4FOUA

Structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
IYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding/membrane protein
molecule keywords FimX
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fouA00
3GG0A 4FOKA 2R6OA 3GFXA 4Q6JA 3GFYA 4Y9OA 3U2EA 5M1TA 3HV8A 4RNFA 4LJ3A 4HJFA 3PJTA 4Y8EA 2BASA 5MKGB 4F48A 3GFZA 5MF5A 4KIEA 3S83A 3PJXA 4LYKA 4J40A 3PJWA 3HV9A 4F3HA 4RNIA 4ES4A 4RNHA 5MKGA 3TLQA 4AFYA 2W27A 3GG1A 3PFMA 4Y9MA 4HU4A 3N3TA 3KZPA 3PJUA 4HU3A 3SY8A 4FOUA 4AG0A 4FOJA 4Y9PA 4Y9NA 4RNJA
chains in the Genus database with same CATH superfamily
1LP6A 5CPLA 1A47A 1PKLA 1OYBA 4US5D 3BOXA 5I3IA 3EYPA 4RZ4A 3POHA 1F3XA 5HWJA 3DYMA 3ZJ7A 3T2OA 4AG0A 7A3HA 2Y5JA 1V51A 3NZRA 4AHQA 4BEUA 3W83A 4NILA 2Y4SA 3L7RA 4TXEA 3MBDA 3UJFA 4LY4A 3A9IA 4DQWA 4GC3A 3OBAA 4HA0A 5BCAA 1AJZA 3EMZA 3AMLA 3W7NA 4Z2GA 4CU7A 1JDFA 1REQB 3II1A 4UTKA 1QMLA 5A8MA 4L1WA 3ATZA 1S5WA 1F3WA 1DWGM 2CLEA 4XKYB 3VIJA 5DEZA 4H8HA 1EO5A 2QPUA 4CU8A 2FH8A 2PD5A 5CJNA 1HW6A 3SCUA 1PCWA 4Y9NA 3W53A 4WD0A 1J93A 1MW2A 4S2BA 4ICNA 1HJXA 4Y8EA 3E96A 1HKIA 4XTIA 2ZFAA 4L7ZA 2PCQA 5DF0A 3WK2A 4EK7A 1OWQA 3DENA 5GPRA 3I3BA 1Q6EA 2PDHA 2IMRA 3FGCA 1R3YA 1JF5A 4Q7BA 3RRAA 2ZBTA 2YR1A 4OOUA 3T9PA 2V69A 2I14A 5IXEA 2F8QA 2G95A 4XD4A 1RK6A 1D8WA 4DF0A 3STGA 5HNNA 1EC7A 4O53A 2QYGA 2R91A 3HQPA 4BI6A 2B7NA 4OU1A 1L6YA 4F0MA 2Q8LA 4HOWA 1UD8A 2CCRA 2GJXA 2J9ZA 4MSSA 4DX3A 1KRMA 1Q2RA 1XX1A 4C1NB 1HGYA 2HTMA 1UD5A 1SYTA 2PWUA 4PMVA 1M5WA 1I2OA 3W27A 4MDOA 2QKFA 1E4NA 1WDWA 3S8HA 1T99A 2YB1A 3WDPP 3FJ6A 2AAAA 1LL6A 2DIJA 5JIPA 1PYFA 3WQ5A 1VR6A 3R1ZA 1J6PA 2WXDM 4Z1BA 3FYOA 2OYKA 3A6OA 3FXYA 1CPUA 2PDWA 3LA4A 1U1HA 1K70A 4E8CA 1R3VA 2OODA 3TC6A 4CNUA 3EOUA 1TO3A 3VZYA 4FR6A 2VD8A 1I75A 2ACSA 3UR5A 1E4LA 2O9PA 3R0UA 3EB4A 5D05A 5A95A 4NQ1A 4JFWA 6PTDA 2Y8VA 3BARA 4PMQA 3IUDA 4M7TA 4F4RA 1E9ZB 1JDDA 1Q85A 1OD0A 3NL3A 1GW1A 3OQ8A 4BWLC 4KCUA 4N42A 1N82A 3W1TA 3OLIA 1LUCA 3VIIA 3NQEA 3EA3A 2OZ3A 3R89A 1UB3A 2PGWA 5HOSA 3SY8A 2Z1WA 4F2BA 4B3LA 3E0LA 4GG9A 3JR2A 4B5UA 1W91A 4JEJA 4X0VA 2XIMA 4PUUA 3DN5A 2R82A 2EAWA 3VZZA 2WANA 2CC0A 1FX6A 2WBGA 3WMCA 2GJRA 3EMQA 7PTDA 3W87A 2BVWA 4AMCA 3BLEA 5FF4A 2AMXA 1UP0A 3K13A 2P88A 3F4WA 2XPKA 3REQA 4GFSA 1UJQA 1ICQA 1SW0A 3QFWA 3DYPA 3QSRA 1MRAA 1FWEC 2C6QA 1GHSA 2DT1A 3MHGA 1S5TA 1SZEA 2VGIA 3GHUA 3W7OA 1Q8JA 3SURA 2OKOA 3RO6A 4JAWA 3SM0A 1CGVA 1SJDA 4E0CA 1ZBVA 2YA1A 2QS8A 4C7DA 4IGHA 4QTGA 1AQHA 4NJHA 4XK2A 1UW9A 1C3FA 2VWSA 2RAGA 3PUEA 2FJUB 4J3UA 2VT0A 5K7JA 1KM0A 4GVFA 4KW2A 5FD0A 5BRBA 5AOUA 3KAOA 2J66A 3TW7A 4BQ5A 2YA2A 2EO7A 3XISA 3WQWA 3P8IA 2FTYA 4DJEC 1R8LA 4GO9A 4QNWA 4DBWA 3S3GA 1BFNA 4EX4A 4GCAA 2FFCA 3RN6A 3HV8A 1E6QM 3A9BA 3VNYA 5C9XA 2ICSA 2X1SA 2VEGA 1JNDA 1B3VA 2W61A 3TJLA 3OYXA 4P7QA 3MANA 3TIMA 3TOPA 2J8GA 2XJ7A 1QCWA 2B0MA 3UJEA 4GO8A 3M5XA 3WUFA 3KUMA 2BLEA 3F4CA 3WLOA 3CAVA 2C3ZA 1XL9A 2XFWA 2VZVA 3WLNA 2E1DA 5IM51 1VJSA 2C1HA 1EP2A 1FP9A 3BWWA 3QQWA 3G1SA 4MDPA 4MGGA 2Z2UA 3M9YA 3W22A 2QDGA 3UR8A 4CD8A 4UTMA 4GCXA 2GDUA 