4FOLA

S-formylglutathione hydrolase variant h160i
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
299
structure length
283
Chain Sequence
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQRIPTVFYLSGLTCTPDNASEKAFWQFQADKYGFAIVFPDTSPRGDEVANDPEGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKLDFLDNVAITGISMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPWGQKAFKGYLGWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords S-formylglutathione hydrolase
total genus 91
structure length 283
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4folA00
2WUEA 1EH5A 2VT6A 4UBKA 4GWLA 3WA6A 2O2HA 3WK7A 4LXIA 3BIXA 1F0PA 4LXGA 5AK3A 4UHBA 2RAUA 2XQIA 2DHDA 4B85A 5LIPA 3WYNA 1FFCA 4Y2XA 4F0JA 5C8ZA 1XZDA 2GBIA 1YR2A 2BUCA 3O4GA 4X93A 4BE4A 4C89A 1ISPA 5JANA 1K6EA 3K2IA 1MAAA 2PL5A 1CFJA 3F67A 2RHWA 4Q1VA 3PFCA 2WHRA 3JWEA 3WI7A 4EY6A 3DLTA 2QT9A 1VA5A 4Q3LA 3I2IA 5DNUA 2XB6A 4HZGA 2ACKA 3R3VA 4BAZA 1CUCA 3KDAA 1BN6A 1XZKA 3R40A 1XZGA 1P0PA 2JGIA 1KU0A 1E89A 1AUOA 1LPPA 4MWSA 1UOQA 1HQDA 2H1IA 2XMZA 5LKRA 1XZEA 3ZWQA 2WQZA 1BRTA 4WY5A 1YCDA 5FLKA 3BWXA 1CUSA 3I2KA 4GHWA 5AKYA 3BIWA 3O4HA 5JAPA 3BJRA 3FLAA 3M81A 5EI5A 3D3NA 1J07A 3BDIA 4M0EA 4AO6A 4B80A 1FFAA 2VJCA 1XZFA 2GBFA 3BDVA 2XUPA 4CG1A 5JIBA 4EY5A 5CRIA 3C6BA 2R11A 3IURA 1X70A 1ZJ4A 1CEXA 5IVDA 3CCBA 3L1JA 3VVLA 2JGKA 2I78A 4B7ZA 4AN1A 4F5ZA 4BTVA 1XLUA 3DNMA 3H17A 3FLEA 3AUKA 2QM0A 1RP1A 1U65A 1XFDA 3C87A 4RNCA 3IVMA 3PF9A 3E1GA 2XE4A 1U4NA 5CH5A 1IZ8A 4BCBA 3OURA 4X7BA 4Y2TA 4X00A 4AMYA 5A2GA 5DYTA 4QNNA 1UT6A 4OB6A 1VZ2A 5JD4A 5HF9A 3SC2A 3FVTA 2FJ0A 2XDWA 3IULA 4Y2RA 1EINA 4DSZA 1AC5A 3MGAA 3IUJA 3O9MA 4K6HA 4QDZA 3SX4A 5ALHA 2PSHA 2VJBA 2X76A 2OAGA 5AICA 1TQHA 2B4KA 1SFRA 1XLWA 5D6OA 1Y7HA 3FCYA 3C6XA 5AKHA 1WHTA 4L0CA 3IA2A 3ESCA 3R3YA 3LS2A 1W1IA 1DU4A 4KRYA 2WM2A 1AKNA 2HA0A 1QIJA 5IKXA 2V97A 3DL7A 1G4HA 4CCWA 4C4YA 3NUZA 4MWTA 1CUGA 5AKGA 5EIHA 1JKMA 3V1KA 1ETHA 4IHAA 1I6WA 4C01A 4J7AA 3V48A 4LYDA 3WQHA 1P0MA 1W6RA 4FTWA 1ZD5A 2JGMA 4LKOA 2OG1A 5F4ZA 1JJFA 3WL7A 4IH9A 2WJ6A 4E14A 2RONA 3H1AA 5JAHA 5DTJA 3V9AA 1DX4A 3U1TA 1AURA 2J4FA 1QIDA 4ARBA 3I6YA 1ZD4A 2AJLI 2C4HA 1CUIA 2XLCA 1MAHA 1X2BA 3WWOA 2WJ4A 2WG2A 1ZICA 4OU5A 1QTRA 3X3HA 1TRHA 4UFPA 4EY7A 3ZLTA 3K6KA 3CCCA 4ZWNA 1R4ZA 3AZOA 2AXEA 4CIBA 3G9ZA 4U2FA 3WMRA 1QIFA 3D2BA 3O4IA 4X71A 1CV2A 1LPNA 1UK8A 2WFLB 5HZGA 2PX6A 1YAHA 3VDXA 3FYTA 4U2GA 5AOBA 2CJPA 4X6YA 4S0XA 4P08A 2G5TA 4KE7A 3WWEA 5FRDA 3IDAA 4G9GA 1QLWA 3BL8A 3ICWA 5LZ2A 4BC1A 4IQ4A 3AFIA 5AM4A 4FHZA 2B9VA 4X3CA 1XZHA 5T4BA 5AH0A 3STTA 1N5MA 5HK9A 2O2IA 5ALWA 1ACJA 2JGJA 4QZVA 4W1QA 1FFDA 1F8UA 5AKKA 1R1DA 4DIUA 4KR0A 1VKHA 3FSGA 5HF6A 3JW8A 3SWWA 3KXPA 4G1FA 2V98A 3JYHA 3C6YA 4X92A 3W9UA 4FLMA 4J03A 4FMPA 5LZ8A 2XUQA 4BVJA 1CR6A 1CUAA 1C4XA 3AZPA 4CG3A 2ZSIA 2VTVA 3RK4A 4BTLA 3VJKA 3FAKA 2XUHA 3T52A 4K6GA 5DTIA 1VXOA 1UK9A 2XQJA 4L9AA 1T2NA 1C7JA 2WFMA 1H2XA 2I3DA 3TJMA 4AB1A 4H7IA 2QMQA 2DFPA 2WIDA 1VOTA 4EBBA 1R50A 3FNBA 1LPSA 3D7RA 4C4XA 1J1IA 1N8SA 4CIAA 1ZIXA 1JJIA 5AKIA 5D3KA 5AKLA 1UKCA 3PI6A 4Q3KA 4QDUA 3IB3A 2BCEA 4BRZA 3KWJA 3H2HA 2HA6A 5KWJA 2BGNA 4AO7A 4KAFA 1EXWA 4H7HA 5K3EA 3P2MA 2OGSA 1L7QA 4WFJA 5HQ3A 1WCYA 4C87A 1MN6A 4C4ZA 2HA2A 4GBGA 4QDTA 1LPOA 2QZPA 3H0CA 3ED1A 4GECA 1EI9A 3AZQA 3CN7A 4DM7A 1JMKC 1W75A 1ZGCA 4QLOA 1QIGA 4ZRDA 5T4EA 4UBJA 2K2QB 3PFBA 1QIMA 3WWCA 2RHTA 1NX9A 3E3AA 4UHDA 5A62A 1QIIA 5HF5A 2PPLA 3STUA 4UBMA 5SYMA 4J0CA 5ALIA 5AOCA 2XMGA 4KE8A 2HA5A 2QTBA 3I2HA 3R41A 5CT4A 2H9YA 2DR0A 3DKKA 4ZREA 4BP9A 2YYSA 1UWCA 1DINA 3DD5A 3EBLA 1AZWA 2RGUA 2CKMA 3I6ZA 1DQZA 2B20A 2DQYA 1EDDA 3LLCA 3HYSA 4BB0A 1KU6A 2VAVA 2JEYA 1VZ3A 2G4LA 2C58A 1Y7IA 1LNSA 3HEAA 2VA9A 5ALEA 5A71A 1MPXA 3OOSA 4AZ3A 1U2EA 3QPCA 1BE0A 1BCRA 1SC9A 4W1PA 4KE6A 2EEPA 1KEZA 1ORVA 1X2EA 2BGRA 3BF7A 1MO2A 2ROQA 1WHSA 2Y6UA 5FOQA 4L3WA 4EZIA 1QIEA 3HRHA 1LPMA 5EHQA 5EHXA 1UOOA 5AIAA 2G5PA 3DOIA 5H3HA 1YAJA 1OILA 3DYVA 4I3FA 4PNZA 3LCRA 4BAUA 4BVLA 1YASA 1AGYA 4KRXA 2IX9A 2JF0A 3DL4A 5EFZA 1FFBA 5ALJA 4K6KA 4XJVA 5SYNA 4MYSA 4BZWA 7YASA 2XMDA 1R9MA 2W22A 1YB7A 4DNPA 3H1BA 3OM8A 1XZJA 5HFAA 5HCUA 1P0QA 4GEGA 1IUPA 1O6FA 2H7CA 4PQEA 4BE9A 5ALUA 1MNAA 2DCMA 1RWQA 1EVEA 3GFFA 4QWMA 3STVA 1JU4A 4WDQA 2FUKA 1WPRA 3D4LA 5CT8A 4EA6A 2C5GA 4W1SA 5I7UA 3N0TA 3QMMA 4A16A 5AJHA 1CPYA 1GXSA 1ZI9A 1N5RA 5DWDA 2ZSHA 4HAIA 1EB9A 2O7VA 1E8DA 5ALSA 5T4HA 2Z3ZA 3C5WP 4B81A 1K5PA 1HKHA 3C8HA 1TKRA 2XI4A 3C6ZA 1CUXA 3ZLUA 5CTAA 2JGFA 2X8BA 2XUAA 3G8YA 4FWBA 3B3QA 1ORWA 3E4DA 4Y9SA 5ESRA 2QXUA 2PU5A 4FFWA 3H2IA 4WFKA 3BJMA 3OG9A 2QKYA 5LZ7A 3CN9A 3HSSA 3WK8A 5AK6A 1JT2A 2XLBA 5BV7A 5CH3A 1MNQA 1TCAA 2YASA 4F60A 1MT3A 3WK4A 1Y37A 1ZOIA 2ZYSA 1GQRA 4Y2PA 4J0GA 1WB6A 4H0CA 3F97A 3UUFA 2XQFA 3DKRA 1EK1A 2QVBA 5HF8A 4I19A 1XZAA 1JU3A 2WHPA 3AILA 1LGYA 5FV4A 1L7AA 3C5VA 1BROA 5AKXA 5DYYA 5K5EA 2EDCA 5AI0A 1L7RA 1TAHA 4QLAA 3UUEA 3NOXA 3PF8A 2YH2A 4JNCA 1K4YA 1QFSA 5AI6A 1W52X 2ONCA 3W2TA 3I2FA 1XLVA 1G66A 4H7JA 5JAUA 4B9EA 3F9CA 3WL6A 5HK8A 4OPMA 3DCNA 4X97A 3GZJA 4H18A 1UZAA 