4FOUA

Structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
IYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding/membrane protein
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fouA00
3PJTA 5MF5A 3HV9A 4Y9MA 4FOKA 3TLQA 2W27A 3U2EA 3KZPA 4J40A 3HV8A 4LYKA 4RNIA 4RNFA 3PFMA 4Y8EA 4Q6JA 4RNHA 4Y9NA 3GG0A 4F3HA 4KIEA 3PJXA 4AFYA 3PJWA 4LJ3A 3N3TA 4FOUA 4HU3A 3SY8A 2BASA 4Y9OA 3S83A 4Y9PA 5MKGA 3GG1A 4HU4A 4RNJA 4AG0A 2R6OA 5M1TA 3GFXA 5MKGB 4ES4A 3GFZA 4F48A 4HJFA 3PJUA 4FOJA 3GFYA
chains in the Genus database with same CATH superfamily
1ITXA 4QLLA 3GNDA 3VOFA 3U7BA 5K4ZA 4QLJA 5KZMA 1QBBA 1RH9A 1RQBA 3TSDA 2DH3A 4IIBA 7TAAA 3TCSA 4XG1A 3OTRA 3VNIA 4O13A 4NZ5A 1GOKA 5BOEA 3MB9A 3R8RA 1F07A 3RPTA 1Z8AA 4IPPA 2HTMA 1TJPA 3V16A 3VNMA 1V03A 2R9RA 1VFUA 2AL1A 1UR4A 1WV2A 4NJHA 3B0VC 5RUBA 3N2TA 1HTIA 3W87A 1E1EA 4IIGA 2VJXA 3T07A 2YR1A 3VTRA 3AU2A 5EBUA 3CZLA 4EF9A 4DF2A 3B0UX 1THFD 4HA3A 3NZGA 2X8RA 9XIMA 2DEPA 1RLCL 2IKHA 3UZWA 1OC7A 5D09A 5GJPA 2VDHA 4EXQA 5CJNA 1OFQA 8XIAA 4HU4A 3L0KA 4JTHA 1M6JA 1CXKA 4LU0A 1VBUA 3EB4A 3SFWA 4GY1A 3WELA 4ZTXA 2YA2A 2CBIA 3N29A 5H91A 3MBDA 1C93A 1OYAA 5F4SA 2W9MA 3NL6A 4HTYA 4WOQA 4DLFA 1VEPA 4UIOA 3PN8A 5D33A 1PX3A 3VD7A 3BURA 1PHQA 1IWBA 1A5NC 2GUYA 2G5WA 1XWYA 3LPOA 1YNYA 3CK5A 1Z7AA 2VZSA 3BAKA 2PTXA 2NUXA 1QHPA 3PC0A 4GZ7A 3NXLA 1TPUA 4FXSA 1EBHA 2QPUA 3N6QA 3FGCA 2X09A 3BO9A 5LIKX 5H8PA 3B8IA 1L6SA 1KCXA 2ESCA 2Z1VA 4GMEA 3CEPA 3RLVA 5HQEA 5D37A 4B3ZA 4ZZ9A 1SJBA 4CD4A 1DPMA 3CB8A 4R3UA 3VCNA 1UJPA 1CWYA 4BCEA 3TYDA 2QUUA 3BGJA 3GD6A 3W1TA 4Z1DA 4HNLA 4GD0A 3W23A 3WLHA 3MKVA 2DPEA 2E3ZA 5IFTA 1TPC1 4WUIA 1XBVA 1NWTA 2XVKA 3SRDA 5ECUA 5G1YA 1RVKA 3DFOA 3BZGA 4OE7A 2WW5A 3FN9A 1UROA 1YDYA 1Z3NA 4GNJA 4I9MA 3KWSA 2OELA 4ZB0A 2GSEA 4UUIA 2VEIA 4DXXA 2E7FA 2PBGA 2ZICA 3T55A 2Z1KA 1QOQA 4QLKA 2VGFA 2NSOA 1XW8A 1MQQA 2GQ8A 3VMOA 1IEQA 5DMNA 4PR4A 2CLKA 1GOXA 3WLIA 3K2GA 3KLKA 1RCQA 3M0YA 3BARA 3FSUA 3K4AA 3REQA 1KXHA 3WKZA 3RM9A 3HJEA 3Q94A 4IF2A 1GKRA 5F2LA 1FCQA 1P7TA 3VGGA 3GFXA 3UQNA 4ACYA 1MNZA 3U7VA 3N18A 1NTHA 5TQLA 7REQA 3LHZA 1GG1A 1LZOA 2ICSA 1XFBA 2V5KA 2V69A 4GGHA 2XGZA 4I6KA 3IJQA 3CJPA 3DDMA 4BQ5A 1XX1A 2A21A 3U4FA 3ZXWA 3ZT6A 3UR2A 4TVDA 1ZJIA 4LUJA 3UWQA 1FTXA 1IR1A 4FF7A 4K8EA 2Q3OA 2ZADA 3WD3A 5DEZA 5E0FA 1H0IA 1Q13A 3EWYA 3SCPA 2OGJA 3ARVA 3P2VA 4GC4A 3CH9A 2DJLA 3ORWA 1ZNNA 3DESA 1R5YA 3TCEA 1FFQA 1G7UA 1ZRQA 4AHOA 2O9TA 3C2YA 4TX6A 1X7FA 1LLWA 1W32A 3BCFA 4WKHA 3HG4A 1KM3A 3O6DA 2WCAA 3GH5A 2EF9A 1P0NA 3L9CA 3UP8A 4GUIA 5A6SA 3NGJA 1Q6LA 5JU6A 2O9OA 3M41A 1E51A 3P8IA 3AXKA 2HK1A 1J93A 4UOJA 2Y4SA 3BQ6A 2A2IA 3E02A 1DVJA 3WBAA 1NELA 2PI6A 4L4PA 1O4UA 3STGA 4GHRA 3NPXA 1GKQA 1LDCA 3UYIA 1ZJBA 4R34A 2EPNA 1FWEC 1DBTA 3THDA 4ZMGA 1XBYA 2QCGA 3ONCA 2INEA 1NU5A 1J9YA 4CD7A 1V0LA 1RZMA 1LJYA 4L61A 4H19A 3WUEA 1GPWA 4NVTA 3PPCA 3TXVA 1KTNA 2RUSA 3IVSA 1YHTA 5E5CA 4C7FA 4DHGA 3CEUA 3H22A 1X39A 3MTWA 4F0LA 3U4AA 2ISDA 1O95A 1TA3B 4D8ZA 1EXPA 1HKIA 4GO8A 1AH0A 1IGWA 4J3UA 1GEQA 1HJXA 4PBGA 1NQKA 3VKJA 4K6AA 3NPWA 1RY0A 4WDUA 3DOPA 5G2HA 3M0JA 1V02A 4X9SA 3U48A 3B8TA 4DX3A 3W9ZA 3LPGA 4JHZA 2BOEX 3NO5A 3FVDA 2Q71A 5G4HC 1W2VA 3QOMA 4H7VA 3EMQA 3KOXA 4YWSA 5CPSA 4HZ6A 2ZZ7A 1WZAA 1F61A 3WLQA 4MB3A 2BY3A 5CG0A 1FHLA 1JRBA 3BOLA 3KRZA 4KT2A 3N15A 4Q4SA 2O92A 3P61A 4BEQA 4JHOA 1K8XA 3ZO9A 2J25A 2VR5A 3SCQA 4BI5A 4Z2LA 5I3JA 5LZLA 2WSQA 1GZJA 1MYRA 3QKEA 4JTGA 2G96A 2ZX6A 3R0UA 3PP7A 4TXEA 1OFAA 3EPOA 2NV1A 3VIJA 3VE9A 2VCBA 3V35A 4UZSA 4U3AA 2GGJA 4OU1A 1FWFC 4DBDA 3N9SA 2XSBA 1V7AA 3FOKA 1EYWA 1OX6A 4FNRA 3VYLA 1HUVA 5AC5A 1H7NA 3MUXA 1MEWA 3T2OA 2OT0A 3A9BA 5M3WA 4QG8A 4GIEA 2BG5A 5LA0A 4JTIA 5J5RA 1A5AA 4C91A 1N2VA 2MANA 1PV8A 1QNPA 5T26A 4GPNA 1WDQA 3QV7A 3V1PA 2QPXA 4TVCA 3AIBA 1NWSA 4FX8A 3TNOA 3PZQA 3ANVA 2XFFA 4UQDA 1NFGA 1HVXA 2C1IA 4Y6GA 5HINA 1L6GA 4XVEA 2BXZA 1UZDA 2ZWYA 1W5PA 3NDOA 2D20A 3A64A 4LALA 1YLVA 3W1AA 2ZWZA 3G8RA 4JTSA 4YYFA 3NQMA 1UD8A 1CNVA 3R4IA 3H26A 1VFSA 3STCA 4Q8WA 2ZRZA 3ELFA 1XD1A 1AH4A 5HMDA 4HB7A 1K77A 3LHWA 2E0PA 1W5NA 3IVTA 1Z41A 1E15A 3N6HA 3MSRA 3W38A 1GOQA 1W91A 3U0HA 3VM5A 1A4LA 3CGTA 3R0DA 4B5SA 1GVSA 3GBEA 5DFAA 2J8TA 4XUYA 3T6CA 4FLQA 4GI6A 4DBEA 3CC1A 4OECA 4MB5A 3WFZA 1MEIA 3B8UA 2DSWA 4H2HA 4XISA 2NUWA 2VFIA 2JKPA 1KM0A 3F4DA 4LCRA 3OEXA 2AGTA 2Y85A 5JBEA 4W8AA 1KR1A 1WOAA 1QOXA 3TQKA 1V6VA 2PDYA 2ON3A 2C1GA 4F3HA 2YDAA 3HPFA 3W22A 4FOUA 4LBRA 1V6UA 2YXOA 1DWJM 1E4IA 2FVLA 3BVJA 4XTIA 1IXNA 5A8MA 2PWVA 3F5KA 4QP0A 1GYLA 5LHEA 4IPLA 3AIEA 3WNOA 3ZR4A 3DBNA 3RILA 1A3XA 4HN4A 1E9YB 4XO6A 1TCMA 3OOQA 3FS2A 4ATLA 3B97A 3G3DA 3SY1A 3WNLA 1RBLA 1RHCA 5ECVA 3M7SA 1SFLA 3GHRA 3GRIA 1E40A 3BE7A 2G97A 1R3VA 3IWPA 4X2RA 2CKSA 3QY7A 4AIUA 2WCGA 3TK7A 1LQ0A 1EDTA 4JTRA 5AVNA 4RR4A 2WXDM 4JD4A 1KBJA 1IR2A 1EJTC 1KFJA 4GQBA 1S2TA 4KKXA 4UWMA 2XGBA 1A5MC 1RBOB 4AC1X 4U5KA 1KC7A 3HFYA 1KFWA 1TWDA 5IDIA 2VGIA 4K8GA 1OZQA 3PAOA 4AZHA 3H54A 2P0IA 3N13A 3HMCA 4H8VA 1TVLA 3RFAA 2GJPA 1XYLA 1U83A 1ZBKA 4MB4A 3HQNA 3OLDA 