1M65A 4CQCA 3GKFA 3BW4A 3D0CA 3L21A 1R3WA 4CCDA 1XS2A 5CG7A 3IANA 4ZO7A 5BOEA 3IIZA 1EGVA 1SFLA 4GBDA 2C14A 3O15A 4YCOA 2CKRA 4JCMA 5HBFA 3DXIA 3HPXA 3AISA 1NFGA 4AC1X 2CETA 4O8RA 3THCA 2DP3A 3O6AA 1XKYA 1QHPA 1R2TA 3GRIA 3W2NA 5E0CA 2GGJA 4ZE4A 1OADA 1QI2A 4AD5A 4AW7A 1J2BA 1TWIA 3BOLA 1O95A 3AHZA 4Z0JA 3M43A 2GOUA 5IHRA 1TUXA 1EUAA 3ZT7A 3GC5A 5I0DA 3P62A 3QV8A 4PC8A 1V3IA 3R13A 1R87A 4OFCA 3PPCA 1UWIA 3GNXA 2O7SA 4UTWA 2ABAA 4J3XA 1GTEA 2H9AA 3L66A 1YX1A 4DWSB 3ARUA 3T0TA 5I07A 5AFDA 3W1QA 1ZJHA 3H55A 3UY8A 1KFEA 3A13A 3QZAA 5AZ1A 4Z1CA 1HFBA 4JTLA 4GVIA 4WIWA 1J0JA 5D38A 1VD6A 4HHPA 1PTGA 1BWKA 5KZDA 1A5NC 5I24A 3MSDA 4D72A 3CL6A 4DUXA 4LPCA 9CGTA 3IJ9A 1EJRC 1W1A1 2E8YA 1N8IA 1R0MA 4EAYA 4KEUA 3UVAA 5FOOA 1DOSA 3JUGA 5C9RA 2DVXA 2WHKA 1GOWA 1ADDA 2V67A 3GW0A 3IJQA 3KOYA 4MJMA 4RXGA 4BHYA 2PDMA 4DZHA 1DIDA 3G8RA 1HTIA 4FEZA 4O1AA 4HNOA 1JD9A 1BG9A 5A69A 2FDSA 1AMYA 2R14A 1ADSA 3MV01 1JPMA 5XIMA 2ZRXA 4L4MA 4DM1A 3GO2A 3W72A 3S2JA 3MW7A 5E09A 1LCOA 3N9RA 2ZUWA 3WQPA 3H2EA 2IQDA 4B2DA 2H3DA 3EWDA 1UOKA 3MYOA 3GAKA 3BXWA 3OQEA 1VCGA 5LXEA 2HJPA 1Q6RA 1C9WA 3IJ6A 5DT7A 3L4XA 1WAWA 4JTHA 4LS2A 2PTDA 4Q8TA 1JG9A 1I2NA 1JZ4A 2W5FA 1J96A 3IJ8A 2FPTA 2WMKA 3TA6A 1W2PA 4U28A 4XZ9A 4PUNA 4ZXOA 2J74A 3TYBA 2QCHA 1EX1A 3JZEA 1MXGA 5DBTA 3L5MA 1OM0A 3MC5A 1UR3M 3TQKA 3PZNA 3CQJA 4ZR8A 3QYSA 5I3JA 2WQDA 4Z1AA 3Q65A 1NVMA 3B8IA 1YEYA 1BEUA 3PS7A 2GQ9A 3RMEA 1EJXC 5U4NA 3WUEA 3L5LA 4RE4A 4H2CA 3QJAA 4Q4SA 4WKFA 5G5IA 3OHIA 1JCXA 4ATDA 5G4EA 4IIHA 4UTJA 1ZUAX 2VEIA 3OGSA 4Z1DA 1ODUA 1D3CA 3GNRA 5C55A 4WDTA 1L0PA 4OBSA 3PFRA 4S3KA 4P7NA 4IWWA 1O68A 3WUGA 1ZRQA 2ZRZA 3EDDA 1FWCC 1KM6A 4ASTA 3PK7A 3ZFHA 1OABA 3GXIA 1CXFA 3LRMA 3UZWA 1D8CA 4H9MA 1WXJA 2WCGA 2W66A 4HB7A 3AIWA 1VFOA 4OE7A 4GMEA 1TV4A 3BG3A 1LOQA 2E0PA 3RCMA 2ZUNA 1R2RA 4O8AA 1W3JA 3I68A 3BTNA 3VCRA 5D32A 3OW1A 2P50A 5I77A 3WQ4A 4C65A 4A4AA 4NP7A 4OIFA 1XXXA 1DHKA 3TVAA 2VUNA 3W7MA 3RHGA 3B04A 2XGBA 3ARXA 4TX8A 1Q4NX 2ISSA 1AQFA 3S2MA 3ARTA 4MZYA 3WDHA 2Y7GA 3QPEA 3R8RA 1KGWA 1VJZA 3FXGA 4RE0A 4L5ZA 4GUIA 2H6RA 3CHVA 2E5BA 2JK2A 4F66A 5T26A 4KH2A 3SFWA 3U4AA 1ZS2A 3B05A 3BAYA 2D73A 1DIEA 1RBLA 5EYWA 5CZ0A 1CBGA 1XJBA 5BXPA 1K6WA 3S4TA 1X6LA 2WM1A 3NPXA 2ACRA 3OBEA 3ZVHB 4E2OA 3NQVA 3GD6A 3ES7A 4XV0A 4QE4A 4IX2A 3TQPA 1H7RA 4PB4A 4E2DA 3SGZA 3R25A 3KBVA 2IKIA 2TYSA 4GJJA 1GPFA 3CPGA 3G1RA 4G1KA 2OTDA 1J11A 2WJDA 3VD3A 2YGYA 4JIPA 5BOFA 4LRTA 3V4BA 4C6JA 1L2UA 4RNHA 1P48A 1F6PA 1W1YA 5LNVA 4US6A 3B4YA 1EXBA 5GNYA 3SRDA 1M6JA 1WBHA 3M44A 4LTSA 1CGUA 3QPZA 3VIKA 4GQBA 5MF5A 1VIWA 1H0GA 4M3PA 3MHUA 5FF2A 1OC7A 4AF0B 1U33A 2X42A 3WN6A 5ABTA 3F2DA 1FHDA 2FIQA 4AD1A 3LLDA 2GUYA 1SW7A 3RDKA 3U5YA 8RUCA 2X16A 4ERAA 3MDWA 3DHPA 1B5TA 1UD2A 5A8GA 1MUMA 4PUMA 3EDKA 2Q71A 3W7EA 3TSMA 5CPQA 1D9EA 5EBUA 4BCEA 1AZ2A 4CD5A 2WPGA 1A0EA 2WJEA 1XH2A 4UZUA 3CPRA 1WZKA 4LBUA 4F40A 1A3HA 4Q3MA 4BI7A 1AODA 3MWCA 1E4IA 1UR4A 4NZ3A 4MNLA 3CMFA 2V9DA 5DFAA 1QAPA 3KCLA 1K1DA 1ZTVA 5LIKX 3VDGA 3W1AA 1P6BA 5C7VA 1QFEA 1QO5A 2PWHA 3VIFA 