3ICVA 1MTZA 4B84A 2HHAA 1THTA 3WA7A 1LBSA 4PV7A 4U2DA 4G8BA 3GROA 3EQ8A 3L1HA 5HKBA 4Y2SA 1UK7A 4OUKX 5FP0A 1EDBA 4DNQA 1TK3A 3BE8A 2I3ZA 4FKBA 2Z8ZA 3FSGD 5K3CA 3HACA 1XZIA 3ANSA 1THGA 3R3XA 2HRRA 4UBIA 2HU5A 4FLFA 3C45A 3R0VA 1JFRA 4IH4A 1QZ3A 4OSEA 5E4JA 2G63A 4QEKA 5CT9A 2WKWA 3I6MA 4ZGBA 1MU0A 2Y2VA 2QUBA 1QOZA 1XZLA 2VJDA 2WU4A 3M3DA 3DDUA 1XZMA 2DQZA 4M0FA 3C43A 3H2KA 4Y2VA 1JJBA 2GYWA 1WB4A 3FLBA 1XROA 1G5FA 5A7HA 1YA4A 2QOEA 5ALFA 3RM3A 2WUDA 4N8EA 3KD2A 4EUSA 5ALPA 1BEEA 4HRXA 2RI6A 1B41A 4Y2UA 4AZ0A 1LZKA 3CXUA 2D0DA 2HU8A 4BDSA 1FJ2A 3GA7A 3HABA 3R3WA 4QE3A 2HU7A 4PO3X 4G4JA 3OTQA 2BAGA 1QO9A 3WKBA 1YA8A 2ACEA 4H7EA 5KREA 5EIAA 2Y1KA 4UFNA 1GPLA 2QRUA 2ZJ7A 3GBSA 3M83A 2XUKA 4ITVA 3HC7A 5ALVA 4B9AA 4FDMA 4FOLA 2BKLA 3RARA 3EQ7A 2WJ3A 1GQSA 2WILA 1HDEA 3U0VA 2OLEA 4WCVA 1XQYA 2P8SA 3NWOA 1SCKA 2YXPX 4G5XA 1S8OA 2XQKA 1CUDA 5AOAA 4TGLA 1YS1X 1Q83A 4K2AA 3QVMA 2XUOA 5K3FA 3I2JA 1CQZA 2FJPA 4UBLA 5HKAA 1XZBA 2C0PA 3ANTA 3O95A 5JAOA 1CLEA 4Q82A 1CUUA 2HA4A 3A2MA 3S2ZA 4PW0A 4UPDA 1ZD3A 4OB8A 4G4IA 3D2CA 4OB7A 2WUFA 3EQ9A 4IO0A 1A7UA 4TVKA 5C81A 1GT6A 3VKFA 4DMKA 4BYMA 1H2ZA 4N5HX 4OYYA 2WIKA 4NS4A 4EY8A 1IZ7A 2HA3A 1R9NA 4G4GA 1LZLA 2Y6VA 1G42A 4GI1A 1EVQA 2HFJA 1HPLA 3SK0A 2GZSA 4QWWA 2LIPA 2PKYX 4BCDA 4WJLA 3I1IA 4MYDA 3ZPXA 2R8BA 1W4LA 4AN0A 2WUGA 5LZ9A 5FKJA 4KYVA 1LLFA 1QIKA 3W9BA 3KSRA 3WLAA 2XUGA 3ESAA 4WFIA 3Q0TA 3FWHA 3ZV7A 3VJMA 5AM2A 1E66A 1YSCA 3AIMA 2Z8XA 3C70A 3LP5A 4JH0A 2XUJA 4A5SA 1OCEA 2QJRA 2J3QA 2W6CX 1UXOA 3N2ZB 3PICA 1EHYA 4X95A 1BEZA 5CH8A 1H2YA 4BBZA 3BXPA 2VJAA 1R3DA 1XZCA 2H7XA 4U2BA 4FLEA 1QFMA 1FFEA 4Q34A 1UOPA 4UFOA 5ALKA 2GBGA 5JADA 1WB5A 2PSJA 4X6UA 2FX5A 3QBJA 5E4YA 4WY8A 5AK5A 1VLQA 5LKAA 5IVIA 2OXEA 4Q3OA 5BOVA 5DYWA 1QO7A 4L72A 5AKZA 5AI9A 5ALRA 4K5QA 4MEBA 4JYMA 4GLBA 2HADA 2JEZA 3B12A 4QDXA 3G0CA 4UBNA 4EHBA 4G8CA 3EF3A 2C0QA 3FYUA 1FSSA 2IITA 5C7YA 4HRYA 4HXFB 2HRQA 3IBTA 1XQXA 1CUJA 3A6ZA 1XRLA 3H04A 1CQWA 5AO9A 4GW3A 4DMCA 3KWFA 1MJ5A 3F96A 4FBLA 3HZOA 5JZBA 5YASA 1IVYA 3AIOA 4RPCA 4X94A 3VVMA 2OCGA 5K3BA 3FYUC 3HI4A 2WSLA 1DWQA 2HA7A 2ZJFA 2XUDA 3WWPA 2OQIA 3WK6A 2RIPA 4A23A 1TCCA 1CVLA 2O2GA 5ALTA 4NZZA 2BFNA 4KEAA 1D07A 4MXDA 3OC0A 3FYUB 5ALYA 2BJHA 1J06A 3NGMA 3RKSA 4Y2YA 1CIJA 5T4FA 4FNMA 2WFZA 1VXRA 3F98A 1R88A 2QS9A 1JI3A 4FNGA 3FCXA 1WM1A 4UUQA 4G8DA 2XQGA 4H77A 1M33A 3HXKA 2B61A 2VQ6A 3V1LA 4O08A 3PDCA 4MQMA 5AP9A 4RGYA 2XMQA 3E0XA 4UHFA 3O9VA 3ZI7A 1Q0ZA 4GXNA 2PSEA 1EDEA 1O6GA 2PSDA 3WJ1A 4Y2JA 5E2IA 5K3AA 1CUEA 1XRPA 1ZD2P 1GPKA 1ACLA 2WG1A 3D2AA 1XKTA 2C5FA 3WWDA 5ALGA 3L1IA 5JASA 3DYIA 4KJXA 4OU4A 3VXKA 4Q05A 2NW6A 1SCIA 3V1MA 3T4UA 5FPPA 2PVSA 2PSFA 1UK6A 2ORYA 2WU3A 1EK2A 1AX9A 4HXGA 2HL6A 4NVRA 3A2LA 5LZ4A 1EA5A 5JALA 3TEJA 2Z3WA 3EIOA 3LIPA 2PUJA 2AJBA 3H19A 3MUOA 1RYYA 1XRNA 2HIHA 1QIHA 1E3QA 3B5EA 4EB0A 1DTEA 1XRMA 2VEOA 1LPBB 3MVEA 5D7BA 1JMYA 3RLIA 1QTIA 3AINA 4W9RA 2CB9A 1BS9A 4BC0A 4V2IA 1VE6A 3YASA 5DNVA 2OQVA 4J0IA 4AX4A 5ALNA 5EGNA 1ZGBA 1UKBA 5ALOA 2J4CA 4C88A 4G9EA 1GZ7A 2ECFA 5LP1A 1CUWA 1QJ4A 5EHZA 2VATA 4UHHA 2AJDA 4P92A 3DS8A 1XQVA 3FOBA 4CG2A 5CBKA 3O0DA 3WL8A 1TCBA 4Z49A 1VJ5A 4BCCA 3QPDA 2ZYRA 1GKKA 3H18A 1Z68A 3WYDA 1BCSA 1H22A 1UFOA 1DT3A 3G9XA 4PSDA 3LIIA 2BUAA 5KWIA 4AXBA 3AIKA 2Y2UA 5JZ9A 3HJUA 3F8SA 3WL5A 1XKLA 4INZA 4C6HA 4BATA 1A88A 4DNOA 4J0DA 4YPVA 2H7YA 4FBMA 3WJ2A 5FXMA 1HBJA 3G02A 3K9BA 5CURA 1B6GA 4P9NA 1OXMA 1J2EA 2XMBA 1K8QA 3QH4A 1E5TA 4LYEA 1WOMA 3Q8WA 2VAXA 4MQLA 2QJWA 2WTMA 3O4JA 2AJCA 2ZYIA 4IH1A 2WIGA 4N8SA 1Q84A 3ESDA 2OGZA 1GKLA 2JBWA 1VA4A 4UHEA 2OCIA 2XMRA 1IMJA 3IIIA 2WIFA 3HLKA 2EDAA 2WTNA 4X91A 4CCYA 2WG0A 2PM8A 3PUIA 2PU7A 4BDTA 1F6WA 4ROTA 1EB8A 4DMHA 4F21A 2OPHA 5JZSA 4CFSA 4AMZA 4PSUA 2Q0XA 4U2EA 2DHEA 3QMVA 5ISMA 1A8UA 2CUTA 2DSNA 1USWA 2UZ0A 3TGLA 4ZXFA 5AKEA 4ZV7A 2OCKA 4OYLA 4Y7DA 1AQLA 5JD6A 4N5IX 1GPNA 5AI8A 1LBTA 3H2GA 1DQYA 2JGLA 4TPKA 2OGTA 2J3DA 4EY4A 4KE9A 1QONA 4X6XA 4D9JA 1W76A 1F0NA 4XIIA 5CT5A 1QGED 4BRSA 3STYA 3STXA 2GYVA 4JEIA 5AM3A 1DX6A 1CUFA 5ALQA 4KAJA 4H7KA 4B6GA 4ETWA 1PJAA 2OAEA 3G0IA 1EX9A 1UKAA 3M82A 1ZIYA 4XX1A 2HDWA 2XT0A 2XMSA 4GDMA 4DYHA 3GELA 3R3UA 2ZJ6A 4DTCA 2QUAA 3G0DA 4HS9A 1ODSA 1ODCA 5JYCA 4WDRA 4KAAA 5A7FA 4W1RA 3ZLVA 3QITA 3W05A 1PV1A 4RE5A 4XWGA 4DNFA 5C8XA 5I8PA 5BWCA 1NU6A 3S8YA 4E46A 4X90A 2JGEA 1HLGA 4FFVA 1IUNA 3FVRA 1DT5A 2I03A 1XRQA 6YASA 4LHEA 3UMJA 1P0IA 4LIPD 1WPXA 4UHCA 5FPQA 5K3FB 1PFQA 4I4CA 5C8VA 3DEAA 3WZLA 3KOOA 1NU8A 3TRDA 5ALZA 3QYJA 2X5XA 2GZRA 4QDOA 1E8NA 2VT7A 4B0PA 1MX5A 2ZYHA 3WKEA 4J0HA 1DWOA 1SCQA 4XVCA 4B0OA 2BUBA 3QPAA 5A6VA 4AO8A 2QXTA 1Q0RA 5CXUA 5HFNA 3D0KA 2ZVDA 2HM7A 5EHNA 2IIVA 4W63A 1E8MA 3OPMA 2CBGA 5IH7A 5CMLA 3V1NA 5BWBA 2HFKA 2E3JA 3GUUA 4B83A 4YX9A 1HL7A 4H7FA 5CXXA 2QR5A 5ALDA 3WIOA 5AI4A 2WIJA 3WKDA 1AMNA 4CCYB 2V9ZA 4ZV9A 2ES4A 4DMFA 5AKJA 1YB6A 3WZMA 1CUHA 1ODTC 4CI9A 3D59A 1A8SA 3DOHA 2XUFA 4E11A 4M0MA 4DGQA 2CEKA 1CRLA 4LXHA 2GYUA 3AJAA 5D3ZA 3ESBA 1CUZA 4B82A 3BF8A 3DJYA 5DJ5A 2DHCA 4BZZA 4PF1A 1ZI6A 4HVTA 1K63A 4H35A 3QM1A 3G0GA 