5I07A 4MNMA 5CC7A 1LOSA 4RUBA 1E5JA 3ZVHB 5HXMA 2OKTA 1JF5A 4XIMA 5I7GA 3AI0A 1KFBA 1EO7A 2B81A 4QAIA 4XAZA 2XTKA 1PIFA 2ZTJA 3IV8A 5D03A 1T8QA 4RZ4A 3ABSA 2FIQA 3EBVA 3PJXA 1JJKA 5HUOA 4DO6A 2G8ZA 1UP2A 2B0MA 4PBEA 2DZVA 4KF1A 4AXKA 4R53A 4JKLA 2WKLA 1UZ4A 5HWNA 3HQ1A 1MWOA 1E4LA 3A4AA 3W86A 1E1FA 5C9RA 3M5YA 1D3CA 1OB0A 3M6DA 2HXUA 3DIPA 1LT7A 1ZLPA 2O56A 1KLYA 1UASA 3KL3A 1CGXA 1XKJA 4DELA 5CH9A 1PX8A 3GDBA 3C0QA 4CQBA 2JIEA 4I3GA 1YDOA 3QM3A 5CZ0A 2CZFA 1AFSA 4XAPA 2AKZA 2RJGA 4UC5A 3VNLA 4HHMA 5BWFA 4ZXLA 4HYRA 4M8UA 5REQA 1DQUA 1A5CA 1V77A 5LIUX 1UH2A 4HA1A 4D8AA 2ZXDA 3UG4A 1PTGA 5A6JA 1TVNA 3MHUA 2ZXQA 1DE5A 2CLPA 4D71A 1Z48A 2VDIA 3HG3A 3MC5A 4MGGA 1ONXA 2P50A 3I3DA 1K7EA 4AB4A 1IYXA 2VQUA 4DRSA 1WAWA 3W2NA 2HZGA 4HZ7A 4J3TA 1ALDA 4N42A 3WDJA 3VNDA 4UBPC 1JYVA 3DBPA 4S2CA 1M01A 1IT7A 4IMEA 2J8FA 3WIJA 2XZ9A 4HPJA 2YCLA 4MWAD 1J0KA 3RNDA 3QY8A 1WZKA 1KO0A 4B5TA 1UH3A 2HISA 1TPB1 3TQVA 5A6TC 4REQA 1JYXA 2VEMA 3NQCA 4KIRA 4FALA 5DCDA 1V6TA 1U2YA 5A8GA 2CC0A 1PKMA 4NNBA 3FYPA 5LXEA 2ZUNA 2BBFA 4AH7A 2J47A 1D2KA 3M43A 3P5YA 1ZB5A 2BP1A 1F2JA 2Y7GA 3KS5A 1QRQA 4GINA 3K8LA 5IBXC 2OT1A 5BNKA 4S23A 1CXIA 1GQNA 1NIUA 2JIWA 2VI0A 1E3XA 1M7PA 4DNMA 2GYIA 2YIHA 2QCMA 3WQ4A 1RAKA 5LXXA 3BW2A 1DJQA 2Z2UA 5AZ0A 3ISIX 2XVPA 3M1ZA 3WH5A 2XN1A 4XZIA 1XG3A 4NZ4A 4GRSA 4ONVA 2A0NA 1W2PA 2DW7A 2CZ5A 4Q8TA 2ZUUA 2IW0A 3RU6A 5HNTA 2WSYA 5I09A 1JCNA 1FKWA 3AHXA 1V02E 3MCOA 2ZZ5A 1PJ9A 2Y7EA 3O0KA 1TO3A 2P3EA 4P8UA 2WSPA 3T44A 3E2RA 3QYQA 2J74A 1YNPA 4DJDD 1GORA 3QLDA 3IJLA 3HPXA 5DMMA 3GVWA 1PTAA 1BAGA 2UWFA 5C2GA 2AQVA 2WZTA 1PYFA 1E4MM 3MJYA 3SADA 3PG8A 2J24A 2ZQ0A 3G2GA 1LL7A 5CQ1A 3V5OA 4P5UA 2PF8A 5EA9A 3FK4A 1QWKA 2VYOA 3OGSA 4E8DA 1GT8A 4JQ1A 2WVUA 2CLLA 4AWTA 4BZYA 4GCXA 3NIYA 4G56A 2AGKA 3LV6A 3WUFA 1TTPA 1UKOA 1ZAIA 5FKYA 3DFQA 4G6CA 4JR5A 1B0IA 4LUYA 5C7VA 5M2FX 2Z24A 1JDEA 5LHFA 5ABGA 1LUCB 5FJUA 4KMQA 2ALRA 3BGAA 1OY0A 1GVOA 4CGTA 1P0DA 4HN8A 5BU6A 3E0FA 2XPKA 3T40A 3N4AA 3TMLA 1CLVA 5HWMA 4BQ2A 2X05A 2PP0A 2F6KA 3MANA 4LCQA 4PL2A 1M03A 3LYEA 4I5UA 1Q4NX 5A95A 2QEZA 3QMTA 4LQ1A 5A6MA 4GY7A 2Z2AA 4XKYA 4QHRA 1Y5XA 5AC7A 4ZOEA 4M56A 2PD9A 1DWGM 1I1WA 4B4FA 2BB0A 3FIGA 4JZ5A 3FKRA 4HGXA 5FEPA 3VCCA 3H2CA 3E2SA 4CN6A 1E9LA 1LP6A 1OIMA 3UVIA 3UZYA 1PZ3A 2GUUA 1SW0A 1NOUA 5KEZA 3ITYA 3CZKA 5J04A 2OFJA 3HA1A 3DECA 1XYZA 4QX4A 4DAIA 1KD0A 1JULA 3JW7A 3NPVA 4N02A 1CIUA 3OYZA 1GUVA 1UKPA 2OVLA 2OGYA 4HOXA 3CHVA 3O2LA 4AG0A 3H8AA 5M1TA 3FVMA 5H8UA 1QOPA 7CGTA 4ECLA 3F4WA 1KBBA 3KTXA 2QCHA 2V63A 4IXHA 3EPNA 1LBMA 2ZC8A 2GWGA 1ECEA 4GCAA 3KVKA 1FWBC 4NI8A 5HNUA 3PZNA 2UY3A 2ONEA 2ZUTA 3CUZA 1IXPA 5I78A 4C1LA 3EOOA 1JNEA 4A3UA 3VUPA 3PFMA 3M6YA 1REQA 5D8ZA 4S3FA 1VEMA 1ONRA 3ITOA 4MAVA 3KBVA 3WMBA 3TTSA 1Q3NA 2C3ZA 5AC8A 1C8QA 2PDFA 1KBLA 4NASA 5CZSA 4CQ8A 5DLCA 4PCPA 4GVFA 4Q4RA 4IPNB 3NFUA 2OEMA 1WP6A 2PWFA 1AQFA 2EPKX 1OC6A 3ZR6A 2FDSA 3S5YA 2BVTA 3UFYA 3CM4A 1J0ZA 3KBWA 5D9NA 4JIRA 3IUDA 4S3BA 1T5AA 2F7FA 5D2TA 3D3AA 1A3WA 1S39A 3BLIA 4RNIA 5BXTA 4LNYA 4UTMA 2DVXA 2VEFA 3USBA 4L6OA 3GS6A 3QOKA 5JBDA 4TV6A 1RUSA 5FJOA 2VM8A 2XDFA 3DG3A 1JIBA 3E0IA 3S9IA 4KWOA 4JKKA 3VDHA 1R38A 3EOEA 1A4MA 1WAUA 2KAUC 1EJWC 1WKFA 2C71A 4G7EB 1KXVA 4PMZA 1ZSXA 3AHYA 3GXDA 1O66A 4R5EA 4WDTA 3CYVA 3KX6A 3MY9A 3S6DA 1VRDA 4NQ1A 4S3DA 3G3MA 1RCXB 1RXOB 3QTGA 4GUFA 2OEJA 2C0HA 2J9ZA 2EJ1A 3RCNA 2DSUA 3HOJA 3GG7A 1B3ZA 5AHFA 2BSLA 4JTLA 3A4WA 1DQXA 4LPCA 4LVAA 2E9BA 1LRQA 4MIMA 5KSWA 3CHDA 2WANA 3QKZA 1UYQA 4H8UA 2QUMA 4O8AA 5C0QA 3OU8A 4Y9NA 3DN5A 4O1DA 1WB0A 3AXMA 1BXCA 3FSTA 5HOSA 3H70A 3TJ4A 3GFZA 4JGDA 3FA5A 3VM7A 1FH9A 5FL0A 4PUDA 3TYCA 1KTCA 1RJRA 3KM8A 3AROA 1EJUC 2FFCA 3SJNA 4X3ZA 2O7QA 3EEGA 1UWUA 4FSAA 3FLUA 5AZ1A 3FYOA 3BSGA 3WQVA 3S2LA 2V5LA 5LIYX 1HL9A 1W9VA 1DJXA 3F4CA 1FX6A 2X16A 1HVQA 4QDWA 2PWGA 4RZ6A 1DIDA 1ADSA 1VPXA 5CGMA 4XBJA 2QCEA 4LXFA 3K46A 1YDVA 4UQ9A 1MQRA 4MDOA 3ZFHA 4AYSA 3H7RA 1F4HA 4C6IA 2D3LA 3GC5A 5CPMA 2G4JA 5E0KA 1V6WA 1JEZA 3WH9A 4LEQA 1OJXA 3QRHA 4NT0A 3USZA 1HKVA 3VPLA 3VIKA 1A3HA 3QFEA 2EGZA 4DJFD 1NVMA 2BDQA 4ATWA 4ZQCA 1MNSA 3A3XA 3E3HA 2HPIA 4QEHA 1KFLA 2PZ0A 1QVBA 4IM4A 3W2JA 4B5WA 4QTGA 1WXJA 2W79A 1PIGA 4F79A 1K8CA 4LS0A 2IXVA 3QYSA 1UR8A 1G4EA 3N1AA 3CUGA 1DE6A 2VX7A 1M41A 2HQAA 3GVQA 4RPPA 3RAOA 4XUGA 5CBBA 1GW9A 5MKGA 1S3TC 1GHSA 1EFZA 3EKGA 3UR5A 4RL3A 3RR4A 3ID7A 1V3JA 3PULA 3U2OA 2AMGA 4GE8A 3AJXA 2XZ7A 5FOOA 2NQZA 2CZEA 4M24A 4RE3A 4A21A 2HBXA 4QQUA 3R79A 5D9MA 2FTYA 4O28A 4IQJA 1H4PA 4UTTC 2NUYA 1QI5A 4Y7EA 2Y5JA 3QV6A 2B4GA 1R2RA 2NVDA 3UA3A 3VIIA 1SYTA 2EHHA 1M1BA 3W2UA 3AYRA 4MMWA 1J8VA 3B4UA 3MI2A 2Y8UA 1N8IA 2YL5A 2RKXA 3NZ1A 3BAWA 1TV8A 3B4YA 1K9TA 1XCXA 4FXFA 2OCZA 4NJGA 1EUNA 2WVTA 3TZFA 1YNQA 4H9MA 1SZRA 3C8NA 4U31A 1XYFA 4ERAA 3R7MA 4DXKA 4B16A 1IE7C 3LMZA 3MT1A 4PODA 4QG6A 3M46A 1PZ2A 5JUVA 3H2AA 5EB8A 3WX7A 4N0RA 1XS2A 4A29A 5C7HA 1ML1A 1V6YA 2F6XA 2E09A 3RM8A 1XLDA 4AZCB 1D7KA 2Y6ZA 4LX4A 2VNCA 2X40A 5C55A 4MWAC 1LL4A 1XGZA 3UJSA 4DWSA 1HO1A 4N9EA 1VGAA 4XKMA 3QBUA 1L8NA 