1J0IA 3VOGA 1GOMA 5HQLA 4N02A 4GZIA 1VBJA 1EJTC 3A5VA 4L9XA 2QGYA 3AS1A 1WAUA 2Y62A 2WK2A 3CUJA 4QP0A 1XW8A 2VEMA 3M16A 5G2WA 1T96A 4UTHA 4G8TA 3CTTA 1W3IA 2V30A 4KCTA 3KOXA 2E6AA 1AD1A 3UXIA 4A8IA 3W81A 3IRDA 3NWRA 2BTMA 3FGCB 3LXAA 4LSBA 2WWDA 4GPNA 3WQ6A 2Z1VA 1AJ2A 3NL5A 1HF6A 3BG5A 5AYZA 4ATWA 3KZPA 1C7TA 5TD4A 5JBDA 3QC0A 1QW7A 5E1QA 3HM7A 1J0ZA 4GIAA 5BU6A 3LSCA 4AEOA 1KTBA 3VK5A 4J1OA 2E5DA 4PTNA 4J3ZA 2BV9A 4YVVA 1US2A 3S2LA 1S46A 3B8SA 5G2IA 4WXYA 3QGVA 3D46A 1ZAHA 4MKSA 3W6MA 4PFHA 4Y90A 1GOOA 3W1UA 4NVTA 1EBGA 3R5EA 4IM4A 2PTZA 4CQ9A 4UFIA 2VTFA 1FWJC 4J2PA 4YXGA 4DEFA 4P8WA 3UFYA 2WMIA 4MY9A 3ZWSA 1TJPA 2DSWA 4HVXA 1S2CA 1BGAA 1Z6KA 1JZ2A 3KVMA 2CZDA 1O4UA 2EG8A 1UWAA 2DH3A 3WLJA 1E4MM 4K38A 1IEWA 1EJUC 1GVEA 1ENUA 3WLIA 1TJ2A 4S3DA 2YKKA 3FVMA 3NZPA 1PZ0A 4HNUA 1TCDA 1EDGA 1PKYA 1KQZA 3T05A 3TC3A 3M0XA 4W8BA 4HKPA 3EWUA 1DE5A 4AIBA 3QW3A 4IIEA 4MFEA 1D3GA 4TVUA 4I5RA 4DZAA 1PIFA 4WRHA 3W7PA 1TRDA 3NAVA 4N6EA 3W70A 4AC7C 1M9HA 4XX6A 3AZRA 3BLPX 1RV8A 4GOAA 3CU2A 3VPLA 4FLRA 4O1EA 3AC0A 3AZTA 2EF9A 1XCFA 4DY1A 5EMKA 3LBCA 1OF8A 1RCOB 3RXZA 3TU9A 3STPA 2P76A 4ICMA 1QXLA 4NZCA 2EEXA 3T8QA 2W63A 5JMUA 1FHLA 4PTXA 1S1RA 3C2VA 1UKOA 4WVXA 3C5QA 3WD0A 1IQ8A 1XQKA 1KKRA 1V0LA 5BROA 3E38A 1AL8A 1B9ZA 4GZJA 2MNRA 1LWJA 1PX8A 3A4WA 3MMDA 1BPLB 3CZGA 4RK8A 2BOFX 4CU6A 3UQNA 4L6DA 4DB7A 4M7SA 3I7QA 3SJ3A 3W00A 4EF8A 4GYPA 1RCQA 3KL0A 4IGNA 4RDYA 1W3KA 3APTA 1F05A 3WMLA 1JPHA 4AD4A 4L4OA 5DXYA 4QSFA 3QY6A 3PG8A 4JBRA 1HKMA 1MWOA 1TPVA 3A23A 1XIEA 3M0YA 2ZRUA 1YXYA 3G0UA 3E3HA 3VYLA 4O14A 4I5XA 1MI3A 3QC3A 3C0QA 4WLCA 3S1WA 4KWVA 4BF5A 1MUWA 1R3QA 4V27A 2DY3A 2HV5A 4XZWA 1JCYA 2PZNA 4TV5A 3R94A 1MVYA 4EF9A 4HSNA 1ZPTA 2YL9A 2W67A 4IPPA 4IFRA 2V2HA 1EQPA 4L9YA 4JIHA 1WDDA 3AU6A 3IJ7A 1MW0A 2G37A 4MTVA 4MF4A 3NQMA 4XSMA 2ZUSA 4NZ1A 3RPDA 5A2BA 5KSWA 3CUZA 1YE6A 3OVQA 5FF7A 4GVHA 1TV5A 1T5AA 3HMJG 2R1PA 2UY3A 1ZBWA 1H5VA 2JIWA 3SCRA 3JU2A 2VI0A 1NWUA 3AUOA 2Y61A 3TJ4A 3UJRA 1JZ7A 4YWSA 4JYFA 5HMFA 3N11A 1AG1O 3TFCA 1TTIA 1MQPA 4P2VA 2JIEA 2BG5A 5CGMA 1HKWA 4PGLA 3L4UA 3N14A 3B9AA 3WH5A 5AC6A 3W7CA 4I9TA 3B0PA 4AYGA 3W4RA 4F0LA 3UP8A 1KNWA 3LNPA 1ZSXA 3EPNA 3PN8A 3AWOA 2OJPA 4IG2A 2JEQA 3INPA 1H63A 2WHMA 4AXNA 1E6XM 1CDGA 3Q94A 3HJEA 1FFQA 1PYMA 4IFKA 1TPFA 2ZX6A 3K1DA 1V6XA 2GVEA 2EPKX 2XZ9A 1H62A 3SUVA 1NWRA 4QITA 1RPKA 4KPLA 4KRTA 3I3EA 1GT8A 2Z25A 3OTRA 4GX8A 3RRXA 2JGQA 3FFSA 2FMNA 2XN0A 5D02A 1Z42A 1K8YA 2INZA 1KBLA 1ZJBA 1YNPA 2WC3A 1FWRA 2A3AA 3GWQA 4M19A 3HFTA 1CGYA 1QNRA 2FGBA 4E4PA 4H9TA 2A79A 2ZE3A 3L4WA 4ZOBA 1RJRA 2OPJA 3EA1A 2O56A 3VU2A 6TIMA 4O15A 4S3GA 2PDGA 1XBVA 5AN7A 3RF9A 3WQOA 3IIVA 3W29A 2C79A 4J35A 2YDRA 3OJGA 1V0KA 2EPOA 2J7CA 4ZGYA 3MVTA 1VFUA 3G6LA 1LTDA 3EMCA 3WELA 4B92A 1TWWA 4N9CA 3VIOA 2W91A 1BXNA 1H60A 3I3DA 3S9YA 2XSAA 1WCGA 3V1HA 2PWEA 5HULA 3SRHA 1TJ1A 3AJ7A 1FFRA 3CXOA 1LQAA 3S1UA 5AVNA 4I3GA 4WKHA 4CNSA 2CZEA 4C91A 4Q22A 2VOMA 3U57A 3FHAA 3LY0A 2B7OA 3CK5A 3UJ2A 1UD6A 3A21A 3ARYA 3F5LA 4WJXA 5A8NA 4JQ3A 3DFSA 3H70A 3LPFA 3GDTA 