3MUNA 1GGVA 4RE6A 5JD5A 4X85A 5IVHA 3FBWA 2PUHA 3PE6A 4Y2QA 4HTAA 5ALXA 4MEAA 4DSAA 3VISA 3WK5A 4J3JA 1H2WA 4J0JA 3QZUA 2AJ8A 1BU8A 4PSCA 5LLSA 4OCZA 1LPAB 4BVKA 5HQ3B 3W04A 4JYPA 2C7BA 4ZI5A 1ZJ5A 1CUVA 5CW2A 1N1MA 1VE7A 4E15A 1SOMA 5JARA 4OD0A 2OCLA 5LYYA 1A8QA 3WK9A 3G7NA 4P93A 2VSQA 4YK7A 4J0KA 5AM0A 2PBLA 3W06A 1QE3A 3VJLA 4BP8A 3QMWA 5AM5A 1DWPA 4BAGA 5ALLA 3G9TA 1TIBA 5LZ5A 5EIEA 4ARAA 2WFLA 3PUHA 5K3DA 5J3JA 4HXEB 1MX9A 5AM1A 3A70A 1U8EA 4YASA 2VF2A 1BN7A 4N8DA 1T4MA 5AHXA 2O7RA 5DNWA 5IVKA 4QA9A 5A7GA 3DQZA 3I1YA 2WHQA 3A2NA 3WKAA 4UBOA 4JUIA 2CZQA 3G0BA 1MX1A 5DLPA 3STWA 1H23A 3IUQA 3I2GA 4AQDA 4H7DA 1XRRA 1XQWA 5AK4A 3ILSA 5FDFA 4U2CA 4MJ3A 2XUIA 5E4TA 3D5EA 2WHPB 4DLNA 4NMWA 3I28A 2JIDA 5ALMA 3IUNA 2GBCA 2CMFA 5KBYA 3H2JA 1CUYA 2D5LA 3R3ZA 5JATA 3WIBA 1YS2X 2WLSA 4KACA 5AI5A 3G9UA 2XMCA 3C8DA 1ZI8A 1IUOA 5CT6A 2Z5GA 5AIBA 5FUMA 1C7IA 1CUBA 3WKCA 2V96A 5I9IA 3IUMA
chains in the Genus database with same CATH superfamily
4ZAXA 4JUCA 1Q1QA 3DH0A 2IXBA 1EH5A 3JQAA 5FX2A 2QX7A 4UXJA 2NADA 1HT1E 1YB4A 4IDFA 1OWLA 1PJBA 2HUPA 2P3OA 1J24A 1IATA 1AMUA 3AVYA 5JZVA 1V1MA 2YWEA 3TTSA 2WZCA 3PLNA 4Z0HO 1SUSA 2Y99A 2XGSA 1F0PA 4TMYA 4KR6A 2G07A 2X77A 3F4KA 4EHJA 3TFWA 5EXTA 4JBWA 1R0XA 1E94E 3BILA 3Q0EA 4B4OA 4O4LB 1G18A 2MMCA 4ZTBA 4RLHA 5LIPA 3RKRA 3CZ4A 2WSSD 4C6SA 3ESQA 1K0UA 1FFCA 1UADA 3KYDB 4AS3A 4F0JA 4ENVA 4GIBA 3OF5A 4X1OA 4CMHA 2O8CB 3OJLA 3WIEA 2HY7A 2O1WA 3QFFA 5IBQA 4YBZA 1JF8A 2ZBDA 4BE4A 2HPVA 1ISPA 2EEZA 3KLBA 4BP1A 1D1SA 2KPOA 2NSYA 3BZUA 4J7XA 1K6EA 1XWIA 4WOBA 5CLJA 3LZCA 2FPIA 3U4QA 1Y1SA 1GNLA 1GPDG 2VH5R 3BOSA 3R9IA 2MOKA 1ODLA 4K05A 1LI5A 3CZMA 1RBMA 4H1HA 1OFVA 3F6YA 2GFHA 3LC7O 2HZ7A 2QTNA 4AIIA 3NR2A 2VNSA 3ZEIA 4M7PA 3IQHX 4GE3A 5JS2A 4DDUA 1GILA 2E6UX 2HV9A 3IBSA 3JWEA 3PUYA 2Y71A 3PWKA 4M88A 4O02B 3AGQA 3FXAA 1M2FA 3TZQA 1IHPA 3VNBA 1NW9B 1XG5A 1JEAA 3RVSA 4HZGA 2QORA 2IS4A 5IG2A 4D57A 2QY6A 4C4RA 4G89A 3ICQB 3G5TA 5DN9A 3RC7A 1A69A 1NQ5A 4R9NA 3WQRA 2D2IA 2GN2A 5KTTA 1COZA 2QF7A 1BN6A 2FZCA 3UJCA 3SNKA 1XZKA 1P0PA 2P35A 2FMXA 4CDNA 3W5DA 2IVFA 3PXAA 1LPPA 3R9XA 5DU2A 2P6UA 4MR8A 1TEZA 2B36A 3KEOA 5FTJA 1XMQB 2ECOA 4GSLA 2NU6B 2PZJA 1KDOA 2ODPA 2XMZA 3A26A 4EYQA 1XZEA 1UMKA 1RZ3A 4YCSA 5DSXA 3OJXA 5DW0A 1Z17A 2Q0SA 5E3HA 2ZZNA 4GP7A 3NVAA 1EM8B 1YCDA 4EELA 5FBVB 4E5KA 1JYFA 2J3KA 2XCIA 2YRXA 4IJVA 4JP2A 1QH0A 3M6AA 2D4HA 4E08A 4XQCA 2OCAA 2H3EA 4Y67A 4JEUA 1PZNA 3T7AA 3EULA 1XCBA 3QOYA 3MTBA 5LSAA 5B3LA 4DR7B 4GPEA 4WZBB 5JAPA 1R8XA 3BJRA 1TYDE 3FLAA 3LRTA 4ND1A 5EI5A 1F8FA 3V8MA 2Q5IA 2AR9A 4QM7A 1ZSYA 2J41A 2IHZA 3BDIA 2ZWAA 3BGIA 1B8PA 4QM6A 4MKIA 5EKUA 4AO6A 4B80A 4EVQA 2VJCA 2C5EA 3QKUA 4HUJA 4A0HA 2GBFA 2JIOA 2BFAA 4KXVA 4BJ6A 1W4AA 3LPDA 5KHOC 1M75A 3QU9A 1L5GB 4JI3B 2NO6A 5H3CA 4PX5A 4XA8A 4Y1FA 4RMIA 3FIJA 4OAOA 5IWAB 1PP4A 1ZJ4A 2J45A 1JA1A 3CCBA 5IVDA 2AIRA 2Y0DA 3TXYA 2VDUE 3UMGA 2Q1XA 1WCIB 2H1SA 2WJAA 1XHLA 1D2NA 3AEQB 4I55F 4QD3A 3VVLA 3PX7A 3TKAA 3ZI4A 2JGKA 4ZZIA 1E4VA 5U4QA 5K3SA 2CF6A 4N7JA 1C9JA 2CVQA 1HL3A 3B78A 3TZ6A 3UY4A 4B47A 4F04A 1OGJA 2OENG 2QQGA 4J90A 1YRWA 3D6MA 5F7ZA 2FSFA 3V1TC 1YJQA 2B0CA 2XT6A 3WYAA 3VR5H 3PPVA 2H2AA 1RP1A 4L51A 4PSAA 4TRRA 1ODFA 3ABSB 1P9RA 4UE3S 2F4NA 4KUGA 3TB4A 3MHPA 2DT5A 3DCYA 3PCRB 1KSGA 5M34A 3VUEA 3RASA 2R9VA 4ZXPA 1US8B 3E1GA 2BMDA 3Q2OA 1W59A 1X77A 2RGYA 4RXUA 1IOWA 3A10A 1NV8A 2UYYA 3HVKA 2F9LA 3IQXA 3LK7A 3ZWOA 2X5OA 2IHYA 4R40A 3BKXA 3BTSA 4GZLA 3R7AA 2XJ4A 2C4WA 2X58A 5DPMA 4DCNA 4MAAA 1APBA 5DYTA 1KFJB 4QNNA 1FVHA 1HTTA 1P72A 1T2UA 1WWKA 4HH0A 3S28A 3ZHCA 2NPOA 1CHDA 2C88A 4J49A 4DMMA 4CTNA 3OC6A 2WM3A 1DLJA 1S2NA 3GEBA 4REQA 1R16A 1T5DX 3FVTA 2FJ0A 3N58A 4TM7A 2O2CA 1VQ1A 3D1JA 1RSZA 1GUZA 2YVLA 4OL0A 2IZ1A 1WDTA 1ZK0A 2DTXA 4HPJB 3RQSA 2BEUB 4LQDA 2QVZX 2VF5X 2GS9A 3IUJA 2R4UA 3GOQA 4MIKA 1RQ2A 4K6HA 3UGTA 3ESXA 2IF2A 2VJBA 1FMLA 2NSLA 3EEFA 4R0NA 4B40A 3DMDA 1BRMA 1HEUA 5EJ9A 4RH0A 1NBOA 4AMVA 1SQ6A 2YXLA 4RJJA 2IPOA 4DLVA 4OYHA 2UYCA 2ZIWB 1YMVA 1N4DA 4FKMA 1Y7HA 4KXWA 4ER0A 3KPUA 1I7SB 1VIMA 3NBAA 2A5YB 1LEHA 3UMCA 3HG7A 1Z4LA 2JLAA 1DBQA 1OFIA 1SBQA 4IFTA 4XW2A 1WXHA 4F3NA 1AS2A 4EKGA 1UM9A 3TSWA 1LQTA 1H4SA 2V6JA 2AS0A 3LS2A 2WE7A 3SDSA 2ZR9A 1QOQB 1PR2A 4Q9HA 1W1IA 5AT1A 2G1UA 3VPDA 1NSTA 3KV1A 1YXMA 3ETJA 3OZUA 5DVZA 2IX3A 4OY3A 1QH1A 3QA9A 4BBPA 2WM2A 3VAAA 2HNKA 2ZRIA 2IYZA 1EAMA 5TE9A 2BV3A 3OWXA 1X7GA 1X38A 4V0LA 4N01A 4YUYA 1A71A 1QIJA 2BCGY 4G97A 4GLFA 1TVKB 4HYEA 4EO4A 2XCSB 2HR1A 4L6CA 2PNJA 4E33A 1NC1A 1KPHA 2IQ5A 3F74A 4YT8A 5J1SB 4O0MA 3K6SA 1QMGA 3OESA 4ZVOA 4CCWA 1N7HA 4RS3A 1ZWKA 4C4YA 3GIWA 1ZKMA 2JLUA 4RNDB 5KUTA 2YHAA 2FMFA 2BHRA 1SUPA 3K9NA 4MWTA 4OJNA 3IVRA 2XKJE 2ODEA 2YJ3A 4C06A 1CUGA 4G5OA 1R9GA 1E3MA 2WJVA 3W7AA 5KYGA 4C9BA 1GZ3A 3KKPA 4XGRA 3V1KA 4FFBB 3ZLBA 3OMXA 3QBTA 1H3EA 1WP4A 3WIVA 3EGWA 5LNK6 4J7AA 1SN7A 1GVNB 2QAJA 2RHJA 5DI3A 4GZ5A 5EMHA 2O3TA 4R54A 5BQFA 3ZG6A 1GDTA 3K73O 4KQ9A 1M6HA 1Y4SA 1A72A 3EXHB 3T7IA 1NDUA 3K5IA 3HV2A 3U7QB 4FTWA 4S24A 1MV8A 2N75A 4GI3A 4LVCA 1DDOA 3HCBA 2LPMA 3PYLA 1LV8A 