3CAWA 1V51A 2WHJA 1TIWA 5A2AA 1KLZA 2BLEA 1HL8A 5H1WA 3K30A 2ZCGA 3HN3A 3FYYA 2INFA 5DX7A 3DERA 4RE2A 1H2JA 1PZ1A 1YQ2A 2Y70A 3LZ3A 2JK2A 1HG3A 1DWIM 5HQLA 3N2OA 1MFVA 4BEUA 3CYJA 4JPGA 1KGWA 4FLRA 1NWRA 1JPKA 4JL1A 1SM9A 4HK6A 4RZ5A 3EXRA 2X42A 1TTJA 1KQZA 2Z29A 3ABOA 3WJWA 1BG9A 1VP5A 1AD1A 4JEJA 2Z0IA 4P8VA 1M7XA 3APTA 4FNPA 3GVGA 2ZRXA 2AQOA 3PTDA 3WDIA 1JZ2A 4O17A 2WHKA 1AW2A 3QPYA 1DJGA 2VURA 4Q32A 4CU7A 4EXBA 4NZ3A 4XB3A 2ATSA 1K7FA 1RCOB 3GR4A 1LOLA 2YX0A 4ZSUA 3NZRA 3TC6A 4DJDC 1LORA 4F2TA 1YW1A 3OIXA 1EQCA 3C0JA 3RX3A 5ABEA 2GSHA 4DAFA 2G3IA 3ME3A 3MSGA 3NSMA 1E0WA 2CLOA 4OWGA 2YFOA 2F9RA 4L4MA 4UFMA 4EXAA 3CQIA 1PPIA 4NZFA 4X0VA 1XXXA 3DCPA 5DXYA 3KTSA 3VGDA 4X60A 2PC4A 1K9DA 2VOMA 2OX4A 3DEQA 3OPSA 2R6OA 5HA7A 2IUZA 3HGRA 1EPXA 1W9XA 5CKSA 2W66A 4JEQA 4LF1A 2PWUA 3ONBA 2Z6JA 2YYUA 3ZLGA 1TZZA 1MO0A 4L5ZA 3DHPA 3IIPA 3SGUA 3UD6A 3GM8A 3DHFA 4NAFB 4EOUA 1NARA 4RK8A 5A3HA 1GOOA 4ZCWA 3VIOA 1PIIA 2CIPA 2PMQA 4I7UA 4WCJA 3L68A 4R7OA 2W63A 4CU8A 2Q8LA 2DUZA 1TTQA 3EWBX 2IMRA 3BCJA 1A0CA 5U7SA 4GNKB 4YIWA 4W87A 1C7SA 2WMFA 3OB8A 3LGEA 1W1TA 2PURA 2DIJA 4Q33A 1MRQA 4KFNA 3R25A 5K9DA 4UQAA 1E71M 2YZ5A 5M5DA 1NOWA 2CNCA 3GDMA 2WJFA 3W1UA 3O9NA 3TC3A 1WDRA 4GLEA 5BRBA 3MV11 5J5DA 4UQEA 4MB1A 2XH0A 4XBSA 4ADSA 1PYMA 3TUUA 1BRLA 2OWCA 2FMNA 3D47A 3R8GA 2CZVA 4O18A 1F6PA 3WNKA 1B90A 4YTSA 4GX9A 4MYAA 4IJRA 5CEWA 4GC3A 2Z1XA 5GNXA 2F8QA 4P61A 1POKA 4Q7IA 3QR1A 2OG9A 4EPBC 4O0ZA 3DHDA 1AJ2A 3LTSA 1TR1A 2Z25A 2VX6A 3G1YA 3ITTA 3FXYA 5CSSA 2HRWA 3H2NA 1ZCOA 3R58A 1OFDA 3W6LA 2HS6A 4DWDA 4QDMA 2EXOA 4OV9A 2ZE0A 3UG8A 1XIIA 1P0EA 4ZR8A 2CPUA 1S2WA 1C9WA 5LA1A 4RV3A 5AHEA 2OQHA 3A23A 3LCHA 3MA8A 3O8AA 2X2YA 3JZEA 4P7QA 4E0CA 4DZIA 5JH1A 1IZJA 4AIOA 2BHZA 3PFRA 1NH6A 1FWGC 1W1VA 1FHUA 4MVAA 2X2GA 1B3VA 4BFAA 3OLIA 5CGTA 4E2VA 3T2QA 4C6NA 4JQ4A 1F8IA 1IIHA 1ME9A 5AHNA 4PUMA 4ERGA 4AEFA 4AHQA 1ODZA 2FGBA 2V3EA 4OOUA 2VZUA 3TTOA 1OFPA 3LXAA 1PKYA 2QMJA 3MUAA 4F0HA 4WXZA 2DDXA 1XIGA 2J9YA 1Y5WA 3LTPA 2E25A 2FVKA 3CQKA 1D8CA 1H1YA 2VFEA 1QI2A 3LK6A 4IJBA 3BWWA 4W88A 2VFHA 3GU1A 1ZPTA 1XUZA 3RUBL 3TNBA 4MLJA 1LLZA 4IT1A 4W85A 1WXYA 3NL2A 3TX9A 3RG6A 4PUJA 3G22A 4D6FA 5CGQA 5A8PA 2WSKA 2NX9A 5C5YA 1GGOA 4HU0A 1YPFA 4OFCA 2EPLX 5ENLA 4O12A 4G1NA 4U28A 4FOKA 1R85A 2PTWA 4AW7A 3CUHA 1R3YA 1ZS2A 4N2YA 2ZKMX 3AWNA 2ZUWA 3NL5A 1T96A 3DI1A 4AF0B 4R9OA 4OTKA 4LW7A 3PBGA 1P0KA 4M82A 3GC4A 1R0MA 2POTA 1NJJA 2F6UA 3GR7A 3WLPA 3C56A 3W2MA 4F0RA 4W7UA 2XYLA 1DWHM 3MUCA 3LOTA 4MTVA 2AL2B 1QJWA 4L6HA 3SO7A 4CVUA 3VDGA 2J77A 3LNPA 3CNYA 8RUCA 1RK6A 3WZ0E 5IRPA 1RPKA 1SFTA 4ZL1A 3QZAA 5K9XA 3CAVA 3DAQA 4WR3A 2QS8A 1FWRA 4E8CA 3LERA 3BLKA 3TA9A 2FPTA 1H1NA 1PVNA 1UC5A 1M3UA 4JNZA 4GISA 1EL3A 4P7OA 3C2FA 3LCXA 2R91A 4I9AA 3RGTA 4D1JA 1B3OA 2DH2A 2ISWA 1E1CA 3WK2A 4FIQA 1TRDA 2BVDA 3WY1A 1M04A 2I5QA 2X0HA 1X97A 5C9WA 3QMSA 4LS2A 3AXHA 1UKTA 3EX3A 6CGTA 2IPWA 1TMLA 4NUWA 3A13A 4IGNA 4UNIA 1AQ0A 1RA5A 2FH6A 3W7LA 3UWWA 1TG7A 1CBGA 3W1QA 4A4AA 2E1DA 3WQDA 2YYTA 3S83A 2CWXA 1U30A 5C54A 4UQCA 3SI9A 3AYTA 3OHMB 5HNRA 1P48A 3KZPA 4HHPA 4HNUA 3OW1A 2VC7A 5IDZA 1LBLA 2GK1A 4S1FA 3IV3A 1GW1A 2NT1A 4CEXC 1OFBA 4X61A 4E3VA 4L1WA 4DJFC 4PCTA 3ARZA 4Y96A 4AHPA 1FXPA 2PDNA 4UQBA 1QTWA 2DT2A 3TR9A 1Q4WA 2Z2BA 3NR0A 1CGUA 5H2ZA 3W6YA 3RRAA 3OQ8A 1DTNA 4KS0A 2Z1WA 1XLHA 4DZHA 4KIEA 2VRQA 5HR6A 4UTFA 2FMOA 4UTIA 3EZ4A 1W9UA 4CQAA 3IRDA 3WLMA 3HM7A 4F0SA 1RD6A 1DIOA 3QSTA 1AVAA 5AYZA 2FDMA 4WKAA 2G3NA 4KFOA 3N14A 3W2KA 3GTFA 1WDSA 4PRTA 3P93A 2I9UA 4UTHA 3EMZA 1I9CB 1XLJA 3FNDA 3ZOAA 2FZDA 4LCSA 3LCWA 3B8VA 4AIBA 2Q8XA 4ZE4A 2Z4GA 4M0XA 4MYXA 3LCFA 4WJEA 2P53A 3PAJA 3MI6A 4ZO7A 1VFFA 2AAAA 2DJXA 1K9EA 4O1BA 4IP7A 3LI1A 3COTA 4PEEA 4S2BA 8XIMA 4WY0A 1U1HA 4FLOA 2FVMA 1UD3A 1GVFA 1Q6QA 3R0KA 4Q4PA 3T9PA 2QDDA 4M6UA 3DYPA 4OT7A 2VMFA 4JTTA 4DEFA 4D6IA 3LLDA 2VGBA 1UR0A 4ENLA 1UQZA 1W9BM 4MNJA 2CERA 1FCBA 1LRTA 4LB4A 4PMNA 4E4PA 4HA4A 5CZKA 5FL1A 2QJNA 1ZAJA 3W7PA 1AK5A 1YE4A 2NX3A 3ARPA 1UC4A 2A7NA 2GVGA 1YBQB 4Z2HA 3ITGA 4C6LA 3IRSA 1O1ZA 1UW9A 4OBTA 3G1AA 1RBAA 4JDBA 3GE7A 2RGMA 2PWDA 1A5LC 3IUHA 3BG5A 2ZC1A 5CXPA 1H7PA 1VAHA 1V4YA 1AW1A 3TJLA 1QR7A 3VNKA 4EACA 4H04A 4YHGA 3ZVIA 1CLKA 1JUBA 2Y7FA 4UOZA 4C6MA 3DC8A 4I9JA 3UR8A 1TV2A 4JIHA 3HF3A 1XIMA 3OHIA 3R10A 4IXXA 5GJMA 4LYPA 4PZVA 4Q6XA 3D6NA 4O52A 4H01A 5KITA 3W7JA 3UEQA 1JNDA 2ZVRA 4HSOA 1DJYA 4RV8A 4OUIA 4HNNA 4TOQA 3PUOA 2HVMA 1WOBA 1GVQA 1R3WA 1OFEA 5EFDA 4F48A 3U3HA 4W5UA 3VDCA 3TSBA 3OG2A 3M0LA 3JUGA 1LLOA 3UJFA 2O7SA 2GQAA 3ZT5A 2OO6A 3E74A 2X7VA 1X98A 2GQ9A 1EGZA 1JXJA 1MXSA 1Z44A 1FFRA 1VPQA 5F1VA 2YPIA 4LRSA 1E5NA 3MDUA 1NEYA 3EYPA 4N7QA 3OZOA 5DELA 4ADTA 3BMVA 4W84A 3G6MA 1TJRA 2FYMA 1NFPA 3T2PA 3W7HA 1VBHA 1TYGA 1R87A 1K4GA 3HURA 1FWNA 1ISVA 1I60A 1XYMA 3CB3A 2QLYA 3W76A 4A6GA 1M9HA 2E5DA 2DY3A 2UBPC 2OO0A 2WWCA 2E4TA 2FZNA 3M0MA 1OWQA 1XRTA 3W81A 1E73M 3PZTA 1YDNA 3NQ6A 1HFBA 2I56A 4L65A 4IGSA 5I24A 4A2RA 1OADA 5I6SA 1AG1O 1SGJA 1VC4A 3LNMA 5C70A 2OWWA 3KOFA 2O55A 4RJEA 1R2SA 3WLOA 