4FOTA

Crystal structure of peptidyl- trna hydrolase from acinetobacter baumannii at 2.20 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 62
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4fotA00
4IKOA 4FNOA 2MJLA 5EKTA 2LGJA 2PTHA 3TD2A 3KJZA 5IVPA 4QAJA 4ZXPA 1RYMA 4LWQA 5B6JA 4JWKA 4P7BA 2Z2KA 4FYJA 4Z86A 3TCKA 3P2JA 4FOTA 3KK0A 2JRCA 1RYNA 2Z2JA 4DHWA 4ERXA 2Z2IA 3NEAA 3TD6A 2NAFA 4JC4A 4JX9A 4YLYA 3OFVA 1RYBA 4OLJA 3V2IA 4FOPA 4QBKA 3VJRA 4HOYA 4DJJA 5IMBA 4QT4A 5IKEA 3TCNA 4JY7A 4QD3A
chains in the Genus database with same CATH superfamily
2XRZA 4U2FA 1GG9A 2R9VA 1GA1A 3GWGA 1GPBA 3SX2A 1C2TA 5B4UA 5FF9A 2OZLB 1ZM3A 4PS0A 4JBHA 3JASA 3KR2A 4Q02A 2ATVA 3CM0A 1NVEA 1EVZA 3ZY3A 1OASA 3GFTA 1DU4A 4INAA 2H59A 4EA8A 2IYFA 1KJWA 1ORWA 2GBPA 5PGMA 5JSHA 4DCGA 4Q3KA 3TB4A 2QD1A 3GPDG 3WO0A 1H1LB 4W9RA 4YLEA 3RSLA 3ZY4A 4OHKA 4X65B 5EJ8A 4C2TA 1ZCBA 5CDUA 1HTBA 2VXOA 2ZSUA 1M1NA 3WTBA 4EO7A 4Q39A 2VNSA 4E08A 5JVDB 3WMEA 2QU8A 1HNNA 2AF3C 4BEBA 2PZAA 2D2EA 1YWGO 3KEQA 3KR9A 4UHFA 5BQOA 3W3AH 1A69A 2O2SA 1ZNQO 2XOEA 1CRWG 1PO7A 2PJDA 3T94A 4DNPA 4ND8B 5B2ZA 4RJLA 1FJ2A 4YCCA 2O8DA 3R6GA 1O97D 5B57C 3KSUA 1FRVA 1SK9A 5COAA 5BR4A 2A0YA 4R1TA 4RJIA 3QUSA 2AJ8A 3R7LA 2FZCA 4WLNA 1EM6A 3PNMA 1Y3DE 1ZK3A 2GVZC 4C21A 3UK0A 2F3QA 3FMIA 1H94A 1NBMD 4TYYA 5C5DA 1RJ9B 2EDAA 2ILTA 1ZIPA 3VU1A 4DUGD 4AN0A 1M2OA 1OT3A 4LXQA 4H2DA 4PRLA 5KVAA 2B2NA 4P81A 4P22A 4QHTA 3GRCA 3AZQA 3M9XA 1JQ5A 3BMCB 4IYRA 3TVDA 1Y1TA 5F64A 2N75A 5LLSA 1FXWA 3GH1A 2GK7A 2IYYA 3CKLA 3HDYA 1F4VA 1KMNA 1XFDA 4N8SA 4A73A 4FHGA 2HA3A 1A8IA 3BL6A 4YDHB 1P7YA 1II8A 1WCIB 5ESDA 4RTLA 4ZALA 4Y1GA 1KI3A 1SA0A 2AT1A 5U1PA 3WBBA 4CM9A 2QMHA 3DMFA 2WU4A 3GGOA 1XELA 3NTVA 2Z58A 3OY7A 1V3VA 4HRAA 5CA0A 5A3SA 2QLNA 4TMVA 3RTAA 2GHRA 2XECA 4JP2A 4JI3B 4QYTA 3H83A 2AK3A 2GF2A 3EXHA 5IJAA 2ZPTX 4X90A 3HKCA 4KN5A 4HLUA 4UUAA 4YWHA 1TT5B 2C94A 3X1MA 5F23A 4G4SO 3WQSB 4QUHA 2JGLA 1H2XA 4DTCA 1AZLA 5BWLA 1K08A 3Q0IA 2XYRA 1X7XA 1V4NA 4KO8A 4PPNA 1YL7A 5L8VA 4K8RB 4YYZA 1UZMA 2E87A 4JKIA 1YA6A 1E63A 3F6EX 2ZGVA 3QFHA 4O08A 1G8JA 1GDHA 1ZC4A 3AR7A 2JGDB 2W6OA 1BMFA 4XDHA 1JHUA 3LK6A 1GILA 4AQDA 1PF7E 4R68A 5C7IO 3N0WA 3I12A 4TLCA 4EI7A 1B3BA 2H08A 1DEOA 2SHKA 2PE5A 4B0PA 3SKVA 3GZNB 1UJ4A 1YOVB 4XQGA 2P9GA 1H9BA 4IWXA 2VZ8A 4FWIB 3GA7A 3HCOA 3KU4A 2BLLA 3BB1A 4DCSA 1SG0A 4R1OA 5EP1A 5FTMA 4D9FA 3TMYA 1E2NA 1H4TA 1LU9A 1BYIA 2HO5A 4L5JA 4MKXA 4IJKA 3W1WA 4W9NA 4C4YA 3GJXC 2PUCA 3N39C 4ZAXA 2SKCA 3AY6A 2H4YA 2ACWA 3P9ZA 1FUEA 4IDCA 1YVUA 2D0PB 5KKAA 2H31A 3RVJA 5DX8A 3RC2A 3UJHA 3AUSA 2D0IA 4RFVA 2L17A 1WR8A 2X3UA 2Y76A 3ETHA 2J5KA 3L6BA 1XL0A 5GJCA 3RNLA 5G02A 3FOZA 1ESEA 1N4AA 4XYGA 3TF5A 3NJ8A 3ZY6A 1DQZA 4U8GA 3I53A 2JAXA 3SDSA 5LQUA 1O96A 4J0FA 2ID9A 1C9NA 2PAFA 4RQAA 5C8YB 2PZMA 2D1QA 1V16B 2G7MC 1SXHA 3LY7A 5E7MA 3GVHA 4QBTA 4EPWA 5HHTA 3C6BA 2AFVA 2ZAYA 4OUDB 3KLNA 3RVSA 3V8RA 2JD0A 4HB0A 4I66A 2CHFA 1ZICA 4P2BA 3DLCA 1QTIA 1FJXA 2YL2A 4M0PA 2G1PA 1EFPA 3NH9A 4NFYA 2FWMX 1ZKMA 2ZKLA 4K3UA 2GM5A 4BO6A 3E23A 3FPLA 4GNKA 1DC5A 4N3BA 4CCYB 3CE9A 4M1QA 4O29A 1ZOOA 4HAIA 4OYYA 1V3QE 4BQQA 1WBDA 4C7OA 2WVHA 1E2HA 3NHPA 5TVGA 3EEQA 3WGNA 1N6LA 1ZD4A 2ZYVX 1UJNA 4AJ2A 1AUPA 2FJUA 1C1DA 1IQUA 3DB1A 1V1RB 4PC6A 3ZDXB 5FA6A 2BFMA 2O06A 3NGXA 4YAUA 1QGUA 1UBMS 4MPDA 2J6IA 4FZRA 1E8MA 4H1VA 2D54A 3LXRA 2HHLA 2O14A 1J8MF 1OYYA 3IMGA 3NDIA 3R3JA 4GPZA 1XOIA 4LECA 3VR4D 4TZ0A 8MHTA 2G4VA 2YVLA 1T15A 5ESRA 4GNRA 2OILA 4NLLA 4D4GA 3L8GA 2GNPA 3D6AA 3TLMA 4ARSA 4CM1A 5JQWA 1NTRA 3OMWA 4CV2A 1NT4A 4R41A 3JRNA 1LK0A 1QHHB 3PSAA 4H0NA 5GWXA 5SV2A 1Q15A 2X8AA 3MLAA 1GXSA 4MCAA 5EMHA 4TM8A 5TT1A 1KA9H 5LXTF 1QH8B 3IAS1 2ZM6B 4HBZA 4FGUA 1Y5RA 3ZR4B 5JY1A 4F92B 3TGWA 3WGHA 3QG5A 1B16A 1LTKA 3R0IA 3TLCA 1IZ9A 1H5QA 3HR7A 5JTUA 2KS6A 4LHSA 4RANA 3L7DA 1TC2A 4DJAA 5IF9A 3AR5A 5G0TA 3NC4A 3SC2B 4BE7B 4F85A 2OM6A 3EXFA 4D5GA 1Y3HA 1VKNA 4F06A 5HQ3B 2XRFA 1ONOA 3GT3A 4RKWA 2RHHA 1NPDA 5M5BA 2VF8A 1DJNA 2NZ2A 3T1TA 2FPMA 1NUTA 2LE0A 3U4QA 1ZKDA 1JHVA 4NOMA 1S4QA 3C3DA 2OEPA 1N34B 1C0IA 2YVAA 5CXSA 5A5GA 3WHPA 5B12A 4DV0B 2XT6A 5BVHB 1RXWA 1PFGA 1SBHA 3P27A 3E1SA 1ZNXA 3TOXA 4AB1A 4FSDA 3UJAA 2PVPA 1XWFA 3O7WA 2JZOA 1EXWA 2C7RA 3O1LA 4C20A 1TAUA 3ZX5A 3DHVA 3UK2A 3QKRA 4N7JA 1KOLA 4UOEA 2R6FA 1LQ2A 3E9DA 4WASA 1ETHA 2YIJA 3LLCA 4MRAA 3K5HA 4RBNA 4ALKA 4QD3A 1YBHA 5KVQA 1WNTA 3BK2A 1RVV1 1BXRB 2CJYA 1XCPA 3L05A 3NPMA 3PYLA 4IDDA 4HXGA 4ZXFA 1PGPA 1B14A 1QANA 4UDOA 2B36A 2ZRCA 3HY6A 3T3MB 3TPCA 3H9CA 3QJYA 1CQPA 1ZWKA 1DQPA 5THXA 1GQFA 2FWIA 2H17A 1RCUA 2VHUA 4NONA 2C29D 4J90A 1J00A 3RLIA 3BHNA 5C52B 2ZUEA 1TM2A 3E9ZA 3CRVA 3H0KA 4V0KA 2WQ7A 4KNYA 4PSKA 1DDIA 4GVPA 4CF3A 3AKEA 3R3YA 4LHZA 4BATA 4CMEC 1VJDA 2OHVA 2QLFA 2DKOA 2GK4A 1I2BA 1W0CA 2EL9A 4G0YA 2R2AA 3AJ9A 5AM1A 2OOKA 5IRCD 1AZWA 4Z2AA 5JR3A 1V16A 1QYWA 3EVCA 3FFAA 2PN1A 5M04A 5FWDA 4RDIA 4YO7A 5SICE 3BQNB 1CVIA 3JARA 1QOPB 2CLIB 2BY4A 2VYVD 4Y9TA 3IMKA 4OAOA 2W2KB 5FB3A 5KYKA 4NATA 1KWKA 3JD3A 3NIFB 1Z4JA 5K2MA 