2OG1A 2IHNA 4ALLA 1V48A 3PHHA 5TJ9A 3F6SA 1M8JA 5JAHA 1GU7A 4WSOA 3VU1A 2X0IA 2I76A 3V9AA 1M2NA 3DB1A 4EUEA 5B12A 1TFRA 5JZMA 1KQGA 2PGJA 4YDRA 1QIDA 3CZ5A 3OJWA 5F3DA 1K8XB 4WKGA 5D01A 4DQXA 5T41A 1Z15A 2CFOA 3N8HA 4FFBA 4QLBA 3EBPA 1V8ZA 1NQWA 2FYTA 2Q41A 2FG5A 1VLMA 1IU9A 2AJLI 2FFBA 2VQSA 1PEDA 1CX9B 3EDQA 3DHYA 4IJQA 2I55A 4PPGA 1G55A 1MAHA 1X2BA 5MDHA 3O21A 2X3FA 2A4MA 2FN7A 3KLPX 2ZJZA 3BICA 2AXNA 1PVVA 3N74A 3WYGA 3X3HA 5C5EA 3VOBA 5JMOA 1O58A 1X42A 2ZBRA 1W0KA 4ZYWA 4NIMA 2IW1A 4H31A 2B7CA 1DXYA 3O4VA 1QX3A 5AD1A 4B34A 1HURA 5L3ZA 4ZWNA 3VO1A 4YI3A 1SQ0A 3Q9NA 5KTYA 5FT9A 3IOCA 4PTZA 3CLSD 3S2UA 3GVPA 5DNYB 2JFQA 4BPBA 4XVUA 5TMDA 3FY4A 3DUWA 1W25A 1OAAA 3TRFA 2XYRA 1IRXA 2YYYA 3G9ZA 1WMBA 1I5RA 3Q4GA 4IIJF 4EJ6A 2VWQA 1KZ1A 3MS2A 4RD0A 3RSOA 3UW3A 3VU8A 4U0JA 2W2MA 2ZRCA 1QPZA 1TF7A 3D2BA 1B1CA 1W9HA 1UAGA 1BXZA 2CJYA 3G85A 3GEMA 3LTEA 3P0HA 3WRYC 1J9EA 5KNDA 3SZMA 5H7XA 1HE1C 1MOPA 1NBMD 2WFLB 5LUBA 2BH9A 2QY9A 5ENDA 4MYUA 1YAHA 2Z5VA 2Q49A 2VSFA 1I1HA 5F1KA 4B7AA 3NNSA 2OBLA 2QI9C 4DPLA 2CHFA 2H4YA 3CVXA 4RPHA 2CJPA 3E5NA 4ZYTA 3IAXA 4CDRA 2WAMA 5JY6A 3I5AA 3PL5A 1RWVA 1V2GA 5KOHB 4BB5A 2ENUA 4XCVA 3BB4A 4D92A 3FHCB 4BO1A 5FRDA 2QENA 1SC3A 3QLVC 4FEYA 1AQYA 1E2PA 3MQ4A 1J8MF 1M6NA 2FOIA 2KSQA 1CJMA 2YICA 1QLWA 4G9GA 4DZRA 4PNEA 1AHPA 2WJYA 1YDEA 5GM1A 2F7SA 4FE3A 4MS4A 4YO8A 3KAPA 4NK5A 1LBEA 2GXSA 2IYXA 2YZNA 2WMYA 5I4CA 2A1TR 2L18A 5KC9A 4GVXA 4PZCA 3ICWA 1FP4B 3K1AA 1SH7A 1CF9A 3TZHA 4D41A 4D4LA 3O47A 4PPFA 1EM8A 3O8LA 1D6MA 5BV8A 2WI8A 3K1ZA 4UUOA 2W4IA 1QAMA 2LCQA 4DYDA 4M1SA 2FGKA 1QQ7A 1T5BA 3WWZA 2O5RA 4D4JA 3SD7A 1CJCA 2Z56A 1JA9A 1RT9A 2JGJA 2FLWA 2V7PA 4E30A 1M7HA 1A9TA 3KR9A 2EATA 4LE2A 4DUGD 4W1QA 3QLVA 4C22A 1FFDA 3D5QA 3ND7A 1XPUA 2A1UB 2QVCA 5LQCA 1B15A 1T1IA 4BWYA 1YZTA 5T3YA 4N65A 1I3KA 4RO0A 2BFDA 2JBAB 4LXQA 4C6TA 1Y8RA 4DIUA 1EPUA 1VKHA 3U1VA 1LDGA 5T3UA 2VYNA 5B4TA 1QGOA 3VZBA 4O4HB 4XRGA 1RNLA 1C9KA 3IVAA 3ZJTA 5DASA 1MD9A 1T6ZA 5EKDA 5H9WA 4QRDA 5GOTA 5UKDA 4B32A 4ZYVA 2FWIA 3IUYA 2P2ZA 4RELA 4XIFA 2HWXA 1Y3FE 5C1BA 1Y8CA 5KAMA 1XA4A 1ZM9A 3ABRB 1Z7YA 1PNRA 3C6YA 2PGXA 1Z3IX 4YLEA 1D2EA 2GN0A 3W9UA 1E9CA 2YQZA 3T5BA 2NAPA 2KHZA 3M1AA 4EYSA 3OY7A 2XBLA 5JPIA 3WHKA 5DLYA 3L4KA 4C4OA 2FLVA 4MQEB 2V1XA 1JWLA 1UL1X 2PPVA 1CR6A 2YXDA 1CUAA 3Q6IA 5KAPA 2YUIA 4B8WA 2EGUA 3AZPA 2BL4A 3EUWA 2VTVA 3RK4A 4P32A 3VJKA 1GV0A 3NV7A 3SAJA 3L41A 3T52A 5ABPA 3VOAA 3PP8A 4W9NA 2X19A 2P62A 3NNDA 5HIAA 1JXMA 3E7PA 5CB4B 5FFFA 1Q44A 3K0FA 1VXOA 3JZFA 5CFQA 4MRSA 3D5TA 4L9AA 3LFHA 1J2UA 1V11A 4EMUA 1I3NA 2RAFA 4DLAA 2LV8A 2VP2A 1VHLA 1PBTA 4F72A 5CG2A 2XVAA 3RAJA 4RA9B 1EEXB 2OZVA 3KM0A 4JC0A 3BXXA 1S2MA 4QULA 5BRJA 4GG1A 2GDZA 3QWFA 4QXMA 5WRFA 5ERXA 4FOSA 3WGNA 2D5BA 2QL5A 3HYTA 2OAQ1 4H7IA 5SZJA 2JG3A 2HPAA 2VYVA 4EBBA 3GVCA 3FBTA 2C9OA 2JDIA 4NNOA 5E6RA 4U9UA 5B1HA 4IZ6A 1G8AA 1PJRA 5M7EA 4CM8B 5GZ3A 2AB0A 3D7RA 5G53C 5KX5B 4FJ2A 3PV0A 5DX8A 2AEFA 1IAVA 4D9MA 1ZIXA 3TUJC 1JJIA 1M1NA 1P7VA 3B7PA 4YXWD 2VP9A 3AY7A 1IOLA 1P2GA 3ENKA 4MNTA 2J3LA 3CZPA 1HORA 2UV8A 3PI6A 3IB3A 2LW7A 4QDUA 5AKLA 2HKIA 2X0DA 3QEKA 4QJ3A 1TI7A 3LF1A 4R16A 1WSWA 3KWJA 5H02A 4OI4A 3TLXA 1SZPA 2DM6A 3BQ9A 3ENNA 4HF7A 4CCAA 4HVCA 1HH4A 3CKMA 3RT9A 2E1PA 1FSPA 4KAFA 3IXLA 1DXQA 4OG2A 4CIVA 3A36A 3WNZA 2F3SA 2HCFA 2EKBA 3FWNA 3IDOA 3CLUC 4HDAA 4J0EA 4ESOA 4LCJA 1L8OA 1XU7A 3E15A 4I1SA 4J1QA 3PNQA 4LVUA 1D6JA 2GPSA 2F3PA 2IUTA 4DW8A 3KIPA 2ZDQA 2HWUA 1AJEA 3CU5A 5J2TF 2PWBA 3MHTA 1IXSB 3HHEA 1B93A 3VO9A 3WSWA 3AOEA 2Q4OA 3CRMA 2AEJA 3A4MA 1H42A 1L4BA 4AZTA 4ZJPA 1WF6A 2HA2A 1EDOA 4L4ZA 1UZUA 1EAYA 4JP5A 1BMDA 1T1GA 2QZPA 3LPCA 3D1LA 3PXBA 4KMOA 4LV5B 2QGNA 3GD7A 2FV8A 1ZL2A 1P7YA 2JANA 2UKDA 1QV9A 2ZXFA 3ZWDA 4GECA 3AZQA 2XTNA 3LT4A 5TMBA 3T0FA 1SD2A 5BSUA 1T3ZA 4BIIA 4LS3A 4F3KA 3H05A 5ILGA 3TCXB 1J9GA 2D3WA 3VH4A 4BWFB 1T3TA 3JQAB 1QVZA 5T4EA 2HN9A 4Q1FA 4GM4A 1REQA 4HDNA 2ICAA 4E5MA 5K99A 3PFBA 3IKLA 2HCTA 2KYRA 3BHJA 3GJSA 5H3LA 4Z0NA 1LK7A 1QVAA 4NFYA 4Q4CA 1FQOA 3OQ1A 1B6TA 1GVHA 3EODA 4TRMA 3DWGA 5D5HA 4TLLB 3UAXA 1KK0A 3QEOA 4U8HA 4C7KA 4MARA 3QKWA 5EY5B 5A62A 3IVXA 4XYBA 2VDNB 3UC5A 1V1RB 1XKQA 1ESZA 3N53A 2JJ2A 4FNAA 3STUA 1MCZA 4HN2A 3DHVA 2VJLA 4J0CA 2FXIA 3K09C 4UCWA 5K2MA 4ON9A 2HA5A 1CY7A 2V5UA 2GK6A 2HJWA 1MO3A 2Q5HA 3FPKA 2DUUA 1F20A 1RADA 2AJTA 3I2HA 4M60A 3SQNA 5K9ZA 1EUYA 2ODAA 3LD9A 3DO8A 3O1LA 1H6BA 3W8FA 4EVIA 2GO1A 3RVNA 2FFRA 3PNBA 2ZDHA 4G86A 4B8ZA 3JQRA 1YVPA 1AZWA 5IT5A 2VS1A 3FI9A 3K9WA 1KFEB 2H1FA 2CKMA 3OE4A 4QPPA 1M34E 4TTJA 3RV3A 2B20A 2AMYA 2DKNA 2BBSA 1NZFA 1V3VA 3WQQA 2JEYA 4JU8A 1WQ3A 5KQMA 2G88A 1VZ3A 1OXVA 5HE8A 2YZ7A 5J5CA 3BX1A 5LP6C 3AJ8A 1WZEA 1LNSA 3ELDA 1REQB 1KFKB 2ORVA 2C59A 5A71A 4AZ3A 2CW5A 3K0FB 5B58T 4BX8A 2I80A 3FDZA 4W1PA 5BPHA 1YVUA 3LBAA 4V1CA 1TZMA 5FA5A 4ICIA 4OEHA 4CM4A 1HKUA 4D44A 4RGBA 4CMGA 4GWGA 2I8CA 1X2EA 4RA6B 1RQLA 1RWNA 2GI4A 3BCSA 4L73A 3SOPA 4UVIA 1YULA 2VRCD 4ALNA 5MF6A 1TEXA 1T5HX 3ROXA 1EUQA 3O7WA 4P3YA 4RF2A 1ZM3A 3EZGA 5CLLA 1WULS 2PE5A 3ZS8A 1FLDA 3ZCTA 1GGJA 1WHSA 4HRAA 5FHRA 