3QZ6A 1OZMA 3QMRA 1UPPA 3TAKA 4JN6A 3TN3A 2A6LA 3VABA 4RDWA 1TPDA 2XUCA 1JG9A 1A47A 3M64A 3NM3A 2YW4A 4P8WA 3IGSA 3RCYA 5CG7A 1J6PA 3MWAA 2ZRYA 2V5JA 3U5YA 2TAAA 1MUWA 4G9PA 5I02A 2EG6A 4O1CA 3OJGA 2XN0A 4KWUA 2PD5A 5JXQA 4Z1AA 1P43A 4HNCA 5GNZA 4U3CA 3RJXA 3WK0A 4AWSA 4YXGA 1PHWA 4CQDA 3KP1A 3JU2A 3MSDA 3ARQA 4N9BA 1C8YA 2PODA 4PUUA 5G4EA 1FKXA 1CEOA 2C7FA 3LCLA 3WEZA 4Z1CA 3WLTA 3OG3A 4QNEA 1VLIA 1BSLA 1F6YA 2Y88A 4BWLA 1CB7B 1GVIA 2Y63A 4NJJA 4FZIA 4ZOAA 4IFOA 2BODX 3S2NA 4HHHA 1G4TA 1IEVA 1EBGA 1O1HA 3B0PA 3JS3A 3PPFA 3LRMA 1OF6A 3L4YA 1CX9A 3SQMA 2W27A 3VOIA 1S3HA 5E6YA 4AYGA 3F2CA 3T0DA 2GGEA 1I2OA 3UA4A 3QV9A 4GI9A 3QF0A 4ZA0A 1GK8A 2JFEX 4RW3A 3R6IA 4PRWA 2CCRA 2QF8A 1PO9A 4CNSA 1JDAA 4KQNA 4JQ3A 2Q8ZA 1UA7A 2QYGA 5LKYA 2O4QA 2G3JA 3CHFA 2BS9A 5BZAA 4GWEA 2BY0A 4PGLA 3XIMA 3E2QA 3AC0A 3KE0A 3BG9A 1S5MA 4FR1A 1EQPA 4S3KA 4ZBCA 4EKJA 4K68A 4EPEC 2WAGA 2GVJA 2JQXA 1W17A 2X1UA 4LAOA 3N11A 2PDHA 4A8LA 1KFCA 2WYSA 1S46A 4FF5A 1OCNA 2VZTA 2QR6A 2NLYA 4YN5A 3IIXA 1UPMB 4M1RA 1A80A 1KV8A 4PFMA 2VELA 4DZ5A 3PF3A 1XPGA 1H5VA 2QULA 1Q63A 2V5BA 5FF7A 2PDGA 2XSXA 4FX6M 1E70M 1GG0A 1L0PA 1LWHA 3SUVA 2NQ9A 1O94A 3REQB 3L4WA 1EJRC 1VD6A 4IX2A 3SCUA 4QGCA 2FHCA 3GXMA 4CNUA 1TPVA 2Q09A 1JAKA 4HZMA 4AC7C 1P7TB 2XFYA 1EHAA 1FWIC 4QG9A 1S38A 2A5HA 4PYSA 2IPFA 1NY1A 7REQB 4PL1A 4WDXA 3L4ZA 3G77A 1RQHA 4Z17A 1YPXA 4L9YA 1I2NA 5XINA 3VZYA 3WDHA 3O6CA 3QLLA 1KA9F 1LQAA 2RHGA 3BXWA 4BA0A 1RD5A 4HSNA 4Y9AA 1K3UA 4QIUA 1Q65A 3SGGA 2GVEA 3FAWA 4AVNA 1KV5A 1NQ6A 5I79A 2INZA 1DIEA 3VGHA 4C6OA 1HN1A 1XLLA 4QAWA 2DGAA 1FCUA 4HCHA 2PDPA 1CGVA 1Z42A 3G6LA 4XD4A 3II1A 2QDGA 5AYIA 1XYCA 1O6IA 3VA8A 4GGBA 1TJ1A 5BROA 4H9VA 5C9UA 3Q67A 4V27A 4DO7A 4M7TA 3M0IA 4S38A 1V7YA 3VMNA 3M0VA 4CCZA 1E4NA 3L2IA 4XV0A 1RY8A 4PB3A 1OBAA 1EF3A 2RAGA 1OG6A 2QXWA 3CL6A 2V2HA 2C16A 4JL2A 3AU6A 2XFWA 2PRMA 5AECA 3WYZA 1CB2A 4QITA 2PWHA 1Q85A 4ZOCA 3VKBA 4NYYA 2PS2A 5AY7A 1GONA 2AKMA 4LVDA 1QDSA 2OZ0A 4JIQA 5D4YA 2PFHA 2PPGA 3PZOA 4V2XA 2PGRA 1K4HA 2VRJA 1WBJA 1AZ2A 4AZ7A 4LWWA 4AX7A 4WX2A 4CEUC 3T81A 1TPEA 1GCYA 3IAPA 3BK0A 2E40A 1BD0A 1Q6OA 1UD5A 5AKQA 4AXNA 4GKTA 3WDRA 5D9PA 3HIJA 2NT0A 2VDGA 4FNSA 2OOFA 2CLMA 3VD9A 2FPVA 1ITUA 3PJTA 5CSRA 5MHBA 1JGMA 3DYOA 1F3WA 4HZ8A 5FJPA 4W7WA 2FPYA 4GIRA 4IPJA 5I3FA 3AYSA 4WJ8A 1TVPA 3CL8A 3UCQA 1UP0A 3QHMA 1CXFA 5FI8A 4ERIA 3C0LA 2I16A 3P62A 3FFSA 1SO5A 4YVXA 4PMOA 2HVNA 1X1ZA 3S6TA 4C1KA 2YOCA 3HQPA 1V0NA 3K4WA 3T8LA 4B92A 1L9WA 1KFEA 1O60A 1UWAA 1VCFA 2HVOA 4DJEA 2BMBA 4EVZA 2Y8VA 1EWDA 1OK6A 4AZGA 4RKAA 4HPGA 4AY7A 3ZJ7A 3HZ3A 1N55A 2DT0A 4OUEA 5ABHA 3ERPA 3TDFA 1ITQA 3WQOA 1KM5A 7ODCA 2I1OA 1AODA 2E1WA 2QUTA 4DBWA 4X63A 5DBTA 3F4NA 4ORMA 1GKPA 4F9DA 1C92A 2XG9A 4G2DA 1B5TA 2PEVA 3PTKA 3GK0A 4GO9A 2ZDSA 4TX9A 4Q8VA 4ATDA 4ZODA 1C3FA 3UT0A 4ZOBA 3GO2A 4WHBA 4DM1A 2A1YA 4HQVA 2CLEA 2PCQA 2VCAA 1JCMP 4CD5A 1PWLA 2YL8A 3HGOA 2GFTA 2FHFA 4FPSA 4DPQA 1C8VA 1JR1A 4L7ZA 1EUAA 4AD2A 2YL9A 3FEQA 2XINA 1XIJA 4QSHA 1EZ2A 3OP2A 3K13A 2TRSA 1WDWA 2PUZA 4RXFA 3W7MA 1XC6A 3AISA 3EA2A 5E9AA 1FWCC 1VFHA 3MSYA 2YCJA 3PNUA 4HYVA 1TV4A 1JL8A 4AMCA 1T6MA 5LA2A 3VNJA 3TYUA 1L6WA 1UR2A 1SVDA 1QHOA 1JPHA 4DI8A 3HMJG 4HSHA 1LOQA 1O5XA 4IL2A 1JZ4A 3T4CA 1FWSA 1GVEA 5HJYA 4AD4A 2GQ3A 4LBSA 4IP4A 3G8EA 1VJIA 1VLWA 4HMCA 3FX4A 4Q8QA 2YB4A 3C2EA 1FCVA 4JYDA 5HUPA 5I3GA 1H11A 3A6OA 3H7VA 3VCRA 1BQCA 3B9NA 4GI4A 2B31A 3OIHA 3TN6A 3SCVA 3RF9A 2XIJA 3TMQA 3W85A 4B3LA 2BV9A 4HHLA 3OBAA 4E38A 3CHCA 4H6EA 4KEUA 4B3KA 5F4WA 3URNA 4JX4A 3HTWA 1XFCA 1N82A 3L2LA 1ZFJA 1R86A 3O7UA 4QEEA 4UCFA 4IX0A 3BQ5A 1RJQA 1HW6A 4QISA 5F2IA 4QJ4B 3NG3A 4O54A 3U8GA 2Y61A 2PWEA 2VWSA 4I8DA 3ZYZA 2A79A 5HQMA 5PTDA 2YBVA 1SPQA 4JFUA 4OJYA 4DF1A 9RUBA 2DZUA 2R94A 4E5TA 3CZGA 4Z1BA 1FVPA 4J7RA 1JVNA 3BLLA 3FJ6A 1NDYA 3N2CA 5HULA 4IG2A 4GJIA 1S2VA 1LCOA 1ME8A 1VF8A 4PN2A 4WY0F 1DV7A 5HJLA 2NQLA 4J2PA 3GTHA 3H21A 1E9ZB 2GDQA 4V1XA 4B5NA 4UFIA 1G6CA 2YGYA 5KZ6A 1UBPC 4KCUA 3CMFA 4B4HA 2YDQA 1PDZA 1T0OA 3AICA 1XP3A 2OX1A 1E3ZA 2X1RA 5DQPA 2ZRVA 4FS9A 1TFVA 3W4RA 1KXQA 3EXTA 3O6YX 3MMWA 1KB3A 1UOZA 3NQGA 3AS0A 3F4VA 1VENA 2QW5A 1TPFA 3CQHA 3CQJA 1ME7A 3R5EA 1XL9A 3B0YA 4KRUA 5FSEC 4LT9A 3B03A 4O16A 1Q5MA 3ARYA 3CWOX 2VD9A 6REQA 4V33A 5CLWA 4PTVA 1QPNA 4CCEA 1HJWA 4UTWA 1GWJA 5HR7A 2QAFA 4Q4OA 3GWQA 4JTAA 3MUY1 3SUWA 3CBWA 2I5IA 3W7EA 3STFA 3FA3A 3ARRA 2ATMA 2ZOXA 4JNMA 5CAKA 1KWGA 1PL9A 4O10A 3S5OA 3PHAA 1BWKA 4LS1A 4BKNA 2XHYA 3WF1A 1XLEA 1UZHA 4TR9A 3E0VA 1GOIA 1JCXA 3MHGA 1TX0A 5FF2A 3VIGA 4PMYA 2ODOA 3AZRA 4NXSA 5IM51 3ZMRA 1C8XA 5BXSA 3ARTA 3GHUA 3GIPA 4OVXA 1RV8A 3CZ8A 3N9RA 2X1TA 2GJNA 4H9TA 4N4QA 3B3DA 4GACA 4NYUA 3UZXA 4E2BA 4GX8A 4RNFA 2WNQA 2WM0A 5AFDA 3NWRA 4IPIA 4V28A 2V68A 4BI6A 4MOZA 4DWSD 1CGYA 1OINA 3S5SA 1FWTA 4JTJA 1B54A 3RR1A 4GJ1A 4ZQPA 1A53A 5AYBA 3MZNA 1XCFA 3E0LA 4KWWA 2DW6A 3W6MA 3JVAA 1VEOA 7A3HA 3R11A 2GOUA 2QJGA 3O07A 1US2A 3VIPA 1V3LA 3T09A 3WFAA 1KRBC 1W1A1 1M7JA 2PA6A 5E1QA 3B8DA 3PZMA 3P80A 4KFPA 4BF5A 1TB3A 2QCNA 3AHZA 4RXGA 5REQB 2GUBA 