3KA 4OYYA 2PSJA 3N2ZB 3DS8A 3BJRA 4X91A 4W63A 2V9ZA 4LXGA 4B81A 2XUOA 1WB4A 1W76A 4QDZA 1CUDA 5ALOA 5LP1A 1XZAA 4JH0A 4ZXFA 2WFLA 3H04A 4AX4A 2EDAA 1ZOIA 2Y6VA 4NMWA 1ODTC 1JKMA 3OTQA 1VLQA 3ZLVA 3DYIA 4AO7A 2X76A 3LS2A 3PI6A 1GT6A 4XX1A 4UHDA 4KE8A 2WU3A 4X6XA 1QIKA 2GBCA 3H1BA 1LZKA 3H2GA 2XMZA 1Y7HA 5YASA 3YASA 3DOHA 2JGIA 2WG2A 2XUDA 3A2MA 3BL8A 3WWOA 2ORYA 3PE6A 4DMFA 5JANA 3VXKA 3NOXA 2C5FA 4H77A 2XUGA 3QMWA 4KEAA 1CUCA 3C43A 4J0GA 5F4ZA 5JD4A 5ALJA 3NUZA 1SCKA 3ESBA 3JWEA 4IO0A 1WM1A 1DQYA 2XUKA 1J2EA 1BEEA 2QMQA 3WIOA 1ISPA 4BAZA 1XQYA 2ZYIA 1CVLA 4U2BA 2JGMA 4JEIA 4QDOA 1JU3A 4IHAA 5C8ZA 3T52A 1YCDA 4U2FA 1E8NA 2BUBA 1K4YA 3GUUA 2HU5A 5ALUA 3WZLA 5HKAA 3Q8WA 3DYVA 1GPNA 1B41A 5DWDA 3UMJA 4BTLA 1WHTA 4J7AA 1UK6A 1XZMA 4K6KA 2Y1KA 1R88A 3KOOA 2PM8A 4UBOA 2J3QA 4X85A 4P08A 1EK2A 2JEZA 1QJ4A 4HZGA 4CI9A 3IURA 5FPPA 2ZYRA 1FFEA 4BCDA 1CIJA 2RGUA 1JJIA 1MN6A 1LGYA 1SC9A 1MAAA 1XFDA 5JYCA 2DQYA 1KEZA 3S8YA 3I28A 3ANTA 1SCQA 2WIKA 3STYA 2GYUA 3U1TA 2XUJA 2CZQA 3LIPA 3EQ8A 2Y2VA 5JZSA 1G66A 4P93A 1YR2A 1DX4A 3R0VA 1R9MA 4QNNA 3F96A 1UXOA 1ODSA 1C7IA 4X93A 5LKAA 5CT9A 3VVLA 3QZUA 3W04A 2AXEA 3STVA 5ESRA 3WK6A 3V48A 2HU7A 1DWOA 3E4DA 5ALLA 1QIMA 3FYUA 4BC1A 5IVKA 2XQKA 3QYJA 3QBJA 3UUFA 4DLNA 3H19A 5AM0A 4AZ3A 4KRXA 3R3YA 1IUNA 4JNCA 1WB5A 3D3NA 2G4LA 1TK3A 2HFKA 3MGAA 1JJBA 3OOSA 5AKEA 4CG2A 2GYWA 4QDXA 1R3DA 3F97A 4X97A 4UFOA 4UFPA 4PF1A 2CMFA 3M82A 2PSFA 2XMBA 4OB6A 1LNSA 4U2CA 5ALNA 1TCCA 1QOZA 2BKLA 3IB3A 1JI3A 4B9EA 1F8UA 2JIDA 3DLTA 3PICA 4KJXA 4UHBA 4BVJA 4QWMA 4H7HA 2XQGA 4CCYB 2VJDA 1U2EA 4H18A 5DNUA 3C6YA 3FWHA 5EIAA 1XZGA 1ZGBA 5HZGA 1XZBA 1HDEA 4Y2JA 1XQXA 1ORVA 1FJ2A 1QIJA 5BOVA 2XDWA 1SOMA 3DKKA 2XUQA 1XZKA 5A7HA 3QM1A 3WMRA 1CPYA 3V1LA 5DTJA 1TIBA 1BCRA 1DWQA 3O0DA 2WFLB 5CBKA 4OSEA 4WY8A 2X8BA 4WCVA 1XRRA 3FLAA 1CUAA 4DMHA 1AKNA 3LP5A 3P2MA 3BJMA 4KAAA 2ZYSA 3WL6A 1ZJ5A 1BS9A 5JARA 5JAPA 4HRYA 4HS9A 2QUAA 3FCYA 4F0JA 5LZ8A 2VA9A 5K3DA 3O4HA 5JZ9A 3BF7A 4C88A 3R41A 1EH5A 5E4JA 1YAHA 3JYHA 4BVKA 4GHWA 4S0XA 4FWBA 1XRMA 4BDTA 3QMVA 5FOQA 3I2GA 3QPDA 4RE6A 4DNQA 2XLBA 2EEPA 5ISMA 3T4UA 5KBYA 1CUGA 1VE7A 3FVRA 2XE4A 5AIAA 5JD5A 2Y6UA 1CFJA 2DHCA 2I78A 2PU5A 2ACEA 4ITVA 3HRHA 2WUEA 4CCWA 1CUEA 3CXUA 2ZJFA 1MU0A 1QFSA 5LZ9A 1CUZA 4GLBA 3FOBA 3EIOA 3STUA 5CT8A 1MAHA 1VJ5A 3OPMA 3AIMA 1QIFA 3EF3A 3PUIA 5CXUA 2OPHA 2QXTA 2ZJ6A 4W1RA 2PPLA 4ZI5A 3HZOA 4MXDA 5KWIA 4KE6A 4K5QA 2VF2A 5CH3A 3S2ZA 5JASA 1Q83A 3WZMA 5LZ7A 4BVLA 4IQ4A 5AKXA 4Q82A 4EUSA 3WQHA 1XZDA 1XZCA 1E66A 2JGFA 2WUGA 2Z3WA 3BE8A 5ALZA 1MNAA 1GXSA 2FUKA 1EDBA 1E3QA 4DMKA 1XRNA 3AIOA 4ROTA 2PVSA 4X95A 1C7JA 5FRDA 3HSSA 3WWCA 1EI9A 2RONA 5ALWA 4DMCA 3H1AA 5JAHA 3C6XA 2PX6A 3E1GA 4G8DA 4UHFA 3IBTA 5A6VA 1DINA 1YA8A 4KYVA 1F0NA 5A2GA 5CH5A 4P9NA 2GYVA 4H7FA 3ZV7A 1XQVA 3WLAA 4OCZA 3EQ7A 3F98A 5ALPA 2OLEA 4UBJA 5ALKA 3I1IA 4CFSA 5LZ2A 2J3DA 3G8YA 4KAJA 1TAHA 3GBSA 1WPXA 1QGED 2WG1A 1ZIYA 3O9MA 1CEXA 2H9YA 1H23A 3PUHA 1FFBA 4DSAA 4FTWA 3QMMA 2BUAA 2WIDA 3RARA 2GBFA 1UWCA 2JEYA 3G0GA 1DU4A 1FFCA 1CUWA 5I7UA 1W75A 4Y2VA 4Y2QA 5DYYA 3F9CA 3TJMA 5ALYA 4UPDA 3WKAA 1CQZA 3WYNA 4BP8A 1EB8A 3VISA 4OUKX 1VZ3A 2O7RA 2XUFA 1A7UA 2QRUA 4U2EA 4IH4A 3WL7A 4FBLA 1KU6A 4G5XA 3I2HA 1MTZA 1YS2X 2IIVA 1ODCA 1HPLA 2ZVDA 3L1IA 4KE7A 2JGKA 5E2IA 1E8MA 2WJ6A 2CBGA 2XLCA 1H2WA 5K5EA 1QTIA 5CW2A 5CMLA 5ALXA 4NVRA 3WK7A 4NZZA 5JZBA 5K3CA 4AMYA 4K2AA 4QE3A 4FLEA 3BDVA 3PFBA 1Z68A 5LIPA 1H2ZA 3QITA 4X6YA 1P0QA 3DQZA 3R3UA 2B20A 1TKRA 2WTNA 1YB7A 4BBZA 4UBKA 5CH8A 5I9IA 1XRQA 3H2KA 1UOOA 2O2HA 2OAEA 5AP9A 4OYLA 1DWPA 2BAGA 4G4IA 4P92A 4UUQA 4BYMA 3C87A 2WIJA 4OU4A 1YS1X 3GFFA 3HYSA 2WHRA 3D0KA 3W06A 4J0DA 3D59A 5AO9A 2WLSA 5CURA 2WHPB 2RHWA 4O08A 2HFJA 5JATA 4B82A 1EDEA 1G4HA 1VXRA 1YASA 3WKBA 4BE9A 4EZIA 4BAGA 2WTMA 4EBBA 1QO9A 2XMGA 5EHXA 1RWQA 3G9ZA 4B6GA 4UBLA 1XZEA 4HXGA 1VXOA 3WIBA 4FNGA 2XUIA 4C6HA 1E8DA 1YA4A 1BE0A 1L7AA 4QA9A 5HF8A 3HLKA 4X3CA 1TCAA 4W1PA 3QPCA 2B9VA 2BJHA 3BXPA 1CUBA 4C89A 5T4EA 1G5FA 2LIPA 3TGLA 1N1MA 2AJBA 3R40A 1XZIA 4EY5A 4A16A 5ALDA 3G02A 4XJVA 2ONCA 2C58A 2I3DA 3FYUB 3WK5A 1JMYA 2C0QA 3SC2A 1E89A 1TQHA 2Z5GA 1THTA 2XQFA 2RHTA 4I3FA 2ACKA 1ZICA 2C0PA 4K6HA 2RAUA 2DCMA 5AI8A 2RI6A 3ILSA 3STTA 4IH9A 1JMKC 3DKRA 3C8DA 1P0PA 1VOTA 3G7NA 4FLFA 5AKIA 3PF9A 5FLKA 3AJAA 5ALFA 4Q1VA 3F67A 3DOIA 1Q84A 3AIKA 5K3FA 3G0DA 1BCSA 2E3JA 3WWEA 4KE9A 1JT2A 4W1QA 4Y2UA 4DNPA 2QUBA 2OGSA 2HRQA 1S8OA 5DNWA 3L1HA 3KDAA 2O2GA 4QDUA 5D3ZA 1PFQA 5T4HA 4X6UA 2VTVA 4AN0A 3H18A 3AFIA 4B84A 1TRHA 3KD2A 5LKRA 5H3HA 3SWWA 5HCUA 5BWCA 1UK8A 1H2YA 