4IL2A 3HPSA 1GKPA 2J9XA 4JYEA 4JNMA 3QKEA 3C61A 4K1WA 3PAJA 5ABEA 1DPMA 1DXEA 4LBSA 2RGLA 3AIUA 2YOCA 1VJIA 2ZX8A 1GW9A 1KCLA 4GABA 4HYWA 2POZA 1JD7A 3W23A 1WV2A 1GPWA 3CWOX 3T0DA 2ZXBA 1PDZA 1FOBA 1MZRA 3BAXA 2FDMA 4HPXA 3CH0A 2OXNA 1UR1A 4H6KA 5IDIA 3NQFA 3WDQA 3QKZA 4PRWA 1F3EA 2QCGA 3A24A 2WAGA 4BI5A 3BCFA 3LQLA 1P6CA 3WBWA 4BQ4A 3ES8A 2GUBA 1QOQA 4Z2JA 4TX9A 1FWWA 3MUY1 5CSUA 4LF2A 3BLDA 4XB3A 3E5PA 1HO4A 3BJSA 4ZB0A 4M82A 2H3BA 4CD7A 4QCEA 4RJEA 1SZGA 3MPGA 4HD5A 1EX5A 1BRLA 1TIWA 2GK1A 3WLRA 3U8GA 5H91A 4RDVA 4AWSA 2GGEA 1NTHA 1H1YA 3PZMA 1WKYA 4C5ZA 1DE6A 3VOHA 1BXCA 2VURA 1XGEA 3NQ8A 3SCQA 2VR2A 3TYZA 1WP6A 1DKWA 2G5WA 3O6CA 4JTJA 2AQOA 3P0XA 1DHPA 1LF1A 3APGA 1RY8A 4PSRA 4NNAA 3CV1A 1EPVA 1H3GA 4F9JA 1BYAA 1KXVA 4GA8A 2G3IA 4AUBA 4KESA 3V3WA 1W9VA 3NQBA 3WL0A 4LS1A 3Q67A 1R86A 5BMWA 1XKJA 3THQA 2C19A 4HHLA 2QV4A 1P4CA 5FSEC 1KWGA 1GQJA 4Z2LA 4KWUA 3VMNA 4Q6JA 1QR7A 5LSMA 1UPMB 3QLLA 4XD6A 3SECA 3SUSA 1FCQA 4IIGA 4ECLA 1G0CA 3E0IA 2AAMA 3L0KA 1NIUA 1P7TA 3VOJA 1DJZA 1Q13A 1TPC1 3DU0A 1C91A 1ZAIA 1P0KA 2ZC1A 3UWYA 2C18A 2PS2A 2EQDA 4JIIX 3FDKA 3FS2A 3E2RA 3O6DA 4HYVA 1EWEA 5GJNA 4A3YA 2WV8A 3AIEA 2XH7A 4ZENA 1R7AA 4FNUA 2NXGA 1SFSA 2EHHA 2GQAA 5JH2A 2PODA 1K9DA 4AIEA 1FUYA 4RW3A 1EHNA 3RYSA 3TX9A 2WSKA 4HNLA 4DJFC 3H2MA 4FOKA 2R6OA 3UCQA 3E0VA 3PBMA 3V7PA 5A8PA 1N55A 1TUFA 4DHGA 1X96A 5EFDA 3VC5A 2INFA 2YDSA 4Q6XA 1QK2A 3E9AA 2G3FA 1FDYA 4CD6A 1WUFA 3NUKA 2CXGA 4RV8A 3PBYA 4P7LA 4URIA 5KZEA 2B7QA 3O3RA 1M04A 4HHMA 3TTSA 1MEWA 1XH1A 3WQFA 3PZVA 4CQBA 4AH7A 1EP3A 1EYWA 1DJHA 1NDVA 2REQA 3OGVA 1NELA 2O7QA 2YDAA 3AOFA 3S2NA 3UERA 3CZLA 3I6RA 1KB3A 1GK8A 2WVTA 1GHRA 4KFPA 4KRUA 5A6TC 1ONEA 3R0KA 3M07A 2GJPA 1NJJA 3TN5A 2HE5A 3EXSA 1OC5A 2A1YA 4DNHA 4ZBCA 3B8UA 3KM8A 2HXTA 4NNCA 1C92A 2XIOA 4LC8A 2HVOA 2JALA 3WH8A 3NXLA 2V5KA 2CERA 3EWBX 3BAIA 4HOZA 3GNOA 5HPCA 3BMXA 5A2CA 2IXVA 2GGIA 3K4WA 3LYEA 4HK7A 2H90A 3ZSSA 3WNNA 5XINA 2A3BA 3VTRA 1V4YA 4K36A 1TKKA 4O16A 1FWIC 1KM2A 1H4PA 3BL3A 3GNPA 3NR0A 3WL1A 2DDXA 4XZIA 2ZZ7A 3VABA 3VXGA 4MKVA 1E1CB 1RH9A 3ZYZA 3KE0A 2YX0A 4RR4A 4B5NA 1US3A 3NPVA 2VGGA 1XLBA 2VENA 3W85A 5LHFA 3VKDA 2XU2A 3W82A 3NDZA 2YIHA 3BICA 4WSKA 4MUPA 2HCVA 1TMQA 4QLKA 5HPOA 4NT0A 2BASA 1FWAC 1UH3A 1R46A 1E40A 5AY7A 3O1NA 3ELFA 4JL1A 3LOTA 5D4YA 4LAMA 2WWCA 1KR1A 1N7KA 2ZKMX 4OOZA 2NQ5A 2ZA3A 3LPGA 3QY8A 1A53A 1AH4A 3ZQ9A 3V1PA 1P1XA 1JCTA 4FMVA 1XIGA 2G50A 3ZVHA 1NQKA 1V5XA 1FCBA 1UHVA 4QE5A 1Z41A 5LGZA 2WMGA 3K8KA 4MVAA 1ALDA 5HNUA 4L6HA 4IG2B 3GXMA 4X3ZA 3VKBA 4DO7A 2OU4A 3ARSA 4JFSA 3AMKA 3WY1A 2IQTA 3OOQA 2YCKX 1ITUA 3AIRA 1J01A 2Q8ZA 2B31A 1GNXA 1GZJA 1RVGA 2FB2A 1LT8A 3EOLA 3RITA 3TUUA 1LRQA 4H9UA 4NJGA 3VUPA 3LTYA 3MA8A 3R0DA 1XIMA 1ZHAA 2CBVA 2ZUVA 1EF3A 3ZXWA 2ATSA 2BGQA 4Y96A 2QNEA 2NVDA 1PPIA 4QX4A 3T40A 2JBMA 2XGIA 1B0IA 1CCWB 1JYVA 3W76A 4ZO9A 3SCTA 3LTPA 4N9BA 1ZLPA 4J3WA 2PDUA 4IJCA 1V03A 1GJWA 2X0HA 2BWGA 2VRJA 2XDFA 5BRQA 1ZENA 3CHEA 1DWJM 4LXFA 4FNRA 3PBVA 4GI9A 2GDQA 1CWYA 2FVMA 2Z27A 3PWAA 4G1NA 4H01A 3C2EA 3L0GA 