1BFKA 3MFQA 4O2BA 2VK8A 1F48A 4TMXA 1ICEA 1CUJA 4HWTA 3SKYA 2B92A 1B8UA 1EHYA 1KU6A 2XMRA 3KD3A 2AKEA 4YFVA 2Y1LA 3LUAA 3GVCA 1AIPA 2GUWA 2OVFA 5DI3B 4BEVA 1K5PA 2C9BA 2PYIA 4ZO8A 3B1WA 4HCJA 4YRSA 3BEDA 4R2WA 1P7WA 1X6VA 2X9VA 4MJ3A 1E0KA 4G85A 1FNDA 2W7TA 3K94A 4GI5A 3FTPA 4GO1A 2VYFA 4IQ4A 2G0NA 3G2HA 4FQ7A 4N54A 4CM4A 2PVSA 5GGYA 5JG7A 1W76A 3H4TA 4AP9A 2H54A 1YRQA 1FU4A 1ZVMA 4LVUA 5CT5A 4DB2A 2YYAA 1Y3CE 2PT9A 5FWAA 3IIIA 2FH5B 1LDEA 3K9GA 5LKRA 4Z86A 1PKXA 2AC4A 4C0HA 5CB4B 4DLLA 3KDSE 2HLHA 3Q7SA 4PFQA 4Y8VA 4IUYA 1QFZA 3EAFA 3I6YA 1EQAA 3FBWA 2XUKA 1LZKA 4MI1A 2O7VA 4H16A 3VX4A 2VLIA 3CX7A 3CLUC 4E5YA 4TLLB 4PYIA 1NBHA 2WJYA 1EDDA 1X7XB 3KTFA 1J6UA 2QROA 3G6WA 3T99A 3A9TA 4BQEA 3C8UA 4LW8A 5UKDA 3H1BA 1E6EA 4AJKA 1A3CA 1KEEA 3DC7A 4LZWA 2HRDA 3ZNNA 3EXHB 1MX9A 3KHUA 5ALEA 4D46A 3DT8A 3CB2A 4I2NA 3S44A 7GPBA 4X24A 1SH7A 3A1DA 3DDWA 4M9RA 4OMDA 5BWBA 2QT0A 4RMGA 1FJGB 4YJ2B 3ZU6A 4OTZA 1L8AA 4A0QA 3N3AC 2OAEA 4G4JA 1OIWA 3H3JA 1SA0B 2OCGA 2FZ5A 3M49A 3Q9LA 2I1VB 2V98A 4DBLC 3TD6A 1NW8A 1E5XA 1YR6A 4IV8A 4REOA 2H1OA 1TA4A 2BGNA 3SJAA 3KKPA 3KWLA 4M0FA 4J94A 3JD0A 3HS3A 5EC8A 4GXTA 1K9SA 1VSVA 2ECPA 3HEBA 3K09C 4G09A 1U4OA 1E3DA 3MA0A 1NRIA 3HP7A 3MF4A 5MHTA 2C07A 3UHOA 4IINA 5FORA 4QM6A 1JKMA 5DNEA 3EBOA 4YMUA 5JC8A 1DLIA 3KV1A 1UJBA 1MJFA 4KQCA 5IYZA 1V7CA 2CXTA 9LDTA 4R31A 3VSDA 1XVIA 1ESNA 3GUVA 1S5PA 2P9BA 5IZCC 2ZSFA 4MOWA 3SQDA 5JD6A 5H8WA 2QX7A 2V03A 2FW7A 2Z2KA 1QMGA 4ZHQB 1NFRA 2VJMB 2G36A 1NNSA 3DBIA 4OK6A 4AO7A 2PX5A 4MO2A 4YEDA 1RAIA 4BJ6A 2FSVC 3A6FA 1QO9A 2CLOB 4XASA 3V46A 1GL3A 2HWUA 5D5HA 4AIRA 4KN6A 4O5OA 4N41A 3VYUB 4WXHA 4QTXA 2PPLA 3OQHA 3R44A 1MC8A 4X91A 2IY8A 3DFKA 1UK8A 1OLSB 5K5EA 3H1EA 1U2SA 3PEVA 4BUJA 5FPQA 4O1IA 3BXXA 3PNYA 1LPSA 2PWYA 2WJ6A 3LCJA 3LP6A 1NATA 1NDHA 4MTLA 1FZQA 3K4QA 3NNSA 2LCIA 4M0EA 4XCVA 2J3EA 4HUJA 4NEQA 3ASZA 2CK3D 2HPVA 4GKAA 4QQFA 5DHQA 3WK6A 2J9ZB 4A82A 1QG2A 5HQTA 5IVDA 1GVHA 1AHPA 1P5RA 3H2KA 4WPGA 1K6IA 1Y3AA 2C96A 2QMUA 3QE3A 3UPUA 4RIFA 2WWRA 2HYDA 3NGLA 1XR3A 4OP2A 1TA0A 4TWAA 2D2FA 1DKUA 1JFVA 3TW8B 4LFAB 1U1GA 2GERA 5B58T 3MXTA 4NY1A 5DN6D 5MGBA 1UC9A 1IRXA 1Y3IA 1EMDA 1ZESA 5AFSA 2IYSA 2MSEB 5EP4A 1K92A 3GCWA 4TXHA 2V6MA 2IQ5A 1L6IA 1P9NA 1X1CA 2WOJA 4IGFA 5T6BA 1KHTA 2WD8A 4K8OA 1M2FA 1TLLA 4RL4A 5B1YA 3D2AA 1QB7A 4IFTA 5CDGA 4TROA 5KOYA 3T7DA 3VDRA 2NNLD 1I7LA 1X13A 3SD7A 5DLQC 4QUBA 4D7AA 3LLSA 4R0VA 4DGSA 4BNJA 4DJJA 1P9LA 3TECE 1QHEA 1C81A 1Z8FA 4RGQA 1PK7A 1YU6A 3JYOA 3I0ZA 2MU1A 4DY4A 4ZYUA 1R3DA 1IN5A 5FI1B 4TWJA 4FGLA 5KSOA 1M3SA 2EFJA 2YZMA 1ZOIA 2A1UB 2FG7C 5DFAA 3T52A 5KNBH 1Y9EA 5COBA 3KB6A 4JVLA 1OH7A 2FMUA 4EBFA 1LRLA 1TZ2A 1WXGA 3T3PB 5CYOA 4AUMA 5CB6A 5AXDA 1W5AA 4EGSA 4QOFA 2FR8C 3WRYC 3P19A 2WNIA 3STYA 4FTWA 3PD1A 3IUMA 4I6GA 3TQCA 1VCMA 2CJWA 1PCXA 3URMA 4I08A 4CM8B 5DOVA 1Z6XA 3G17A 1U2DA 3W2EA 3WL6A 4ZVKA 4LEIA 1CFZA 2GEUA 3LQYA 3FBTA 1RQPA 2D3TA 2RGEA 1NVFA 1TVMA 1GKLA 2NXNA 3ZPXA 3HXOA 5E4TA 1B8NA 2HDOA 4L95C 2W6ZA 1H2ZA 2W6MA 3F3KA 2JARA 3FHCB 4Q1FA 5HMLA 2KPOA 4C07A 4K6MA 4R0NA 5LKAA 3LHIA 1H6CA 3I3SR 1X7DA 5AKZA 2WLSA 5D3QA 3QMMA 1G6OA 5LSAA 4PCUA 2H7YA 3FYCA 2A5GA 1G5HA 5GM1A 2GF0A 4HAWA 3WKEA 1E9BA 3GY0A 1EXMA 2WSIA 3CCBA 1GTMA 3P5BA 4UNNA 5EQTA 4YT2A 3KR0A 1WO8A 1X80B 2G77B 3P9RA 2OB1A 2RGWA 5J40A 4Z0HO 3OO0A 2E49A 5JJIA 4Z0PA 5NULA 1YNSA 5JJCA 1GSIA 1YZGA 2XNKA 3KQPA 1T4MA 1MV5A 3ZCVA 2FR1A 4NZMA 4R9RA 5CX1B 1CYEA 1BROA 4LRSB 1GITA 2ZCUA 1NOIA 2FFBA 2YXBA 2Z4RA 3Q87B 1M76A 3HLKA 4RY0A 4JJGA 4YJFA 3TLBA 2Y66A 2CKDA 1PZMA 3UENA 1BJKA 2V45A 3N86A 4DM7A 1YNOA 2NYVA 4L2IA 3DOJA 1HDRA 5K45A 1POXA 3CE6A 4Q4JA 5TB5A 3TEFA 2GMWA 4IMIB 5EXDA 1GAJA 1XO1A 3K0CC 4R2IA 1FXSA 1WZUA 4P3PA 1YHYA 4PFJA 5J9FA 4KYVA 3RROA 4UZSA 4M98A 4OP1A 2JJ8A 2PMCA 1NJ8A 1AKRA 2QUBA 3IXMA 4BFWA 1QTNA 2QNRA 1RWBA 2X2EA 2QIOA 3IYLW 4TSRA 4H7DA 3MVEA 5HS6A 2JLBA 2Y1FA 2C54A 4LSMA 4EFKA 3WLKX 1M73E 1QH1B 2ZWOA 4B46A 3WKDA 521PA 2J9FB 4E14A 5IS2A 2NACA 4N01A 4KPFC 2Q4RA 4BLPA 4ID3A 1BN6A 4YXWD 1LVHA 2IHKA 3EVNA 3UUEA 4H6XA 3OX1A 1L5SA 1T4BA 4RQTA 4NC9A 4U0JA 1TTPB 2R7LA 4BQOA 4YRZA 4QQKA 4G1VA 1RTTA 1KORA 1T1RA 4MJLA 4X1KA 3HB1A 3L0BA 1PJCA 3HNOA 4NHEA 2QZSA 1E7QA 4D56A 4KHPB 3LGXA 2PMEA 3PGKA 2WINI 3WLEA 1DPGA 4MVJG 3WLTA 4BE9A 4F5WA 4H3VA 1B2LA 2IXEA 3K32A 5EOVA 2HLNA 1GNLA 1R12A 3R2JA 4E4YA 3I72A 4RACA 3PNKA 4ERXA 1H2BA 4RH1A 4DG8A 2JGRA 8ABPA 3I2IA 5AIBA 1KI8A 1Z2EA 4A03A 4P0QB 2GJ4A 2Q27A 1E0DA 2AN3A 1C3EA 3D3EA 3KKKA 2OBMA 5CITA 1Z5OA 1AO0A 3WNZA 3VNUA 4EHLA 1WAMA 4CRWB 2C7PA 1V1MB 3M4XA 4F6RA 3DMTA 2H2DA 2RIPA 4GSKA 1Q7CA 3I73A 2BFFB 3FLAA 3HRKA 3G68A 2INGX 2BIFA 1U1CA 4DV4B 3FNGA 4WLOA 2DQZA 3O6VA 4F2PA 4PPYA 2O0KA 1J97A 4QOJA 2NG1A 4EG1A 1BRMA 2O7QA 1N75A 2AEEA 1ZIXA 1JYFA 3WB2A 1UR5A 4IDQA 2YXDA 1QGAA 1E79D 1WTCA 2PUWA 2XB2A 2Q6KA 2JI6A 3ICQB 3AUXA 3AJRA 2HFJA 3PUZA 3UUWA 2NO4A 2FV8A 1P2TA 3ET5A 2FRDC 3GMTA 2ZAMA 3R7WA 1OYWA 2VT2A 1AOXA 2ID7A 2WICA 1WXFA 4PYKA 4RNCA 3I2YX 1AZTA 4BNLA 3MC1A 4CUJA 2LKCA 2OCKA 1T1JA 1N2OA 