3VKFA 5JD6A 3H2IA 1C4XA 2HADA 2OCIA 1EB9A 1AUOA 1CUFA 4W9RA 4AO6A 2J4CA 4FBMA 4WY5A 3OM8A 1IZ7A 4ZWNA 5K3BA 1VKHA 2JGEA 2XB6A 3G9XA 4L0CA 5AI5A 1THGA 2V96A 3O9VA 2DHDA 2VQ6A 2QOEA 2QVBA 5AK6A 1X70A 4UFNA 3D2CA 1J06A 4RPCA 4XIIA 2JGLA 3HACA 1W4LA 4Y2TA 1UZAA 1IUOA 5AH0A 3B3QA 3WJ1A 2RIPA 4AMZA 2G5TA 4Y2XA 2NW6A 1P0MA 4B7ZA 3HXKA 2WHPA 4XVCA 1LLFA 4EY4A 2PBLA 4FMPA 4X7BA 1BU8A 5IKXA 3G9TA 5AK5A 2BUCA 1QTRA 2WJ3A 3O4GA 2WM2A 3I2KA 1A8SA 2OGZA 4KACA 2ZJ7A 4V2IA 2GZRA 3G0BA 3CN9A 1ZD4A 3K6KA 4DM7A 5AOAA 2WKWA 3OURA 2QKYA 1ACLA 5EFZA 3FYTA 3VJKA 5DYTA 4Z49A 5D3KA 5ALHA 4DGQA 1HBJA 5AM3A 1CLEA 1ZJ4A 2P8SA 4K6GA 5ALGA 1YSCA 3GELA 2OCLA 3TEJA 2CB9A 2C7BA 1MX9A 4B9AA 3QPAA 4ZREA 1O6GA 3BF8A 2WIFA 3R3XA 3ESCA 3FLEA 2VSQA 4UBMA 2AJDA 3ZWQA 1DX6A 3WK8A 1CUVA 4I19A 2JF0A 1JFRA 4EB0A 4WFIA 1JJFA 3FSGD 2XUAA 5EHZA 2DR0A 5AOCA 5IVDA 1AZWA 3O4JA 4BATA 5CT5A 3I6YA 1GQSA 2YASA 1EX9A 5BV7A 1E5TA 5AJHA 2IX9A 4CCYA 4X92A 4OB8A 5AM4A 3E3AA 1YB6A 3DL7A 5K3EA 3PDCA 4X00A 4INZA 1UKCA 3WKDA 4G9EA 3W9BA 5AICA 4HTAA 2QS9A 1U65A 3VVMA 2QXUA 4EY7A 3B12A 2VJAA 2QJRA 5C8XA 2OGTA 2QZPA 5AI9A 4MEAA 3MVEA 2HDWA 4RNCA 2HA3A 5BWBA 2GBIA 5DLPA 4LXHA 1XKTA 5A62A 1K5PA 3WL8A 4WDRA 5IVIA 4Q3OA 1XLUA 2QM0A 4U2GA 1LPPA 5FXMA 2HA2A 4G9GA 3AINA 1MPXA 5AI0A 2I3ZA 2DFPA 4LHEA 3EBLA 5ALMA 3VJLA 5JALA 2OXEA 3H0CA 1MJ5A 3HJUA 1W52X 5I8PA 1JU4A 4QDTA 2Q0XA 1AMNA 3R3VA 4G8CA 5HF9A 4M0MA 3C8HA 3A2LA 1T2NA 4UBNA 2HL6A 3BIXA 2HU8A 2GBGA 3C70A 1VE6A 2VAXA 4DTCA 3AZQA 5CRIA 4FNMA 3CN7A 3GROA 5EHQA 2XMRA 4HVTA 3IDAA 4QLAA 4UHEA 5FDFA 3M3DA 3M81A 4PSUA 4TVKA 4KR0A 1BROA 2H1IA 3R3ZA 3PFCA 4BTVA 4BP9A 4AO8A 1PJAA 4Y2SA 1P0IA 3U0VA 1XRLA 4N8SA 4AN1A 2ZSIA 3DDUA 1N5MA 4QWWA 3ZLUA 2Z3ZA 5IVHA 1ZD5A 3DD5A 5DTIA 4OD0A 3W9UA 4Y2YA 2WFZA 3KXPA 3WKEA 5AKZA 4MJ3A 4FKBA 2IITA 1HL7A 5LLSA 4AXBA 4GDMA 1WB6A 1LPNA 3N0TA 4C87A 4DNFA 4DSZA 2HRRA 3KWFA 4F60A 4MWTA 4FFVA 2J4FA 2VEOA 4U2DA 1LPMA 1Y37A 1HQDA 2H7CA 1EINA 3SX4A 2CKMA 5HQ3A 1K6EA 1SFRA 3JW8A 1OXMA 4E46A 3CCBA 3X3HA 2BFNA 2OQVA 1PV1A 4H7KA 2BCEA 3ESAA 5AKLA 1M33A 1UFOA 2C5GA 2C4HA 4LKOA 1AQLA 1QIDA 4DIUA 1CRLA 4LYDA 1DT5A 5EI5A 4DNOA 2WILA 1I6WA 5AIBA 4A23A 4E11A 1NU8A 1T4MA 2XQJA 2D5LA 5A71A 3RLIA 4AQDA 4I4CA 1Y7IA 3STXA 5E4TA 4WFJA 4BCBA 1CQWA 5JAOA 1FFAA 1XZFA 4PV7A 4B83A 5AOBA 3I6MA 4RE5A 2OCKA 2V98A 1N5RA 2WUFA 4N5HX 5DNVA 1CUUA 3V9AA 2X5XA 3NGMA 4DYHA 4Y7DA 2ES4A 3I2FA 1IZ8A 4GECA 3V1NA 3WL5A 3D5EA 5CXXA 1UOPA 4UHCA 2H7XA 1LPBB 5FV4A 2H7YA 3ESDA 4X71A 2WQZA 4G8BA 4CG1A 1QIEA 1F0PA 1SCIA 4GWLA 4L3WA 3W2TA 4NS4A 5C81A 3Q0TA 3D4LA 1LBTA 1CUYA 5FPQA 1LZLA
chains in the Genus database with same CATH superfamily
1NRWA 1OHHA 2JCBA 4B0PA 4PIVA 3LY9A 4KH1A 5I9MA 3FTQA 3OJFA 1KE2A 1M74A 4IUBS 1UZUA 3VPBA 4DE5A 2NN3C 3LX5A 2A59A 3EFBA 3FSEA 1SQFA 3OF2A 3B1XA 4I50B 4KQ1A 5KWJA 4CEIB 1IYZA 3HC7A 5IH7A 2DRIA 1U8UA 4MAAA 1XCOA 3FRJA 1IVYA 5LWQA 3RYCA 2WWVD 5DI3B 2IYRA 3SFZA 1A4XA 2F8TA 3RM3A 1TF2A 3I5UA 4LFBB 3LCVB 5DK6A 3WSTA 2ZATA 4TLAA 1W1IA 1Z4LA 1WHSA 3H17A 4FX2A 5CVEA 3UCEA 1JEQA 3RRXA 4AZ3B 1IE3A 3HG7A 3Q6MA 1CY4A 2K5UA 4HL6A 1YIDA 2Q3HA 3V7UA 1TPZA 5TPWA 2O14A 1ORTA 1THZA 2WYVA 1G4AE 5DNDA 3PPWA 1R10A 4BGVA 1FFSA 2XHZA 3UO8B 3R7FA 2V0NA 2XY4A 3B89A 3BGWA 3QLJA 4KIWA 4B35A 3AP2A 5D6OA 2CUKA 4R8KA 3QF4B 3E82A 5AESA 5SYAA 3K71B 5AJYA 4RC9A 1JHDA 2FEWB 2CC2A 5I7WA 3M8KA 4RO0A 3KEMA 4RSHA 4ITUA 1IZ9A 2W11A 4KNYA 4CIAA 5DNEA 2VYCA 3C7CB 2PT7A 2JLVA 1TM2A 1OZGA 3HDTA 4GBMA 5BMVA 2EZ4A 4EHLA 1VRWA 2WLTA 4RQAA 5KJ6A 3PEFA 2QTLA 2WMYA 2OG1A 4ZPJA 3T9CA 4DY4A 1KO4A 3PJEA 4JB3A 4QBHA 3GGSA 3JD1A 2DQ4A 4K87A 4MPDA 5FUWA 1QNFA 3PVSA 1M2VB 1PFWA 2ECKA 1YWGO 2EFEB 2JLRA 2ZRIA 3OCJA 1WCIB 2I99A 4MYDA 4XYEA 2NO5A 3JQAA 3OOYA 5F5LA 1BVRA 2ID7A 4CLHA 2O5EA 4XEHA 1UBCA 1HRKA 2RHOA 1V7QA 2ZS8A 3L0IB 3Q1KA 2JVIA 1OIWA 2R60A 2VBIA 3H1PA 3LF2A 4J0CA 4QPNA 4D4JA 3B9RA 2BDTA 3B1ZA 4G3XA 4IQGA 2IYTA 2XBUA 1V25A 1X80B 1QSGA 1UBNA 2FNAA 1M7BA 2P1RA 5LLDA 3CZPA 2H4JA 3Q9LA 1W9HA 4ZMSA 2VJCA 2PL5A 3BJIC 2XKKA 1SUPA 3FSJX 5ES3A 3COSA 2D0OB 3H6HA 3NBQA 3T4PA 1OGJA 3PGKA 1VKNA 3VHRA 3EVZA 3WJ7A 10MHA 5EIHA 4WH0A 1S4MA 1WOMA 4EPWA 1MNQA 4KWIA 4DCJA 4O2AB 4EKGA 1LSUA 1OD6A 4PONA 2NU7B 5E6SA 1UKBA 3VDXA 4ZICA 4WBNB 3MWGA 2ABWA 1UPUA 1USUA 4LXQA 2CUTA 3T7TA 2BE7A 2YWFA 2AVNA 4LQLA 1QV6A 2A2ZA 1CUJA 3R3SA 3EZNA 3EW9A 3HA2A 4OJYA 4WV3A 3SC3A 4PQRA 4MITA 3WNCA 2VATA 1CV2A 1E58A 1FFDA 1T4CA 3CNHA 2Z3VA 3L7BA 1XU7A 4INOA 4K9DA 5HKBA 1NMSA 2X5NA 4DV5B 5JSYA 4NXMB 3I1YA 1UWVA 1JN0A 1A0OA 2Q1YA 2WD7B 3AVQA 4F1JA 3T5PA 4PGFA 1FP7A 2KSQA 4JVSB 