3WFLA 4IZGA 2DGAA 5TQLA 4B5TA 7ENLA 1SUXA 4MAVA 5XIAA 4LC6A 3GG7A 4JNZA 1REQA 3CV6A 1OFEA 4IGMA 3PNUA 1UQYA 2FZBA 2Z1XA 2VXNA 3PTQA 1IT8A 4ZQRA 4JIEA 3FVDA 2VDGA 2ZA2A 3CIWA 2Z24A 2DSVA 1OY0A 1QJWA 1QPOA 3P7YA 5HATA 1FVPA 4WR3A 3TW9A 1GTHA 2CBUA 3N9KA 4ZOCA 3T7VA 3GIQA 2ISFA 5F4XA 3CPUA 3T08A 4AZCA 4ADUA 1X1NA 3C3NA 2DU2A 1DV7A 1HUVA 2NSXA 2O9TA 3NNTA 4MJZA 2OLAA 1R6WA 5IOBA 1K8CA 3AO0A 1FTXA 4LEFA 3W6LA 1XYCA 1BTCA 4WXZA 2JE8A 1E0VA 3LBMA 1AH3A 3CZKA 2GSEA 5FL1A 4FOJA 4L64A 4OJYA 2Z0IA 1XFCA 2YFOA 3P74A 1XDJA 1P6WA 1ISZA 3VNMA 1OSEA 5G4HC 4ZSUA 5HJLA 5J5RA 2PLJA 2TAAA 3UNDA 1H51A 2PDJA 4OWGA 5LNWA 1VFTA 3FK4A 4J40A 3MI2A 2UBPC 3HG3A 1HNYA 1QNSA 4DNMA 4ZMGA 2OR2A 3WF1A 4DO4A 4EP8C 1UCWA 3GB6A 3MU7A 1I45A 4AZGA 4JTEA 1E0XA 4H9VA 1UIPA 5FF0A 2GJXB 2EXOA 2VR4A 4PRRA 1TQJA 4XAPA 4GUGA 4AZBA 1DBTA 2R24A 4S3FA 2NXIA 3ECQA 1RLDA 5FJRA 4EKJA 1LRNA 3PVFA 3MHFA 4BQ2A 2RH9A 3BLLA 3BQ6A 1XRTA 3TEVA 1AQMA 3ZT6A 1TMLA 4JTGA 5F1VA 1G6CA 3ITVA 3KBJA 4H1ZA 3FAWA 4E38A 8XIMA 4ADTA 2DVUA 1R3TA 1EFZA 2QZRA 2DIKA 5D2YA 1B31A 3HG5A 1OCNA 3T4WA 5CG0A 3LERA 3ITCA 2OZ0A 4FHAA 1GQLA 3RPMA 3TONA 1OYCA 1WOBA 2Y24A 1JYNA 1KBBA 4OQVA 4K68A 1KM1A 2BP1A 3CASA 4B3ZA 3VZXA 4NYYA 3WH9A 4R7WA 3KWXA 4WDUA 3U2CA 4HCHA 5HMDA 1JL8A 3TKFA 1BG4A 2CLIA 1XISA 3CQHA 4KERA 1WDSA 2V3GA 2GPTA 3M64A 1A5LC 1O5XA 1IEQA 3LXCA 1HP5A 1CNVA 1VEMA 1E6ZA 2AMGA 4AQLA 5A1AA 3NJ3A 2Z4GA 1LWHA 5AHLA 4NHVA 4Y8FA 2IPWA 3TW6A 2P3ZA 1UH2A 2Y85A 4EXBA 2WW5A 3UVIA 1TZZA 3KWSA 1K03A 4J4KA 1Q6CA 1MW1A 3Q58A 5C9UA 3ALFA 4LV9A 2VHLA 7REQB 4KFNA 4DYJA 4G9PA 2FZ9A 1K6AA 3WQVA 5LA2A 1XSJA 2Q3RA 3SCWA 4AZ7A 4I7WA 7TIMA 1Z3NA 4QDWA 3MUZ1 1D3HA 3LEPA 1AH0A 3P14A 1MO0A 2KAUC 1NAL1 2TODA 2OWCA 1YRRA 4TQTA 3LLFA 3G0XA 1JCNA 2PBGA 3QZ6A 2F61A 2NSOA 5EY5A 1BKSA 1LLZA 1KRAC 3HU7A 3L4TA 4FSAA 4KIEA 3VIPA 1TX0A 3GUWA 1XRSA 3ORWA 3G1VA 5BXTA 5I02A 4CNOA 3KHJA 1VFLA 4M24A 2YW3A 3VMPA 4NJIA 3M7SA 4JEQA 4Z17A 3M1ZA 3B4UA 1NDWA 1XWYA 4NXKA 3S5ZA 4MKNA 5IHSA 1IEXA 3WENA 1F4AA 4WSHA 1GZ1A 1UKTA 4FXRA 4YTSA 1HJSA 4LFYA 1U1JA 6XIMA 3NZGA 5EMYA 1NWSA 2FTWA 3WLMA 4PUWA 1PWMA 5CPSA 5AYBA 3O8AA 2YCLA 3P93A 2VFGA 3SY1A 2HBVA 1W9BM 4R85A 3VC6A 1RJPA 3KL3A 3WUBA 4R33A 2A7PA 3T81A 5IBXA 1A49A 1LWIA 3UEQA 5TIMA 3BAWA 3WBXA 4CUCA 5GQBA 4B90A 3NL2A 4CEXC 3NQGA 3M0KA 1BF2A 3H22A 5G2HA 2C71A 3FW6A 4Z2HA 1ZBKA 3OA3A 1A50A 4KETA 1TMHA 2CW6A 4JTRA 1Q6DA 3TMQA 2RDXA 4POCA 2PDQA 4PB5A 1F9CA 2VCAA 4OVXA 4CQAA 1WZAA 2VGFA 4Q4OA 4G2DA 3HA1A 3GW3A 3SADA 3MUCA 5CJ5A 1H1NA 2VYOA 3N29A 4GQGA 2E1WA 3N04A 4LUSB 4WX2A 4BY3A 4LYPA 2X1UA 1RBAA 3FSUA 4AF0A 2YXGA 4U33A 2A7NA 4Y7EA 2JKEA 4PN2A 3UXKA 3YPIA 4JR5A 3KBMA 1TWSA 2O4MA 3H4WA 1KGXA 4ZXLA 4C1NA 3TTOA 1KXHA 2PU1A 1RQBA 3F4VA 2PMQA 3KDOA 1T6MA 2ZUTA 1LL7A 1HQTA 3UETA 4WY0B 3WMSA 4GVGA 4AZHA 1VB9A 1J0YA 4JN6A 2CLHA 4AMAA 1AQ0A 4QSHA 3OYZA 4DJDD 5FEWA 3N17A 2WKJA 1POJA 1F8MA 4HCLA 2YBTA 5E93A 2PDPA 2QLYA 2G3NA 2VDIA 3NGFA 3NYZA 1JZ8A 3T07A 5K9CA 1OK4A 3CS2A 3ITYA 5CSSA 3S1XA 2BOEX 5CBIA 1AW2A 2XIJA 1XUZA 4PBGA 2ZZ6A 2YW4A 