3ISJA 2LDBA 2O50A 2Y67A 2VHJA 3F90A 1U0LA 2GSDA 4QXMA 1DMSA 3OX2A 4QU9A 5ALIA 2TS1A 5BV8A 3ZG6A 2I87A 1PE0A 1BMTA 2Z56A 2ZBRA 3AV0B 3QVUA 4TTPA 3NVKI 2G72A 2ODNA 1ZIOA 4I2VA 1J25A 1OXTA 1QZZA 1HTTA 2OECA 2Q0XA 4H1UA 4QJBA 5D00A 2E7ZA 4FGWA 3KB2A 2PH1A 3UWSA 2WG0A 3HWX1 4IILA 2O7NA 4WKOA 5ESWA 3JV7A 3N05A 1NURA 4XQ0A 1T26A 3GPIA 5K8JB 1V26A 2ZXEA 4FYVA 5DASA 5ECYA 4X3PA 3PQ6A 1COWA 2AL7A 2GN2A 4Q5IA 3X1JA 3T1OA 1D0IA 1Q0ZA 5LMUB 4R83A 5A1TA 2JLQA 5DKFA 2A94A 3KS9A 4P93A 2CLMB 1F06A 2PJUA 4DCNA 3TLKA 1W5SA 1F5SA 1P8AA 2F00A 4G1EB 2IU3A 1KQNA 1O6GA 2B8TA 1SQ0A 2VPYA 3R41A 3QY9A 2YJZA 3UJ7A 2FQYA 3VYWA 1P9RA 1P5FA 4DA8A 1FYVA 2Y9MB 1L5KA 3WXMA 4C4XA 5DB4A 5EJ9A 2FUCA 1Z22A 4RY2A 2HADA 2XBUA 3AWDA 4Q24A 3WLOA 3E3MA 5H4HA 1MW9X 5AW9A 1SGWA 1UKAA 3HCFA 4B4DA 1RZVA 1K0UA 1RT9A 4EW1A 1HR0B 2AXQA 3TTTA 1XD2B 3NBAA 4DABA 1VE7A 1ZG3A 3VV2A 5K3CA 1STOA 3AGPA 4MRRA 1ZA2A 2JHPA 1Y9JA 1J0AA 4JBIA 4ARZB 5HBGA 3VKHA 1GEEA 5ITVA 4Y6GB 5A9SB 4QUGA 4IXTA 4ZDJA 5BUCA 2VZEA 4BDSA 1FMCA 1QGYA 3ZX4A 3EEBA 2FOLA 3KD2A 4TLAA 1NOKA 1ORTA 1WM1A 2FXIA 3JXEA 4NZNA 2PKWA 2HSGA 4JUAA 2I1QA 4BFVA 3KZNA 5AW1A 4N1AA 3V34A 3QE9Y 4NTZA 4HQOA 4RFSB 3LUFA 3GLSA 3S8MA 1H69A 1KPHA 2GBGA 1UP4A 2GTIA 3NPAA 3ZD7A 1HSZA 2QW1A 2HQSA 4LRTB 1VE3A 2WDPA 2WJ3A 1LK7A 1YHNA 1H66A 1PZFA 4XSGA 5FUXA 1ZD9A 3M3DA 4AP5A 2H0QA 2AJBA 4HB2A 3F7OA 4Y6RA 1DBQA 3GEMA 1OBVA 2HUNA 5LQSA 2B7LA 4XIYA 1K6XA 3M3HA 2AJLI 4UU8A 3LBAA 4DEVA 1YCHA 3BBPA 1X87A 1TKCA 3H97A 4LOHA 3F67A 4P31A 4UUNA 2D0OB 4US1R 1UK7A 1ZUNA 1HE2A 1J49A 2H16A 3GH3A 3WGQA 2J32A 4M38A 4P4SA 3K0BA 4XGRA 1USVA 2A92A 4TWIA 4ZT3A 2QIPA 5I7SA 1W48A 2EQ5A 2ZWAA 2BE7A 3CEPB 1HQCA 3PHHA 4NMXB 3O90A 3TRIA 1W85B 4Z54A 2B0CA 4II7A 4BVBA 1XZ8A 3WIOA 5THQA 2NP7A 2NUBA 4KHZA 4ZMRA 2FFQA 1K8XB 1RZUA 3HYSA 4HQ0A 2GN1A 1X7GA 1SC1A 4S1WA 2X13A 3R3HA 3T1YB 3AEZA 1MFZA 3PQEA 3JQFA 4IMJB 4D4HA 2YHUA 3KEFA 1JFSA 5GM2A 4MPJA 3A9CA 2CDNA 3KVVA 5E3IA 3ZZUA 4J4HA 1RW4A 4ZT6A 5CURA 4DV7B 3EWIA 5JNRA 2TMDA 4QC2A 3D8NA 2ZBVA 1LSSA 1NKVA 2Q41A 2YTZA 4YQFA 1A72A 2GKGA 3BF8A 4OHRA 4Q3OA 4C2AA 1PNTA 2A5DA 3GRVA 2QGFA 1NGSA 2Y1OA 3MQFA 4OH7A 2RONA 3A3PA 4EB3A 1I80A 4NXMB 5BNWA 1YBVA 4MV1A 4WJKB 4C14A 3AGQA 1JWAB 4QEKA 2R4QA 3CLSD 2DE0X 3FWZA 1OFGA 1T24A 1UC4B 4R9NA 4TMFA 5KTNA 1E3WA 3H18A 3T4XA 4KUEA 3S1SA 3LSYA 1PEYA 3QJ5A 2PNJA 5GINE 3TZHA 1N0IA 1ZVJA 5FOTA 4QEZA 5F35A 5IX8A 1U28C 4UBKA 1YRWA 3OWOA 4H0CA 3R5FA 4X71A 4FKZA 4KQWA 4LHXA 3INRA 3TRJA 4E5KA 5JYCA 5KQMA 1WP4A 2FVXA 2WSYB 4WZBE 2XMGA 1BJTA 2XNDD 3SQLA 1FBNA 1Q95A 3CLUD 3FPJA 3FPAA 4QUAA 3OOWA 2QF7A 1BCSA 3N0TA 2PKXA 4LI3X 2WHRA 3CNQS 3TK1A 2QVXX 3LUCA 1U2PA 3RBZA 1BCSB 3WMGA 4CODB 3E1KA 5A06A 2VUHB 2HHCA 1QC5A 3QVGA 1O77A 1T6XA 1HDOA 1U02A 1IK6A 9LDBA 3OPXA 1NP6A 1YZTA 1VHWA 2FQQA 3ZDAA 1LPBB 4KVZA 2CHUA 4FYMA 4BDTA 3N53A 4DAEA 2C4TA 3AR4A 2V9PA 4KXQA 4W5WA 5AJZA 5FKJA 1IYZA 5LQCA 3C48A 3H1FA 1N9KA 4FHEA 4M9ZA 4N6NA 4DV5B 1MNAA 3IEVA 2ZSHA 1PEKE 1DTWB 2B1GA 4QAQA 2WU0A 1AM4D 1SCDA 3C7TA 5GADl 4AJLA 2E4YA 1TAHA 2ZUFA 2GSWA 5CYGA 3GJ8A 1EDEA 2PUJA 10MHA 1X8JA 3ZJ4A 1YE5A 3TTXA 3T3NA 3AT1A 4ASUA 1YQUA 3A3YA 3T8YA 3EMBA 2WJVA 3KOZA 3PQ7A 5ELXA 3WB1A 1DEKA 3FMFA 1SBCA 2V7BA 1R4AA 3C98A 4GI3A 3RSFA 4RZSA 5JS6A 1NY6A 3G2OA 4B4UA 3HKBB 5BNZA 1XSEA 4HNHA 4RSRA 4PM4A 4N3CA 3IDOA 2WDZA 3IIMA 1N5LA 2OUKA 3AHCA 2P6NA 4D9BA 2W70A 4MQFA 5JC1A 1DG1G 3QEKA 4FPXA 5BN5A 3GNTA 1BKSB 2E4WA 1M66A 2QZZA 3WS7A 5BPHA 4P08A 3U56A 1JSCA 3LBHA 2FU5C 3ZWWA 3JWPA 1CDZA 1XZQA 1ZL0A 4XWWA 2R8ZA 2QRHA 3NDRA 4XR4A 3TZKA 1EQUA 1KE1A 5I4KA 1N78A 1L5WA 2O3QA 3SOZA 1JR3D 2ZRMA 4V02A 2QTNA 4NZ9A 3S3TA 4YV2A 2ONKA 2O1SA 4JOSA 1E2GA 2WFLB 3OJFA 4AF6A 5DT2A 4F4HA 4CGZA 3QVWA 5JAZA 1QBKC 3WLFA 5BRNA 4U9IS 2J30A 1T8UA 1MO6A 2G83A 1DI0A 3CBGA 3I23A 3K31A 5AJHA 1AURA 3WR5A 3STTA 3TTYA 1WUYA 2WIGA 1L5GB 5B6PA 4DHEA 3PZRA 5BQPA 4ZVPA 3G2LA 1AQYA 2AV6A 3OU2A 3ACCA 4GVXA 1D6SA 4Q9AA 1WPRA 1WSDA 1Y34E 2Z4SA 2ZIXB 4S1TA 4XLZA 3ND8A 2XI4A 3EW9A 4BL5A 1IH8A 4CM6A 4D80A 5KEIA 2QN6A 3H2IA 4Q1EA 3SJ7A 3PC6A 2CHQA 4GOJA 2IOFK 5EWJB 3I0NA 2VSOA 5KVCA 1E7YA 3ADPA 4ECEA 3KQKA 1AS3A 2P90A 3G5TA 1S3FA 3EA4A 1O6ZA 3T54A 4HBGA 5DX0A 1BDMA 1E18A 1UWLA 1W5TA 3AYZB 5AI5A 5D8DA 5LP1A 4M55A 2YCBA 2IELA 4Q4CA 3L6OO 3I6QA 4UAJA 4FBGA 4O63O 4KUHA 2Q3LA 1R0KA 1DBWA 3Q85A 3JZFA 4BQNA 3MGCA 1U3VA 4DSZA 1PJRA 4TKLA 5DCUA 1L7DA 3JQ7B 3D54D 5FBZA 1C0LA 5L7TA 4O2AF 3FTDA 4P58A 4XUDA 3WLIA 3DGFC 2WBLC 3M6MD 1N32B 3SS8A 2AMYA 2GAAA 1R9MA 4ARZA 5IF3A 4XGKA 3LX6A 1UBOS 4Q4AB 4ZEXA 5D3MA 1YS2X 2FX3A 3WL5A 4Y6OA 1YZFA 1QCZA 1ESZA 2YKGA 3SSOA 4LWOA 3PRHA 4A8HA 5LOVA 1QCDA 1EYZA 1T4CB 2G28A 2HCTA 2WTAA 3DVRX 5C7LO 5IHXA 2ZTVA 2CXUA 2A9PA 3WWDA 2GN6A 1RYMA 4FMPA 2ZJ6A 3RE1A 1PT7A 2J4DA 1FNBA 2CZGA 3CR7A 1BOOA 1ISJA 1HORA 3TOSA 3G2KA 3T4EA 2CLFB 4HRXA 2O4CA 2RGNA 4MGZR 5LXTA 2D2XA 3OMXA 4UMVA 3HN2A 3BJMA 2FNAA 1MABA 2Y0PA 1OKKA 1SKBA 5GV8A 1WCXA 4REQB 1RXVA 2V1UA 1RBYA 4EG5A 4AN4A 4LWZA 2EL7A 2BFAA 5BURA 5DBGA 5I7VA 5IG2A 5CEJA 2WYIA 3R6LA 1L5MA 