4E3ZA 4AJ1A 4O2RA 5CLLA 3OQHA 5HUQA 4LY3A 1B6SA 4TGLA 5KHLB 1TM3E 1KR5A 2OFWA 2OUKA 2YIJA 3NIFB 1GD1O 2YBEA 3MPOA 4ZTUB 4YCJA 1EWRA 4UHHA 3R0IA 2R8YA 4QFBA 3DC2A 2BHTA 1M1YA 1WB9A 2EKZA 2ZSEA 3PBKA 3OEYA 5FL3A 4ALNA 4G4SP 4Q05A 4BNNA 3DOCA 5CYFA 1VYTA 1CRZA 1H4QA 4OBBA 1XQ6A 2G1AA 4BUZA 4AG5A 3LQRA 1B15A 2J67A 3OKAA 3ZU5A 3ISVA 1K6JA 1KJ8A 4FDUA 3UOGA 1STOA 2B8NA 4NZYA 3O8RA 4WZBA 3VOTA 1JALA 2AGVA 1KZ6A 2IUYA 3KELA 2EKBA 1DL5A 1V1MA 1T91A 2Q4RA 2YRXA 3OG9A 4I5DA 4RHFA 2R1UA 3ELYA 5CM2Z 1SG6A 5C8VA 1PNTA 1XZHA 2PGIA 2B5OA 1HQYE 2QQFA 2DR3A 1JIUA 1WPGA 2GXUA 4I5IA 1KEKA 5L3ZA 1HNZB 1T13A 3IPXA 4GXNA 1ZM7A 2H0RA 1Z73A 3RKSA 3C5WP 1MQ8B 3CLVA 3C1TA 4Y9SA 4KVAA 1E62A 1YAJA 1V5IA 5K4GA 4WBNF 4GR5A 4XR4A 5B37A 3Q5GA 4JYMA 3GARA 2JIZA 2BN4A 2QVYX 2WFAA 2PGDA 4YFVA 5HTOA 1SU7A 1YDGA 3G9UA 1Y98A 3P9XA 2DX7A 2DJIA 3X43A 3ZGYA 4DUZB 4PLZA 4FILA 4KUGA 4ER5A 4EI8A 4OPMA 5AD1A 1E0JA 3A7DA 4FUTA 4OH7A 1DSSG 1KKMA 4BKUA 4DJEC 1D07A 1DAHA 1E1LA 4YAUA 5LPNA 1FSSA 1BD3A 2IY8A 2VUHB 4GOMD 4ECEA 2O3UA 1YJ5A 3F47A 4LJYA 4E1VA 2FE4A 3P26A 3HSKA 4ZOAA 2IDMA 3SJCA 1E79D 2PN1A 4KMRA 4ZZ0A 4ED9A 2IU4A 4D8UA 3GRKA 5CB8A 3K2IA 1UK7A 3JAKB 1GAJA 3DNMA 2C96A 2IYEA 2YWJA 3VUEA 3EX7C 2A9RA 4PHGA 1RAAA 4RMNA 4MUHA 4UZFA 4YIHA 4ARCA 5DHRA 2WABA 1MO6A 4BB9A 1PI3A 3OWXA 1P0FA 1ZUWA 4R68A 3Q10A 1RLJA 4EJ0A 2YR0A 4TMFA 3GUVA 5JZMA 1EFLA 1OJLA 1T9GR 3AF5A 4MDFA 2HUPA 1UOQA 4MX8A 2IUTA 3NJRA 4Q6BA 3GFTA 2ZUDA 4Y1RB 5FPYA 5IHPA 5JH7B 3CUKA 4OHMA 1FFHA 1W25A 4HRVA 1V8FA 5J2TB 4RK6A 1N6HA 1CERA 1ACMA 4RELA 1A8HA 1J0XO 2Q62A 1AKMA 4PYIA 4HV4A 4LQCA 1ISHA 2X6RA 4CVNA 2WOOA 3F74A 2RH5A 3PK0A 1UKEA 4RKQA 5CLQA 3JTEA 1AUXA 2CXQA 4JXXA 1EUYA 3H3JA 3OZDA 4N40A 2VXBA 3KHTA 2QGNA 3L6OO 4TYNA 3WJ2A 3R0JA 5AK3A 1NFQA 2JD1A 3GJ7A 1MX1A 4NICA 2BDEA 1W6RA 3R5FA 2HRDA 2XYVA 2PQ2A 1URPA 3FWZA 4KRYA 3VOAA 2Q9BA 4RSMA 1RYYA 5K0BA 2N3ZA 3C39A 5IH3A 1X13A 1WUTA 4HAYA 4BU0A 3FTFA 3IPYA 1A9SA 9LDBA 2VTBA 1CSEE 1HFWA 3LUAA 3EEFA 2HM7A 2VXCA 2PUAA 4YONB 1J0CA 1MDBA 2QTFA 5TVKA 4NPAA 1MH1A 1Y3AA 5EP2A 2ZSHA 1F5NA 4AN4A 4LOLA 4YAEA 2XYQA 1LVGA 2IW1A 3STWA 2IOYA 3LAWA 3W4IA 3ECSA 5K0LA 2OE2A 5J43A 5FFMA 1SH7A 1EP2B 1ZL2A 2O48X 3BMQA 2GN8A 1B3BA 1QO7A 3HP7A 2C7PA 4X41A 4JBYA 1O95D 5IHXA 1GDDA 3J80A 3AF4A 1T36A 5A1JA 1R8YA 5EIEA 4DJAA 4YRDA 1NC1A 4YEDA 2IKQA 2G88A 1Q50A 2PRKA 3LRTA 3EK2A 5BV0A 2ATIA 4MS3A 3KSRA 1KZGB 1L7MA 1U0OC 3WB9A 3HABA 1R6UA 5FBQB 2C77A 3DUWA 2ZIWB 1A4UA 3DDHA 5F2NA 5L40A 2OAQ1 3HFJA 3EA0A 3KYCA 4H7DA 3KYDB 3RI3A 1GN8A 3WWDA 1J8DA 2UUCB 2AD1A 1VCNA 1LNZA 3CNNA 3CKLA 4RZUA 5TQ2A 3N8GA 3PUKA 4PW0A 4B1FA 2F3PA 1HFJA 3AP1A 2NUBA 3CJTA 2VI5A 4IDHA 4KRFA 2YOHA 2AJTA 2W6ID 3HJRA 2X14A 4DPMA 3TOSA 2V45A 3A1EA 1M2OB 2X8WA 4YRTA 3TIXB 3TVYA 4CLXA 3BK7A 3KWJA 4M1SA 2FW8A 4EYSA 5IM4A 2GPJA 3OZFA 4GSYA 1L7XA 5DTRA 3S99A 5DVZA 4DUYB 1Z8NA 3KCNA 4NU5A 2VJMA 4KSYA 1NX6A 1KQNA 1OCEA 1KQ3A 2ZCJA 4BGUA 4LGYA 1RMTA 1TMGE 5C35A 2CLEB 5BSFA 4I2NA 4OUDB 1RMYA 2BKAA 3IQZA 3T7RA 1ZXLA 1RBMA 1VMKA 4YLYA 1KZYC 4AD8A 4LSGA 4WZAA 1S3GA 1E5QA 2GPWA 1TZMA 2BPOA 3RAJA 3K70D 2GETA 3C24A 4ZAFA 4XEUA 1XBTA 2EWVA 1Q92A 2V9PA 2WF7A 4P80A 2KX7A 3G8DA 4LPKA 4DKXA 4FVTA 1QE3A 4UAGA 3OX2A 1MVNA 2E4XA 2WUDA 4U4AA 3TIIA 3U44A 4CT4B 1CRQA 1A7JA 3ZHYA 1WDMA 4MGEA 5D85A 5DHFA 5LQNA 1NI4A 1SQ6A 1W4RA 2Q8NA 1RPZA 1XHLA 3JASB 3RUFA 5GM2A 1EFRA 2DSTA 2ZANA 3CJQA 3V1MA 4RZSA 2QX7A 1ZHHA 3QMPA 2WZCA 3OOWA 1U2TA 3PWKA 4NYJQ 4D80A 2PYZA 4GG1A 4BQPA 1HWYA 3ZLTA 1P0CA 1HNNA 3CF0A 1F6WA 4YDQA 3PEWA 4OQXA 3K6SA 4Q93A 4D9IA 3F8TA 3N0WA 1ABEA 4N5LA 3USES 3IL2A 1PTJC 1T25A 3F3YA 2CBZA 2VT6A 2Y1GA 1WHSB 4KCGA 4LA4A 3VYWA 3OJ0A 4TRNA 5I9TA 4ZAXA 3TDMA 4M0CA 4UDNA 1Y4UA 1KK0A 1UM8A 1CY7A 3IXLA 3ZCUA 4DZRA 5B2EA 3BFJA 3E5RA 1SXPA 2CD7A 2B8WA 1H94A 3K0AA 5TQ0A 4LJ9A 2LZ0A 3D5QA 4DPKA 5HRUA 1Q7GA 2XVXA 1MOZA 4RJIA 5EJIA 1OPXA 3RSZA 5ICGA 1YF3A 2NU9B 1GLNA 2DCUA 4TPKA 1SUIA 2Q5CA 4WNCA 4TLMB 1NOIA 4LNUA 2ZUEA 4KSBA 4N49A 2PRZA 3JATB 3T54A 3KFXA 2OSVA 2HSEA 2VLBA 4KK4A 4MVJP 4YAFA 5B7NA 1MQ9A 2VHVA 4QQNA 2QD4A 1T2DA 4AM8A 3FOCA 3DFMA 3D54D 2E4VA 4TROA 1IUPA 3S7ZA 4NONA 1EDOA 1O97D 2IOQA 2C82A 5FKJA 2UYOA 4F9TA 3OZBA 4PO3X 1XROA 3MJ4A 2QG9A 1T9BA 4MB6A 1X3SA 4ARAA 4CNQA 4YMGA 3LFTA 4CDRA 2W6JD 4GQBA 3DKPA 3GCZA 2GFIA 3WLJA 3PR1A 4TWIA 4GOND 2E5WA 4DR6B 2E6KA 4NNJA 4WECA 3PQ7A 3O8QB 3PR3A 4LX8A 5ENVA 3HVHA 4ZOCA 3VTFA 4D79A 1H2XA 5C5DA 2XQVA 4PPNA 5BSRA 4E08A 4OUDA 1GYQA 5DX1A 4C3VA 2R6AA 4HWPA 3MBOA 4C78A 4EWLA 4PLVA 3VC3A 1VZ2A 3NORA 1Z4KA 4RGYA 1CQJB 4DG9A 3LFHA 4RQUA 4CN8A 1ZVKA 1GL3A 3QW4B 4IXDA 