2JLZA 5LA6B 4KYTA 1L4NA 3WRVA 5I9TA 4L3WA 3IILA 5AW5A 3OEEA 3LAWA 1W36D 4L76A 4QDJA 3NBQA 4Q4DA 5EHQA 1XTRA 5KDDA 1Y4AE 2H11A 3O1JC 5AIAA 2G5PA 3I92A 4B7XA 4N7RA 5H3HA 3OPYA 1XNQB 2OY0A 4D9HA 3JQ8B 3N2GA 4NHEA 3OUZA 3O94A 3KU4A 4I3FA 3MAGA 3A7EA 1XVIA 3PQ8A 3FPGA 3LCRA 2W6JD 4Z5XA 5E7MA 5KTOA 5B7QA 4KTTE 4MS1B 1IFXA 3B2QA 4K1XA 4IIVA 1YZLA 2R7AA 5DH9A 1J90A 5A3SA 4CKEA 1FRNA 3B1YA 2SICE 2VTKA 3IP1A 3VR2A 3PJGA 3RS7A 3MGGA 1VLJA 2R1TA 2P90A 5ALJA 5IMSA 4C78A 1G63A 1NWCA 4ENRA 4A73A 1NKSA 4GI5A 2Z58A 2W2XA 1KYQA 4Z4HA 2ZAGA 2XMDA 5P21A 5JDIC 4XVQA 3RVQA 1X8KA 2HTFA 5I48A 3PHIA 3KKLA 1I30A 1YQDA 4P36A 2RGNC 3UJDA 3ZIAD 5J4KA 4Z0TA 3UT5A 2YXNA 3C7TA 1YR9A 5DGCA 4HNVA 2IYEA 3ITNA 2H07A 1P0QA 3AONB 2DU8A 2X4DA 1GGHA 3K4PA 3QG1A 1F8XA 1G8MA 1N2BA 1GL3A 3S27A 4WCFC 4RA9A 1IUPA 1O6FA 2H7CA 3TI7A 4OF4A 2UVDA 1MNAA 4B5LA 1T5TA 4XUEA 1EVEA 3UJ9A 2I7VA 1UZLA 3R20A 1NI5A 1A98A 1SUAA 4I6JA 4AYWA 1V8BA 3STVA 2O4UX 4FYVA 2VF8A 4D97A 4KWTA 1BXRA 1U6KA 5E1BA 1T6NA 1JIXA 4TYPA 2XODA 3FPEA 4K9NA 3KYCA 2G70A 2IWHA 4Y9DA 1IN6A 3I1JA 3SIPA 4EA6A 4AG3A 4EFMA 1N0WA 1S4MA 1Z4NA 3C5HA 2Q2QA 1XCMA 1W36C 5FUWA 2AZXA 4HVAA 2RGAA 1ZGAA 4PC1A 1Y7LA 1DV2A 3BE4A 4BFZA 4XE5A 3KWMA 4EKDA 5K8UA 2X0RA 1JA0A 1WNTA 4U3JB 2NZWA 1EB9A 2X40A 3K1YA 1BDHA 5BMVB 2ZJ5A 1DAHA 5ALSA 1QS0A 5T4HA 1QZZA 4N54A 1UANA 2PK3A 3P0EA 4HDKB 1NUHA 2IODA 4HQRA 4KVAA 2A1IA 3C5WP 2H57A 2FQWA 1U81A 1WF3A 2OXFA 3C8HA 3UFXA 1TKRA 3W6ZA 3EGDA 1IL0A 4LI3X 5GY7A 1I2AA 3HA7A 4O4HA 1J0BA 1PWYE 4WI1A 1L5NA 5CTAA 1FUIA 1GTJ1 1ND5A 2JGFA 3IOYA 4MV5A 2A1UA 4KOAA 2MSNA 3UH1A 1ZMBA 4IQ0A 2WF6A 5ER9A 3R9XB 4LHZA 4URUR 1GL9B 1E3TA 1YMQA 2F1RA 2IHUA 2R6FA 4FGKA 4V0NA 1NN3A 3NHLA 3WMEA 2R87A 3DR5A 4L4SA 5U1PA 3HSYA 3VHRA 3COVA 3OG9A 3VNQA 2GNPA 2KLHA 3CH7A 3JATA 2OHIA 4G41A 2J32A 2ZE7A 3CN9A 3NHRA 2BONA 4PLZA 3L7YA 2FW6A 5LZ7A 3ZGNA 1YQQA 4JN6B 3VMFA 4EG3A 3WK8A 2CHGA 3EDCA 5AK6A 3VUFA 2UYOA 4E2WA 3ZIDA 3MRXA 2WM9B 1OHHA 4B4KA 3AYZB 1EQUA 3LBNA 2OHJA 2AFIB 2YASA 3I76A 3JXEA 5A9SB 1D5CA 1M2EA 1ZOIA 3PRJA 3OIVA 4RETA 1GQRA 2TMKA 4Y2PA 2G9UA 4C0QC 1RBYA 3WIUA 1D4FA 2QI9F 1IM5A 3GGCA 2NTJA 2ZROA 3EIWA 3DKRA 1YJCA 3ZWNA 4OFBA 4XKJA 5ESWA 2O52A 1POXA 3GRAA 2Q6LA 3UEOA 3Q8MA 1TKAA 4I19A 5EGSA 3WLPA 4CUZA 1CZNA 4UAVA 3IHTA 1LGYA 2R8OA 3O0TA 1NNEA 1ID8A 3UB4A 2PUWA 3HJGA 5DYYA 3GXBA 1QRAA 4LDPA 4PNPA 1JG1A 1Z07A 4UM9B 4LNHA 4I55A 4IJMA 3DKIA 1N2ZA 4RA6A 2FRDA 5EJ5A 3PR1A 4PC7A 4FFLA 4OJKA 3NOXA 3BCHA 3F5FA 2VUSA 2YH2A 3GK3A 4JNCA 4JIGA 5CDFA 3U3JA 3NBFA 5KVAA 2O2YA 1G6Q1 5CVCA 3T9CA 3D6HA 5EUCA 4F11A 4GKAA 2QB5A 3BS4A 4HZIA 2BDUA 1RAEA 2RJOA 4RPIA 4I1PA 1HXHA 4H7JA 3FA2A 1NXQA 5DGHA 1EQ2A 1L3BA 5GINE 3CUYA 4FGZA 1UJMA 1H2BA 2EG9A 2JBAA 3EGXA 4IY1A 3F9CA 2GYYA 3KCQA 4B7UA 4QECA 4OPMA 5E9AA 4FMDB 3HB1A 4NDNE 3I3SR 3PITA 4QTTB 4O33A 5MHTA 1D2GA 3BWYA 521PA 3GZJA 1EJ0A 3P19A 2NVWA 3TTUA 2YWBA 3DVRX 4H18A 5DCYA 4ZAWA 4XWWA 1Q77A 3SGLA 3I9OA 2WKQA 2EF1A 3U48A 2R4TA 2YN0A 2W6JA 4POAA 2ORWA 5HWSA 3E9CA 4YP0A 4CHTA 3TLZA 2JAPA 3IQEA 4R8LA 2HHAA 3ML1A 1XB2A 2VEDA 4FCCA 5C52B 4WZZA 4CKXA 3EGXB 3R3HA 3ZW7A 1J5XA 2ZIFA 3GROA 1L5SA 1DIRA 4C0HA 3EQ8A 1XYGA 2NT3A 3TRJA 3TJZA 1XNJA 3ZWXA 2AWOA 3A6PC 1ZVKA 2C83A 2ZJAA 1R27A 1Z0FA 3NU1A 2C7PA 1E6UA 3WLOA 3V8NA 4LF5B 5KQLA 1GZ5A 2GETA 2OLKA 2ERYA 1UZNA 2ZSKA 1EDBA 3KHUA 1M83A 4MPDA 1KY4A 2CCJA 1VPDA 5GV7A 1KETA 4TWIA 4DXAA 1I3OA 2PZLA 5BW6B 2H59A 2O06A 2PCLA 1UEXC 4FHGA 3AG6A 2YOHA 4FKBA 2Z8ZA 5HOEA 4DBZA 1XEWX 1IJFA 4M0KA 5AVJA 7ADHA 3ANSA 5LPNA 4YJ2F 1E4YA 1U0EA 1MB2A 2QMZA 4FZ3A 2WSIA 3UK0A 2C8JA 5E8RA 5BSHA 1A5SB 2FSUA 2PX2A 4I1YA 4NE2A 1R6TA 1YZUA 3B1FA 1THGA 4FZJA 4XLZA 5C7LO 3GT4A 2UXCB 1FDTA 3MOGA 1RXUA 4JJZA 1I1OA 1B0ZA 13PKA 3B9PA 3EEQA 4AROA 2WJZB 1JECA 1AS3A 1V1MB 1UJ6A 2Q99A 4UBIA 2HU5A 1ZVVA 1BDMA 1RI2A 1JFRA 3BUSA 4OOEA 4OSEA 5E4JA 1EWTA 2DPMA 4RM2A 3A6DA 3CNBA 1KMQA 1V4BA 2WYVA 2WAXA 2E21A 4F6RA 1TCUA 2WKWA 3GD5A 5BSKA 3LKVA 3CLRD 1IVSA 2Y2VA 1NW3A 3BM5A 2QN3A 2IEAA 1COWD 3JWGA 3Q2KA 4RUKA 1XMIA 3NFRA 2BGJA 2ZS9A 3C43A 1Z0SA 4EKIA 3H11B 5KNCH 2J59A 3CRNA 1C8VB 2JW5A 1F1BA 2R0QC 2FFHA 1B8UA 5CU7A 5LQAA 4GBED 1NQVA 3PD7A 2G9ZA 1DBWA 1P4AA 3DE2X 3E48A 1P1CA 1XEFA 5J4VA 1IN5A 1JFVA 1D03A 2I7TA 4E07A 1DQPA 3OLYA 2CJXA 2P5TB 1XA0A 1E6KA 3I4FA 3MXTA 4KP7A 5B30A 3DWEX 2PZ8A 2AC7A 1YA4A 1SXIA 2B8EA 1VP3A 2P2CA 1K2WA 2PX4A 5JSYA 3RM3A 4J91A 5CEEA 3SG0A 2M6KA 1QS0B 3GGJA 3IOMA 2VJOA 4NYMR 5B6PA 1MABA 2QMYA 5ITSA 1E1CB 4DXDA 2HNAA 5BRNA 4ZRMA 3TOZA 3D8TA 4RMNA 4EG8A 1ZS9A 1KIMA 4L8FA 1BD4A 3U3ZA 4MGYR 4G0ZA 4D79A 1YUMA 1EFPB 2Y1GA 2XQVA 5I3CA 4UMFA 1C9EA 1HLDA 3EGOA 3GWZA 4IDGA 4MVJH 1TOAA 4LZJA 3CTPA 1KEPA 1LZKA 4IX9A 3PQEA 2D0DA 4E5VA 1LK5A 3TZKA 4IZIA 1FP2A 4KQ1A 2XEDA 3VBCA 4HVLA 5FNZA 3GY0A 3SR4A 1K6IA 1KJIA 3CNNA 3GA7A 3KSDO 2GSDA 4N4AA 3QF7A 1WV0A 3P71T 4D9GA 3U6KA 3BB1A 5JC1A 2FMUA 2HU7A 2DECA 4PO3X 4M9RA 4HDOB 2VP3A 4MRAA 3WNVA 1ZGJA 3IIJA 2ZANA 4HQ0A 4I5GA 3X2FA 4G4JA 4CDGA 1AF4A 2CNNA 1FJHA 3GG2A 3PBKA 3OUUA 4KBYA 4PG8A 7REQB 4NCAA 4R1PA 2L69A 4KKXB 3KEGA 5HXAA 5FPTA 2OCXA 