3VMPA 1WPCA 1EC8A 1U33A 3W84A 3N3TA 5A8NA 5HPCA 2V3FA 1ZZMA 1GQLA 1Z9AA 4IGMA 4AMAA 1E72M 2W92A 4ML9A 4GZEA 3C6CA 3BG3A 1VS1A 3RK8A 1PS9A 4I5XA 2DP3A 3EX2A 3GX9A 4YMZA 3N17A 1P6WA 3VOCA 4MDPA 4NXKA 2YCLB 2A4AA 4RLIA 2QDHA 4GZJA 4GYJA 4W89A 3NZPA 3NURA 1Z6KA 2Z27A 4REQB 8CGTA 3UWVA 2W62A 1RK5A 3TAOA 1B3YA 3E1F1 1TE6A 4D1IA 4I6VA 4QCEA 3LXBA 3ENLA 3EDKA 2YL6A 4ZQNA 4OIFA 1OT1A 1JD7A 4NG3A 3S0CA 1FH7A 4UFJA 1F3TA 4HPNA 4YWIA 1G94A 4QNWA 4L9XA 1G1YA 4LBUA 2WVVA 1VCVA 3OODA 4NX0A 5KZDA 3QJAA 3CPGA 1TKKA 4M6QA 2YA1A 4JTDA 2DT3A 3PWAA 4JS3A 1Y8BA 3G1HA 1XRFA 3VIMA 2P88A 4YJ5A 4AUBA 5LNVA 1AZ1A 4YHEA 3SRHA 2PTDA 1OT2A 3N12A 2XVNA 3NQ7A 3KFTA 2HROA 3PB0A 4BF7A 4XBKA 1B3XA 3PBVA 2OEKA 5A8OA 2NZLA 1I75A 3W3OA 5D9OA 3BW4A 2V38A 3IK2A 1F5ZA 2PLKA 4O8RA 1ZP4A 3U5UA 4GXWA 2EEXA 1Z69A 3B8SA 3Q37A 1AMYA 3ATYA 2D2HA 1MW0A 4J28A 3AALA 4Z1YA 2HMCA 3NQ2A 4ZB2A 2Q6ZA 3ZJKA 4DQWA 2WMIA 3QHOA 4B91A 2PDCA 2B7NA 3SCTA 3FJLA 3KLLA 5G4WA 5GVJA 4I7WA 3CUXA 5D2YA 2P0OA 3WK1A 2VFDA 1B2YA 4RE0A 2J66A 4XVDA 3CIVA 1XLGA 2WPGA 4XD3A 5FJJA 1EOMA 1YTEA 5EMUA 2IQ0A 4X9YA 2WPBA 4Y2WA 3PVFA 4D6HA 4GVGA 5C9XA 3VFLA 3DU0A 1SZEA 2XIIA 2XN2A 3NL3A 3W73A 1HT6A 3M0XA 1IZCA 1XDLA 1AUSL 1BHGA 2DFAA 2F84A 3SY5A 3FAXA 2YDSA 3W71A 1IIGA 2ZZ1A 1SZGA 1WQ5A 2ZX9A 3S5NA 1CECA 5CZTA 3B9OA 4FP1A 4IH3A 7TIMA 4XKYB 3SGZA 2QCDA 1J18A 2XSAA 1CXHA 3WDQA 3DKLA 1KWKA 3R89A 1GZGA 1UWIA 3EB2A 4CUCA 4M81A 3V5FA 3BDKA 1LF1A 3NQFA 1IXOA 1AW5A 3KBJA 3J7HA 3WQ6A 3ZWSA 1CW2A 2YXGA 1BQGA 4J3XA 4OV4A 3W72A 5CLTA 4HK5A 2PCEA 4YCOA 1W0MA 2VRKA 1CGWA 2C0AA 3N3MA 4RDVA 1PXGA 4AD3A 4W86A 1TCDA 5DT5A 2EQDA 4LAZA 3CT2A 4JDYA 3I7SA 1BG4A 3H23A 3LRKA 5F4XA 2VR4A 3QC0A 5KETA 3KRSA 4TMBA 1AD4A 1LL6A 2CBJA 3O06A 2BGQA 2WNWA 3STEA 4MUPA 3QQWA 1UR9A 5AVHA 4S39A 2OXNA 3QTPA 3L66A 2XM2A 1W3JA 3L21A 1P6BA 4TO8A 1M68A 3EKLA 2A3LA 2JF7A 3S2MA 3M0KA 4GYPA 4HU8A 4TMCA 2D23A 4ZO8A 1R9YA 4G8TA 3GH7A 1PZ0A 2Z1SA 3AUOA 3MWCA 3NM1A 2VUYA 1KRAC 3LLXA 1REQB 1GZ1A 3DC0A 3SIZA 2R1MA 3G1SA 2WMHA 1BF2A 1J11A 2D2OA 1ZAHA 4JTEA 2CFFA 1B30A 2GVLA 2EG8A 2GJXA 4RNHA 1JQVA 3TVAA 3CU2A 2D0FA 3BAIA 3WBWA 3B05A 3M44A 4Q7BA 1IXQA 2X41A 2OOGA 1W8GA 3ANUA 1ZENA 4IICA 3ITCA 1O12A 1TV3A 3N73A 4M80A 4OGZA 2BFGA 4GBUA 4ILSA 5H6HA 2GGHA 3M5VA 5T9CE 4R7WA 2J7BA 3BAXA 3N25A 4LFYA 1DOSA 1HGWA 4JYEA 4Z0JA 5EKYA 1XIBA 4WSJA 1FHVA 2IXUA 2REQA 3P74A 4JTUA 3BLEA 3BLPX 4XAYA 3WD1A 4PMRA 2JE8A 3N9KA 1D3HA 1NF0A 4KCTA 1IEXA 5TD4A 3TJXA 4WRHA 3UJ2A 5A6KA 3LBCA 2GLKA 3IPWA 1EP1A 4GKLA 2WLYA 5EU9A 4PMJA 1BXNA 1FHDA 3QEZA 2QUNA 3TTEA 2YA0A 3O05A 3WMLA 1XG4A 1K7XA 5A69A 2QIIA 4NKCA 4A3YA 1X1NA 1TV7A 1U1UA 4F0MA 4PUWA 1R9ZA 4JIEA 5GPRA 1HL2A 3O1NA 4NHVA 4ALDA 1VYPX 3TN4A 2NWSA 4IFKA 5AOUA 4DZAA 3RHGA 3CV2A 4JHMA 2AL2A 3TR2A 3XINA 3EWCA 1JCTA 5KINA 1NDWA 4HNVA 1W37A 3B9EA 4EF8A 5T91A 4KEVA 5CAHA 2DIKA 1K02A 4L6DA 1BYAA 4XAFA 3NPUA 1PKNA 2FQIA 4LVBA 4TU1A 4Z42C 1G4SA 4P8XA 4R7JA 2HE5A 1E6PA 2ZZ3A 3GW3A 2V3GA 4KEZA 5LGZA 1KCLA 4Q22A 1HF6A 2OODA 4EAMA 2PDQA 4ICNA 5BXPA 2J88A 3TKFA 3W1NA 4YU1A 4NAEB 1EDQA 4MY8A 2J27A 4WZHA 3EWZA 3UW6A 4K37A 2FH8A 1VYRA 4ZENA 2VUNA 5C2CA 3HPZA 3GVVA 4UR7A 1S1PA 4E6MA 1KW1A 3R12A 1IGSA 1QASA 2WC4A 3EWXA 1XM3A 1W54A 1EDGA 1OGSA 2CEQA 2I14A 4NRRA 3E49A 4AZBA 4GK8A 3AMCA 1KCZA 3HJZA 2WZIA 3G0SA 3VVGA 3WMSA 2XVGA 4POCA 2PDKA 3UY8A 3ZR5A 1LBFA 1CGTA 1RA0A 3PWIA 1S2CA 3P81A 3C5QA 1EX5A 2Q02A 3DXIA 5G1MA 3W7QA 3DG6A 2QV5A 4IMFA 4LF2A 3UPMA 2V81A 2J62A 3T0BA 1H7OA 4QS6A 5BRPA 1DKWA 1E0VA 4RE4A 1E56A 4N6EA 5XIMA 3I6TA 2HCVA 1FQ0A 3B04A 1EIBA 5CPNA 3NSNA 5I2UA 4US6A 1XLBA 2IPGA 3FHQA 1G5AA 3UXIA 2OZ8A 1JRCA 4BQ4A 2WHMA 1V8EA 4UB9A 2GVYA 3L65A 1JDFA 4DWSC 2WNZA 1IQ8A 5A5WA 3WK3A 3S5ZA 2VFFA 3R2GA 3SDOA 5LGXA 4IIEA 4O19A 3T78A 1XLIA 5FIPA 2BHUA 3W0KA 3CLMA 3A5VA 2E68A 1S5WA 3BLFA 4FO4A 5AHMA 5HNNA 4LH8A 3UWEA 3LI0A 4YPJA 1KQYA 5KMYA 2CKRA 5HMFA 2ZRUA 2CXGA 4J27A 1RLDA 1TWSA 4FNTA 3GZ3A 3UPBA 4E8GA 4FI4A 2J79A 2WVSA 3L12A 3ZIZA 4UR8A 3VOGA 5BCAA 4JTFA 1R7OA 4XO7A 2AMXA 3NGFA 1FWHC 1HZYA 4V15A 1AJ0A 1H7RA 1SSGA 1VJZA 4B5VA 3WF0A 5F7UA 3GUWA 1HJQA 4GH1A 1EX1A 1JPDX 1J0JA 1KKRA 4NU7A 5EY5A 1A49A 1HNYA 4R33A 4LRTA 3AMDA 2Z26A 4JCMA 1WZLA 2E8YA 5FAGA 4H6KA 3I65A 4GH3A 3VD4A 3TTQA 1JCJA 1TWZA 3MP5A 4DWSB 4IOTA 4U33A 2G4FA 4C1NA 1I2QA 3TC7A 4ZB5A 3AXIA 4PTDA 4US5A 4L4OA 2J7CA 3NNTA 4GNVA 3L4XA 5AHIA 3UGVA 1BVZA 4HMDA 2I7GA 3TYAA 4MZYA 2XFRA 5SWUA 3F2BA 4MPQA 3AS3A 4WEVX 8TIMA 1BPLB 4L1GA 4JX5A 2BXVA 3AWOA 1DHPA 4LANA 1JCYA 2XJ7A 3UY7A 1E0UA 5JIWA 3G1XA 3PB2A 2C1HA 2I9EA 4AISA 4AD1A 3LGDA 3H4WA 4GY0A 3GR8A 1EA0A 2MUCA 4Q4QA 1X6UA 4LAUA 3F5JA 3AIWA 4QCFA 1O7AA 3LB0A 3I3BA 4JICA 1XBXA 2HS8A 4Y8EA 3CO8A 2ZTKA 4AQLA 5F2GA 3W1MA 1QCWA 1XR2A 5FCZA 3LENA 1TPWA 4LJ3A 4RW5A 3AXXA 3U6WA 2EJAA 3W7NA 5FA5A 4Z2JA 1OX4B 2HNEA 1XYAA 4HYWA 3WBEA 3W88A 5I03A 4LGXA 4ZXOA 3MCMA 2TMDA 1BLIA 3P67A 4AZ5A 4JQ2A 3NVDA 4Y90A 1S1RA 4JKMA 4L1XA 4HJWA 3WJXA 5HBFA 3L67A 2VKZG 3MZ2A 4W8LA 2D3NA 9CGTA 3T7VA 2PBOA 4DXVA 2HXTA 1WDDA 3TYBA 4FNUA 3GH4A 1KM2A 