1AGRA 1Q0ZA 4NV1A 1WDLA 2IY7A 5HOEA 3JWJA 4NL4H 1TYAE 4K7JA 1DXQA 3N0VA 1XZLA 2ZAGA 3R0XA 4JBWA 1B8NA 2AXPA 4W5JA 4P0TA 2FOXA 2JAOA 3FLBA 3LVRE 3QLVC 3K09C 3HBNA 3O38A 2EZ8A 1ZIOA 2WF5A 1TQ8A 3GDHA 4RVCA 2E87A 2H2FA 4FEYA 2UXDB 1N5IA 2H2AA 4HBGA 2M6RA 1QG4A 3THWA 4IGAA 5AW4A 3OT4A 1EUQA 4MCIA 2V0CA 2YQZA 2Z83A 1W88B 4KQEA 3TOCA 2HZBA 1OWPA 5FHQA 4IDAA 3JZAA 3NNDA 1UT6A 1WWKA 2W22A 5KAPA 3REQA 2CMDA 1MXFA 2I4NA 2R5WA 2VKQA 3EG5A 2QT0A 3ISTA 3P9PA 2ZFUA 4WD3A 4C20A 3JAMA 4HMPA 3LBYA 1W5AA 2VHEA 1Z0FA 2C95A 1WDKA 4HGYA 3V7WA 2QM3A 3C8MA 4QBIA 3QG1A 1CJMA 1H1TA 1U7UA 4GC5A 3I3SR 3K0KA 2OXTA 1QZZA 4FFLA 5AM5A 4CIBA 4ZJUA 4UUBA 3VZCA 3ZJ4A 2JRLA 1EHYA 2G5GX 1V2HE 3WDLA 2DGDA 4GI2A 5IAOA 1E6EA 4K81B 4LK2A 1J1UA 3OC0A 1TF7A 3WK9A 5J4HA 3OJCA 5ICSA 3A6ZA 2G6BA 3EQ9A 2PKYX 4N6GA 3LL7A 3VU0A 4CM8B 3OHSX 2KW5A 2W2MA 2IP2A 2ODTX 1FUKA 1MBZA 5IF9A 4M0PA 3B7WA 5H68A 4B3XA 1VBMA 1OX6A 3U4IA 5K1ZA 1Q0LA 1PO7A 1T0IA 4ZRNA 1T4CB 4BO3A 1L5RA 1P4AA 3HJCA 3NKLA 1DIBA 3OFKA 1L5YA 3EHDA 4GZ6A 3Q0IA 2D1FA 5TEWA 2NO0A 1BMDA 3M6LA 4DAOA 2Y66A 1SBYA 2HKIA 3AG5A 1C3EA 2G76A 3H0EA 4M8LA 3W5HA 5D84A 5KNBA 2LW7A 2FCAA 5A9SA 4MO2A 3GEDA 2PKEA 2PT9A 1SBCA 2Z57A 3DTTA 3KXIA 4AK9A 4B09A 2HK7A 2JLZA 1FX0B 4Z99A 1A1SA 5HQ3B 1YE5A 1WUKS 4Q39A 4WRRA 1BEUB 3FNGA 5SZJA 3LP6A 5HW0A 1R6XA 3GT4A 5MN5A 4BZWA 3WDMA 2BFWA 1USWA 3SQXA 3A6EA 4NYMR 4KXVA 2QX6A 1U4SA 3KWMA 4JB0A 3G5LA 1KYWA 6NULA 3O2NA 4ZOQI 4HF7A 4MWOA 2EX1A 2WWIA 3EVCA 3HEAA 2G6TA 1Q7TA 3GUZA 2JLQA 3LY7A 4HZIA 4PFQA 3RYTC 1JHPA 3HVUA 4C7JA 5IJ9A 4CEJA 2G63A 3EUFA 3QV1A 3WICA 1GA1A 2WVHA 5BNIA 1K63A 3B2EA 4I9GA 4C9BA 1HK7A 2P3QA 4C4XA 2O19A 2VDLB 2DFVA 2NADA 1QK4A 2V7VA 3DPIA 3A1SA 1QDLB 2WU1A 2PMEA 2WKQA 3BL6A 3LHSA 1UXJA 1GAQA 4E12A 3H5RA 1CUIA 2HQOA 1YH3A 1LPAB 3K0EA 1U0RA 4KFCA 4GZ3A 1FPQA 1YGYA 4B32A 3ZQ4A 1U8TA 3PEVA 1PS0A 3BN3A 4XQCA 5DLYA 2JFNA 1V26A 1ZJ6A 5E0KB 1IMJA 2VH5R 4R0VA 5GJWC 1OXBB 4LIPD 4ZT3A 1T29A 2PQ0A 4NYMQ 3TMKA 1CE8B 1RLTA 2IZ1A 1HH4A 3G8CA 3NC4A 4R2JA 2VP9A 1RAFA 5KX5A 3DOEA 4J91A 3H4TA 5LDDC 3R76A 1HETA 3KLPX 4HDAA 3E9DA 1EP3B 1T2UA 3GH1A 1PSZA 4KAXA 3HCFA 1YTLA 4LJKA 5IT5A 3AETA 3HZRA 2DC1A 3HDJA 1KRXA 2ZYAA 1VHLA 4MRPA 3GEEA 6YASA 3CZRA 4QXOA 4QU9A 1BO6A 3B51X 3C3EA 4Q7EA 4TKUB 2J9FB 1ADGA 2IW3A 1CR1A 2W0SA 3JQDA 4UD6A 2FPKA 3HKEA 3BDIA 2UUAB 3HADA 3GDWA 4DR7B 2OPBA 3H3XA 4M0FA 3UYKA 2CLOB 2PO5A 2WVJA 4ZI7B 4WKPA 1D0VA 4WZBB 4D96A 1QFMA 4XB2A 2WWGA 4PSDA 4YUZA 3B9BA 3AILA 1GFWA 1XU9A 1FRZA 2DPLA 3HL0A 3UAOA 4CEIA 2DERA 4RD4A 1V8OA 3IUQA 3WYDA 3P9IA 3G2NA 3WLNA 4BC0A 4RF5A 3RAEC 1UWLA 3CJRA 4CKEB 4LRUA 2OLJA 5CNJA 2V8OA 1V47A 1A5ZA 3AKEA 3GXBA 3H13A 3JAWA 4Y0AA 1T1RA 4NFYA 3UWSA 5LYJB 3W5DA 3AETB 3PEYA 5KYXB 4M8NE 1SA0B 5EHNA 5KHOC 2FP4B 3AY6A 1CC1S 4HAXA 5JQGF 2HPAA 1CUSA 3IQEA 1G18A 3E0XA 3R5JA 2BBOA 1LY1A 3A1CA 5IBPA 1G1AA 5F3WB 2FN4A 4A82A 1P4RA 3KPUA 3A11A 1E20A 1E6KA 1KQPA 3L1VA 4JA2A 3RLFA 1ODIA 3GL9A 3TJRA 4KPGA 3AR2A 4QFCA 1II8A 1RAIA 1UM9B 3QKSA 1I4WA 5B64A 3EA4A 5BSGA 3IE0A 3NETA 3GVHA 3KTAB 3PIRA 4UNQA 3ADCA 3SNHA 4BLWA 1IQUA 5EP4A 1Q16A 2HA0A 3B6EA 2H2GA 1TQ6A 5I45A 2AUMA 2JASA 3CURA 4EG6A 2LKCA 3HCPA 3PZBA 4FBGA 2EW8A 4MEJA 1V5WA 1AIPA 3JX9A 2O0HA 4L8WB 2X58A 3TE6A 4PY2A 4D3XA 1MT3A 4GKBA 4O5OA 4LNHA 2N0SA 5HMMA 4BNFA 4AJHA 4HDSB 4JYCA 2O8FA 3M5PA 2NACA 3B5IA 3DS8A 5CFQA 4Y6OA 1V41E 4X91A 2SECE 2GPBA 1G60A 4G5OA 4BLTA 1L1EA 3OFJA 2IYFA 5A9RA 1WNFA 3DFZA 4FGZA 4M1YA 2PZFA 4OG2A 4QSHA 4Q3EA 1Z4OA 4DMUB 4FGKA 1F38A 2QMOA 2XUOA 1WB4A 4JLWA 1X7ZB 2VL7A 2Z9BA 3LXRA 1G7TA 3VKWA 1JILA 1DELA 4Q12A 1E60A 1TYZA 1U5CA 5LP1A 3UB3A 1IZ0A 2EL7A 3NEPX 3R5HA 1GPUA 4RPKA 4RA9B 2WFLA 4RF4A 1JWBB 3LECA 1P5JA 2EDAA 1ZOIA 5LB4A 2F8MA 2YC2C 4B3HA 2FUNB 3F1KA 4YV1A 2QVGA 1CEYA 1NG1A 3LC0A 4J8PA 4PQGA 2VSNA 4AG6A 2CFOA 2EBHX 3IPRA 3KS9A 4M1WA 1S2DA 5HBRA 4HNTA 1MKYA 1Y82A 4AO7A 2XCTB 3ZK7A 4IDCA 1T0JB 5FULA 3R7LA 1RAEA 2MSWA 5FWYB 5KVVA 2XYHA 3AF0A 3GXOA 1BJRE 1QWOA 4I4TA 3V4VB 4GFDA 3HJAA 3ZGVA 2ILTA 4Q4LA 4KE8A 2WU3A 2I8CA 4X6XA 3FPEA 4LJAA 1KA9H 1PLLA 3H1BA 4L1KA 5HXAA 3H2GA 1YQUA 4RQBA 4E6PA 1UC9A 1C2YA 4EQZA 3L7JA 3K8OE 4E2WA 1VJ1A 3TLXA 3QX3A 1KC1A 4BTEA 3PYMA 2ZBGA 4OI2A 2CNBA 5HS4A 3O8OB 3IQGX 1RBZA 3QU7A 4JN6B 4Q6WA 1D1SA 5I8ZA 2WK1A 5CA1F 4ZPXA 2HZ7A 3NOVA 3NIBA 3QFSA 1Z4QA 2HREA 5DDIP 3BL8A 4AAYA 4MVJM 4Q1BA 1AJEA 1R5BA 3NJ8A 3PE6A 3RRYA 3VR1A 2IIPA 2P68A 4C2BA 4R2WA 2Q2NA 1WNTA 4DLTA 4UTRA 3V1UA 1T2CA 2BC9A 3AERA 5HIAA 5IYZA 4R2MA 4U9HS 5KOYA 3H5WA 3SQNA 1XTZA 4LPSA 4NZMA 2WF9A 5BNFA 3VKHA 3H4IA 2HMTA 4NENA 5F4ZA 3SSOA 4K28A 1KVSA 