2Y1KA 3R24A 5HJ5A 1CT9A 4NZYA 1GPLA 1HE8B 3BDAA 5DW3A 1Y33E 5L4SA 4LCBA 3QPWA 3TJMA 4D9FA 4LF8B 2OL4A 3OKPA 1NQXA 5C8DA 4RVUA 4KQ2A 2QRUA 4RKRA 1XDDA 3GMIA 1IWPB 3RRJA 4JOSA 1AUVA 2BI7A 4EPYA 2GBLC 3QFHA 4G0NA 3TE7A 4XPZA 1D04A 1PV2A 4TV8B 4HWKA 3L0YA 1D6NA 3DFMA 3EUFA 2GCGA 5ALVA 3TS1A 5CUQA 4M9QA 2FCRA 3GLUA 1Y8RB 4LHXA 1M5RA 4HDKA 3TTYA 3UHAA 2ZRNA 3ENZA 1WCIA 2Q3BA 3C4QA 1EBBA 3Q5GA 2FPIB 4H4CA 5DBHX 1GQSA 1CP3A 4TV9F 1H9AA 2CUKA 2GA9A 2PX8A 3FOAA 2DGDA 2ZAMA 3L6UA 4MVJA 1VLLA 2J3JA 3EIUA 3PWTA 4ZVNA 1XL0A 3FMOB 1JH9A 3P4YA 2FZ4A 1NYRA 3D02A 1KAOA 1JPNA 3GFQA 3VKHA 3DTVA 2YXPX 4MUNA 3WP0A 2WDZA 3A1FA 1KWGA 5LVAA 2FRXA 1E69A 2DC1A 1KO1A 5AOAA 5GJBA 1B14A 2P41A 4JU9A 2JHFA 5E2AA 2Z1DA 3IAUA 5CNMA 3N6XA 2XUOA 1ZNQO 2I91A 2EFHB 4KXQA 2QMOA 3LP6A 5K3FA 1E0KA 1TFUA 3GP5A 3PENA 4JVMA 1MQAA 4C0AC 1KOLA 3DLAA 2FJPA 1Y0BA 4A27A 2OMKA 3V5NA 1O0BA 1MBZA 3ANTA 4MQFA 3PLAE 3GN2A 4XIYA 5LMCA 3ZIUA 1THMA 3Q3CA 1SBNE 2HA4A 2NU6A 5HUJA 2G17A 4PHGA 4RTQA 4AKGA 2NQ8A 2C2GA 1QYCA 1Z2NX 2I5PO 4PW0A 3UWKA 1W96A 2FX3A 4MVCA 4NFSA 4RJKA 1LBQA 8OHMA 1UP6A 2XNCA 3JQ9C 3CVWA 2ZUWA 2WP8J 3R5HA 1VLVA 2GEUA 1LU9A 4G4IA 5EXDA 3C8UA 3DL2A 2D1SA 3UOWA 4HS4A 2EQAA 4F9GA 7MDHA 3AXSA 1A7UA 1PTJA 1I24A 1ADJA 1TM2A 2H6EA 3AU8A 4JMLA 2RC5A 2W6NA 4M0LA 4M76B 4XGNA 3RPEA 4D3XA 1PFYA 5C81A 5CEFA 2O2JA 3DFIA 1UMDB 3V2IA 1YZGA 4DJJA 1Q12A 2F43A 3LOUA 3REQA 4HGZA 1ZJWA 1TTPB 3PEFA 3U9TA 5JI2E 3ER6A 1W2WB 3VYWA 2P4QA 1E0DA 3KXIA 2XWQA 3Q9UA 2CDAA 4OYYA 5FOXA 3HP7A 3RS2A 5HJ7A 5IXJA 2JBHA 1W87A 1SZDA 4QOJA 1NUAA 3OH8A 2FVXA 1O1YA 1XTZA 2HSGA 2GGSA 2OV4A 4GPD1 1PNOA 2JATA 4IVRA 3I53A 4NS4A 1IZ7A 4JGBA 3INNA 2HA3A 1MB3A 2IOFA 3DAGA 3GPDG 4GZMA 1R9NA 4OIMA 3OZVA 1GQQA 2FHPA 2O23A 2XBUA 1WRBA 1D2HA 1K88A 1HDZA 1UBLS 2HAEA 4K88A 4PEVA 3TNYA 1OFHA 4RH1A 3HXQA 4JJFA 2OV3A 4UEJA 3BD7A 2JZNA 1L7XA 3EZ2A 3KUCA 1UCFA 3SBDA 1AN0A 2RCYA 3KVOA 3P8ZA 4MVJP 4RD2A 2X1VA 3NAGA 3W8RA 1HPLA 3NH6A 3A2KA 1SIBE 3B1JA 4NDZA 3DPUA 5CK5A 3BH0A 4XI9A 4QWWA 3QXGA 2WSMA 2ASEA 1OMOA 3FNFA 4OBEA 4UEOA 4LOAA 1B0AA 2ERCA 1WAMA 2J0SA 3IV6A 1D8TA 1RTTA 5CX1A 2HF9A 4BMDA 4C4PA 3AEUA 1A9ZA 2ZS7A 2H0AA 3EXG1 2L19A 3QUQA 2I6UA 3HCEA 3ER9A 4EJ2A 3HRIA 4AAYA 2MSLA 4ZU1X 3USCS 3ZK8A 4YMLA 4TLCA 3UG6A 5LDDC 1ZD8A 2A9VA 1M34B 2NGRA 4NYIQ 1V16A 1PR4A 1YL6A 3ITDA 2VQEB 2CZCA 5D3MA 2XUGA 4JI8B 1KEKA 3ESAA 4ND7A 3CE6A 2OZLB 5FI1B 4GZ3A 3BFPA 4NPHA 1EGVB 2IP4A 3B60A 4L8VA 2B69A 4O2BF 5BT8A 3R7WB 3ES9A 3JZMA 2XE8A 3RAPR 2EHJA 1WCWA 4P4SB 1A5ZA 2QAGC 1G4AE 1I3CA 1YB1A 1YSCA 2Z95A 2APJA 1DBRA 1R00A 1U0RA 2E49A 4IXMA 4EG0A 3LP5A 4P0PB 1UP7A 1OCEA 1ZZEA 2WE8A 3RVRA 1EVYA 1L5MA 2J3QA 3CF4G 5F78A 2LGJA 3MIZA 4D9IA 4FX5A 2W6CX 2J09A 5KQSA 3MMZA 2QX8A 3HO8A 4WBXC 4PRKA 1R0RE 1KO8A 4MGKR 1JPJA 3TEMA 2OFOA 1H8HA 3I37X 3INRA 3PC7A 4HB4A 4DIBA 1O8BA 1CRQA 2QNBA 2E48A 3K9FC 2HO5A 1CTQA 1RI5A 1BEZA 4IF4A 1H2YA 1ZLXA 2B6NA 3T3IA 4BBZA 2VJAA 3K32A 4D9KA 1RXIA 1XZCA 2H7XA 4Y6SA 1MJHA 4U2BA 3RSGA 3O3CA 1E9RA 3L8ZA 3D0RA 4ZQBA 1ZLYA 4WESB 4CFZA 4DR4B 1XR3A 4JLWA 1OY1A 4P81A 2JD1A 3KD3A 2M6LA 4AP9A 4BO5A 4JKYA 4Q34A 1GITA 1WY7A 1NVKA 3FNQA 3MD0A 7AT1A 4HDQB 4NZ9A 3CMCO 7MHTA 1RZVA 1GTMA 1SEPA 1L8QA 3AKCA 3MERA 3ZIAA 4M0PA 3EOZA 2DRIA 3ANYB 1V11B 3RCBA 5JXGA 3EF0A 1QGYA 3AF5A 2G28A 3QKSB 2FX5A 3KJZA 3TOXA 2Q5FA 3WR5A 1YZVA 3IXQA 2G8NA 1ZCJA 5AK5A 4B8YA 1KF0A 1JILA 4HWRA 5LKAA 3ESZA 3GUVA 2X41A 1TPZA 1PGQA 4Q3OA 4Q7EA 4OHRA 2AV6A 1QO7A 4L72A 1FFGA 5AI9A 3QOFA 4JLUA 3V00A 4D43A 3U44B 3O8OB 4DC1A 4EFKA 1T36B 3AFMA 3AESA 3I72A 1KMHA 2IZ7A 3AB3A 4GOLD 4R1LA 5JAZA 1SZJG 3T4EA 4KNYA 2ARKA 1S3IA 3TF5A 4QDXA 3G0CA 4N5MA 4UEQA 4NBNA 5DHAA 3HEBA 3ZCRA 3GJ5A 4BQRA 2J3EA 2OBBA 3FTNA 4RS4A 1FDUA 3UV6A 5C7YA 5KMGA 1EXNA 4HXFB 1R0CA 1Q20A 4WEQA 4BMYA 3IVCA 1RYDA 3KHSA 3BA6A 3F5SA 4AMGA 1P61B 3I83A 2H3HA 1CUJA 2DLCX 1ZH6A 1P5ZB 4G01B 4TTPA 1YFLA 1KH3A 3AV0B 1JN0A 4TTTS 4ABTA 4JYAB 4OHOA 2GEBA 4GQAA 4G5FA 1E98A 5DN6A 2G7ZA 4HH3C 4DC0A 4DMCA 4QFBA 3KBBA 3KWFA 1MJ5A 2GLTA 4HYQA 5NULA 3V7UA 3OCWA 3A3YA 3B7GA 3HZOA 4MRMA 5JZBA 4KDCA 4YJHA 2GXAA 3LU1A 2HI0A 5BNIA 2W7TA 4I2NA 1YZNA 3TTXA 2OCGA 3RYCA 1SR8A 3CEJA 4JC8A 1I94B 1GM5A 3WBJA 1OBFO 1RAIA 1YOVB 2QG6A 1E7MA 1XTBA 1HMYA 1EFRA 1X7XA 2CXTA 2VZ9A 4X45A 3A8TA 4IXWA 3V2GA 1D4AA 2IEGA 2PJDA 1DWQA 3E58A 3HTXA 1FC0A 1A9QA 2QK4A 2OQIA 4OP2A 4KO1S 2JHPA 4ONEA 4MUKA 2J67A 4MGIR 5CIWA 4DUPA 5L6LB 5H8WA 2NV2B 2P7HA 2X2EA 1H4VB 5F33A 1F4LA 1V39A 2ADMA 3FWPA 3O74A 1AGNA 1Q7GA 4CNQA 1PYGA 5I45A 3G1WA 5E0KB 3DZHA 1KZGB 2RI1A 4MXDA 1YI8A 4RTOA 3HCOA 3M49A 2H1LA 1Y89A 1N0UA 3FYUB 4XJSA 2JD2A 1J06A 4NZNA 3I12A 2IV7A 3UM9A 2WMDA 1H6DA 3FW1A 2NU8A 3RDPA 3U09A 4F9FA 3SBOA 4IF6A 5FB3A 1XU4A 3ADPA 4JITA 3HGTA 3D8NA 4ZU3A 3T5DA 4BMOB 4JLSA 1PFUA 2QTTA 4HR7A 1XMVA 4H1VA 3LBIA 4K9OA 3O84A 2I7XA 4NCJA 5DBOA 1CIJA 4J1TC 5LYJF 4MPTA 3ZY5A 3K71B 4FHEA 1ZK2A 2ZJ3A 4L78A 3CW9A 2H9IA 1NPDA 5A5VA 3FFTA 4F93B 4AI6A 1P18A 3NEPX 3Q7TA 3VC3A 5IRCD 2O0HA 1P1HA 1VHTA 1BSVA 2OAP1 4FNGA 5JVDB 3M6XA 3K8ZA 3FCXA 1WM1A 4RBNA 4R7GA 5J40A 3ZNOA 5ED4A 2WTEA 