4XTDA 1QNOA 3NJ3A 2PAJA 2XGIA 4F66A 1CDGA 2YXXA 1A0EA 1TMHA 4D8LA 1E0XA 2CU0A 4D2JA 2YLAA 2ACRA 1FDJA 4H9YA 1NDZA 1X6NA 3CV7A 3CXOA 2EG7A 3S9ZA 4WXYA 3PSWA 3URQA 3EOSA 1UIOA 3DFPA 4HKPA 3EEZA 3XISA 4KGJA 4QE1A 2YCKX 4O14A 1G69A 1YRRA 4Q8MA 3VU2A 3EDFA 3NCOA 4RCXA 3K8KA 4QE5A 3IGHX 1Q8AA 3IARA 3KCJA 1KRMA 4N9CA 1DIKA 2YCEA 4KWSA 2CETA 2C13A 1CXEA 3DX5A 1ZCCA 2KX9A 1MQPA 2TSYA 4EPKA 2G41A 4W93A 5K7JA 4JFWA 1J2BA 4X2PA 5CC3A 2FGLA 3VD3A 1OK4A 3H55A 4WSHA 2OU4A 4LNCA 3VAVA 1X38A 3NTYA 1IWPA 3GNOA 3W1LA 2WMGA 4M19A 1XISA 4NNCA 3PBMA 3POHA 1IT8A 1JD9A 4E2DA 3VZXA 2HSAA 3TROA 3OZPA 1DXFA 2WKGA 3V36A 3BMXA 4JX6A 4DUVA 1H61A 1DTUA 1S2UA 1R47A 2ZX8A 4O57A 3W7GA 2VENA 1BRLB 3D0CA 4FR6A 1TE1A 1UIPA 3LHTA 2OPJA 3WD0A 2Z7GA 1RVGA 1GVRA 3DFHA 5M03A 1W1PA 3LGGA 2DV0A 5IXEA 2E67A 1H41A 2W6RA 3NO3A 4NZJA 4XX6A 3KVLA 5DMLA 3BH4A 3S47A 3GVRA 3QHNA 3LCGA 4GYKA 4YTRA 4B9YA 2PDLA 1I45A 1DQWA 1J10A 5GNYA 4TTUA 3WO8A 1ONEA 3D3FA 4FXJA 3LG3A 1XLAA 4EAYA 3MYPA 1A5KC 4LSBA 3DGBA 4DI9A 4BK9A 3GNRA 3KAOA 3L5MA 4AEOA 2W61A 1VR6A 4P2VA 2H3DA 1UUQA 4KWVA 1JDCA 4E4UA 2BGNE 4G7FA 2P10A 3PJUA 4URIA 5DCEA 4IHCA 2DZTA 3GXNA 5ABFA 1E6ZA 1RPXA 3ZJ8A 1QO5A 4OBRA 1K8YA 4BQ3A 3AS1A 5BWAA 1MUMA 4JY9A 4GUGA 4B90A 1A0DA 3S42A 1CPUA 5LNUA 1WNOA 3RITA 1YXDA 3H24A 4MY1A 3WQ8A 1Q2SA 2E6FA 2GDVA 2WOQA 2O9PA 2G50A 1EYEA 4ZFMA 3V4BA 3UG3A 5L9FA 4PMDA 5IHRA 4EANA 3CWNA 3WN6A 1KR0A 1W1ZA 3DZ1A 3GLCA 3TH6A 3NEHA 2DSKA 3Q58A 1PB0A 3IJ8A 4LAMA 4HT3A 2ZA2A 1AQHA 4XK2A 4ACZB 1H5YA 1H3GA 1MUCA 1SU5A 4XD5A 2OTDA 3S4TA 4PTMA 2O0TA 4CU6A 4HCLA 3GB6A 4JFTA 1O5QA 2C18A 4W8BA 1KBKA 4OHQA 3M0HA 2I5GA 1L2UA 1RQEA 4DUWA 3PZVA 1B1YA 3F7JA 1VIWA 4Z2IA 3GTNA 3G0XA 2HJPA 1V3KA 5FSDC 3V5CA 4OKDA 2ANUA 3TW9A 5LIXX 1F74A 4GA8A 3ZZ1A 2QUVA 3R43A 4PUKA 2WLZA 3MHFA 1TZ7A 2NQHA 3IS4A 2HDJA 3CH0A 3ABZA 3C52A 3CLWA 3MMUA 3LS9A 2BVWA 1WXZA 4LVFA 1LG2A 3W7IA 3I7RA 3DKJA 4NILA 3AMKA 1DXIA 5G2IA 2UZ9A 5HMSA 1S2AA 3C0SA 4FA3A 3LHUA 3NAVA 3MV01 1J0YA 3SCSA 3VOJA 1R7AA 1F05A 1XLMA 7PTDA 4MM1A 1OM0A 4HU3A 5D04C 4NJIA 3EKZA 3FXGA 5CCZA 1QO2A 2VHLA 3NZQA 5AYXA 4LC8A 5E9XA 5DN1A 1BYBA 3PY2A 3QQ0A 4DJED 2WBKA 4GIAA 4H7CA 1E1CB 4NX5A 1TUXA 4ROPA 1WX0A 3LLFA 4XZNX 3O15A 1RJPA 3T1GA 4AWEA 3VKKA 1W3HA 1JGIA 3GSMA 3VX1A 2OWXA 3E38A 4AZ6A 3C2OA 2IS7A 2PGWA 2YW3A 3WF4A 3VDBA 2QV4A 3I10A 3HPSA 2A6NA 1SW7A 1MW2A 1OCBA 1VPYA 1SO4A 3DENA 1J96A 1PDYA 3P0XA 1OD0A 3KL5A 1UBSA 4O50A 1MSSA 3VILA 3FV9A 2GK1B 4FHAA 3GDLA 1ZJHA 4HK7A 4UNKA 1KNWA 2E5CA 1DHKA 2POZA 3JRKA 3LRLA 3LV5A 3WFLA 3H12A 2R1LA 4I8YA 4CNNA 1KFKA 3GAYA 4YYCA 4PB4A 1W1B1 4XZ9A 4JTQA 1BVWA 5D05A 4BJHA 3TEVA 3WG6A 3BJFA 1Z32X 2H6RA 3T0AA 1UZ1A 1T99A 1TELA 4EP8C 5IHSA 1W3NA 3KDOA 2PP1A 3W82A 3CS2A 3SECA 5CPQA 1MW3A 3WF3A 5DXXA 4KBXA 3WJSA 1NOFA 4RZBA 3QW4B 4RNJA 4LY4A 4D6GA 4R85A 2UY4A 2QPSA 3DGRA 4J4KA 1SR9A 2DZBA 3QZEA 3WCZA 1PUDA 3O0FA 3QGAC 3GYCA 4GXMA 4UTKA 1QPKA 1KBIA 3B0XA 3P82A 4D6DA 1A5SA 3K1GA 1UQYA 2OZ3A 5E09A 4Q8OA 1XCWA 3TFCA 2YDRA 3H2MA 2DZPA 3A47A 1Q6GA 1FXQA 3AUJA 1GJUA 3VNZA 1XLCA 1V3HA 1XSIA 4WY0B 1I0BA 5I3DA 2GZXA 1AL8A 1U5VA 2E6AA 4MWAB 3NO1A 1OQFA 2Y7DA 3ZS4A 3KBMA 2AOSA 3TZNA 4BR1A 3WL0A 3W74A 4JBRA 3K4DA 5A6LA 2HV5A 3A21A 1BWLA 2ASHA 2E6YA 4YS1A 4A3RA 4XIAA 1BKHA 1HJUA 2HNHA 5JQ9A 1QW9A 5F2MA 1XSKA 4L9ZA 3W7KA 3KDNA 4HA0A 3W1PA 4A8NA 1XIEA 3E9AA 3S8HA 1EWEA 1JF6A 3UPWA 4IWWA 1M5WA 1R3QA 1OEPA 1BGGA 3EWDA 3CIXA 2EAWA 4KW2A 3TLQA 2H9AB 2QJJA 2CXEA 1J5SA 4AAJA 1RR2A 3MP3A 3A3WA 4DO4A 2CHRA 1QI0A 1W3LA 3SRFA 3L5LA 6ALDA 3AIUA 3ES7A 4XZHA 3AIQA 2ISSA 3D5HA 3RXZA 1YXCA 1G4PA 3EDEA 3KRBA 3W37A 1QPOA 3LN3A 4EIVA 5HAOA 2OQYA 1WUEA 1JQXA 5I77A 2EPHA 1IV8A 4K3ZA 3QFWA 3UJEA 3RLUA 2R1PA 4WKFA 5FF0A 4QM1A 4P7NA 4TX8A 1KGUA 3MBFA 3WBXA 3S1XA 3RCMA 3BANA 3EOUA 3MMDA 3KL0A 3KTCA 1R6WA 5AN7A 2GGGA 3SCWA 3TYZA 1W3KA 2Z28A 6ENLA 3EXSA 3CUIA 3W02A 3OBKA 1MW1A 5EPDA 3NA8A 4MF4A 3PZ9A 4N4PA 1E6XM 1UWQA 4C7GA 3L0GA 2J9XA 1BTMA 1F76A 3UETA 3TV8A 4A3QA 1UHVA 2XIMA 1CCWB 6TAAA 3BSMA 3GXPA 4FLSA 1MI3A 1XBZA 2R8WA 3IIZA 3FDKA 3GHSA 1Q6CA 3HO8A 3ICJA 5DY3A 4U4MA 3G18A 3A4JA 1H49A 1ZQ5A 4INFA 1TPH1 1W1IE 4UTLA 1JXKA 2VVNA 2C6QA 3TONA 1I8JA 2V30A 2QCFA 1POJA 4JAWA 4LY8A 4I5RA 4O53A 1I2PA 1ESWA 2XH4A 1S5TA 1WKEA 3AQUA 1PEZA 5A2BA 3ECQA 1FRBA 1JYNA 5EBAA 2ZX7A 4ZQOA 1AQMA 5A6BA 3AS2A 3RDKA 1MEHA 4YVPA 4MZ1A 2DVUA 2FTPA 4EE9A 4C6EA 4L64A 1M53A 4QJ1A 3SBFA 5TIMA 4GABA 4Z0SA 4IQDA 3H2FA 1KM1A 5K4XA 3CV1A 2ZUVA 2PE4A 2ZXAA 2OR2A 3E0WA 2ZFAA 1FUYA 1KGXA 1TX2A 4BWLC 2F61A 1SW3A 2R14A 4L56A 2YB1A 2WC7A 3PJWA 3MKCA 2PSNA 3VINA 3KBSA 3AIRA 3DHUA 1LM1A 1IT0A 4Z2KA 4K8HA 3FY1A 1O5RA 1E0TA 3WH7A 3PS7A 2MNRA 1GJWA 3LU2A 2IQDA 1Q7ZA 3GG0A 5E6ZA 2H8XA 3URBA 1K1DA 1V3MA 1ZGDA 1FA2A 3AAMA 5K9CA 1LQ2A 3RO6A 3G1DA 3ZM8A 1TJ2A 4JY8A 3SFKA 3TWAA 2QMKA 4Y9MA 1YIXA 1D9EA 1XQLA 2NVCA 4LYRA 3FW6A 1AA1B 3LPPA 1CYGA 2PF0A 1E43A 2CZDA 2Y5EA 5D38A 2ZBTA 5FEWA 2WKJA 3WDPP 5EMMA 1D8WA 3HU7A 3I4EA 4C6QA 1W5MA 1VRXA 3UZZA 2BHYA 4MLRA 1Y65A 1JCLA 2JF6A 1XIFA 4Z2GA 5AHLA 3OLGA 1VHNA 5BMWA 