4GQIA 5AVVA 4M0LA 5ESDA 3RUPA 3NUZA 2FLKA 1O7JA 3BHMA 2AA3A 2AQHA 5DKFA 3M2PA 3KTDA 3T9AA 1G41A 2VK1A 3LDHA 1W88A 2QIPA 1E6WA 2VHCA 4IO0A 4CTNA 4BO5A 2ZIVB 4IRUB 2WB4A 3DM5A 2XPCA 5G0TA 1ZIDA 2VZLA 5EP3A 1ORHA 1RPJA 4YREA 3T8YA 4Z54A 1K92A 3A6HA 4WASA 1ISPA 4JI3B 4EP1A 5TMEA 3EC1A 3R9WA 3CSUA 4CNBA 1XL1A 2BTQA 2NP6A 3WYEA 4JGBA 2AL7A 4YR9A 4Y30A 1CQJA 1Q6ZA 3HWRA 4GX1A 3LTEA 3RF6A 2ZZNA 1CYDA 1ULSA 4XPIB 1JU3A 4FOPA 4IHAA 1QC5A 1JR3D 1T5OA 3ET5A 1YCDA 4TKZA 4UMFA 3T52A 3WMGA 3PXXA 5G4LA 5E6UB 4ZI2A 2BUBA 2C2WA 2YIMA 2Z43A 4J43A 4LOHA 3ESRA 3JQBA 3WZLA 4DR2B 2ZYDA 3VR3A 1OAOC 3ROXA 3WTBA 5LD2B 1VIVA 4KGVA 1IHUA 4DTIA 3M5DA 3HBMA 3HN7A 3TTWA 4BTLA 1SZCA 2YW2A 5DIZA 1RHKA 3JWPA 3UXHA 3ZYZA 3F0TA 4WGGA 2DUUA 3JQ8A 5H1YA 3IIMA 3N8NA 5JVDB 5BPFA 4K6KA 5SZIA 3EWNA 1R88A 1OBFO 2E2WA 2G0TA 1BOFA 2HLNA 2Y93A 2YHIA 1PD1A 4IVNA 2H8KA 3DGEC 3KFVA 2J3QA 4FS8A 4G81A 4R1LA 4HMQA 2ENWA 4P2BA 1KFCB 4DLUA 5TY0A 2OWEA 1NVUQ 2Q21A 2ZQYA 2ISCA 3OHMA 3MB5A 3NHJA 1XUOA 1AA6A 4Q03A 1U3GA 2A9VA 2JEZA 1QJ4A 4DRZA 2R68A 2J9XB 3CRVA 3IURA 2UZ4A 2F59A 2CVPA 2VDWA 3BTSA 1W1WA 2ZYRA 4BFSA 4BCDA 5GONF 2BGWA 3E2PA 4RJTA 3T3NA 1CIJA 1HZZC 1PR0A 4RIFA 2RGUA 3GNLA 4LNUB 1POXA 3GRPA 4CMHA 1DVRA 4ZGWA 1BDMA 5ADUS 2IPAB 3TF5A 1MN6A 3ID6C 4UEJA 2Q5OA 4PC7A 3IR5A 4IX9A 2QLJA 1TFUA 5HDQA 1T8WA 2DQYA 2PZBA 3I28A 3K6SB 1GPH1 2QSYA 3EVNA 2IHNA 1XJCA 3WAGA 2GYUA 4RA6B 2XUJA 1KO8A 3MT9A 3LIPA 2AC7A 2DVMA 4RGQA 4MK4A 4JKOA 1LLQA 2CFIA 5F21A 5IUJC 3SMVA 2FN3A 1Y63A 1L4YA 4JBNA 1ZEMA 3ZVLA 2TS1A 3W6PA 4PLPA 4LYYA 3KQQA 1XCJA 3LTNC 3H5TA 4P93A 1DX4A 1R9MA 1JG2A 3CMMA 2P9QA 4F3KA 2YNMA 3AU8A 3T3EA 3TR6A 4GH5A 4IV0A 2X0FA 4D6XA 4D9EA 3U6BA 2BMDA 2OUIA 1XTVA 1PSWA 3VYTB 3C5CA 3KTFA 3VVLA 3DFUA 1L7EA 3ZIAA 3QFTA 4JQCA 4R69A 3STVA 5AMXA 2OHHA 3QK7A 3EZXA 3UTCA 2ZEJA 2ZWPA 4MR9B 2RI0A 4UZSA 1A5AB 3GLGA 1T2FA 1O0SA 4JK3A 3ZV5A 4C0JA 1QIMA 3MCAA 4JP8A 4RXTA 4N3BA 4TQAA 5INTA 3OA0A 3RVPA 4C03A 3FYUA 2R62A 3U5ZB 3ABRB 4V0MA 3C14C 3M0EA 4HP8A 1NIJA 2NWQA 4MV9A 4NNOA 3QBDA 3CLHA 2CV2A 4BGIA 4XVRA 2FPPB 3QWBA 1IUKA 3QBJA 3HXOA 2C9ZA 3ND7A 2YFQA 2X9VA 1YZQA 3H19A 3KV1A 1NVDA 2OWDA 1EZ1A 2W2LD 3HN6A 3R3YA 3LT2A 4JNCA 2H7VA 1CVRA 2RB5A 2VN8A 4XCQA 3SXUA 2B3DA 4GBED 3MUFA 5KYKA 1TUGA 3P97A 1QP0A 3N07A 1LDNA 4G5RA 1JJBA 4N5NA 2E18A 4QDXA 2J0UB 3PQ3A 1YONA 4FPXA 4QOSA 1OXSC 1E6CA 2WA1A 3BA6A 2CYBA 4V3BA 2CMFA 5JS2A 2PSFA 4E3WA 3EUEA 2I8AA 1BDJA 3M7IA 1D04A 1X77A 1LNSA 1DKRA 1CW2B 1ZRSA 3NUGA 3A6DA 1TCCA 4YALA 5ALNA 1E0SA 1Q7CA 4H3KB 1HNWB 5FI3A 3E3LA 4UM8B 4EKNB 4BXOB 4JLUA 5TGZA 5JYDA 3RC8A 1DCKA 1L7PA 5CVDA 1VBKA 3WYGA 1JI3A 4B9EA 2QU8A 3GLRA 1F8UA 3U7EB 4A6PA 5K2MA 4AU1A 4DMRA 1QO0A 4YRCA 1AK9A 3FTNA 1BVUA 2VZEA 5I3CA 5KKCA 1DPGA 1E3WB 4EA7A 4UHBA 4BVJA 2QRLA 2VHWA 4ZRMA 3SEZA 4P1ZA 1AS3A 2VJDA 4CODB 3Q5DA 2J0UA 2K4MA 4R1UA 1IWBB 4ABTA 1U7TA 3GUHA 5ECDA 2V5VA 3DHEA 2XOKA 4O4HA 3T3GA 3TYXA 2O5CA 3TKYA 2ERXA 4BKQA 5JDCA 5LFAA 5EIAA 1A2BA 1XZGA 1JDPA 1WOYA 1ZGBA 5DLQC 4FFRA 1NDUA 1QQ6A 4LE1A 5HJ2A 1KOJA 3SXPA 4YV2A 2ZUCA 5JU6A 1QIJA 4Y1RA 3R0ZA 2P6MA 3LKBA 1SOMA 2MYTA 1N0IA 1EPUA 5KCMA 1HDIA 2WA2A 4RPJA 2DU8A 4Z4GA 4LZZA 5DASA 4Q7KA 4GMGA 4AVYA 4J16A 4D3ZA 4J3NA 4KBYA 2I0FA 4LE0A 1ISGA 4JUBA 3ZHSA 3SHVA 1GUZA 5EEGA 3QQPA 3PFFA 2NIPA 4FX5A 2ZW9A 3TZKA 3V1LA 3RADC 4ZVRA 5DTJA 1QU3A 3N53A 4WWHA 2ZPTX 4FZVA 4HQOA 3R7NA 3VSDA 3WOHA 2D0IA 5JRJA 2VPXA 1PVOA 3HB7A 1DWQA 4FR0A 2NTYC 4HQFA 4KSCA 3B13B 5EGSA 7GPBA 4J4TA 2RBKA 1KWGA 4OSEA 1HLDA 1XO1A 4YJFB 4WY8A 1TAGA 3TD2A 2J9ZB 3ASVA 3TVTA 3WRXA 4QUBA 3VHXB 3K05A 4IYJA 4DDVA 3ND6A 2CXRA 5JPDA 3F3SA 3QUAA 1FQOA 1QCCA 3P0RA 3PJDA 3QUTA 1CT9A 2EP8A 1MABB 1T8UA 1PZHA 3FLAA 3OVMA 1A9XB 1LSOA 3BYZA 3HFGA 4H27A 1CY1A 1LRJA 2BGLA 2ZSDA 3IP6A 4D2IA 2YWDA 3ILVA 5KDLA 2G9UA 1E9RA 2GA8A 1AS2A 3D0OA 1J56A 2OT3B 2YVUA 4KGXA 4P3KA 7MHTA 3P0JA 5THKA 4XYLA 2ZWMA 4X60A 5HVNA 3EB9A 5AW8A 3GGGA 3KOWA 5G0SA 1BS9A 2XNHA 4O4JB 4G0QA 4ENTA 4FGWA 1DIAA 1I7PA 3HDYA 3FPBA 3R20A 4IRMA 4ZAYA 4WLVA 2P2ZA 2VOJA 3W7VA 1FFYA 1M73E 3N39C 4HS9A 1GR1A 1XDBA 2ZE6A 4URYR 4F38A 3BD6A 2VWPA 1WIWA 1ZK2A 1VI2A 4FNAA 5D8DA 2HU2A 1MB4A 1Z17A 3OSUA 3QFRA 4LFCB 4ALLA 1NDQA 3EAFA 4XGKA 2H31A 3TRHA 3BK2A 1N8TA 4QOGA 3P0HA 5LYJA 3WS7A 1XEWX 3IVCA 5J5AA 1ULZA 1RS0A 4GRAA 2JFHA 4QJ5A 2P9HA 4WNYA 2HXSA 1G64A 4DC9A 3ZJUA 1H3EA 4PINA 2C5BA 1EHIA 2POQX 2C1ZA 4RL4A 4BFVA 3QEMA 2ZCVA 2VF8A 3GT7A 1XRMA 2NVBA 4BLRA 4Q7MB 5ILGA 4M2LA 3BMNB 1OLUA 3E2MA 3EXAA 1IBMB 5JVDA 3TKLA 2J33A 4RE6A 2RHMA 4O63O 4IXNA 3IPCA 1F6BA 3UJNA 2ZE7A 3MM4A 1BS1A 2EEPA 3OT1B 2A9JA 4FYPA 4G09A 