4U2YA 4G6CA 2CLLA 1BQGA 2PUZA 5A5WA 4R53A 1XC4A 4MNKA 3R8HA 3OZOA 3MBFA 5CZSA 5CZTA 1E9YB 4JL2A 1XYLA 3NL6A 4JY9A 1XCWA 1E0WA 4V1YA 4O4VA 1TV7A 3ARRA 4AEFA 1ZB5A 3CB3A 5LYRA 2HZGA 2HSAA 3BPWA 4M8UA 3C8FA 3GXPA 2GUUA 5A3HA 4M5PA 3F4DA 1JAKA 3GG8A 1GEQA 2XH4A 3QV9A 4YMZA 3CNYA 3T0CA 2O0TA 4Y9MA 4B4FA 1OJXA 3WNKA 4C6PA 1OFPA 3G2GA 3O06A 1V02A 4RL3A 2E9LA 3UNTA 1W5OA 2OSWA 3WEZA 2HNHA 2VUYA 4NAFA 2VWTA 4DWSD 4MJ2A 3WNMA 4O52A 1GKQA 4MLJA 4H8NA 3KS5A 3G1FA 4K8HA 2B7PA 3IGXA 4M6PA 3QR0A 1K7EA 2AL2A 3TQ0A 4GX9A 1B3XA 3H2NA 2E5CA 3QHNA 1ZZMA 4HK5A 3ZLGA 5HMEA 3TYEA 4AZ5A 4XG1A 1EO7A 3GHRA 3IEBA 5AC4A 3KTCA 1M7PA 1UBSA 3MUAA 1O1HA 4PBEA 5CC3A 1MXSA 7ODCA 1P0NA 3UF9A 4ZFCA 2QVNA 3QLDA 4QG8A 2VL4A 3WFAA 3MKKA 1X39A 2YL6A 3Q37A 1XIDA 1B4EA 4MFDA 3URAA 2Y1HA 3KCJA 2R1LA 2F9RA 3FEQA 3GVQA 3LCGA 3CM4A 4IXHA 3SRKA 3MY9A 3QQ0A 4N0RA 2ISWA 1CLKA 3LSBA 2J7BA 1TPDA 4DXVA 3PTDA 2X0SA 3VE9A 1XIFA 1LRTA 2FVLA 1VHNA 4HPGA 5GNXA 5BXSA 1AUSL 1DXFA 4HA3A 4WDWA 2PC8A 2CHOA 3VGBA 1ME9A 3I4KA 4PE8A 1G5AA 1DQWA 3PPFA 1QI0A 2WMJA 4BZYA 4KWOA 3N2TA 4PBFA 2YYUA 3DBNA 3DFYA 1Q6FA 2QDHA 1PTAA 4LBRA 3EEGA 4XWUA 4WHBA 2EG7A 3N6HA 3UZJA 1PTDA 2GVJA 4AHPA 2D23A 1T8XA 4ZTYA 2V5JA 2VFEA 2PDKA 1G67A 1V8EA 3M0ZA 3M0JA 3AS0A 3DG3A 3USBA 4GWEA 2QCEA 4N9EA 1TELA 2Y7DA 1L6FA 2Z2AA 3SFKA 3GQYA 5M03A 5I3DA 5C2GA 3A64A 4UOJA 3IGUA 1FH7A 1L6WA 2DZTA 4D6GA 3NQ2A 5EU9A 3U2OA 1SJBA 5TNVA 3CZ8A 1Z8AA 4MNJA 5EL1A 1B4KA 3B8VA 4JTIA 3I65A 4GHRA 1GG1A 1OD8A 3M4HA 3MYPA 5BNKA 2NX1A 3C8NA 3IGSA 2EKGA 1LDCA 3UG4A 1ZFJA 3V0UA 3NO5A 1CB2A 1UMLA 4RUBA 2VM8A 3K8LA 3P80A 2VX7A 4V15A 5CPMA 1C8YA 3RGTA 1H50A 1YDOA 3C86A 4JFTA 4H04A 4AAJA 2WKGA 2XISA 1HL8A 3NQ6A 4JDYA 3TN6A 4UQ9A 1ZP3A 2VVSA 5REQA 1YDNA 1FWNA 4AU0A 1X1ZA 1YHTA 4DI8A 2X30A 3NQAA 3BJTA 4JTUA 3VOCA 4GNJA 5B80A 4GUJA 1IWPA 2GYIA 2ZZ3A 3FV9A 1FXQA 2Z1KA 3XIMA 1DWAM 1KFBA 3AYVA 3AICA 1EJWC 4RNFA 5FF3A 3UZYA 5KETA 2GJLA 4LX4A 2JF7A 4LRSA 4E4FA 2J9YA 3O6YX 3ISIX 5BWFA 2YBUA 4GK8A 2D2GA 3AYSA 4G5DA 4D1JA 3U7BA 4WGHA 1ICSA 2NX3A 2QIIA 2F6KA 3FSTA 3F2CA 1FY6A 4NASA 3POCA 4TMBA 2YJQA 1B30A 1KKOA 2VZUA 2CLMA 3UPWA 4GZ7A 3VOFA 1JPKA 3LU2A 4AFYA 1TZ9A 1C8QA 4FA3A 1RCXB 3TN3A 2D0HA 2Y6ZA 4OZOA 3GC2A 2G4JA 1X8FA 3P61A 2Y8UA 3L5AA 1I2PA 3PBWA 5AB3A 1D2KA 2E9MA 1EEPA 5A94A 1K3UA 1SSGA 4XBKA 3VM5A 1JZ6A 3K2GA 4IJRA 4MWAB 3CUFA 2PLMA 2BDQA 2CLPA 3PNZA 4K8EA 1GONA 3Q4DA 5C6MA 4UFMA 2P5NA 2IPJA 1W3LA 4MIMA 2GSJA 3UR7A 5LKYA 3NSXA 2KZHA 4FPSA 1GVRA 4M0XA 3UG5A 4U5IA 3N19B 3CHFA 1RA5A 4LT9A 1A5BA 1WX0A 3W7KA 3BMVA 4I6KA 2HQAA 1E9LA 1CECA 1RP9A 2IKGA 2R94A 1Q65A 1BHGA 4LJ3A 1W0MA 1G69A 4UR8A 4UFJA 1RR2A 3N2CA 4LNYA 4U31A 1ME7A 4DZ5A 3W6YA 3P81A 4JQ4A 3CBWA 5DX7A 1UBPC 2HISA 4FK9A 4RV3A 3WBYA 1XLLA 1PL9A 3AZSA 3WMBA 4L4LA 3O7UA 1ISXA 1WQ5A 5GJPA 5CBBA 1TRIA 4IPJA 2WLYA 2WVVB 3G22A 2YXXA 3AQUA 1DL3A 4JHZA 4B5WA 1QHZA 5CGTA 4OGZA 3CUHA 1CLVA 4Q4QA 1I8JA 2QJIA 3G0SA 1KR0A 3KOFA 2CU0A 1L8NA 4H6EA 4O50A 5KMYA 1YYAA 2IPFA 1A5CA 3W1NA 4FS9A 5F2GA 4DYKA 4HZ7A 4WUIA 4U3CA 1FWHC 1ZNNA 4KEMA 3VM7A 