1NVGA 1C7EA 3S68A 1RC1A 2EW1A 4GM0A 3JPWA 1HNXB 4AUEA 3RS2A 3QZUA 4EF5A 2C4KA 2GJ9A 4QDZA 5JYEA 1C1HA 3A4MA 5TQ2B 3ZQ6A 3ZDEA 1D0VA 2AMVA 3DOHA 4ABYA 4L5AA 3LWBA 2X22A 3OLQA 5K0CA 3SICE 1DE0A 4JUBA 3KXLA 3BIOA 2ZRGA 2X8BA 4NECA 4UCWA 4ME6A 5DN6A 1DUIA 3UT5B 3U5TA 2P9TA 4PLCA 4CKBA 2QRVA 3MB5A 1KJYA 1PN3A 4MQLA 4NQZA 3UJ3X 3BB3A 1OIXA 2POCA 1ZBDA 5EERA 5IJ9A 2WW8A 3SKXA 4E3WA 3PLRA 5IJ0B 5JD4A 4LNUA 4HZGA 1JX6A 4F7WA 4PZAA 3O83A 2MJLA 4EKIA 4IDBA 2O2ZA 5K05A 2CDRA 2JD2A 3I83A 1HLGA 1X1TA 2QSZA 3JQ9C 1CERA 3SZRA 3UHPA 2A59A 2X2PA 1LC0A 3GLQA 3WRXC 4BC1A 5ARDA 1CQZA 4OXYA 1VL8A 3PNSA 3OWXA 3U4MA 4CR8A 3NMUF 3FAKA 1RLUA 3BJEA 2N1BA 3L84A 4BO4A 2Z43A 3SZOA 5JTTA 4EX6A 4ZYWA 4YTEA 4OLAA 2WK1A 1X7ZB 4H7IA 4JJ6A 1QZUA 1U8YA 4JI0B 5DGXA 3QKSB 3H8VA 1S02A 5AKLA 3W3AD 3KUDA 3UY4A 4H6PA 3ZBUA 3OIDA 4ESHA 4ZTZB 4D57A 4WK2B 5AESA 1A9RA 3MG9A 1EFCA 3KZKA 1SHKA 1A2KC 3AX6A 3KTDA 4J29A 1XNHA 2ACKA 3GLFB 4FIZA 1THGA 3T3IA 3WIDA 3LUDA 5DN9A 4ZHQF 1PQWA 2YWHA 3O8QB 2XTZA 3AF1A 3A10A 3HU1A 5BV1A 4XYLA 2EAUA 1Y8QA 1FUUA 3E8XA 4GPIB 5E9JA 3ZTWA 5HK8A 4BNXA 3I6BA 3ZDYB 1B7GO 3RVQA 4CBVA 2IOHA 4B7XA 2DU8A 1E2LA 1PHPA 4RZUA 2EZTA 1SBNE 1H22A 3F1LA 3W7AA 4L22A 4DE5A 1JG1A 2OCXA 4PXSA 3ZV3A 1Z6PA 2BCEA 3QW4B 4C6TA 1KI4A 2IRWA 2JEZA 4Y6LA 4EAAA 2XWQA 3Q7TA 4CTKA 2ZUVA 1J5XA 3MEQA 2PUVA 4EG3A 4F21A 5KQGA 5DK6A 2Z9BA 3IKTA 1RKQA 4X95A 4UQPA 2A0KA 2P0EA 2ZUWA 4LVCA 1HK7A 1X19A 3IA7A 4F3TA 3DBVO 2M98A 3HI6A 2CHVA 4MAMA 2J9FA 2NPIA 2R6CA 2WD9A 4IMRA 2IEGA 2OLEA 3VC7A 4JODA 3OE7A 5HZKA 4MGHA 3GD5A 4KTVE 1R37A 1IXYA 4UUQA 4W5TA 4TV9A 3VBEA 2YHSA 5T67A 2FLKA 2QLJA 3EZ6A 3QELA 1JF8A 1JS1X 1Z73A 3H9JA 3PX3A 2YC2C 5J2TF 4CWAA 1QRDA 4L2IB 1XHEA 3OE5A 1EGAA 1RHKA 4WZBA 1OWPA 3UK1A 1OILA 2PAAA 5P21A 2YFHA 5GZ6A 1FLVA 3C70A 1T0PA 3ZXUB 2E18A 1PJTA 4I0WB 3IP7A 5EZYF 1NA5A 4EF4A 1CUGA 2BGKA 4ENPA 1VLLA 1KYTA 2Z5VA 1G21B 4FI3F 1M7BA 2C4NA 3ADCA 4AI6A 1PVDA 2MHCA 4R6WA 3VR5A 3D6FA 3ZS9A 1I4EB 1QJ4A 4J43A 2D2VA 4MR8A 1O03A 2DCUA 4AL4A 2I62A 1MAWA 4MW9A 3S2FA 5EMKA 4F1KA 4JLKA 5BWOA 2AYYA 1EJ6A 3E5NA 4NL4H 1KZ1A 5HCIA 4B3DA 2R3SA 1PWEA 2PLNA 1BW9B 2IHJA 2NVUB 2QPOA 3DOEA 3EWNA 3X1WA 3FF4A 1QQAA 1FVXA 2H1RA 3FF1A 1G5FA 1GPH1 3NS7A 4WBNF 3M5CA 3RKUA 2GN4A 1KI9A 2CLLB 4MW5A 1F8UA 4LTDA 3REGA 5JXHA 4IRXA 2AMJA 2WPDD 3TAUA 1CUEA 1MNQA 3AI3A 3WSTA 1K5HA 3CRZA 3ECSA 1L5HA 4DSAA 3DWFA 2CJWB 3FHOA 4M49A 3TCKA 1BZYA 2R8XA 2WR8A 4IH9A 2MSDB 3ZK9A 3UT0A 5DM2A 5DNDA 1R50A 3HVRA 1GNQA 4OHXA 4LFBB 4C4PA 1XDGA 2A57A 3KQMA 2BPOA 5LDGA 3RIHA 2YRXA 4H7FA 5E95A 1DZIA 1HDEA 1QZTA 1UJCA 4YRTA 3ICVA 3OZAA 5HTKA 1D6NA 5DNWA 1Q1NA 5BNFA 1PSWA 3AUYA 4FEYA 3ZU4A 3CNLA 3LDHA 4EHAA 4N5LA 1JG6A 16PKA 3NBFA 3NDJA 1HLDA 2XX3A 2PBRA 3BXZA 3LT1A 4UEJA 1JB1A 3EXG2 4QNMA 4G9BA 3WSWA 1L5FA 4G07A 2BKXA 4IZOA 1U81A 4AKSA 1YQDA 5D51S 5TGTA 4YJGA 4K2HA 3TS1A 5CT6A 5IZ4A 2R8BA 3M5WA 3OU7A 4WGFA 3WISA 3IL2A 5K4AA 3HJGA 4KLNA 4C7XA 1ZD2P 4BIIA 3B82A 1YJQA 3C6XA 3CMMA 3K30A 3T7CA 1ZGAA 1ZNWA 1QG6A 5CU7A 4IJVA 3C3MA 4IZ6A 2YWRA 4N9QA 3A37A 2C3PA 5F52A 3SN6A 4B09A 3OHMA 4DMMA 5I48A 1XTSA 3F9CA 4MV8A 4JL8A 4PFSA 1ZRNA 4R2LA 4ZCRA 2OMEA 3S2GA 3IALA 1NHWA 3DDUA 4CN9A 4JJ4A 1AGYA 2O6HA 3AUTA 2ZIEA 5EHQA 5J2UA 4ECAA 1P1BA 1UQUA 2SNIE 3DDHA 3E7WA 3TH5A 1PT8A 4PCVA 2GILA 2BDUA 2Y6UA 2PSDA 4GRAA 3S6JA 2DSNA 4BBPA 5HUQA 5L3QA 1ZOSA 2HRCA 5GONB 4ZWNA 4AWBA 2DH6A 2J07A 3ZXYA 1SKAA 4V1CB 2NTNA 3PUVA 2V3VA 3T5CA 3ZW7A 1VLHA 2J0EA 4LYFA 4UTVA 1EBFA 5COQA 1O3YA 1VL5A 3IA2A 1K75A 1WZCA 2CLCX 3KFXA 3O38A 4H3SA 5E8JA 1X86B 5LA6B 4G23A 2XZTA 4MWTA 7YASA 2C04A 3NAQA 1SU8A 1XQXA 4KZPA 4BEWA 3VPAA 1B43A 2OBLA 3FCEA 3GRPA 5DM60 3HJAA 3ZQUA 2JBWA 4ZDKA 3DEJA 5BUSA 5J43A 5J4HA 3NI2A 3U7IA 5B3JA 1FP7A 2VJMA 1I1QB 3N8KA 2AI2A 2I2WA 2QLTA 2QLLA 4S1NA 4PHCA 2XJ9A 4KWHA 4LYAA 3ZCRA 2YMPA 5AI8A 2XE6A 1CUIA 5HM6A 3EBLA 4DNXA 5J2TB 3O93A 1NMEA 1CQJB 3A2NA 3IBTA 3HJUA 1RSZA 5CYPA 1U0OC 4OU5A 3O8OB 3ZK8A 1RIIA 4PRKA 2F1OA 2H5JA 2I8AA 5IUJC 4M4SA 3QVLA 4FEEA 2QE7D 1J90A 1HUQA 1NULA 2NT4A 2WRZA 4W6QA 5EXTA 5B1EA 5GY7A 1YMUA 2WZCA 4IP0A 1Y4SA 2RAPA 3CG4A 3D3WB 2YFKA 2A0WA 1W25A 1Y48E 2IE8A 4Z9YA 2JFWA 3KQTA 4PN7A 1O08A 1P18A 3IPXA 4BKPA 5K0ZA 2XB9A 5EEHA 1TQ2A 4LMAA 4K9LA 1OB2A 1A7KA 2IEDA 2XZDA 3AF3A 4FGJA 4MWZA 2HV8A 1V5WA 3FNHA 2EFGA 3O94A 4ZPXA 4YJ2A 2FEOA 3MT9A 4Z4QA 4RVDA 5DRTA 1MN6A 2BM0A 2OORA 4INOA 2O3SA 3EZ7A 4B4OA 4KXMA 4UD2A 3TD9A 5KNDH 1BX1A 2QN7A 1AXRA 3DKIA 2IY9A 1UMCB 1ECBA 4CKEA 2LZ0A 1WMFA 4G0NA 4CQNA 1FP6A 3CWCA 3D7SA 4DAOA 621PA 2H1FA 3L7CA 4B6QA 4BB9A 3LPLA 1TUBA 1GTJ1 5CVUA 4C3OB 4OHCA 4K9NA 3DKRA 2UZAA 2EBFX 1NW7A 3CLTD 3JD4A 3ZK7A 1KH2A 3KJGA 4L73A 4BCBA 4D81A 4TSFD 5CB4A 2PKQO 5EGNA 2FZGA 3FI9A 3JD1A 2WT4A 3EA0A 4E46A 1KDRA 2JIRA 4RZQA 1LSJA 2PANA 2JFHA 1B3RA 3Q12A 4GYYA 4L9SA 4U6QA 1IPHA 2BEVA 3FGOA 4DVJA 3UWOA 4WKNA 2A0XA 4AZTA 4BPBA 1MW8X 3O2JA 5TPZD 4LGMA 2AXEA 3ZE1B 3I9JA 1KMQA 4IWYA 3V55A 1XZDA 2P5YA 4MYCA 4NOKA 3NC0C 3WBFA 3PPYA 2JZCA 2F9FA 4C3ZA 4I8IA 2RH5A 1I6LA 1NBIA 3A2LA 3LUGA 3AF0A 