4B2DA 6XIMA 2BX7A 1H60A 1YPIA 4GVHA 1WKDA 1XGEA 4A8IA 5HATA 3TJIA 1DL3A 2TODA 2VFGA 1UR3M 1V08A 3BJSA 4NL1A 3EA3A 1GTHA 5EGRA 2L5HA 1JDDA 3N2MA 4DBSA 2YBUA 3A22A 4U2ZA 4UNLA 2YZRA 4CQ9A 3ZLHA 1IZKA 1FWAC 3SR7A 3WUGA 2QHAA 2X7WA 4ICCX 1L6YA 1YADA 2C79A 4H83A 5A8QA 3KP0A 3ANYA 5IOBA 2VR2A 4NY2A 5KTLA 3M0ZA 4C6CA 4DO5A 3NYZA 1FDYA 2WSRA 4H1ZA 4GQ0A 4YL2A 3VKAA 2YBTA 1W31A 4IZGA 3G5EA 3BV7A 3RPMA 1WA3A 2J7GA 3BC9A 1ENUA 3BSHA 4LUTB 2WZEA 3W75A 3GXIA 3ABRA 1VFTA 4MKSA 1KKOA 1UMLA 3E96A 1ODUA 2GPTA 3E2VA 1ZBCA 5DBUA 4C6BA 2XIQA 1G9HA 3P5ZA 1P5BA 1XIHA 2QNEA 4LC6A 1J2WA 4KH2A 1P1MA 2R24A 3VZZA 4BY3A 3QPEA 1G7VA 2ZXBA 3U9IA 3TFXA 2ALDA 1CXLA 2CITA 3ARXA 3IANA 3B9AA 2FZMA 3NQ8A 3W25A 2I57A 2OJPA 4S3JA 1TJ0A 4GJJA 1UKQA 3P0WA 1TA3A 3O3RA 5L6UA 1C29A 1OG0A 3ZWTA 4ICMA 1K70A 2XH2A 3EWUA 2DQWA 2PDXA 1IWAA 2NX1A 3GU2A 1IF2A 4DF0A 2CW6A 4NZ1A 4IJCA 2A3AA 1H09A 4XSLA 4CQCA 3W26A 2BGSA 1F9CA 4IP5A 4O1FA 3OVQA 2QVHA 3SCRA 2JEQA 3E5PA 4ROQA 4DLMA 4AY1A 1B4EA 7XIMA 2GOKA 1TQXA 1MZHA 5I3KA 1S5NA 3TYEA 3IGUA 1UP3A 1W3IA 2FHBA 3CTLA 4ZGYA 1AJZA 4QBXA 2OLSA 2VC9A 4OQVA 3ZSTA 5EYWA 4TVUA 4JFSA 1I2RA 2WMJA 4ASTA 2VC6A 5IFPA 1V3IA 2Q3RA 2WM1A 1F7BA 3NOYA 3UXDA 3VGBA 4YTQA 2W3ZA 5I3HA 3DG7A 3TN5A 5E0CA 2D0HA 4JOMA 1LT8A 4DJEC 1W5OA 1ADOA 3PUDA 2Z00A 3TLLA 1F3XA 4ZSTA 4QROA 5C9ZA 3W00A 3I7QA 3RN6A 1OF8A 3W2LA 3WD2A 1P6CA 5C6MA 1ICPA 2D24A 1W9DM 4BS0A 1KCKA 5BRQA 4HTBA 2J7DA 1BFNA 4LUSB 1XIDA 4O0QA 1B9ZA 2HBVA 3DFSA 1XUUA 4PSPA 1VIZA 4Q8PA 2VZOA 3L0NA 3IAQA 1TV5A 4NSBA 4H6QA 3M5XA 1M65A 1ONWA 2BNJA 1MRAA 1F3EA 3ITVA 3DFTA 4C6FA 4GQQA 3CV6A 3GZAA 1ELSA 2RJHA 1EHNA 3GAKA 2X1IA 3QY6A 4NRSA 3NQDA 2Y24A 4NNAA 2QJMA 3G24A 3K5XA 3HV9A 1V93A 5LIWX 4J3VA 3KW3A 4E3TA 5D30A 2OQLA 4J9JA 1FDZA 3RU8X 3VKCA 3AOFA 3ITLA 5I00A 4U10A 2YFNA 1OFRA 3MUZ1 1MXGA 1SFSA 3NVTA 3BAYA 5EMKA 2V82A 3S1UA 3UG5A 1SZFA 2GL5A 3SSZA 3W07A 2WBGA 4DB7A 2ZZ6A 4QFUA 1OCJA 1OABA 1T7LA 1N7KA 3EOLA 4A05A 2W67A 4XAGA 3VDAA 3SQLA 3ARSA 2PDJA 2Z6IA 4HMEA 3TU9A 4AD0A 2J8GA 4CLMA 2UY5A 5CJMA 3BZJA 1J79A 1JI1A 1SMDA 1XHGA 2WQDA 3CUFA 4A2SA 1CT5A 4IIHA 3KVMA 2WWDA 4HJFA 3TW7A 3N2XA 1BWVA 4S3EA 3AYVA 4C6KA 2Z1BA 3EDDA 4B5XA 5ABTA 3RM4A 3A12A 3UERA 1QXLA 2VEPA 2PZNA 3BPWA 2R82A 1QPRA 3NSXA 1Q6RA 4PH6A 3ZQ9A 1JUKA 4PCFA 1ZHAA 2J6XA 1GQJA 3I3EA 3MQTA 4NP7A 1GPFA 2TYSA 3UR7A 1ZY9A 1K6AA 4QJ5B 3M07A 4GQGA 4O4WA 3W27A 4IIDA 1H50A 3QV8A 4MHBA 2HE8A 3S6OA 2EKGA 2XIBA 4F40A 3GHTA 3KHJA 3EA1A 4GFSA 5D2WA 2OKOA 1NP2A 1UR1A 3BLDA 4PSRA 2OLAA 1Q8JA 3JR2A 1ADDA 2G3FA 1Q6DA 1QBAA 5FESA 2W91A 2V67A 2VGGA 1FP8A 3GYEA 4TQTA 4KCVA 3ATZA 3EX1A 4WVXA 4ZEPA 3WF2A 1EJSC 3VGEA 9XIAA 3AHTA 3FA4A 4FK9A 2DZSA 4ZQMA 1C9DA 3THUA 3M4HA 2DIEA 1SZNA 4AFYA 2VEGA 5D2VA 3P7YA 2AAMA 2IPJA 3HGSA 2ZZ2A 4MNKA 2A7RA 2OYLA 5A2CA 4DYEA 1DEDA 4CCCA 3TW6A 1VFMA 4HPHA 4FOJA 3STPA 3ZVHA 3LMYA 3U2EA 1CTNA 5B80A 3OQEA 2VVSA 3KS6A 3BCDA 4N6FA 2V5DA 3ITXA 5FJIA 3LY0A 4XZLX 1H7WA 4X0NA 1JUEA 2FKPA 4XQ6A 2XWEA 4CNPA 1RSCA 3BUVA 3DI0A 4J1OA 1OGBA 3O16A 1Q45A 4YNGA 4IIFA 3S46A 3HGJA 1VZWA 2DVTA 3OLEA 5FF3A 3IJIA 3W70A 4EPDC 1DJIA 4UTWC 3IGXA 2H3BA 5DRIA 3VO0A 1AMKA 4C7DA 4YLWA 1BTCA 2PU1A 2X30A 3EAUA 3QVQA 5GQBA 1N8WA 4IMCA 4GXPA 1C7TA 4LV4A 1R9XA 3BMWA 2OSYA 3BAJA 2NLIA 3SJ3A 4GBDA 1HGYA 1CI1A 4IG2B 3GU9A 1UB3A 3KOWA 1Y7VA 4TUFA 3GFYA 1JAEA 3B06A 4FEZA 4AEEA 2VT0A 4K2SA 3UU0A 1L6FA 3APYA 1H0GA 2NSXA 3KCLA 4HOWA 3URAA 3GQYA 4IMGA 4NAEA 2OSWA 3PUEA 5HJXA 4XZWA 3LSCA 1PAMA 2A3BA 1GNXA 2YCIX 3FGCB 4JN8A 2VP8A 3QW3A 4NI3A 2P76A 3I4KA 3H2OA 4IISA 3SRKA 4UR9A 1QT1A 1TUFA 2VX5A 5BW6A 3CMGA 3RJYA 1BGAA 3V1HA 2J7HA 1GQKA 4Y9OA 2BY2A 4MUZA 1VBGA 2QGHA 2P1FA 1HP4A 3U2ZA 6REQB 1U1JA 4WSKA 8A3HA 2DT1A 1XH1A 4GYFA 1B31A 1XLKA 1XRVA 3AZTA 3UVAA 4Q8NA 5JBFA 3R13A 3SEPA 4J3ZA 3D46A 3CIWA 4WDWA 4FIRA 2DZWA 2JEPA 2VXNA 3IVUA 5BU9A 3A5FA 4PULA 3EX4A 1DJHA 2CLHA 2PDBA 1PSCA 1NWUA 3I68A 4WGHA 4J5NA 1H7XA 2PLMA 5KZEA 4H4IA 2BOFX 3H53A 4CNOA 5A1AA 2EBNA 4GZIA 1Q66A 4XZMX 3W7RA 3S1VA 1R46A 3ARUA 2F38A 3N34A 1T8XA 1XC4A 2F2KA 3VFCA 5LSMA 5FD0A 5C8BB 3SAZA 1W9PA 1JI2A 3CASA 1HKJA 4BHYA 3W53A 4AY8A 1TQJA 3M7WA 3LPFA 3WD4A 1GQIA 4B15A 3VD5A 1F73A 1XRSA 3C2RA 4GI8A 1UD2A 3HB9A 2SFPA 4IFRA 1MFUA 1ECQA 3IACA 1QHZA 1F8MA 1I4NA 4XD6A 3KRUA 3WQFA 3SSJA 4US5D 1E6SM 2E28A 2CHOA 2D22A 3LBMA 4KEMA 2XISA 3EWWA 3POCA 2NXHA 2ABAA 2RDXA 1R3RA 3Q45A 4YTTA 5B7ZA 1V79A 2E6DA 5EMYA 3UJRA 1R30A 1VFLA 4A3HA 3ZSSA 4GUJA 1EEPA 3H7UA 1D7FA 4IUGA 3RO8A 2JBMA 5F1UA 4A22A 4O1AA 1XGDA 2B7QA 3WNPA 1QNVA 3N04A 3WQPA 3L7RA 3FDGA 2V9DA 3ALGA 2VOTA 1PKLA 1W8SA 2D1ZA 2IKIA 2P8BA 2RFGA 3FEMA 1DJZA 4Q8UA 5D2XA 2C15A 1QI4A 3THCA 2W4XA 3WQEA 2CLFA 1XSJA 1A5OC 4ZTYA 3FJNA 2BWGA 5IBXA 2RDWA 3NOEA 4PUNA 3C2VA 1JFXA 2ZA3A 1J6OA 1LWJA 1C91A 1LUCA 4WK9A 1LWIA 5E70A 1W56A 3VUSA 1AL7A 1R2TA 5CBIA 1PBGA 2J13A 4B9ZA 1UH4A 1QUMA 2RGLA 3QR0A 5XIAA 3H4GA 1WBHA 3CT7A 2V2CA 4QDPA 1VKFA 4DVOA 4PMXA 5HWJA 1Y5VA 4MY9A 2E9LA 3MDWA 2A3HA 3WUBA 4PFHA 2ZRWA 1KRCC 1TTIA 2VTFA 4IMAA 3NYDA 3W29A 2A85A 5AC4A 2WVVB 