3IV3A 1W54A 3IIOA 1JCMP 3C0SA 2YA0A 4CCZA 4J9JA 3GH5A 5H8MA 1F07A 2FZNA 3FY1A 4R3UA 2DW7A 2BFGA 1CW2A 4D1IA 7REQA 3DZ1A 3C3UA 1GVIA 3GIPA 4XKYA 3LHZA 4DI9A 1OB0A 2DZSA 2J78A 1NM9A 3EZ4A 3NEVA 1MDRA 4F8XA 4YWIA 4ONVA 1F6KA 3SO7A 1QPKA 3WQCA 3WLLA 1DQXA 3V36A 5C2XA 3G1XA 1H7NA 3MP3A 4PL2A 3GXDA 4OV4A 4LCRA 4H7CA 1B2YA 5BWAA 1K7XA 3WQEA 1ZP4A 2F2KA 4Y9PA 4IIDA 2XGZA 1XV8A 4PODA 3BVJA 5BXRA 4IIBA 1JF6A 4AZIA 4J3SA 4DPQA 1S38A 2ZUUA 2J7HA 5MKGA 1WB0A 3NOEA 4IMEA 5F4SA 1JEZA 3PPGA 2VCCA 5CBJA 4L6OA 1H49A 3U7VA 1KM3A 4PCTA 1KM4A 3OVRA 2F7FA 1AVAA 3PWIA 3SI9A 3T78A 4P7RA 2W0UA 3RJYA 4P8XA 4TIMA 1ZJIA 4CVWA 5LNUA 3ABQA 4UB9A 4ACYA 1UZ1A 4MWAC 2VFIA 2ZA1A 1MDLA 1Y7VA 2NV1A 1QI5A 2NQLA 4UTIA 4UMAA 4DJDA 2XTKA 5DN1A 2PI6A 1QPQA 2QEZA 1RVKA 4GIEA 3MS8A 1A0DA 1PX4A 3KLKA 1Y65A 1W9UA 4D8AA 4IUOA 3QTGA 2ADAA 1VP5A 3ARWA 4GQQA 2XVLA 1GOIA 3SGGA 3QHOA 2V82A 3ZLFA 4CLMA 1EP1A 4HZ8A 2PTWA 1CTNA 4NZJA 3OP2A 3QOKA 4A3HA 3P0WA 4QXIA 1E6SM 1S2UA 1Z44A 3ARVA 2GLKA 4PMZA 3L23A 1RQHA 2WC7A 4ORIA 1XIJA 2A4AA 3V16A 5C5YA 1XLCA 1U5HA 3QRHA 1NARA 3NQ7A 3EKZA 2QJJA 1V3LA 2J7GA 4HSHA 3SSJA 4C6LA 2DZVA 4QG9A 1KFKA 3OODA 2D22A 2OELA 1UKSA 1K9FA 3RUBL 1TWDA 3W74A 1HXJA 3GVGA 1RHCA 2WKLA 5CQ1A 4QS5A 1EJSC 4AWEA 1UMYA 3R11A 3CYVA 3GC4A 3PB0A 1K9TA 4NY2A 4DUWA 2PEVA 2WJZA 5AHIA 1DXIA 3G8EA 2YL5A 4O19A 5J04A 3GNNA 2A0NA 1DWHM 1JRCA 3QR1A 3RLGA 1HT6A 5GJMA 2J4GA 2QCFA 4IIFA 2XZ7A 5LNSA 3CB8A 5BW6A 3GDLA 3N1AA 3CGTA 1UR9A 1XQLA 3ZLHA 1LT7A 1E55A 4KBXA 1UA3A 4M56A 1K8XA 2VZTA 4TOQA 4EXQA 1EH9A 3W84A 2VOTA 1V7AA 4MLRA 2BVTA 3NSMA 3RX2A 5EGRA 1GYLA 3UGVA 4XBSA 4AX6A 4UR7A 1NEYA 3DHUA 4GZEA 1MUCA 3M0IA 1S5VA 3L2IA 1KD0A 3CJPA 4S23A 4Q8VA 3E2VA 4AVNA 3W24A 3WDRA 3A5FA 4CN4A 3OO2A 4UQEA 5DLCA 2VMFA 4ALDA 2CLFA 4N9DA 3BLKA 1J6OA 5FAGA 1EIXA 3B06A 2WZMA 2G97A 1CX9A 3W73A 3WK3A 4WKAA 1VRXA 4F48A 3ITGA 4KGJA 1WZLA 4B91A 3PHAA 2BY2A 2J7DA 5REQB 5ECUA 1V02E 1KC7A 3COTA 1UJPA 3WIJA 4ACZA 2O4QA 2WJFA 2G3MA 3ZM8A 5JIWA 5FA5A 2G41A 3TFXA 3N2BA 2XWDA 2WNZA 3ICJA 1GG0A 2W4XA 2UZ9A 3PJWA 4S39A 3P67A 3G1HA 1QRQA 2DH2A 3W7RA 2XN2A 4PTDA 1OX5A 3ATYA 1TA3B 1OC6A 2QMJA 2RHGA 4GY0A 1W2VA 1ESWA 3W7GA 4CNTA 2AKMA 3AS3A 2POTA 3G1YA 4DWSC 1K9EA 3UBPC 1TYGA 3P60A 3U0HA 4ES4A 3U5UA 3VDBA 3GG1A 1H7OA 1RXOB 3A4JA 5K4ZA 1QDSA 1NQ6A 3CAKA 4NUWA 2OYLA 1XLFA 1DTUA 3VCCA 2PFHA 4UNLA 5ABFA 4HPJA 3RJXA 1J4EA 1VYRA 3O2LA 3TXVA 5FEZA 4AWUA 4QGCA 4HU3A 3TAOA 3HZ3A 3BJFA 3VNIA 5JU6A 1JGMA 2DJLA 3V0TA 4F9DA 5M1TA 4PCNA 3DFHA 4DJFD 1PSCA 2PE4A 4J27A 3LMYA 1YMYA 1P0DA 2CWNA 1XLMA 2FZDA 4YVPA 4IQLA 1YXCA 2FHFA 1ZL1A 4GBUA 2I57A 2BGSA 4L65A 3ABSA 3QTPA 5DCDA 4DO6A 1U5JA 4GJIA 3KXQA 5B7YA 2FLIA 3GNDA 3OVPA 2GK1B 2XM2A 2OCZA 1E56A 1R2SA 1TA3A 4LW7A 4PL1A 4WY0F 4W8AA 3DOPA 4ADSA 3U2ZA 4O1DA 1JQVA 5CH9A 3QFEA 4ZCWA 2BZNA 4HQVA 2ZZ1A 3FCPA 4C1KA 3GTNA 2MUCA 4C90A 4JNYA 4EOUA 1LOLA 4K7VA 4C6IA 6ALDA 2H8XA 3BE7A 1I60A 2WNQA 1TPEA 4W84A 4A6GA 4HT3A 4NKCA 2R1NA 3I6EA 4MB4A 2X1RA 2VFFA 2R1MA 3QN3A 3KTXA 1JGIA 3T2PA 1KXTA 4O17A 5DCEA 5GVJA 4RPQA 3EWYA 