5KB3A 4NDNE 1GSOA 2JIQA 2GT1A 2N1BA 3G8AA 4N7JA 1JQAA 3RSOA 1JYSA 4FW8A 4B6FA 4BX9A 1JXMA 1FXWA 4D4MA 3AUSA 4R1MA 1II0A 3LPCA 4KVZA 5E9JA 1U3DA 3ZG6A 3AVYA 1P7PA 1YBAA 2QEQA 4YQZA 2DHCA 3FW1A 1GTZA 1SC4A 2FWPA 2QTTA 3ETHA 5A9TA 4YRPA 1E7WA 1DJLA 2HV9A 4P58A 2A0FA 4EPVA 2NO4A 3I6BA 1U6IA 2ACEA 4ITVA 2H65A 4PS1A 4YIKA 4BFUA 6GPBA 3HRHA 3GY0A 3PA6A 5JSQA 3KJHA 2DT8A 1K97A 4M0UA 1CUEA 3CUUA 4CCWA 5F1YA 4ENQA 3S2GA 3IQDB 3O84A 1FVOA 1JSRA 4KUEA 1QFSA 4D44A 4EATA 1CUZA 1EU1A 3ABZA 3JVVA 1J8MF 3FOBA 3EIOA 3O47A 2G8NA 4C4PA 4M1MA 1R2QA 1PNQA 3L0BA 3AVXA 4NU6A 3F5MA 4IHQA 5EMKA 3HA7A 4X1OA 3ZCVA 5CG1A 2IE0A 1LBEA 4L7QA 1NUAA 3BSFA 4YRKA 1GTMA 1KKUA 1T1IA 4RLQA 2TMGA 3K9CA 4EZEA 4K8RB 1SHZA 3A1NA 3GC6A 3K31A 4FYKA 2AOVA 4RM2A 1T34A 4Q3NA 2QTGA 2BTOA 1H8HA 2QXTA 5FWNA 2YXBA 2AYXA 5JNVA 1G6OA 2W8BB 1PLKA 3CF6R 4J7CA 1OYYA 1XAHA 3HDHA 2I55A 3GNTA 1YI0A 2RCNA 4AG3A 1O1YA 2JHCA 3DT8A 4P84A 4NBVA 3DLBA 2SCUB 2VF2A 2QE7D 4K5QA 5CH3A 2HQ1A 2W2KB 4RY2A 2FZ4A 2C4WA 3ANLA 3H8WA 3Q3VA 1WXFA 4Z2YA 4IG9A 3G89A 3WHIA 4ZTBA 4F45A 5AKXA 4RY9A 4N0EA 1WCV1 2YZGA 2YUIA 3HUEA 3CCFA 3NYWA 4EUSA 2OXRA 2XGJA 3IIJA 4KW7A 2DKOA 2C4NA 3IO3A 1UWKA 2AZ4A 3EVAA 1F8YA 1F0KA 3NS7A 1OXKB 3NKVA 2P9JA 1SUFA 4DIKA 2Q49A 3A4MA 3O93A 1EDBA 1B14A 1E3QA 2H92A 2CK3A 1T8YA 3KPVA 1A04A 2XITA 1MVLA 4Q9NA 4B5KA 1NATA 5IDQA 4OGWA 4RYDA 3B1FA 2P7IA 4IXMA 1E1MA 2ECQA 3BKWA 4J2OA 5IS2A 3VNSA 4JLNA 4LTNA 1GGJA 1VC2A 4H1UA 4DJ5X 4ICIA 2NOAA 1EFDN 4CMGA 1YCHA 3LQFA 1BMQA 1RTTA 3C6XA 3H1AA 1E9SA 2B35A 4TLEA 5KS2A 3OU2A 2QPLA 1KIAA 3R5XA 1XEWY 1W85A 2J07A 2QV0A 2ZAMA 2UV8A 3HKBA 4HX5A 4S1VA 5LBUA 2WTAA 3VZQA 4P2GA 5EVCA 1DINA 4I3GA 4QYSA 3RB8A 5BR1A 3FTCA 2YWGA 4HEA6 2XWSA 2W90A 2PV7A 2JCYA 3F1LA 5A2GA 2G7MC 5F1OA 3ZZ0A 3H2ZA 3E8MA 2QT1A 3GLIE 3K30A 2PGXA 2IYWA 3AI2A 5C31A 1FVXA 4ER0A 2QNIA 3C2QA 1G0OA 3JQGA 4J1TC 1D4OA 1XQVA 3HYRA 2AH5A 4P3OA 1H8EA 2ZTMA 2QK4A 3CX8A 5TF4A 2V59A 1Z16A 1S5PA 3F98A 3RIXA 4XVHA 2QQGA 2YJZA 3R3JA 2WHXA 3FUVA 4JAVC 3VV2A 5L3QA 4S1PA 5ALPA 1HE8B 2MDTA 5ALKA 4URFA 2RB4A 3TLKA 4CFSA 4EI2A 5LZ2A 1BE8A 4OEHA 3ZI0A 3E61A 4YVFA 3H84A 2WAOA 3F3MA 3U26A 2FOLA 1TJ4A 3HVKA 1E4YA 4KZPA 3KB2A 4ZCSA 2PH1A 2IODA 3PXEA 1ZIYA 1NW3A 3KVNA 4UOQA 1N5KA 3PQ8A 4NCHA 3EIXA 3GJQA 3WGQA 1IOVA 5DCLA 4E5SA 2H9YA 4KTTE 1ZGAA 2ODAA 3ZKWB 3VVCA 4CV3A 3LMKA 1HLPA 5KTYA 1DAIA 1FFBA 1H6AA 4DSAA 1IN1A 3I0MA 4FTWA 5EJ5A 1RM4A 4PO8A 5HQTA 2O2YA 4B3CA 1YOBA 2G9QA 2HWWA 4URUR 3EFOB 4YH1A 2WKRA 3WB2A 3CR8A 4FB4A 1QOQB 2XWJI 1R4NB 1LCIA 2JEYA 4BO9A 1QBGA 2H4FA 3U1VA 2DF8A 2Z2JA 3HSYA 2B69A 4I8IA 2M6SA 5DNCA 1YRHA 2RJ3A 2F1IA 2JC3A 4K1LA 3VXKA 1W35A 2OBXA 4KKXB 2L0XA 3DVSX 4G97A 4RK7A 2C84A 3AFHA 1WF3A 2ZIEA 3N7AA 1D6JA 3Q8XB 4RK4A 5FWAA 3PGVA 5F73A 2Q6LA 3CPEA 1C9JA 3F9CA 3IT2A 1EFPB 4UCFA 3WYFA 4UPDA 5EJMA 4HDNA 5IAGA 2D8AA 4TS3A 4N7MA 3WYNA 1YDMA 4M8IA 3GCWA 3IQXA 5LP6B 1A9QA 1J24A 3H4VA 5CFZA 2FA9A 4RV9A 1EB8A 1PYDA 2DKNA 3TL6A 3VISA 2VZ0A 4W7HA 4B3DA 2RGEA 1OU4A 4YJ3F 3FPHA 3KRTA 1AS0A 2OENG 5TDHA 3QXGA 2LCQA 2C2XA 1A7UA 3R74A 4R8VA 3EH2A 3LVQE 2OHFA 2JI8A 2TMKA 4U7JA 3VNAA 1GJRA 3G8BA 1KVRA 3HKDA 5E3HA 3WL7A 4KLAA 4FM9A 1WBDA 1L8LA 1KU6A 1Z6GA 2JK0A 1QP4A 5BV1A 5CIYA 4NXNB 3SX2A 1MTZA 1WXHA 4URVR 1HXHA 4H6WA 3Q41A 3FZYA 1UAAA 1M67A 2ZVDA 5BY2A 4YECA 2Q1UA 3X1MA 4TYMA 2Q5IA 3MJVA 4BB6A 1Q3TA 4KX3A 1MHTA 3F7NA 4G2NA 2C9CA 2CBGA 2RGNA 3DP7A 4LVCA 1HNXB 4Z4QA 1TVMA 5I9SA 2I3GA 1TNDA 2Q9AA 4E1AA 3AF6A 3S2EA 1I13A 5K5EA 1K75A 2PX3A 3U4CA 1WY5A 1E96A 2VYVD 5CMLA 5FBLB 3WK7A 5K8JB 2QTWB 4NZZA 5JZBA 2QRGA 2ARKA 2VHZA 2QG6A 3FKSA 2HK9A 2KI5A 1S2MA 2BZSA 3M89A 4MVJH 4QE3A 5K3CA 3PFBA 2JJ2A 1C9KA 4PQFA 3TINA 5IWCA 3Q8LA 1Z68A 3EZ9A 1H2ZA 3SQOA 4YYEA 4FC6A 3LKZA 2W8BA 2YQ4A 3LW7A 1M34E 1Z6QA 4ZT4A 4QL3A 2O8NA 1KI4A 2JG3A 1P29A 1AV7A 4NFLA 4BBZA 4D9KA 1KDVA 4YAWA 1QV7A 2YHSA 4FGLA 1KHHA 3GVXA 1G7SA 1ADYA 1GRVA 1XG5A 1BXGA 1UOOA 3CRW1 3HZZA 1DB3A 2OAEA 3ROPA 2G28A 3KE8A 4M87A 3ZNNA 3D9QX 4J1SA 4XH9B 4EJFA 2IU3A 4H6VA 3G7UA 3JV7A 1GSAA 3MCUA 1Y6RA 1MZVA 5F77A 3E35A 4HWTA 3QFHA 3SG0A 4CL3A 4YYZA 1EUDB 1FLNA 4FFPA 1VHDA 3PEEA 3E18A 1G21B 2R8XA 3GFFA 3P5SA 1OXVA 1O08A 2EJCA 1VJ0A 3QOFA 3D59A 2VPWA 3M5CA 1N4DA 2Q7DA 1WZEA 2E82A 3MJEA 4HWSA 1ZL0A 4WK6A 3QV2A 1PU2A 3ZWNA 4C4TA 2J9YB 3OM0A 3LQYA 3HCDA 4AC9A 2A9FA 1NF2A 2HFJA 2WP8J 1AKWA 3DV2A 4UEQA 1HT2E 4OHRA 4WKOA 1E3DA 1JJAA 5L7WA 2BFCB 1SIWA 5F98A 2PR2A 3LOUA 4YRLA 4BE9A 5T41A 3FWNA 3MUEA 3HB9A 2KBEA 1SVUA 4W6ZA 2D3WA 3EBPA 4BX8A 4TWRA 4KXQA 4Q9IA 3TRFA 1X87A 1PE0A 2O7QA 4XVUA 1RWQA 3G9ZA 5ENZA 2HSDA 2WYUA 2BGTA 4UBLA 