2ZG6A 3KR2A 3QKTA 1L7BA 4Y2HA 4BVBA 5A4JA 1G64A 4D5GA 1X1BA 2MYTA 2DUMA 1QR6A 1YHNA 2PQ0A 2B61A 2GD0A 3HXKA 3IEKA 1PFKA 2B7BA 2BZ1A 3PDCA 3V1LA 5EJGA 4YVFA 1HV8A 5C5CA 1GNQA 1JZTA 1L4MA 2AMVA 3CXRA 1Q19A 4F6CA 5K2OA 4E5NA 4KO4S 1L5VA 1RZRD 3Q8KA 2J5XA 2MDTA 5DIFA 3CJTA 4DLXA 2X3UA 1EK5A 4J1TA 1T1EA 2QN8A 3ETGA 4RHEA 1YQUA 4F86A 4RZXA 1AHNA 2XXBA 2DR2A 4QJ4A 2CNLA 4J75A 4DILA 2PSDA 3WJ1A 1KGDA 4Y2JA 1EXMA 4KBGA 3E1KA 5K3AA 5KKAA 3QBDA 2V7BA 1JVSA 1XRPA 1MTOA 4Q39A 3SSAA 3X2SA 3N6RA 4O29A 3ELWA 3K1AB 3CX3A 3TZCA 4ZZ3A 4LA4A 1NF8A 1YRQA 2Q7OE 1FLNA 2NZ8A 4UJ5A 4TS3A 1C8BA 2WEKA 2VBFA 1XKTA 1U6JA 2JNWA 1U0TA 3OX4A 4HAVA 1JJ7A 4NI5A 2A78A 2A9QA 4FUQA 5HMLA 1SRQA 3L1IA 2FEAA 3ZUPA 1U0SY 1KMHB 1GTZA 4MS3A 3ZVNA 3FYHA 2Q8PA 3PFFA 1OZFA 1S6YA 1ZD1A 4KJXA 3KQNA 1ILWA 1Y63A 2J9XB 1E5XA 3AJDA 5HCNA 4X54A 3VXKA 4GUAA 4N12A 1Y8QA 1Y5IA 3QVVA 1SCIA 4TT8A 1QGUB 3HP4A 2ZB2A 2C54A 1MZVA 2AG0A 1XEWY 3THWA 5JG7A 2MSCB 4LF9B 4WADA 2PSFA 2PQMA 2WABA 3R2JA 4WLEA 4J2TA 3R7FA 2WU3A 1IZYA 3C5CA 3LNCA 1RM3A 4WK6A 1AX9A 1I4WA 1MG5A 3PDUA 4HXGA 4US0R 2Q9CA 3Q7PA 4LDJA 2I2DA 3QVXA 4MYCA 1TUIA 3VU9B 1S1MA 1KZ9A 4YA6A 5LZ4A 1WXFA 1FDRA 3TEJA 1YI1A 2CJWB 3EIOA 1E77A 3DLCA 3T9EA 4NV0A 3MUOA 1SC6A 5ICFA 1RYYA 2HRCA 1QIHA 2UUOA 1XJCA 1E3QA 2C3MA 2W11A 4HLDA 2W2OA 3I6QA 3NP9A 2PZAA 1FDWA 1BE6A 2O2ZA 3UJ8A 2O6LA 3ONDA 1SB8A 1DTEA 1U1IA 3FRHA 3LQKA 1G3IA 3LDHA 2VEOA 3NYIA 3B85A 1LPBB 3AR5A 4QYXA 3P9ZA 5D7BA 3ZHRA 2IY9A 4EGAA 1QKKA 1JMYA 2PH1A 3EXAA 1Q6ZA 4K03A 4Q6BA 2EIXA 1PGNA 4Y1EA 1VRVA 1OTYA 5IJ0B 5M29A 2ZTSA 2KMLA 2V6BA 2VHUA 4RLQA 4U6QA 4HYYA 4BGUA 4KWCA 4OREX 1E1KA 4IIDA 3DAPA 1GPYA 2G25A 3QTTA 2VRWA 4LZNA 3SC6A 5AW4A 2CNKA 5DNVA 2W2LD 2QTVB 2XZPA 1USKA 1Z2OX 5JH7B 4HNGA 1CNEA 3GLQA 4MYRA 4AX4A 4YJ3B 2X15A 1MVLA 4TWZA 4X8HA 3VU3A 1RQ7A 2QV7A 3E9QA 5EGNA 3UGQA 3EQZA 3MLAA 4W7SA 1F2VA 1O08A 4GKVA 4AY3A 1JE0A 1UKBA 4BMPB 1CRPA 4JP3A 3UJ6A 5LP6B 4GNKA 1BWRA 1YE3A 2O7SA 1N92A 1NVUQ 3DDWA 3JRNA 4KJZA 2ZWMA 3B5JA 4YLGA 3IDQA 1GFIA 3KZOA 1ZNYA 5AJTA 3UN1A 3A9SA 421PA 4NCNA 5KX5F 4OLAA 3WBBA 1JX6A 2VXOA 4P4TA 1G9SA 1GZ7A 1W44A 2ECFA 3DQPA 3ED5A 5D1HA 5LP1A 3FOZA 3MS4A 1R5JA 2WAAA 5CLHA 3C1OA 3GA5A 1C4KA 4F91B 4G1EB 3S8MA 2SNIE 2O8BA 2X4LA 5ESXA 4YYZA 4Q9KA 1ONBA 1KMNA 1DV1A 4G5YA 2F3RA 1JJAA 3D3QA 4OJMX 4W5OA 2PVCA 5ILQA 3FOBA 3LZDA 4ZO6A 3ZR4B 2CKDA 4GZ6A 1Z74A 5DNAA 3Q3GE 3WL8A 5BURA 4XQGA 1NXSA 3MXOA 1KKMA 3GP8A 1VJ5A 3ZCQA 1QDEA 2JZOA 4BCCA 4MGEA 3OCCA 2ZP1A 3A3PA 4ZU6X 1XTKA 1OWMA 5CA0A 4KR2A 3MJHA 2W2KA 4YT4A 2NYVA 4EUFA 3SQWA 1ZK4A 2OB1A 3SQLA 1I4OA 4MQ6A 2OM2A 4FSDA 1RRMA 5EPOA 5HJEA 4TXLA 3VI4B 2RK3A 2ZBUA 1PJLA 4RHFA 4PC6A 3RAEC 1W88A 1ZA2A 4YREA 4AXBA 4UNSA 2FY8A 3NMUF 5M2QA 2DZDA 2FW7A 1P81A 2ID9A 1ZN7A 1RRFA 1XJ0A 3CLUD 4YRSA 2AE1A 1DAPA 2XTJA 3F8SA 1SG6A 3DCIA 2NP6A 2M1ZA 4C6HA 2VDWA 1SA0A 4G1UC 4C0XA 3N8NA 2XCOA 3WSVA 5IZCC 2Q9AA 2Z30A 4NBWA 1H2HA 3OQHA 4TUYF 2DERA 5F64A 4B5KA 5JNWA 3KJXA 2IOYA 3CKYA 4JBIA 1T6YA 1HK7A 1T13A 3KLMX 3R0JA 4NZOA 4FDAA 4EIWA 3IBFA 3AR8A 2ZXEA 4TKVA 1A8IA 5FXMA 4E03A 1DFGA 1GEGA 1P6UA 1XGKA 3CRRA 1U2ZA 5CURA 3ZW8A 2PY6A 1HR0B 4GMXA 1BKSB 1MC1A 1NBMA 1TU4A 2Z9BA 3QXSA 4MUIA 4PTYA 4PZAA 2IP2A 5FBKA 1S89A 2GN4A 3E2IA 5CAEB 1CVRA 3L49A 3S7ZA 3WGTA 1JHAA 4CM1A 5F23A 1R0WA 3QH4A 1DADA 5F5NA 4UNRA 2GKOA 4IW3B 1R5BA 4FUTA 3I5YA 4MRRA 1IZ0A 1RHKA 3GJ8A 1KJNA 1F5NA 1KH2A 1J9ZA 4KQCA 5T67A 4FFSA 1A9YA 5D5PA 3F5DA 1X86B 3PNSA 1EZZA 2QJWA 2V7UA 4JIMA 3AR7A 5IZCA 1DKPA 2X1HA 1M2OB 3LVRE 2ILTA 4I4TB 4WZBA 2AJCA 5FBQB 2HDNB 4RYLA 3RT7A 4EK9A 3A9WA 1Q84A 2EARA 1Y4ZA 5KSYA 2QRPA 1ZXXA 2KI5A 4P54A 3ZD7A 2PMDA 2PX5A 4WZAE 2D0PB 5TGTA 3THYA 5GPBA 1IMJA 2W6ID 5ICEA 1YQEA 5LU9A 2EDAA 1N6KA 1NWHA 5DO9A 3ID6C 1GT91 1PG0A 1GUDA 1IULA 5SY4A 5JW6A 1A4IA 3TL6A 2X2FA 1RC8A 3EVGA 2WTNA 2A88A 2Q4BA 3MTJA 2DXIA 3MJFA 1YNSA 1AXEA 3KBOA 3WLLA 4CCYA 4EI2A 4EZEA 2I2WA 2Q2OA 4BDTA 3QE0A 4YRBA 1R0ZA 1TUGA 2J6CA 4N0EA 3OOWA 2I99A 4QOEA 3AKYA 5C46F 1MJGM 2WU8A 4P35A 1B43A 5AJHA 5THXA 3CZ9A 2B5VA 3D4OA 4U6NA 4Z3OA 4NX2A 1L7VC 3HPQA 4G0PA 2MU1A 4O4IB 4PLCA 3WDMA 5K01A 2H18A 3FIUA 2OC9A 3GWGA 3HWWA 4D8TA 1QVVA 4AMZA 4HK4A 1LLUA 2RGCA 3FCCA 2P9BA 1L1EA 2MWMA 2NSJA 1T9ZA 5CXQA 5LOVA 4ZO4A 4WT7A 1IQ0A 1EX1A 1SAYA 1P3Y1 1A8UA 2CUTA 2WICA 3LV8A 3OBIA 4J0FA 4LGCA 4UVEA 2OXCA 2DSNA 4GR4A 4UZEA 4KQIA 5IT4A 1UQTA 3S1LA 1JFFA 4LFAB 3ROFA 4L16A 1IJBA 4BZXA 1PR9A 4WOCA 5AKEA 5FCDA 4ZCTA 3JZAA 2WWXA 3OZ7A 3RUEA 4O8ZA 3S2YA 2IBTA 3IC5A 4Q02A 5A6SA 3GFTA 5AVOA 4Z4IA 3K0AA 1QCCA 1PUJA 2W4QA 5BW8A 2Q0HA 2FR8A 2X9NA 4XUDA 4UDNA 4G36A 1GPNA 1P6XA 1QZXA 1LBTA 5K7SA 3NM4A 3P4XA 2NXWA 2FZEA 4PCVA 2AKEA 1ZM4A 4CF7A 2YFYA 1V3TA 3D7LA 4P31A 1OH6A 3M6UA 1IBMB 4WNAA 5CVVA 4ERXA 1GAWA 4UUAA 2Y0BA 4FR2A 2FWJA 2WINI 4WVFA 2XZLA 5B53A 1C0PA 1ECGA 3WGHA 4EY4A 1OLSA 2UVPA 1O94C 2FU5C 3LHSA 3JYQA 1E7WA 5HMMA 2GM3A 2XJ9A 4RD1A 3ZNNA 1XYYA 1U7PA 3T1YB 3HYLA 1QYWA 5FEMA 1W76A 4FYJA 1II9A 2Q28A 2P2LA 1ADBA 2WWTA 3L07A 3Q9LA 4MITA 1P29A 4MUFA 3WYBA 1VL8A 2FNAA 4DABA 3STYA 1ORTA 1UBGA 3VC1A 3GC6A 3I1FA 1RXCA 2GJ9A 