2W0UA 1XH2A 4L80A 4HVXA 1XJBA 1B9BA 3RIKA 1US3A 1G01A 1ZTVA 3LBOA 2B7PA 3EDJA 1JZ8A 2ADAA 1LG1A 1V0MA 5CC5A 2DQXA 1XQKA 2CYGA 1Q7MA 3UZ5A 3H4XA 4DYKA 3PBUA 1FY6A 3A3HA 2O9RA 3UZJA 3OO2A 3WQGA 3PTQA 3OVGA 3LCIA 3PR2A 4CKQA 1PCKA 1OX4A 5I5RA 1P4CA 4AZIA 2G3MA 3UXAA 1TR9A 3AO0A 3S1WA 1LRNA 4IL0A 2WCSA 5H8MA 1QK2A 3MPGA 1J0HA 4MAZA 3F2DA 4ORIA 5DMYA 3W83A 4PA8A 1UKSA 4MNLA 1EH9A 3MYOA 3RRXA 3W7DA 2D2JA 1US0A 2FZBA 3L4TA 4HNOA 4H9XA 4YTUA 4Q4KA 3S3GA 3FJ4A 3THQA 2WMIB 2ZX5A 1AH3A 4I9TA 2H8ZA 3FKKA 2IKJA 1PCWA 2NXIA 4W5ZA 3YPIA 1JZ3A 1Q2RA 1R3TA 3C61A 3BICA 3PANA 3OVRA 2X0SA 1NDVA 2GJRA 1XV8A 3PZGA 4MKVA 4D6JA 3UWZA 1CLXA 3N6JA 4QQ3A 3VC6A 2UV8G 2NV9A 1EEXA 4HP5A 3WLKX 1VCGA 2ACUA 5JH2A 4AU0A 1NFBA 3G1RA 3MS8A 4JIIX 1U5HA 5BOFA 3DH7A 4M29A 3LM3A 2O4MA 3S2CA 3LD5A 2KZHA 1BYDA 2DUAA 1OCQA 2VQTA 3W1RA 4GYPC 1KM4A 3WH6A 2QCDB 2PGEA 1YX1A 3OA3A 5EL1A 4AX6A 3LZ5A 4H8HA 1NAL1 1ZBVA 5HANA 5M17A 3GY1A 4XWUA 5BOOA 1OGGA 4DUOA 1ISYA 2X0YA 3ABXA 1CENA 4DPPA 1TSIA 4MSSA 1ZP3A 1I6NA 3PSVA 1EOKA 3S1GA 2C8NA 3T0TA 1BKSA 3WEOA 1GOMA 4J40A 1K8ZA 1ZU8A 4G7EA 2V3DA 4HOZA 3EB3A 3GIQA 3GG8A 2PTYA 3OA5A 4AVOA 4H41A 3WQWA 3WEMA 4CVWA 5LNSA 3UGRA 1SR0A 2FB3A 3AIVA 1X8CA 1XH0A 5TF0A 5DANA 3PPGA 2PDUA 3RX2A 3GNNA 3TA6A 1S5VA 3K8MA 3G1VA 3RLHA 3WNNA 1DXEA 3PNZA 2QKFA 3M5ZA 3HQOA 2D69A 3UESA 2CHNA 5CC6A 3GDTA 4U5IA 4LYKA 4M3PA 2E9MA 5A6AA 4RX0A 1TWWA 5EMLA 4A8RA 3PZUA 4PE8A 4KRZA 2HWGA 4RDYA 2QVNA 3OZYA 3QGKC 2VD8A 4UXDA 5BMXA 1J01A 3QC3A 1HX0A 5LNRA 2QQ6A 2DZXA 3W24A 4KERA 3QN3A 3P84A 1GEHA 1MZRA 2GJXB 4C6PA 1XICA 5I3IA 3MJMA 4H7ZA 1UWSA 2XM1A 1YYAA 1WDPA 5FEZA 1YXYA 3VE7A 3V0TA 2PRLA 3L4VA 4UFLA 3IK4A 3U2CA 6XIAA 3QGVA 3KUMA 2ZVIA 5TAOA 3V7PA 4JXCA 2D2GA 3IJ9A 4Q3MA 2REQB 2ISFA 4I90A 3LDVA 4CN1A 2VL4A 1EC7A 1M7OA 4ACZA 3FHAA 3DUGA 5DT7A 1W3TA 1MMFA 3SIMA 2QF7A 1QI3A 4GG9A 2E77A 5CPTA 3MCNA 2OMAA 4Y8FA 5I23A 5I0DA 4KETA 4D9PA 3P8JA 4DIAA 1F6KA 3T0CA 3CWHA 4H3DA 4UCGA 3PBYA 2E5BA 2WJDA 2WK2A 3UCDA 1GJPA 4JCLA 4IQLA 3T8QA 3BV4A 3H2EA 3MMTA 3W01A 4ZQRA 5B7YA 1EP2A 3RPDA 3SURA 5JIPA 4ADUA 3AJ7A 2V2DA 3TOYA 1HXJA 3LUTA 4IFKB 2TPSA 4F4RA 4PCNA 1OFOA 2RH9A 4PC8A 4PEKA 1UD4A 1ZALA 3ES8A 3WENA 3GC2A 1WYIA 4ZVJA 3UF9A 1QW7A 4LEFA 1UD6A 5FJTA 4RDZA 3WJYA 3G1FA 5K3VA 3BOFA 1TZ9A 1NF7A 4UMBA 4F2UA 1B3WA 1HP5A 3TP4A 5CPOA 5HMEA 3M9YA 3N4EA 5CJ5A 2C14A 1OX5A 4KGLA 1V0KA 2J75A 2VZVA 3A9IA 4PTNA 2PGFA 3CHEA 4HMNA 2FZ9A 4JFVA 3SN4A 5J8LA 2PB1A 5FEXA 4N9DA 3INPA 4MPKA 1XDMA 3WJZA 3F1QA 1H62A 5G5IA 2GDUA 3OGRA 3P14A 2QT3A 2DUXA 3GW0A 4FMVA 1QW8A 2QGYA 1VQTA 1W5QA 3WH8A 1YMYA 2HEJA 1K03A 3TOPA 3BLOA 4ES4A 3CZJA 1R8LA 3ZLFA 3QR3A 2QIWA 1I1XA 1ICQA 3C3UA 3PPHA 1QNRA 2NVAA 2PDWA 4QE4A 3DFNA 3Q4DA 3ZJ6A 3N4FA 3WBYA 4QRNA 2OZTA 3HFTA 3TWBA 4UFHA 4JYFA 4M6PA 1DYSA 2VX4A 1XI3A 4QR6A 3PUGA 2WZHA 3BL3A 3HG5A 2WMKA 4ZFCA 4DY1A 1FWJC 1UMYA 2D73A 3CPRA 3QQ1A 1FBAA 3WL1A 1LYXA 3JZUA 4AZCA 3BTNA 2PU0A 2EPMX 2WB5A 1HKKA 1WCGA 1JZ6A 1VBRA 3WLLA 2V5CA 1UJQA 2OLHA 4DM2A 2BVYA 3Q65A 4UTTA 1RP9A 3A4XA 1DJNA 3O63A 1SJCA 1TIMA 4AIEA 5I06A 1XLFA 2NQ5A 3UXLA 1RALA 5GJNA 4WGXA 4J3WA 2ZA1A 1C90A 2G95A 4KESA 4WIWA 1JPIA 3ALFA 4KPLA 3E12A 5CBJA 3R8HA 2R1NA 4BI7A 2QCLA 3P6LA 1EC9A 2GGIA 3SM0A 3SN1A 4K1WA 2RDTA 2C19A 4PMQA 2JKEA 4H2CA 1XF0A 4M51A 1X96A 4RPQA 3TTYA 4XSMA 4TIMA 5AB3A 3BGGA 3ARWA 4EWJA 4PTWA 4UTJA 2NXGA 1GHRA 4Z08A 3T42A 5G2WA 1FWDC 3PTMA 5LYRA 5G1TA 3KEHA 2OYKA 3QPZA 2XH7A 3NQBA 4F9JA 3PBWA 1PX4A 3VXGA 3B40A 3GBDA 4MWAA 4C60A 5CPLA 1QPQA 4LTSA 1J12A 1A50A 2QJHA 2QCCA 4DYJA 2Y0FA 4MJ2A 4C5ZA 5HDRA 3NEVA 4WF7A 3AZSA 4S3GA 5CZJA 1BSIA 1UWTA 3C4UA 4GOAA 1Q6EA 4ML4A 3AMLA 3MW7A 4E2OA 3SZ8A 1WKYA 2ZDRA 5DF0A 2P3ZA 1HJSA 5BXRA 2H9AA 3VNYA 2Y89A 3EPMA 3L23A 2FJUB 2J7FA 1R3SA 2BOGX 4NAFA 1WUFA 3VOHA 1TRIA 1SJDA 1HO4A 4MADA 4C1NB 1UUOA 2GJLA 3B8WA 5HPOA 1VJSA 3VX0A 2F2HA 4F8XA 3UWUA 3SN0A 1KTBA 1G67A 1NP0A 3LEPA 2B7OA 3MO4A 1QATA 4AVFA 4BF9A 4LVGA 1BEUA 5A6BD 4DJDA 4IUOA 1VH7A 1OYBA 2ISVA 4QS5A 4DBUA 3KWXA 3S2JA 4G5DA 5LNWA 3GNPA 1EJVC 3L4UA 3V18A 3W7OA 3CAQA 1IEIA 2ZUSA 5D32A 2HK0A 4K39A 2PDIA 3R1ZA 4X22A 3I6RA 1OHLA 1BXBA 3TQ0A 4IQEA 3NQAA 1K9FA 1WO2A 1B57A 4H9UA 2WJEA 1VFOA 4O11A 1BYCA 1U22A 3AMGA 1YEYA 2BASA 3KHDA 3H6OA 4TV5A 3GTIA 2BXYA 4LUIA 2WZMA 3LTYA 3RMEA 3WLNA 4J2MA 4E4FA 3NQVA 3HPAA 1EIXA 5DY2A 3THAA 1HKWA 1OYCA 3NDYA 4JTKA 4NIRA 3GKAA 1CZ1A 2E8ZA 1JYWA 2P8CA 2GSJA 1DP0A 3ZT7A 4CN4A 3SUSA 4EK7A 1EKOA 4J35A 2V6AA 3GXFA 3CL7A 4O4VA 2PP3A 4EX4A 5FACA 3KCOA 1EPVA 3W7CA 2WC3A 3HG2A 2OSXA 3VK5A 3I6EA 4HNTA 1UWRA 3KVJA 4PUEA 1U5JA 2UY2A 1PWMA 1ZBWA 3T05A 1KXTA 2XVLA 2EO7A 2BY1A 4M6VA 4L4LA 3CMJA 1YE6A 4IGHA 2VCCA 4PMVA 4B2DD 2ACSA 2DSVA 2YLLA 3GXTA 3V75A 2J7EA 2IQTA 2ZUMA 4D6CA 3MU7A 1J5TA 2DU2A 2A3CA 5C71A 2DORA 3RLGA 3VC5A 1TMQA 4K7VA 3A24A 2NW0A 1WE5A 4CNTA 3WQCA 1IEWA 4WJXA 4FX7A 5MF5A 2CWNA 2A7PA 4WQ6A 1QU4A 3HBLA 4UTUA 4OBSA 3V0UA 3C86A 3L5AA 3F03K 3M47A 1SJAA 2BTMA 1XKYA 4I7VA 7ENLA 1HKMA 2QDEA 2QAPA 1UG6A 3IEBA 3SB0A 3PWGA 3OYXA 1NM9A 3DFYA 4V1YA 4PRRA 3MUIA 1BVNP