4A7PA 4JJFA 4FEAA 3V1YA 5H80A 4D8XA 2RKBA 4FNGA 5DTMA 1WV1A 2GZDA 4WMLA 2RGRA 1GUFA 1E8DA 3JZDA 3DQPA 4CLEA 3EF1A 1O5OA 1XCPA 2G80A 2EKLA 1HOXA 1PZXA 5JG7A 5HZHA 2FPXA 5JSKA 3L8YA 1NWCA 4UUNA 1GAWA 3HLKA 5HF8A 3P0EA 4OVKA 5KQPA 3QELB 4A27A 3DW1X 1WA5A 1DMRA 3LPMA 4HO1X 4LAFA 1FFXB 5SY4A 3RSFA 5FV7A 1F3LA 4D4IA 2B9VA 3ZGOA 4JKYA 2BJHA 3HWWA 5ESWA 4ZCMA 3BXPA 1CUBA 3JD3A 2QTHA 4HNHA 1EQAA 3UBTA 1BTOA 4P6VF 4II3A 2LIPA 1YI8A 3LGXA 1ZNZA 4YA6A 4OQ4A 4DRXB 4GKAA 5K8TA 3AY0A 1JHOA 3R40A 3THWB 4ND2A 2E6UX 4M3NA 5EXDA 3DMTC 4DUGA 1XZIA 1G5QA 2CXOA 1OWMA 1UDAA 4TKVA 3NUQA 5EXPA 1I80A 4O2LA 4Q3DA 3SSMA 4EF4A 5LXTA 5DGTA 4EUKA 4AKEA 1KERA 3JQFA 3BT7A 3MNFA 1TC1A 2EG9A 1DCTA 2X0KA 2YJ6A 2XX3A 4OQQA 5A5EA 3RAFC 4JCCA 3ONDA 2SKDA 5EQDA 2CFTA 1IEVA 1ZITA 2C58A 4L16A 3MMXA 1OX4A 2OGUA 5AHOA 4H0FA 2JW5A 2EGHA 4KK3A 4A26A 3WK5A 2HCJB 3O4VA 3SC2A 3IBFA 3OPXA 3FB4A 1VPVA 2GCOB 2EBWA 4IGIA 4KQXA 4QEZA 4WNAB 3VYUB 3A2KA 5DBFA 4DS3A 4LV5B 2I1LA 1GY8A 1AD2A 5FBZA 3HCCA 1OE0A 1XD2A 3BEOA 5E3JA 3GEIA 2ETXA 1U9CA 3GX1A 2RHTA 3HR7A 3O90A 4I3FA 1SD2A 3CINA 2ACKA 3Q9SA 5C5IA 1TJNA 1AZLA 2JBHA 3HXPA 3VPXA 4WZAB 1ZICA 5CIWA 5DRTA 3OLVA 2EJUA 5UKDA 3Q88A 1R6VA 2AF3C 5JCOA 4AKSA 4HI0E 2RAUA 4OXYA 2QYSA 2M2IA 1DS6A 3D8UA 3PT9A 5AI8A 3JRXA 4RY8A 3RWMB 3IE2A 3FB1A 3Q0EA 2O57A 3ILSA 2P3LA 4X7RA 3STTA 1JMKC 3I52A 4G5FA 3MQFA 3C8DA 1JIKA 1KEUA 1VPTA 2P2YA 1P0PA 3S2UA 3ULKA 1MFPA 2W70A 1VOTA 3M3PA 3AX6A 4KLZA 3TXYA 2AW5A 2NU9A 2WOJA 5AW3A 1J2YA 1HDZA 3II6X 4MVJE 2IZ7A 721PA 1HE3A 3F67A 4TTPA 4V24A 1ONSA 2GJ9A 1TD1A 3TSOA 2X4IA 1NJ1A 2JFWA 3G0DA 4EHIA 3H75A 3JWGA 3TOVA 5AHRA 4OA5A 4EFNA 3NBAA 2W48A 1JIIA 3DQQA 1AKEA 2JIMA 2PUTA 3D7NA 3EY9A 4QRDA 2QTVB 3CRZA 4F6LA 2E3JA 1TQ2A 3KQMA 3WRXC 1GDTA 3MJSA 5IAAA 3B3GA 2BBSA 2XKBA 3AU9A 4RYLA 5FX2A 4DEVA 3O8CA 4C1NA 2PH7A 2BHNA 5KC8A 4W1QA 3AR4A 4DNPA 2XCLA 4BMPB 1XP8A 3I6IA 3C6MA 4HH0A 1BXRA 1H93A 3ZXIA 1T5HX 2OGSA 5B36A 2ERCA 5JSHA 4JSTA 3OFVA 1GZHB 4PIMA 1YA6A 2JFXA 3QU5A 4EGAA 3U44B 1JDVA 1L5QA 1TKBA 4ME6A 4NYIR 4XFJA 1E1NA 4GZ5A 5T4HA 4G4SO 3OZSA 4EW6A 2G4CA 2J0QA 2HXGA 2WNSA 2VTVA 2BRUC 3ZE8A 3T0FA 5KNCD 4ZEWA 2AQIA 3MIZA 1APBA 2F8SA 3GEHA 3HVRA 4B84A 2HMUA 2OV4A 1I36A 2FRXA 1DBVO 1N5LA 1TRHA 2HJSA 1NV8A 4IR7A 4DBVO 5BXYA 4CMCA 4D8VA 3SWWA 5H3HA 3L9XA 5HWSA 5BWCA 1DHTA 4QYXA 4DV7B 3EFEA 1HTTA 4F2DA 4IZOA 3VKFA 1C7EA 5TQVA 1G5TA 1IPFA 2VDKB 1Q44A 3PC7A 1EB9A 1WZNA 1W4CA 3BZUA 4ILEA 3TEMA 1AUOA 5K0EA 4DA6A 1IXYA 1O94D 3UAWA 4LVOA 3L7CA 4JHXA 1D1QA 1KMHB 5KYVA 4QHSA 4F5DA 1JQLB 2F3RA 2F1HA 3D1VA 2B94A 1KF0A 5CA0B 4G0ZA 4XWOA 4NCIA 2J6HA 3W8FA 1JV2B 4TLLB 3HQ4O 4ZWNA 3IKLA 3DTVA 4C08A 3BERA 3AB3A 1VKHA 4PXSA 4QXMA 4M7PA 1U11A 3CA8A 5IJ0B 3MA0A 2QP9X 1H2HA 3I37X 1UEIA 5JNWA 3PSAA 3RQSA 3L7NA 4B74A 3OZEA 1PHPA 1CZOA 4M36A 4KYTA 3IEUA 5K8IA 2AYYA 4UFNA 2Q3CA 1J06A 1M6HA 2WSSA 1DG9A 2IXGA 4RPCA 5DI9A 4DAEA 3DZKA 2JGLA 3P2OA 1XDGA 3QNUA 1E2IA 1W4LA 4KN5A 4XIIA 4EY3A 3DE7X 4Y2TA 4WINA 4E2YA 4PYLA 1U7WA 4QPPA 1KJZA 3IDFA 4GNKA 2I6TA 4C7VA 3O2JA 4W9MC 1J8YF 1IG0A 2B92A 4M0KA 3LX8A 5I7RA 3CXRA 3HDGA 2UAGA 3RK0A 2RIPA 2G5TA 3HJNA 3KSUA 4EQ6B 4JOCA 4WZAE 1C4KA 3IOCA 2NW6A 1P0MA 2HMYB 2X0IA 3V8RA 4I50F 4Q1FA 4TL7A 4B7ZA 5J4LA 2W2TA 4P4NA 1FNDA 4EG4A 5JFTA 3HYLA 4E5YA 2PA3A 4EG1A 5IK2A 1O0BA 3ZU4A 4ZVVA 4EY4A 4I1OA 3ZWYA 1CY8A 4IDPA 1J2JA 1KC3A 1AQJA 2EWWA 2FZEA 4QTXA 2DFNA 3CBGA 2W6NA 2O5RA 5AK5A 1BH6A 4BVHA 3VPHA 3FCEA 4B3TB 1U7XA 3BRWA 2WJ3A 4JZKA 1ILWA 3VI3B 3O4GA 1TTHA 1YQDA 3R7SA 1E7SA 1PT7A 4J76A 3UH0A 4BKMA 2OGZA 3V80A 1P9NA 4CJXA 2P77A 3EAGA 3PXGA 1WUYA 2VNIA 3PFIA 1N0UA 1S8NA 3IAM1 3EXG1 3MZ0A 3S44A 4I5EA 3WGYA 2UXCB 1MC4A 3CN9A 1DC4A 1FBNA 5J1TB 2V0GA 5G4KB 3M4YA 2OG2A 5AOAA 3OURA 1ZZEA 3CX7A 1ACLA 1QGUA 3H1EA 2BEWA 3UTDA 4G84A 1HEUA 4D3DA 2H9IA 2J5RA 4EIWA 1D7OA 2WJGA 1OWLA 3WLMA 5JS8A 3WB1A 4DGQA 1HBJA 1BZYA 3HYNA 4OKIA 2PUWA 2ZI3A 1IZYA 2P8SA 2IBTA 1NV9A 1WRBA 3KJEA 3L6BA 3O3CA 4RQTA 4Y2GA 2OCBA 3P20A 2X3YA 2OCLA 1P1JA 1A9XA 3KZXA 5JRZA 2CB9A 3RC1A 1AB5A 1XNJA 1JE1A 2H29A 2ZYTX 4JXJA 2PLRA 3T3IA 3CUEF 3F6EX 4B9AA 4K9KA 2ZM5A 3OZGA 4UVIA 1EK6A 3BF8A 2Q4TA 1HDCA 3FLEA 2MIIA 2HNKA 4FZRA 1UMKA 2Z2XA 4UBMA 3VKVA 2JLYA 2AJDA 1VSTA 4GR4A 1B74A 2YWBA 4QIHA 3VZRA 3ZWQA 2CNWA 1J09A 1GEGA 4AF6A 1CUVA 1W49A 1RRCA 3ONNA 4CRWB 2MINA 2R1VA 2ZULA 4Q47A 1JFRA 1GUDA 1VE3A 1XRSB 4JP2A 4EB0A 4TZ6A 4I1VA 2GAOA 4ZI7F 4HCJA 1FU7A 4B5LA 4JI2B 3BQMB 3O5AA 4KYUA 4C5CA 1H9CA 1JEYB 5E1MA 1NMEA 4FGJA 1JLSA 2E89A 3RS9A 3OPQA 3A05A 1Y3FE 4OQDA 4REQB 2DWCA 9ABPA 3T7DA 4EF5A 4TWAA 2IPLA 1UDBA 1VP9A 3AG6A 