3L1UA 3STXA 2FKNA 1G8FA 1WW3A 1E4OA 2GAOA 3CR7A 3JWJA 4GOMD 2NG1A 2XPCA 3DHNA 3TCNA 1CUFA 1U5BB 4RD4A 4DXHA 3AT1A 4AWXA 1JR2A 1W4RA 1P31A 2Y9MB 3OLCX 5LWHA 4EP1A 2C2MA 3HB7A 4JVNA 4K9RA 1UKAA 1JBQA 1QTNA 1XJWA 1ZIYA 2FMIA 3JWIA 1R15A 2V03A 3N2EA 4PZEA 4ZQEA 2XMSA 4Q4HA 4IHKA 4XFKA 1OGYA 5HIIA 1JIIA 3AJEA 3BXEA 3M7IA 1M72A 1XVLA 4CIYA 2QUAA 3D81A 2EW2A 4RVOA 1VC2A 5K0GA 1P45A 3ZTWA 5PNTA 2IHJA 4M0UA 5B1EA 2HHCA 4MJLA 3ADDA 3GLIE 5DE3A 4NH4A 4WDRA 5TF0A 3PD0A 1CR4A 5B7NA 5E6SA 4E2ZA 4KAAA 3C8ZA 2B1IA 3VQTA 5KYNA 3KTAB 2JCYA 5T57A 3VSBA 3ZLVA 5DRTA 3DC7A 3QITA 2NQ2C 4RF3A 4CN9A 3O8RA 1EGAA 3T94A 2LDBA 2HO4A 4EJMA 3U7JA 3RC9A 1B6SA 4ZHQF 3UK2A 3HWRA 1Q2XA 4FC6A 3S2IA 4XWGA 5LNK1 2PRIA 1B2RA 3M1IA 5C8XA 3BCUA 4DV5B 5JLAA 1MC5A 2FPKA 1T0BA 3OZWA 5BWCA 4Q1CA 1QQ5A 1DEKA 2Z8YM 4KQXA 1WXDA 3O7MA 4Q21A 5H0IA 3RWBA 4RQAA 1QM5A 2IVZA 2G36A 5H1YA 4AW9A 4YUXA 1N32B 3TNDA 3ZHUA 5H70A 3PT9A 1GKYA 1Z5UA 2CLLB 1LI4A 2QR3A 4X90A 3KAQA 4CMIA 2GNAA 4DMGA 4WD3A 4M37A 4MP6A 2R44A 2EX4A 3Q9SA 4TZ6A 5JQGA 3LBYA 1YDMA 1CK4A 4UMEA 2G1JA 4UQOA 3TLYA 2HQSA 1CRWG 1WO8A 2QPOA 2R6ZA 3HU1A 4QOSA 4BX9A 1HM5A 1K5HA 2FXVA 3FVWA 2I03A 1HA3A 3OJCA 1U3DA 1XCJA 5JLJA 4MW4A 4V0MA 4KB5A 1KAGA 2DEUA 1J2RA 1QH9A 2YV2A 3BWMA 5ADUS 4IR7A 4LHEA 4R2XA 1AB6A 1Z18A 3N2KB 3HJNA 4QVGA 2VYND 3W2GA 3ECCA 3O90A 3A1SA 4DG9A 1CDZA 2OK8A 1CC1S 2KB0A 2C3OA 3R0IA 1XXHB 3GAZA 1RM5A 4MIOA 1BMQA 4Q3EA 3RFVA 3WC4A 1KA9H 4UHCA 5FPQA 2ZLBA 5LDGA 4YJ3F 3JVIA 3ST7A 1YBVA 4I4CA 5JH7F 1OWPA 1W36B 4JLKA 1WBJB 4PXYA 3M9WA 4NU5A 2FW0A 3TFQA 3X43A 3DBRB 5J5AA 2EZUA 3TRDA 5ALZA 1P4SA 3QYJA 5HFJA 1QQBA 4BLPA 1EFVB 5JHGB 4CLOA 1Y1QA 3BREA 4J1NA 2WV9A 3RRBA 1MX5A 4JB3A 4PX3A 1X7ZA 3A6GA 1BW9A 1XELA 4B2LA 1C9MA 1X92A 2CWDA 3RJMA 5CCBA 5AHOA 1TJ3A 1FW6A 5E7IA 1NX6A 4B0OA 2N1MA 2ETVA 4X7PA 1OYYA 4YCNA 3EASA 4BNIA 3A4LA 2AMJA 4O4JB 4J3NA 2EJVA 3PGA1 4EQ6A 1ECCA 2R6HA 1V8FA 3OE7D 4HX5A 5I7WA 2RKOA 5TPZD 4CIXA 5HFNA 4IIJA 4WY2A 4YMIA 2FN8A 2V6FA 5EWJB 3VRHA 3GLFE 4YPOA 1RWBA 2Y1OA 1YC2A 4EI7A 2C8VA 1E8MA 4ML3A 1E1RD 1MR3F 3IALA 4GNRA 1YO6A 5DGTA 3WX0A 1G20B 2CBGA 5CMLA 3M6LA 3OOEA 3T1VA 1U1FA 5IH7A 5TLSA 3A6KA 2E3JA 1LLDA 1H9BA 2PS0A 3GUUA 3HUDA 1IXYA 4RTMA 1HL7A 1JZQA 4D3FA 3OTIA 1PTJC 3QEJA 2DKOA 3R7LA 4O2BA 3FCUB 5ALDA 5LYJB 4B3MB 1BX3A 3WIOA 3X1WA 5AI4A 3MILA 3H6GA 1G59A 3ZV5A 4P53A 3JWPA 2QUKA 3B3JA 4ZV9A 3ZHQA 3BCRA 4B6PA 3EFBA 2ES4A 1N6PA 3HLYA 3LWZA 3HUTA 4QHSA 2X8AA 5AKJA 1E6EA 3FYSA 4DMLA 5DCLA 1MHPA 5C1PA 4QU0A 1T5OA 2VP0A 3MSCA 1OXSC 1EFUA 3WZMA 4W7IA 1F2TA 1YGYA 3NATA 4RD6A 4ZGWA 1OBVA 2IRWA 2ZB7A 5A4MS 2HMUA 3D59A 3WMWA 3IPXA 5HNKA 2XUFA 4M0MA 3SCZA 2WVGA 1PT5A 4H27A 4OK3A 2JVIA 2CEKA 5GP1A 5EQDA 2YYAA 1YH3A 2MT9A 4KPUB 2BR3A 4HNHA 2WYHA 1CDDA 3L3BA 5GQSA 4BMSA 4C4TA 3E4CA 4BLOA 1XCLA 2W70A 2EP5A 4FOPA 1NRIA 5D3ZA 2QSJA 4L85A 1NN0A 4RW0A 1IY8A 4JL8A 3ZGYA 5JEEA 2ON6A 1SCJA 1T25A 5KJCA 2JI9A 5LXTB 2FFJA 5TARA 1UP4A 1SVUA 2KE5A 1M73E 1G20A 2PL9A 2ZAOA 3NORA 4PF1A 4DDHA 3RTGA 5H68A 3BTVA 3MWGA 1QH1B 4TXMA 2FSVA 1IN7A 4EFNA 5B7GA 1RABA 4Z7QB 4FJ1A 1LVUA 2Q3EA 3DOCA 4RE6A 5JD5A 4TSRA 4M2LA 5IVHA 3VBEA 3FGNA 3PE6A 4IS3A 3A31A 4HTAA 4BO6A 5ALXA 1NTRA 4A0GA 1GCUA 3ZD6A 4QL3A 4RQTA 4HDSA 2QVGA 2E9SA 3HXOA 4QUHA 1H1TA 4XQ9A 1MENA 1DQSA 1U2GA 4J0JA 4FJ0A 3QZUA 1TQ6A 3EOAI 3IPCA 3V8RA 5KQPA 3VVCA 1BU8A 2FAXA 5LLSA 4JQOA 4TXHA 5BOSA 3IIMA 1V7PC 2BLNA 1H5QA 3VDRA 4BVKA 5L7TA 4YC7A 1RDFA 2C7BA 2OQ2A 2VHVA 2Z5FA 4GMHA 5GTDA 1O95D 3PLRA 4LOLA 3OLXA 4EL5A 1BCSB 3ETDA 5ECGC 1TMOA 5TDHA 1BNCA 1L4EA 2BEVB 2QIOA 1OE0A 3BGVA 3E5HA 1Z5GA 4A8PA 1CUVA 4Q6WA 4MI3A 1KR5A 1RYBA 1G5QA 1N1MA 2YVQA 3I9V1 3KR0A 1OB5A 4EB8A 3RD5A 4E15A 5FL7D 1NLUA 3C14C 3NAQA 3VNSA 1I8TA 5JARA 2ZUUA 5LLTA 4Q4HB 2R1ZA 5LYYA 4UAUA 4MRVA 2QW1A 2YN2A 3RK0A 4BJ3A 3B38A 1J7JA 5JAMA 1RYEA 3NBKA 4X20B 1ZMRA 5TS3A 3WK9A 2BHSA 4TV8A 3I32A 3NI2A 5LD2C 2Z4SA 1DB3A 3C24A 4MWCA 3L7KA 1AA9A 2IU3A 1J4AA 3CO0S 3DZ8A 2EFCB 3RTBA 5G4LA 1B2LA 2MIIA 4YV2A 3AKZA 1QHHB 1QE3A 3DNFA 4XOIA 4BP8A 1TZJA 2WOJA 5IKMA 2GJ4A 1DWPA 5AM5A 1I7LA 2HSZA 1E7QA 1O96A 3CNEA 4X1IA 5HDBB 3DTTA 4OFXA 3TPCA 1NIJA 1G8PA 2B3TA 3PUHA 5BN4B 4N6NA 3U7RA 3S7TA 2X42A 3D4BA 3R5TA 4RV5A 5AM1A 3RANA 1OKKA 4HGPA 1FA9A 3TAHA 4BNMA 1I3MA 1NVBA 4HYTA 1BVHA 4N3GA 4ZQIA 4DWJA 3EGEA 2IDZA 1MAVA 1V7CA 1UXKA 1EGMB 2VDJA 1RXYA 2O8FB 4N8DA 2AF3C 1K5GA 3P5SA 4TLDA 1SRRA 2CDRA 3VPAA 3MWLA 2ZPTX 2ZQYA 4D46A 1FP1D 3W1WA 3CY6A 2O7RA 3EQ2A 3BXOA 4M1ZA 1GAEO 4TKMA 1HNZB 1M6YA 1JVBA 1TM1E 3DSRA 4BVHA 2GZ1A 4WW0A 2LDXA 3A2NA 1JEQB 5DP1A 1Z35A 2JH9A 4ZHQB 3B9BA 1O57A 2Q3DA 2PD4A 1JI0A 3WRYA 1UBNA 2AXPA 1E7YA 2RIRA 4JUIA 3GAMA 4TKUA 3RJ9A 4GXQA 1NTOA 4YCDA 3ROPA 2EYQA 1T6BY 3D8SA 2QZSA 2OKCA 3NYQA 5J2TA 1NVMB 1PS0A 2X8LA 3P2EA 2ONYA 4KFUA 1C0IA 2VNKA 4R8MA 2IIPA 3LM8A 2IU6A 2R00C 1MX1A 2O2XA 3EPPA 3G0BA 3LUGA 4HEHA 3WAKA 4LK3A 4EPVA 4XARA 1DP4A 2UZ3A 1H23A 3NJ8A 1CR0A 2F48A 3LW8A 3TPFA 3KQSA 1G8JA 3I2GA 1GZHB 4AQDA 5C9ZA 4LRQA 5LBTA 2AEEA 1SM4A 3PWSA 4KODA 1YIDA 3WV4A 3SJUA 1XVAA 2JCGA 3LC2O 4BGDA 1H94A 1QH8A 1XRRA 5J4HA