1FPMA 3TGLA 3RUEA 1JQKA 3EN0A 2OBYA 2QGZA 3UPDA 1PG5A 4EEKA 1PS0A 5AW2A 1EWKA 2QR5A 1OTXA 2P68A 5LJLA 1W88A 3RF7A 4AX4A 4B3RB 5IFKA 4NAHA 5CT8A 2BR5A 1R10A 4FX2A 2B8WA 2V6IA 1FNSA 2W2KA 3K4HA 3PI6A 4TMWA 3VR5H 4JJ7A 4TUYA 4DC9A 1KY2A 2WA2A 2EG5A 4HG2A 4Q1VA 3VX3A 3IULA 5JT1A 3DAFA 2VUSA 4B76A 4KREA 1XLWA 1YSCA 4EA7A 3E58A 3O8NA 5JZOA 1PV4A 4F1WA 2OV3A 3B13B 1U63A 5B4VA 5HCUA 2DUNA 3ZJTA 3CNOA 4MQBA 4J91A 1YDWA 2IYTA 3OA2A 2VH1A 3MAAC 3BX1A 1E2UA 1DFHA 3ZE2B 4CKCA 1NKTA 3L92A 2HLPA 3THSA 4GG1A 2G9RA 2V7WA 2WM8A 3AI2A 3B9BA 3UA3A 4LZZA 3TX6A 2OV8A 3BPSA 4B8YA 3NHZA 1L7EA 3F7NA 3MGAA 3O31A 3PGA1 2EGGA 2VKQA 5G1PA 1WUKS 2W98A 2WAOA 3ZZ0A 4B81A 4L08A 3A4YA 4CT5A 4MK4A 3PEYA 1JEJA 4XM2A 5IXSA 5KS2A 5DWDA 2EQBA 1PKEA 4BKRA 1W6RA 3E0XA 2WWWA 3A4TA 3QTTA 4LZJA 3TYXA 4DMKA 3R9XA 3S8YA 4WUTA 2UYCA 4V1CI 1FX0B 3V4SA 3GJSA 4C3UA 1RE0A 3FZGA 4AZVA 1NVBA 3WWEA 1S2GA 3WL3A 2VPZA 2HK8A 1TPZA 4JKOA 4N7BA 1LNZA 1JBKA 3CN9A 5JNVA 3I8SA 2DWOA 2BBWA 3WRXA 2P2NA 4JLAA 1GFWA 2YZKA 4Y9RA 2H1LA 1UPFA 4L8LA 1SULA 2BUAA 3H1PA 3G88A 3IEXA 4YREA 2WT9A 4OJTA 3GU3A 4ZJUA 5KTPA 1SD2A 2RBGA 3L8ZA 1P0IA 3WOHA 1GG5A 4CHTA 4H1WA 3U4QB 5BQXA 4G5FA 4ENWA 3P0HA 1C29B 4PZZA 3Q6NA 4NCXA 3WYBA 2DECA 1V9SA 3L0PA 1CR1A 2NUAB 4BE4A 1WOMA 2B61A 3TKYA 4TTQA 4F2DA 2XVZA 3SJCA 1Q7EA 1XJQA 3F9RA 2PV7A 5EUCA 2Q3EA 2HEIA 1VJ1A 3SR4A 3GK3A 1CB7A 2JJ1D 3TLGB 3LQQA 5DBHX 1KGSA 3C6ZA 2QS9A 3KC2A 4YH1A 3LXUX 4BVAA 2X42A 3D9QX 1IXRC 4IHJA 2QQ5A 1WDKA 2RC6A 1NLUA 5F73A 2I4LA 1YTLA 4ZI7A 1K63A 2IP2A 4GECA 1XVVA 4B6OA 13PKA 3UOWA 1QHHA 3HZZA 1ANKA 3P7MA 2AZDA 2NW6A 2Z1MA 2W48A 5GJVC 3ANNA 3C7AA 3EVFA 3UGQA 5A4MS 2VXBA 1SD1A 2OBFA 2G40A 3QPCA 2XBLA 3E9RA 3V32A 1Q6ZA 1LRJA 2XYGA 2OHOA 1NN0A 2NPOA 1JV2B 1OROA 5ER6A 4BMDA 4PG5A 3LQFA 4AROA 2G9NA 4OO3A 5EJEA 3U7FB 1VGQA 2GF9A 4FS8A 4W5QA 4RDHA 4CV0A 2V54A 2FPKA 4QULA 2BGMA 2R7MA 2VP4A 1YJXA 1QGUB 2QTCA 3EDMA 3GA0A 3L4BC 3ZHYA 1TQ6A 2AKYA 3OCJA 4EG0A 1UBJS 2AS0A 3IPLA 3TNJA 2GEJA 3VH1A 1Q84A 2J9YB 3GP3A 4B17A 2O07A 2Q8QA 3F98A 3IR5A 1VJ0A 4W7HA 2BI7A 5EXEA 1A71A 4M9XA 1Z45A 2R87A 5EPOA 3H0EA 1T1EA 4YO8A 3WZ2A 1GFZA 1GN9A 2UVPA 4XYBA 2XA1A 1DRUA 2CN1A 3K15A 4RA6A 4YA6A 3W6UA 2UUOA 3QI2A 4MGYR 4EPRA 1LI5A 4MQEA 4Z4FA 4CUZA 3EPJA 1QIMA 3B6JA 1VFPA 2HIAA 3D31A 3PUIA 1K2WA 2DOKA 2JW5A 3JSAA 1LQTA 1T13A 3IPCA 2ZOSA 3WLQA 5G0SA 1JXMA 3CVXA 1KXZA 2JBAA 3K8OE 3C6KA 5AK6A 1EU1A 2C8JA 2UDPA 5JSZA 3GRFA 2J5QA 2VUUA 3C7CB 4RCYA 3QIAA 1YCDA 2VT7A 1XXHB 1XBTA 2PSEA 3M6AA 3DL0A 3M34A 1B0PA 4C5CA 4UTXA 1R4MA 2OYCA 4DQLA 2IU6A 4WD3A 3E8MA 2VDRB 2CSXA 4F11A 1MG5A 3A1CA 3OOEA 4TLBA 4BUCA 2QJRA 3PDJA 3PRYA 4W1QA 2HA5A 1ZI6A 4QOIA 4YPVA 2CXPA 1R0XA 5CK5A 3PXGA 4OOEA 4QM7A 4DUPA 2IH2A 1DL5A 3LOPA 1LZLA 1NVVQ 4KAXA 4TS3A 5BXYA 1IJFA 1J2TA 4MQ6A 4NULA 1LDGA 5AQ1A 2C2YA 1DNPA 3KKQA 4QVKA 3UCFA 1QGZA 3B1ZA 3LVFO 5JBIA 2DERA 3OF3A 1P4RA 2IPXA 3RB8A 2AOTB 4I8XA 4UJ5A 1P31A 2FMKA 3D8HA 2AJDA 3PJGA 4HKTA 4RGYA 3EZLA 4TVKA 4GF5A 4PG7A 4O6VA 1QIGA 2QJFA 4X8HA 3GZNA 3N58A 3K72B 5DGHA 5CGQB 1SC9A 3AY0A 1O94D 2Y2UA 2M6KA 3DONA 5AUPB 4X9XA 2AJTA 2WF5A 5DHPA 3ZD6A 1V8FA 2WYUA 4TGLA 3V3KA 2CLDX 2DUMA 2WSSD 2HQRA 3OQ1A 3UFXA 3FSEA 1ZR4A 1CX9B 2H3HA 3LAWA 4O4HF 3OQIA 3H5OA 2F8MA 1QAQA 3M8KA 2WM3A 5L4SA 3T9DA 1KQ3A 3PNOA 4ZT7A 3UATA 3DVAB 1NQXA 3QUAA 5AI6A 3IT1A 1MB4A 2YOHA 2IYOA 3HKCB 4ZOCA 5A3VA 3TIXB 4QYWA 2CL5A 3H5TA 4GR5A 2A0FA 3OLYA 4NR0A 4R1MA 4R2KA 3O4JA 5D7BA 5IAKA 4D96A 3ZJUA 1W581 3NHJA 5BSKA 2CFSA 2LCQA 3WYGA 5JCXA 4U63A 3KZMA 1KZHA 1XRPA 2BI4A 3N0VA 3QPVA 4N0DA 3PQ5A 1GNVA 4P4GA 2EDCA 5I9LA 2J3IA 5KYVA 2VA9A 2VDNB 1GFIA 4RVNA 3TJMA 5F9FA 2A7XA 1E2IA 2Z6VA 5KDDA 5IM4A 1YDMA 4RMJA 1PVVA 4B32A 4BWFB 2ZYSA 2IDMA 1PUIA 1MO4A 4Z9BA 5AHOA 2FEKA 2IA5A 4I1YA 4R1UA 3GP5A 2AWNA 3R0ZA 1C8VB 3JAKA 3LQKA 5TMEA 4K9DA 1HSOA 1XDSA 6YASA 4R9SA 5T64A 3L0CA 3IUJA 3DT6A 2GEFA 3L5OA 2ZW9A 5IAGA 5CW1A 2JKZA 2YJNA 5G1OA 2C3MA 2NYRA 5ERGB 5IAOA 3P2YA 3ENZA 1P91A 5KOHB 2C4VA 1HTWA 4NU8X 4LRUA 3OCZA 4F2GA 2BTEA 2GD1O 1JJ7A 1IHOA 2C8KA 3NWJA 3ROGA 1GWNA 4JGBA 421PA 3BFVA 3CT6A 4NNOA 1HF3A 4PYNA 4TM7A 4UULA 1CRZA 4QLBA 2OP0A 1MIOB 4IG4A 1RMTA 3LP8A 4ND8A 2WIDA 3D6NB 5EJ6A 2Y68A 5INTA 4IG9A 3A4LA 3LPAA 4FOOA 4Y9UA 4JFRA 2JFVA 5ADUS 5CBPA 2QOEA 1SU7A 1ZW1A 2B9VA 3CX3A 2ORVA 1NONA 2C57A 2ZT7A 2H2AA 1CD5A 1H1LA 1QZXA 2FOIA 2HRQA 4MHOA 1QHYA 3BCHA 3CNNA 3FKQA 3O0DA 3U3DA 1RRGA 1OH5A 4AJNA 2BI8A 4KQMA 5B3JC 1ZMOA 1GO2A 3AQIA 1AA9A 1DQSA 5F3RA 1UDRA 2GAJA 4ER6A 3MWGA 3K1AB 4EPYA 3H9EO 1DIOB 5FUQA 2NN3C 1SELA 5J4KA 4AQ7A 4YUYA 4BUZA 4EFLA 2A2ZA 2FFAA 7MDHA 3L46A 3ITNA 4BO8A 2O2XA 2WUFA 2DWPA 3MMPA 3WA6A 1NFFA 4XZ3A 5B7PA 3UJNA 3HKDB 1REQB 4MUXA 3NHRA 3PGXA 3ZGNA 1KYQA 1OTYA 2RHOA 1H2EA 4MMZB 1B73A 2Z3WA 3I2JA 1JJAA 4DM4A 4D9EA 5DYIA 4CI9A 1H0RA 5EXSA 1LA2A 5EFZA 3U48A 2EX4A 4BN0A 1NXXA 4O4JF 2X0JA 1IJKA 1QP4A 2V7UA 1N9GA 1FQKA 2GRUA 2CE7A 2PGNA 1BE1A 1AMUA 5LUAA 4ML3A 2FZLA 4TQGA 1W59A 2CK3A 2BH2A 2HCBA 4F12A 5TF4A 4JR1A 2VH2A 3WRVA 1MIOA 2DMRA 5B7NA 3MWDA 4QDXA 1C8BA 