3CR7A 5FBWB 2NO1A 1U3TA 3VR2D 3L8ZA 4N9QA 2XZDA 2PJRA 3B1YA 4HZUA 5JR3A 3FDFA 1Y1KE 3H9EO 2WJAA 1EX9A 1FFXA 4TTTS 5BV7A 4BMZA 3H5IA 1G4UR 1ADJA 2FX2A 3GAMA 5AJHA 4NZPA 1ZA1A 3Q7PA 2EC5A 3JY6A 1B0AA 2FW0A 3E3AA 4CG0A 1NTOA 4B75A 1TU0A 5CDGA 2YTZA 5CB4F 4U7HA 3PA8A 5EIBC 4X00A 4XKJA 2PZGA 4INZA 1UKCA 1U63A 1DKNA 1WXWA 3KR2A 4WZ6A 2VP0A 5A3JA 2ZAIA 4MVJI 4DM4A 4B6QA 4MGIR 1ISJA 1SURA 4IDNA 2ZWOA 4H60A 4QPJC 3BZWA 4GYJA 1EWKA 1FSGA 5F3RA 1BU5A 4MQ4A 4N82A 2WIBA 3SEFA 3AY3A 4Q4AB 4M8SA 2ZIGA 1IEQA 2H1CA 1R8QA 3S2IA 2DHRA 3UGTA 4EY7A 1U9IA 3B12A 2OBYA 1Q3KA 1O3YA 1C14A 2E7ZA 3ORYA 5BR7A 4E2XA 5C8XA 2PO7A 1RVV1 2C00A 3L49A 4I1SA 1RCFA 2GWRA 1PGPA 4IEFB 1U3WA 2WWXA 3WGJA 4BHTA 3UK7A 5ABPA 2FRDA 3K9QO 1KYXA 3KC2A 2RAVA 4TV8F 4W5TA 2ZUSA 2GK4A 4LCJA 3HU3A 3UYLA 5BSHA 5EJ9A 1JS1X 5FLXA 4QPDA 3ELUA 3F4LA 1U0HC 2C3PA 3UT6A 4BAUA 4DLVA 5BN3A 1EXVA 2QBYA 3ST7A 1E4EB 3R6TA 4M8KA 1W5EA 5KTMA 2ZTVA 2GBIA 4HQRA 1JEDA 5L7YA 4X7MA 3U2QA 5IC6A 5CNKA 2WTUA 4WDRA 3WQQA 1WULS 4O5AA 4U7GA 4OYRA 4CFYA 2IYVA 1PQ4A 2J09A 1O94A 1KAEA 2F67A 4U7DA 4JR1A 4D9BA 3VC7A 3DEYX 3EZFA 4F9EA 1XKQA 4MQEB 2L18A 3KQVA 3MS7A 4B73A 1LPPA 1EXDA 3BULA 3ESXA 3G2HA 2J85A 1KZ1A 5G0WA 2PZJA 2HPZA 4HDKB 2O06A 3N7UA 4O4JF 4EYQA 4XTCS 3SN6A 2I2AA 2O3JA 3N6XA 1XD2B 2X9LA 2I3ZA 2GRJA 5KWEA 3EBLA 1BMFD 1JG6A 1ATIA 3RDPA 4FT4A 3ANYB 3AF3A 3M33A 5LQSA 2OXEA 2FSHA 3MIIA 2O20A 3M4JA 4JROA 4DQDA 1CY2A 1NBME 5B5SA 1IL0A 3VGJA 1OSNA 1JU4A 4QDTA 4WX2B 4QUEA 3NYRA 4ID9A 4ISBA 4MMZB 5E7JA 2VZ8A 3HEBA 4LI0A 3TKAA 5GMOA 4GOKA 5TV2A 1VDZA 4G0OA 1S4QA 2D6FA 1W44A 3PVCA 1M5RA 3L7DA 5LQCA 3T1YB 4TXLA 2ZRAA 2R6GA 4KWHA 1Y8CA 2Z9DA 2Z98A 4D45A 1X1BA 1YQTA 3O1JC 4TLCA 3BIXA 4PHHA 3SZOA 3PPXA 4C7OB 1F51E 1G8YA 3ICOA 4HNAA 1N9GA 1TZCA 1VE6A 1G63A 2E85A 3ZH9B 4MICA 2A9OA 3V2UA 1JJVA 1PX0A 1IHYA 1VI6A 2VZ9A 4DARA 3L40A 4WK2B 5LXTF 4DTCA 5AVZA 2P4HX 3DVLA 1T3LA 1B1AA 1D6MA 3AZQA 4FUQA 4W9NA 1EFCA 2XWPA 1IDN1 5CRIA 4WLEA 1GQOA 3GAFA 2WYOA 3GROA 2PGJA 2PWAA 1RE0A 3KOXA 3P1JA 1ZM2A 4DRXA 1EFKA 2YWHA 3Q8KA 2W2KA 3T3OA 4FMCB 4WQMA 2D2XA 4QLAA 5I51A 3ETLA 4IHJB 5LP6A 1S2OA 4B7CA 3WGIA 4KR3A 3M81A 4G5SA 4P3PA 5TRTA 4TVKA 2WPDD 5BYJA 1EJ0A 3UB4A 3VR5A 4XZ3A 1ECGA 3ML1A 2BEVA 1BROA 4NENB 4NMLA 2CJWA 1MFZA 4XYGA 3RYHB 3KLMX 2AHRA 3BA1A 4MROA 1E6MA 4YCLA 1MAUA 1I0IA 4BV3A 4D8TA 4RVOA 1BMTA 2V54A 3CUVA 2D7CA 4CLOA 2CCJA 3L06A 3PHGA 1EZZA 2ZRFA 1XCGB 2HJVA 4BVBA 1JSXA 3U0VA 4H1WA 4GPAA 1DI0A 4N8SA 4AN1A 2HSZA 2BFCA 3CMCO 3G2MA 1I1QB 3DDUA 3FZNA 4MLPA 3RSGA 3X1ZA 1P4GA 3ICPA 2Q4DA 2B7LA 1KJWA 2G07A 1V4VA 3DEJA 4QFMA 3S2SA 4U6NA 2C4UA 3EGXA 3WFZA 4MMXB 3MAGA 5IVHA 4GKKB 3EDMA 4LF8B 2G06A 2PMCA 4WZBE 5DTIA 3R8CA 5BN4A 4RLFA 2XNSA 4M49A 2OHOA 2ZIFA 5LQUA 3GDGA 1E2DA 3AHJA 4FKBA 4MJ3A 1FU4A 1Q19A 1T9KA 4MAFA 4P33A 1HL7A 1RWXA 4HNSA 5LLSA 4CXMA 3GG2A 3NHWA 1LPNA 2OBFA 3EVTA 1P19A 3OF5A 2ZCUA 5EERA 4C87A 1YDHA 4A8JA 2HRRA 1RQRA 2RHJA 3N0RA 1OF1A 3K9NA 3UUWA 5I7EA 3PJRA 5EYPB 1IZZA 1ZUNB 4JP1A 1GTSA 3VC2A 5COBA 3AESB 4R1TA 1DKUA 5PGMA 2PH3A 4B4VA 2AD5A 1PWZA 1XT6A 1Y4ZA 2OBNA 3FM9A 3U0BA 4BBPA 4FFVA 4NCNA 3TIVA 2VEOA 4U2DA 4IHJF 4KODA 1ZJWA 5C3MA 1N5DA 5DHUA 1DAFA 1KSGA 4AS1A 3GP3A 3JQGB 4G65A 4FWIB 3BUSA 1M76A 3DMYA 5TMDA 3T7JA 4OM8A 3QVGA 1BXGB 2H7CA 3FIUA 1P81A 4JU9A 1GU1A 2ZIXA 4ND3A 1EEXB 1PGNA 1NF8A 2HMVA 4DV1B 4KKVA 1E77A 5HQ3A 2RK3A 4ZAVA 4CM6A 3JYQA 3PTLA 3EYWA 5E3IA 1P45A 1I2AA 3JW8A 1OXMA 4QXQA 1POWA 3I92A 3K0AB 2WYWA 3L82B 5FPHA 1E1DA 4F5YA 4EJSA 3U3OA 3T9BA 1Z34A 1CLUA 2VLIA 3HV2A 5A3VA 2C3YA 4QTUB 5JJIA 2FMHA 4MDEA 3A9VA 3M4ZA 1YQGA 4MW9A 2XJ9A 3TZBA 1UFOA 2C5GA 2E0IA 1JXOA 2QGZA 4LKOA 4ZCQA 1AQLA 1QIDA 3IHLA 2H08A 3DZ8A 3RFCA 4CUZA 4DIUA 2G77B 5B58C 1T0PA 5FWXA 1IATA 1LF0A 2BJWA 2QNBA 4L5AA 5J1SB 4DF3A 5EI5A 3NMUF 1SXJA 1L8OA 3FJOA 2NV6A 3FYSA 4CFZA 1JH8A 4M22A 1UPXA 1MIOB 3ZUPA 3T5AA 4CT5A 1JLMA 3QWAA 1HG1A 2JA1A 3AEZA 4FN5A 4G37A 4MB2A 3CLUC 2OCPA 4XB6B 2Z30A 3PXUA 5T3YA 4RH3A 3ZBTA 4U6QA 4A23A 1HGXA 1LDMA 1ENOA 1NU8A 1B1CA 1T4MA 2FWIA 2CNNA 5A71A 4YT4A 3RVDA 4FQ7A 5JAMA 3QPVA 5JLAA 2V7GA 4AQDA 2E49A 1MO4A 3N9IA 3RASA 2P9BA 3OLCX 4I4CA 1BIFA 1Y7IA 2ZPAA 4I1PA 4PZAA 3STXA 2FGKA 1B4DA 3BGIA 1D9ZA 4L4XA 5DX8A 4KDEA 5B3KA 3H16A 4PV7A 5BSWA 2Z2YA 4PXAA 1JAIA 3GJTA 4UW9A 1GWNA 2VT2A 4B83A 3RD5A 3QTLA 3EDOA 5AOBA 3W5CA 2OCKA 1T6XA 2NPFA 3CGWA 4EPYA 4IVPA 1EFPA 4KXFB 3UZUA 5AUOB 4O8CA 4N5HX 1H4TA 3WYCA 2XGGA 5B1SA 4MQFB 1ZN9A 2B0JA 2EBUA 1IVSA 3TNLA 1L4KA 4E5KA 4D8YA 1JEEA 2GTIA 2YICA 3PDHA 4X20A 5B1DA 5C5CA 3GFGA 3IHTA 4Y7DA 1Y8QA 2XW6A 1AKQA 2DY1A 3K6JA 4LXUA 4DV4B 2IY9A