1JHOA 4YBZA 3QYJA 5GAJA 2JKYA 3QHAA 2NTYC 3UVEA 2VZLA 3KDAA 2QP4A 3GT7A 1GTL1 3O91A 4EJ0A 4FGSA 4KIGA 4RA9B 1MPTA 1T9KA 1USUA 2CWDA 4XA8A 5E6SA 3R75A 4G81A 2OCLA 4BVKA 4I9UA 1J9ZA 1CY1A 1E2DA 3BXPA 2NZVG 5E1BA 2CMGA 1VIVA 1TJ3A 1J8QA 2B6NA 3G8DA 4UUPA 3ZH9B 5BRJA 1U1DA 3DJFA 1P62B 2BBOA 3PC8A 3QBJA 4OATA 1QAOA 2GX6A 5FI0B 2XZLA 3FTCA 4Q3NA 2V8OA 4Y1EA 1VA4A 3PQFA 5TMBA 3WQHA 4CIBA 1G4HA 3WWYA 3VDMA 2Q0SA 4XB1A 4HH4A 2BGTA 2CKMA 1YDGA 4X6UA 5IWCA 1NUPA 4FZVA 2IEIA 3EZXA 4BAGA 5CA1A 3RRJA 2BMDA 2CBGA 3LDGA 4QUEA 3VHQA 1U7HA 2D3WA 3DAGA 5KQLA 3FDXA 3EPLA 4WCDA 1Z5NA 5HFAA 1FDIA 1U8XX 4JDPA 2W83A 3EGVA 4RETA 1DWUA 4WA8A 2PX3A 4W6ZA 4ZT2A 1F2DA 1UM8A 5CFPA 1NSTA 4EB6B 1E2PA 2P6PA 1MXHA 1UXJA 5CFZA 3DCNA 3FUUA 4O1MA 3L8YA 1QYXA 2ESRA 3STHA 5B58C 1BN7A 2JFNA 4G5GA 1PV1A 3QHQA 2GR9A 3DEZA 3DVAA 3OJ0A 5KC9A 2HW8A 3Q40A 3UHJA 3WGIA 4N6GA 5ERYA 2Z9DA 1FYDA 1TJYA 3CPJB 3W5JA 1UOPA 1WSAA 3RYIB 1E9CA 1TC1A 3FB4A 1WXDA 1Z5UA 2WMDA 1Y4AE 4JEIA 4JZKA 3UW3A 2DHDA 3KETA 3UFXB 1X7WB 2AH5A 2DLDA 2HI0A 3M2PA 2ONJA 1DKPA 3V7NA 5K8IA 2PHZA 1J9EA 4WKBA 2J4FA 1EFVB 4G0WA 7REQB 4B2LA 3EVDA 4BNYA 3FHJA 5KQRA 1P33A 3B2EA 4TMYA 3KQVA 1YU9A 1I3NA 2YHBA 1GQOA 2GFHA 2I4MA 1ILWA 3CXRA 5H02A 1AU9A 2V0NA 3ZI7A 2UU9B 4ITVA 1D5CA 5CIWA 3N75A 4OQZA 4FOTA 5DXJA 3HBFA 3C5VA 3HL4A 3ZZMA 5KOIA 4K40A 4Y0NA 4FLFA 2XXAA 3OA0A 4XRRA 1D03A 1NDUA 2C82A 4OHFA 1Z4NA 1YGYA 3HXKA 1PL7A 1OXKB 3M0EA 4KL8S 1BEEA 2FPLA 4NBWA 2XNHA 4I3HA 3NRJA 4ZOLF 2RB4A 3A6KA 1Z15A 1MB3A 4GGOA 4WEOA 2R66A 3FMGA 4V03A 2HKIA 1K8RA 4JN6B 5EPUA 5EQFA 5JFTA 5LFAA 4RPJA 4DDMA 3G9QA 3ZH2A 5DNUA 2ZI5A 2I4RA 4OL9A 1M8JA 3VU8A 3H05A 3MJ4A 5K20A 1XMSA 1B76A 4UQOA 3ZGZA 3EEOA 2QW8A 2DYKA 4CT4B 2GJAA 3GZ4A 1NBWB 1IG3A 3UAVA 1QU3A 3V8BA 3EDCA 3QIVA 1IMJA 1HDYA 4I50B 3TQRA 4JV5B 4U9HS 1PR3A 2NTEA 2UYYA 3RANA 2ISCA 2OVBA 3TW0A 4I4NA 3RS7A 2AOUA 4C78A 1CJBA 2JBAB 3HFGA 2VNJA 4C30A 1XLTC 2X40A 4YMIA 5I8PA 3D7LA 4HOYA 4OX9Y 2BFBA 3SHQA 4AZ0B 3GXOA 1BA2A 1E98A 1RLOA 1TZCA 1W93A 3L6CA 4J6EA 2IYPA 1KL7A 1V4BA 1T36A 2WAXA 3IB3A 3K92A 2CUTA 2ZCVA 5ABPA 3PJRA 3RVPA 4LV8B 4RA6B 2C1ZA 1ZEMA 5B1IA 1FU8A 4MUEA 1M75A 3BZUA 4AS3A 4U02A 2HAEA 5DZSA 1CE8A 2X0KA 2X1LA 3EZNA 5IABA 5B64A 1K6EA 1K86A 4WFJA 5CFQA 3U09A 3IQIX 5KWEA 1HYHA 3RIYA 4CIXA 4P5EA 4WZ6A 2XGOA 1R1DA 1A9QA 5AQEA 4D9GA 5LMCA 3A1TA 3RTCA 1A4IA 5KSPA 4P3YA 1TZMA 5HOQA 2HD4A 2RGGA 3HI4A 1FDRA 1X77A 2YJGA 1YDEA 4MVJD 9ABPA 2WJAA 2WF7A 3MWYW 4G24A 3AM4A 3G7UA 3BDIA 2F6RA 3OJWA 4R8MA 5KNCA 2XCSB 3PYMA 4UTRA 3BMQA 1L4HA 2VATA 4ZZ1A 2J7KA 3K96A 4LHWA 2A30A 5BYAA 3LGSA 4MRVA 1GGKA 5HSGA 1I2AA 3JVVA 2VSYA 1F0KA 1U4NA 3GPBA 4R2HA 4YASA 2UZ3A 4DIUA 1USKA 2QSJA 2P9CA 5JBQA 5WRFA 2C5GA 4M9UA 3PK0A 1FL9A 2PXCA 4KBFA 4GE3A 3E4DA 1KRWA 4II3A 1BG6A 1VXOA 4J2HA 1UBTS 3ELUA 3G0OA 2D4AA 3H5WA 5DX1A 4DM3A 4YT4A 5KTOA 3AHJA 3KP1A 2I3GA 4X1YB 2VNHA 1A8SA 4ZICA 5BMVA 1XZLA 1XRJA 3LX5A 1TZKA 3K70C 1ZCAA 5U4QA 4XIGS 1RD4A 4EVSA 4B6FA 1E79A 1VYHA 1KDTA 4REMA 3UMVA 4EVIA 1ZRMA 2R7KA 4Q05A 3BH0A 4W1SA 5ECWA 3F49S 3AESB 1GR0A 5FH9A 1CLUA 2OTCA 1VIDA 2C78A 5IC4A 1ETUA 1K3UB 4KPGA 5BSFA 2CMHA 2BKUA 3SVZA 2ZUSA 1AQNA 3ER8A 1N6KA 2W0SA 1NMSA 2C9ZA 4TKUA 1MLDA 1ODTC 3TE7A 5KTRA 2AVNA 1JG2A 1POWA 2P35A 3KELA 4L9AA 1I9CA 3A9RA 5KOHA 1A9ZA 1Q91A 3OQ6A 4Q9LA 1CP2A 3P9SA 1G5IA 5G4KB 4Y2RA 2HZ7A 3Q7PA 4WLVA 2XQFA 2Z8YM 2EIHA 3AOGA 3WQBA 3R9XB 1P4JA 1H8HA 2VJQA 4IGAA 1MH1A 1Z3IX 3JAKB 4QRHA 3I05A 4NESA 4PO8A 4JT2A 1SXIA 1Y4UA 4JYCA 4MWEA 1UBHS 1BE6A 4MB6A 1E32A 3K35A 4DARA 2JCBA 1S2IA 1JH9A 4QL3A 3BTVA 3AEUA 3H1AA 2JGFA 1JU3A 2ERXA 3AOEC 1RJGA 4FCCA 3KV3O 4TWRA 2IV7A 1O9GA 2OT3B 1ADBA 2QYOA 4K6GA 4R16A 1T91A 2XHZA 4HN9A 1KVQA 2YBDA 4CL0A 1J1UA 2P79A 5FOXA 3I9OA 4B2YA 4EKEA 2QTVA 3URKA 3CRRA 5C81A 2HIMA 2VWPA 3L07A 2PGAA 2EW8A 4M6WA 5DGTA 1PYOA 4OU4A 2B1IA 4BNDB 1A82A 4HDNB 4OGKA 3U0VA 5K4HA 4OLJA 1IJEA 2EJWA 4N3GA 3HGTA 1AK2A 1O1YA 3G5AA 4YMWA 1I5EA 3P2OA 3RYFA 4Q0MA 5T4FA 3CF2A 1YQWA 3MB8A 3BGIA 3BXOA 2D59A 1Q0PA 3HDVA 3T6KA 4DY6A 2YN0A 1K06A 4R51A 3IQGX 4JYZA 3BTUA 3L6UA 1LDYA 1I4TD 5FPTA 1T3TA 4WL0A 2NUPA 1AK9A 4WADA 5H7XA 3I4CA 1CR2A 1C3LA 3FA2A 4ZCQA 2VRBA 3FCOA 5CM9C 3IVXA 4YECA 4G8BA 4G97A 3VO9A 2D7DA 5CM8B 3TQFA 1FNNA 4R3NA 1KIMA 2XEDA 3EG5A 3QYFA 5I7FA 1FTYA 5JPCA 3EE6A 2X4DA 2C2GA 2C3OA 4G5SA 1CR4A 4IQFA 1I4OA 5I9MA 3WAJA 3ABZA 3U4DA 3FVWA 2AG8A 2ORYA 2V5VA 1A9PA 4INPA 3ZDFA 1J5EB 2I33A 1SWWA 2AE1A 2YH2A 2YV1A 2AOTA 4RENA 2OFFA 3JQRA 2FMHA 4MUAA 2FW1A 4PLTA 5GMOA 4MVJE 4MW4A 2X9GA 3VR2A 3WAGA 3QQ5A 2CLSA 3H8JA 4B44A 1JL3A 1T9GS 1U7OA 5TVKA 1PJLA 2RI1A 3PUHA 3SHOA 4MDEA 2EFDB 3AIMA 4ZARA 1IQ0A 1MC5A 1E8DA 3GGDA 4JR0A 1US8A 1XZJA 3G0GA 3RU7A 1E1RA 3AV3A 3R4VA 4NENB 1VBMA 3TRFA 2ZBPA 3IUYA 1JXAA 4O3MA 3JYLA 2PJZA 5TEWA 4BFLA 1HE3A 1TF2A 5CH8A 1YL6A 2R6ZA 1GYQA 2HU2A 2ZR9A 3N07A 4AYTA 5CD9A 4TXNA 4GI1A 4LYHA 2Z8YA 3WK7A 4EL0A 3CVYA 3M6IA 3ICWA 4TTAA 1L9KA 3PZBA 4RLFA 5CDSA 4BAZA 2VDOB 2JHCA 3E9NA 4MB0A 1UCFA 3ZY5A 1K89A 1W8IA 2P9FA 1WSBA 1BXZA 1Z3CA 2R48A 2J9XB 2WZBA 1KJZA 1CCWA 4XB6B 4XGIA 4US2R 2I66A 5DGCA 2GARA 1U0JA 2HSWA 1E2FA 4HDRA 3C1UA 4EY4A 1XJCA 3VYVA 5I7UA 4YGYA 3V1MA 1U8CB 1W44A 1G6HA 1AQUA 3UJDA 5KBYA 2NIPA 2UVPB 3A9UA 5BPFA 1KETA 4JLMA 1J2EA 1PGQA 2DH5A 1XVAA 4ND7A 3I6MA 3PD7A 4G36A 4L8WB 3UCXA 4B83A 4ZOQI 4DCUA 1MEEA 2G06A 4M1EA 2YMQA 4KIWA 1ULBA 5JNTA 4OA8A 1E94E 1ADFA 3LBYA 1J07A 2NNWB 5EE5B 3SZGA 1SOWA 1XEXA 3B36A 5BUQA 1P3Y1 2RI6A 2VEOA 2WIKA 4CLHA 2FHPA 2IHYA 3D59A 3HB4X 4BMOB 4B6SA 2ECKA 1H8HD 2YV2A 1W36C 4DUGA 4ZFNA 4C4OA 2HC9A 3KQYA 3C3EA 4IZHA 1FYFA 1LPPA 1NZJA 2XUPA 3D7KA 4G5YA 5H0IA 3BGSA 5HIJA 4IIJA 3WIUA 4B75A 4EBBA 1ZJ4A 3NVDA 2CCKA 1C0EA 4XDZA 3KPVA 1XRNA 4D8UA 3VUFA 1G64A 3KYCA 3BZBA 1JFFA 2A35A 4I19A 4KFCA 3V4FA 4V1CA 4X1IB 1IOWA 1V11A 2IZ0A 3GA5A 3ESXA 3L1VA 5SZKB 4M54A 3KHTA 4PV7A 3KUCA 2I4IA 5C8DA 3PI7A 4RPLA 3TVTA 5K0JA 2IKQA 4DREA 4UHBA 3W05A 3KALA 3W34A 2BR3A 2ZJFA 2ZR7A 1YI1A 1G7TA 1SKYE 2ZSJA 2NUAA 3D0QA 3KZXA 2J6CA 2FW9A 2WVAA 3L7NA 1H1TA 4GEKA 4HMPA 2EKBA 2OHHA 4H77A 3G7NA 4IIEA 3O4FA 4NH0A 3VPDA 3AEQB 2F64A 1YFLA 4I4LA 4EFNA 4FXPA 5C18A 2EXXA 1X8LA 3N7UA 3D3NA 1I3MA 2C5AA 2D0DA 1VC2A 1QM5A 3N8NA 4MARA 3MJDA 3FJYA 5F1KA 1ZJ6A 2V7VA 3AVQA 1JIJA 2OXFA 1U7UA 2R44A 4QFDA 1CF9A 5CNJA 4UE3S 5SY4A 1ZK4A 5DW3A 2H51A 3IJPA 1U94A 2DXIA 2BFPA 2PKQP 4ENUA 3UMYA 1R4NA 3SI7A 2XADA 2J5XA 3LOUA 3ZV7A 2VZ9A 5ARCA 4M1TA 4L85A 5K0LA 3TINA 4D4LA 5C7YA 3JWJA 4K7JA 5LWQA 2HA4A 1JU9A 3WWPA 2GAIA 1AHIA 3NOOA 4FDUA 1W49A 4H35A 2ROQA 4JASB 5DCLA 1IEXA 2RBKA 4AAYA 3HNRA 3MXOA 2PFGA 4Q1AA 4BO2A 1RWNA 3SM3A 3DHYA 1GSOA 2ENUA 4ROSA 4BFCA 5JDIC 4I1SA 2E4ZA 3ONWA 1ZQ1A 2A9FA 3PLNA 2FK7A 4P98A 1B74A 1TW2A 1Z37A 3E5MA 3I6ZA 5JDCC 3IAHA 4G5OA 5F98A 1QFJA 2FPUA 3RYCB 4BFYA 1C9JA 1R27A 2ZTUA 4TT3A 3A26A 3RJ9A 3ZBTA 2C7BA 5T3UA 3CXUA 1JTVA 4NFLA 3IHLA 4LE1A 5HP4A 4COOA 2O8NA 5DHSA 4IMPA 2O0LA 3KIPA 4H7HA 3OPYI 2I4TA 4TUYB 2YXEA 1EK5A 2FGKA 3KEGA 4R54A 2H63A 4QOEA 3VNAA 3UMGA 1RU3A 4J1TC 3LX4A 5HR5A 3LPDA 2ILVA 3VC3A 4JI7B 1YKSA 4GUAA 1QCYA 4W5OA 2EC5A 2J0QA 2YJ6A 2YVUA 1O54A 2PNFA 2IYWA 4J7AA 5JWOA 2ZROA 2FSFA 2NVBA 4KVAA 1JEYA 1DB3A 4D0NA 2C84A 1BWPA 4ZOAA 1EA7A 1TKRA 3PGMA 4LXXA 4AJPA 2R8YA 3LT4A 4LMRA 5GJBA 4I4TB 3FTFA 3A2KA 3AKYA 4NBNA 1KDPA 1LX7A 3IQFA 5DNAA 3WQQA 1U0GA 4K86A 3RT7A 1D0SA 2BGLA 4H4DA 4HGZA 4L78A 1O95C 3QNMA 4CIWA 4CQLA 2YV5A 3ADBA 3LY5A 3HVUA 1L5VA 1HRKA 4LXGA 4XUCA 4DRXA 2I7XA 4EG6A 4CMEA 2VQDA 1NNEA 4LOAA 4RVCA 1G21A 1KERA 1K7FB 2PIAA 4S0ZA 3UV6A 1NI5A 1A9YA 1UADA 3AETA 2VFAA 4G0MA 3R7FA 1RWPA 2C9YA 1Q0HA 4KAAA 2C8VA 3A4IA 1L0BA 1COZA 3AJDA 4NMHA 3T3EA 3GR6A 4Y67A 5ELLA 1NXSA 1OTHA 2G3YA 4FI3C 1R5BA 2RJNA 4PG4A 2W6JD 5GPBA 3HJRA 4K05A 2GZ3A 2HF8A 1ZA1A 4KQJA 4PLPA 1GRQA 1DVRA 3AL3A 5BRAA 2RK6A 5CFOA 4F46A 4QIHA 3ZV4A 1JT2A 3A6HA 1TU4A 1HI9A 4TL7A 2JIZA 1ORIA 3LLVA 5FNVB 5LB2A 4GP7A 4P86A 5AH0A 1AGXA 4AU1A 4FDLA 3HVJA 4Y1RB 5J4YA 1IBMB 2Y0DA 1M67A 3LC7O 4D41A 1O94C 3BD6A 2DJIA 2GDJA 1T0IA 3AYXB 2C2XA 2ZSAA 2Y1EA 1BCRB 3TE6A 4KQXA 2GLXA 3M1YA 3LCMA 4AJ9A 4FYJA 2N46A 2WMYA 4U7DA 1L1QA 4FCVA 1DAEA 4ZOEA 5HFNA 3I01M 3SEFA 1QR6A 5A5EA 5LMNB 3RUHA 3HBMA 4J2OA 4HC4A 3THOA 3FKSD 1GZHB 1Z2AA 3G59A 4I1OA 5JRZA 2IS6A 2H48A 1R66A 2ZS7A 3I04M 3VZDA 4O33A 3ZKWA 4V38A 1G42A 5FJIA 2YN4A 3V8PA 1DPFA 1FX1A 2OFXA 6LDHA 3JPYA 1YB7A 5FNVF 1Z83A 4P84A 1Z6GA 2YWFA 3OESA 4MV4A 3RFVA 1J06A 2BZGA 3DG9A 3LD9A 3PXBA 4D02A 3R1IA 4ICIA 1H5NA 2BHLA 4MWCA 5C9ZA 5REQB 1CC1S 1XTTA 3EH2A 4PQFA 4B73A 1N7JA 3AZOA 5JV5A 2ZJ5A 2HPHA 1ODCA 4JWKA 3OLCX 2E5FA 2IK8A 4AD8A 5FA8A 4N03A 5IC6A 4HVAA 1V5FA 4OHUA 3ENNA 4QBFA 5M29A 3IV6A 1KEPA 4IF4A 1KMCA 2R7NA 2GPTA 2G9QA 2IUYA 3JYPA 4I6JA 3F6PA 3TWOA 3V1UA 1IWPB 5THKA 4DV1B 2FMIA 5CNKA 1J70A 3RTDA 3ZIUA 1W29A 1ENPA 3CSUA 4EHNA 1Q2UA 2Y93A 4L4UA 3UYKA 5A62A 2EF0A 4J4TA 1OJ7A 2FLVA 1U4SA 3EZYA 1QNLA 4U6SA 5E6RB 2G4LA 1Z2PX 5HKOA 1KJJA 3TG8A 3RT9A 1UBGA 4LOLA 2X19A 3S70A 1TNDA 3O26A 5GONA 4E22A 1M2JA 2CWWA 4KQIA 4EY8A 5JCZA 5L3QB 4DSOA 5HMMA 2GN9A 1I51A 3VO1A 4C4RA 1BMDA 4MVJA 4UCXA 4WDRA 1Q0QA 1J4AA 1GGMA 2HU8A 3CW9A 4US0R 1YBFA 4IRUB 1FTNA 1I01A 3HHEA 1SY7A 4QPPA 3PT5A 2I76A 1EFDN 2W2VA 4GX2A 5CB0A 4PZPA 3TTWA 1MD9A 1WXWA 4YCNA 1EP1B 1TIPA 1FFGA 2RGRA 2DQ4A 5MN5A 3H65A 1JRLA 1IY0A 2QZJA 2I6TA 1BTOA 3H5VA 4P3XA 5F2EA 4D4MA 3QMVA 4X00A 1QG0A 1YTUA 4KTTE 2XSZA 2C2WA 5B6JA 2HT1A 1TDJA 1XMJA 3LPMA 1V47A 4R1SA 4EUKA 2FPWA 3PX7A 4L4YA 1B93A 2ZAGA 4JLVA 4TKZA 3RODA 5C2JB 1XP5A 3GRUA 4K9RA 3G8YA 5B1SA 2ISQA 4E33A 2A5YB 5IC5A 5JS7A 2GK3A 3FDZA 1GU0A 2IH5A 3R0XA 4IS3A 3QSGA 5KDOA 4ND1A 1LPMA 1DIRA 3R3SA 3JW8A 5K3DA 4XRGA 1J8YF 3OZSA 1L7NA 3PFCA 1AN9A 1FE8A 1NF3A 1PLLA 1GNSA 4QU0A 1OLOA 5TQ2A 1V41E 3HV0A 5JSKA 2J09A 3ICCA 4MVJI 2D8AA 5AO9A 1VP9A 3L7OA 3SS7X 4BHTA 4F38A 4F8JA 3VTKA 4H1HA 1KAGA 3O2SB 4BV3A 2YS7A 3RSZA 1DUSA 2JCSA 2ZVQX 4R40A 2FFHA 1SCUB 1J7KA 4Y2QA 1USGA 2V6BA 3L41A 3OFNA 4D2IA 3W5BA 2C4UA 4MP6A 2Y71A 1MZVA 1VIAA 3F5DA 3GVIA 3B6IA 1V7ZA 1WMAA 5JO9A 4A0HA 1JA9A 1Q1ZA 4JLDA 4Q3CA 1QIDA 3L1JA 3VR0A 3GQVA 1N0UA 4UBIA 4G4GA 1YE3A 5LXTB 1JBEA 4O4LB 3S2ZA 2XMZA 5FPPA 1RWQA 4CR7A 1ZC3A 2QQEA 4PO9A 4LZOA 1CUBA 3DGEC 1QFMA 2MMGA 2P9YA 1C7FA 2H7CA 3AXSA 5E7JA 5F12A 3REQA 3UGTA 2VQSA 5PNTA 3CLRD 3QKIA 3AVUA 2JIZD 5LOVB 1JR2A 3V7YA 3PR1A 1PZGA 4D9CA 1G17A 5AW3A 5CVEA 3NVMB 1QH9A 5D3MB 4XYMA 1RQLA 1KAQA 1WEHA 1J09A 1GPMA 3LC1O 1L5ZA 1ZRSA 2Q0QA 1N1EA 1P8JA 3QV2A 4QDUA 4KRYA 5C51B 2R8EA 4E09A 1SKMA 3U7JA 1WCV1 3K9BA 3LS2A 3T0IA 2JGJA 5IDYA 4A9AA 1MORA 4KKXB 3NEPX 4JYAB 5L51A 3U0BA 1YZYA 2PCLA 4KJZA 5EYPA 1E58A 1I36A 2FG6C 4ZDWA 3G0CA 4ZJZA 2GTHA 4A23A 3V1TC 3PTAA 2QTHA 3CLTC 2D2IA 1YVEI 1NRXA 1B1CA 5T3YA 4DRYA 4JI4B 2J5BA 3T7TA 2XVAA 4NKRA 2GUGA 4S1OA 4ETIA 1EFLA 2NV0A 3KOXA 4MR8B 4Q4LA 4LJ5A 1U8UA 1NZFA 3WLSA 5EWJA 4NF2A 2WF6A 2OO5C 3QLTA 4HY3A 1Y5MA 1OZFA 4S0XA 1DWPA 5FOSA 4P3KA 3KL2A 2WG2A 3IIEA 4NAUA 4DLNA 4QJ4A 5E0KB 1FSZA 2JIMA 3EFOA 4OFWA 3OC0A 3KT6A 4KKVA 2F1IA 1FFXB 2JHFA 3P45A 3FHLA 1PGNA 3FPGA 4ZPJA 1OC4A 4B2IA 5BN4A 4M8LA 2FPSA 2YASA 4M0DA 5AKGA 5AKHA 1UH5A 4KEAA 5IYZF 3RU2A 1JNYA 2WFLA 1T3SA 2OWEA 1UKYA 1IXKA 1P6XA 1X7HA 1L7AA 2BRUC 4RVSA 4PNPA 5BOSB 2DBVO 2WYOA 4OXNA 3HBJA 2BOVA 3AEKB 4NK4A 3L1UA 3V3TA 1QQBA 1T1GA 3N2ZB 1JJIA 5FX2A 1OZ0A 4G89A 1MU0A 1OLUA 4JKYA 2LIVA 1IE3A 3OY2A 4Q12A 2GBCA 5ELMA 4Z7NB 3O8RA 5EZQA 1Y1SA 1YRYE 3PC3A 1MIHA 1X70A 1BU8A 2JDID 3CYFA 3PIDA 4HUQB 1Z5VA 1QDUA 1T2FA 3EQZA 1Z4MA 1U1FA 1WU8A 2I2BA 3TX2A 3BSYA 3I32A 1X94A 2UZ1B 1G8HA 1OOEA 5ADVA 3P0IA 4DUYB 1RCTE 4QYMA 5D01A 1R88A 4DLZA 1R4ZA 4ENVA 2WABA 3H9GA 4OHPA 4R05A 5HF6A 3F3MA 4FHFA 3C16C 2PK3A 2F48A 3DFUA 5JEDA 4A91A 3GAZA 1FMTA 3H5IA 4X6YA 5K1ZA 2Y27A 3ZHVA 3ZJ5A 4PC7A 1CY4A 3C97A 5LNK1 1LGYA 4ND6A 1N8KA 2Q5LA 2HJ9A 3A0UA 3SEAA 1OGYA 1NVAA 3QFTA 4GYKA 3QEMA 2XGJA 3TBHA 4JB0A 5ALRA 2VLBA 2FWJA 4XX1A 1PFYA 3E81A 2MINB 5F2NA 3HG7A 4IDNA 4XARA 4MVYA 3UMSA 1TOAA 4DTIA 5LP6F 1NW5A 2R97A 4I55A 4MWSA 1X15A 2TSYB 4NI5A 4QWWA 4EUFA 4X66B 3FOEC 2D8MA 2H85A 4IQGA 3ILSA 2NU9B 4JU9A 1KQFA 2IYEA 4GIBA 1RR6A 1XTRA 2R62A 2AA3A 2Y1CA 2YNMC 1FFBA 2Q3JA 1GRCA 3ABQB 2IFTA 3SIXA 2QAIA 4AKEA 1DHRA 1WA5A 1PFKA 2X8JA 3P0FA 4EHDA 1U6IA 2O2EA 2Y1XA 4FEGA 5DF1A 5IJZA 4BXOA 1KK2A 3VYSB 3IKVA 2O59A 2R47A 1QRUA 4DJTA 4MZXA 2IX9A 4IDHA 4FDAA 1H5UA 4YRAA 2I4OA 4QOGA 2ENWA 5IJ0A 2Y92A 1M1XB 4IOJA 3DOCA 3ZWQA 1EPUA 1Y3BE 3GDOA 2RHJA 3OM8A 1KGDA 3VJLA 3ZTYA 4FLMA 1ZHHA 1KOFA 2JAQA 2QRVB 2VP9A 3H9QA 3RUFA 1Q50A 4W9NC 3TNFA 4C76A 1DLJA 1ZOPA 3UT5A 4D6YA 1MJ5A 7MHTA 4MS1B 2AHRA 3TAXA 2R84A 2IDZA 5ICFA 3DMDA 4O5AA 4TXLA 1OXXK 1OLXB 1NVKA 4ZZ2A 2JLCA 4J76A 4AO6A 1UBLS 1RRKA 4J9VA 1SRQA 4XWTA 4XFKA 1XROA 3IP6A 1LKZA 1SXGA 3RBAA 1NPTO 1VLQA 3DAOA 4ZYVA 3I2GA 2R4UA 4BNVA 4I6EA 4DMLA 3I2KA 1YR1A 2YDYA 4WJZA 2RFLA 1I9GA 1QO0A 4EMBA 1RWVA 4BB5A 2WUWE 5FTLA 3ICEA 1KOJA 1MH9A 4H15A 1WDLA 2SKEA 2Y8EA 3RVBA 4ZI2A 5TQ0A 2X3YA 1DAOA 2H4JA 5IPFA 1P0CA 5DTJA 1LDBA 1HWYA 2C3UA 2FDRA 2FLWA 1OXVA 4KWEA 3Q8XB 5D5QA 4D4IA 5L9AA 3H42B 4KDFA 3OTIA 2Y0CA 5AK3A 4CF5A 4YRLA 3UZUA 4MYTA 1P1FA 1U6JA 1LFAA 2GH1A 3A0RB 3AF4A 3L1KA 3MCTA 4LF7B 4NJMA 1GZ4A 1G7CA 1T8WA 2Q1YA 4UFPA 1VYVA 1PD1A 3TIFA 1M6EX 4QT4A 2WTXA 3HR4A 1EJ2A 2HJRA 4HSEA 4R98A 3U13A 4J03A 1JE1A 1TEVA 3MWKA 2BGRA 4URXR 3IB6A 2QMQA 4LAFA 3WI7A 5KNCH 3FI0A 4QHYA 2QL5A 4TLMB 1RYDA 1XAJA 2GD0A 2YRWA 3DMNA 2GEDA 5J1TB 3RSOA 1PTJA 3DDSA 3KWJA 1M1YA 3GFGA 1AK1A 4IH4A 3R5XA 4WBXC 1MRZA 3PRJA 4WQMA 3RIGA 3RPEA 5JD5A 1ESDA 4CEIB 3MM4A 3JQ7A 4DZZA 1IRIA 3C74A 4CM7A 2XYQA 3LMKA 2B4AA 3IV7A 4RTMA 4N5IX 4M3NA 1K8ZB 5HA5A 2AD5A 1GQYA 3DW3X 3RC9A 4A6PA 4YMHA 1DKQA 2GZDA 2YNMD 2FSSA 5CVCA 4JCOA 3AVPA 3A4VA 4DLUA 2M32A 3V1YA 3VSEA 2J0UB 2QTZA 5TSDA 3A2MA 5JOQA 2YQ5A 3SSAA 2WQZA 4FR0A 2DHEA 2V6GA 3R76A 2B5VA 4JXZA 4BOYA 2X7XA 4Y2YA 3RKRA 2I80A 1S4MA 3GGSA 2VZ0A 4Q7MB 4XD7A 3ONVA 3RV4A 4FNGA 1JMVA 3EIEA 4BV8A 1JDPA 4DF3A 1H1DA 3PIIA 3ABRB 3KFVA 3LKZA 3I5YA 2WAMA 1R0LA 1U3FA 3L5KA 2VT6A 3OLXA 3OLWA 2XWSA 3QPAA 1WB4A 3QUQA 4FFWA 4GMXA 2R1VA 1MX1A 3WL7A 3BWMA 2ODQA 1I2MA 4URFA 1Z75A 5ENDA 4HT3B 1V48A 3TDNA 1ML3A 3NETA 2V6JA 2GAOA 3CVUA 3HB9A 1LPAB 4UTOA 4MKHA 4D3YA 1S2DA 1YQEA 2VWHA 4QODA 2VXCA 4NJMB 1U2RA 1V1JA 3W2HA 1F0NA 1SM4A 2YXPX 1ZW6A 3Q7RA 4JENA 2RAVA 4LX8A 3KKNA 3KFLA 3GZTB 5TJHA 1AQIA 2HWYA 2OE2A 3FOCA 1GPUA 2CB9A 4OQXA 3ROFA 2I9KA 5A0VA 3W5IA 1GL6A 1L3BA 4Y2XA 4LPKA 3GROA 5JIBA 3KDPA 1ZVQA 3UKJA 1OI7A 4GP6A 1J5PA 4PBTA 2C4MA 4UDYX 5FA5A 5HKAA 1JWLA 2BBTA 1JQJC 3KQHA 1SUAA 1ABEA 3D6VA 2BM9A 4O4IF 2WU1A 4EY3A 4UASA 4DR6B 2HCFA 3D0OA 3NP9A 4HQNA 1QGDA 4DBLE 3O3MB 5JNUA 1NNI1 5FAXA 3JTEA 1VL0A 1DOZA 2IYLD 4HLQB 1YCGA 2VO1A 4HQRA 4LS3A 1WB5A 1R9JA 1QXSA 1RJWA 3VH4A 1VDMA 1R6UA 1TM1E 3F0TA 4GVLA 4I9NA 2AK2A 4O2AB 4K9KA 2XGSA 3UAOA 5K8UA 4YONB 1YS7A 2ZXUA 5K8LA 2WY2D 2W4MA 1Z36A 4GLLA 5JALA 1DTWA 3O8LA 4UVGA 2JIQA 3P9KA 3N59A 1OV6A 2IY7A 2C00A 2NU6A 2REQB 1T6YA 2XCUA 4KO2S 1MEOA 4KSCA 4P7BA 1V2HE 1SVIA 5H1YA 2VAPA 3MBKA 4J0CA 1AHHA 4BJ1A 3SOPA 4Q34A 3RV3A 3WYNA 3E9MA 3KXPA 2FDCA 2FWNA 1EBUA 3TL6A 2EF1A 2BJHA 4MRNA 3ADDA 2ZCJA 1RYBA 2IYZA 5FOV