3U3HA 3EDFA 3B40A 4B5XA 5LHEA 4A3RA 1S3HA 2PDIA 3NQCA 4C6FA 3A3HA 1YKWA 4IFOA 4O54A 3CC1A 2D1ZA 3LX9A 4C6EA 2ONEA 1E51A 3VIMA 3PY2A 3AJXA 4XZBA 4UCGA 3TZFA 4XAYA 2HROA 3ZWTA 5I7GA 1H11A 3IUHA 1PVNA 3OBKA 2ZE0A 1R3SA 1EGMA 3MZNA 4LAKA 5ABFB 3DX5A 1TFVA 5BRPA 5HMSA 2RUSA 2QDDA 5EA9A 1XYFA 4RE3A 4NAEB 2WZEA 1NDZA 1ME8A 3NYDA 4ZB2A 1AL7A 1ISWA 1OEPA 3RCYA 1H7WA 4EWND 2DFAA 1JNEA 4LEQA 3SQLA 4QEHA 2HNEA 4QR6A 4W89A 2NZLA 3C0LA 1PZ2A 3EB2A 4RW5A 1KFJA 1M53A 1BGGA 2Q02A 1UP3A 2XH2A 5FJOA 3LCHA 4AXKA 2OVLA 4GI4A 5FESA 2BXYA 3GDMA 2ZICA 1YPFA 4JX4A 3U6WA 4RZ6A 4CEUC 3B0VC 1XBYA 3JVAA 1UWQA 2V5CA 2YPIA 2XFYA 2VGBA 2D2HA 1OBAA 3LK6A 4IF2A 4J3TA 3CV7A 4K8GA 4ML4A 4DZIA 1CXEA 4AVOA 4MB1A 3RMJA 3WQ8A 3TTEA 2OQYA 3EX2A 3V5CA 5CKSA 4QJ4B 4LYRA 4NRRA 5F2LA 2Y5EA 4MMWA 1AA1B 4CCCA 3H2FA 3KBWA 2X41A 2D24A 2ABBA 1S39A 3CO4A 1ONWA 4IPLA 3TAKA 3LI0A 3WX7A 4S38A 4DELA 1TSIA 3IARA 2E67A 4IMDA 2NVCA 4GI6A 5HK4A 4D6IA 1PKNA 3HFYA 1HKJA 1OQFA 3NURA 2W27A 3STCA 4W8LA 1LL4A 3B9NA 4GXWA 4HPHA 3UPMA 3EGJA 4LCSA 3OB8A 5A6MA 3V18A 2J25A 3KS6A 2DEPA 4E5TA 5D2VA 3P82A 5JXQA 4IOTA 5D30A 4JICA 2FYMA 3S46A 2B4GA 3M0HA 1QBAA 4UTUA 1W3TA 5F2MA 3OGRA 1EGZA 1XIIA 3PANA 2FHCA 3LPOA 1E3XA 1F73A 4IICA 4Q7NA 5H1WA 3PPHA 2GOKA 1V3JA 2EG6A 4PSPA 3SSZA 3SN0A 4LAOA 4Q8NA 1M7XA 1SFJA 4FX6M 3LBOA 1NP0A 4LQ1A 3TYCA 5FJUA 3EPOA 3KBNA 2QXWA 3GVVA 2V38A 3ENLA 1ZU8A 1E1EA 1UG6A 1QI3A 4Q32A 5DMYA 1FWBC 4WCJA 4IH3A 3CQKA 3LUTA 4UWMA 2VZSA 3HJZA 3LPPA 5HNTA 2YYTA 5LA0A 4AY7A 4UUIA 3LZ5A 1EC9A 2HMCA 3PM6A 3F03K 1B1YA 1C93A 4HYRA 3T09A 2QUMA 3KEHA 1QW9A 3B8DA 2GZXA 2G96A 2FH6A 1BYDA 5M2FX 5CSYA 2OFJA 2QT3A 3K5XA 3EKGA 3TP4A 2CHNA 5T9BG 2PPGA 4A21A 4ILSA 1UZ4A 4W88A 2ZZ2A 3WD4A 4C6DA 4UR9A 3LZ3A 1W5PA 4GXMA 1EXPA 1PX3A 2FGLA 4RNJA 2P3EA 4FNPA 4IUGA 1V7YA 3UYIA 3P5YA 4B9ZA 2UY4A 4GKTA 3W9ZA 3SY5A 1BD0A 1AW1A 1S5NA 4ICCX 1A4LA 4ZFMA 4X22A 2BXZA 5E9XA 1BWVA 3WLTA 3H4XA 2QPXA 2E6DA 1UUMA 4LUTA 4PCSA 3MZ2A 1GWJA 2UY5A 1QU4A 2E25A 2WCAA 4WQ6A 3GY1A 3DERA 2GFTA 1L9WA 1QT1A 3DFNA 3VGHA 5DQPA 1TR1A 3VA8A 3QSTA 1HVXA 3AHVA 4GYPC 2OZTA 4X63A 2A2IA 4R27A 2YZRA 2ESCA 5KEZA 3FLUA 2WBKA 4R88A 3TYDA 1Z48A 1Q3NA 5DT5A 2PLCA 5D09A 4GUFA 5JBFA 4AZ6A 2FKPA 2V81A 2V68A 2X7VA 4JTQA 1PAMA 4HTYA 4ZL1A 4FI4A 1KBIA 1ICPA 2Y63A 1LQ2A 3TE9A 1HL9A 3UW6A 1JDEA 4RE2A 1F76A 4KWSA 2HVMA 1QUMA 3VNDA 3W37A 3F1QA 4B5VA 2FMOA 1CIUA 2WPBA 4GY1A 1XRFA 3BOFA 1KQYA 3KX6A 3DFQA 4CD4A 1GVFA 4MAZA 2C7FA 4CNPA 1T40A 1PXGA 2IKJA 3C56A 4I7UA 1CI1A 2VKZG 3URNA 1JR1A 3NEHA 4EAMA 4UTTA 2XN1A 1I2QA 2ZXAA 2ZOXA 1UC5A 4MM1A 1NF0A 1A5SA 5DMNA 5AHNA 1RZMA 4D6FA 4ZB5A 5HINA 1XYBA 5C2CA 5CZJA 4N2YA 3MB9A 3IUIA 1NOWA 4LB3A 3MMTA 4QCFA 4ZQNA 2QF7A 1ONXA 3GZ3A 4GISA 1US0A 3TCEA 2Z6JA 4GNVA 1TX2A 4A35A 4Q8OA 1K77A 5EMLA 3EX1A 1UR0A 5CLWA 1OK6A 3VD9A 4A2SA 3WNOA 1WNOA 4PYSA 5ENLA 4J5NA 4JFVA 3UZ5A 1GVSA 4MNMA 4J28A 3JRKA 1ISYA 3AUJA 2QF8A 1DQUA 2ZXQA 3G5EA 5CC5A 5LIWX 3WLKX 1ZY9A 4AD2A 5D9OA 1NFPA 4HMEA 2PWVA 4HNVA 3DBPA 4WY0A 4CQDA 4UNKA 3SGUA 3MJMA 1E3ZA 1V3HA 1OGSA 5AC7A 4AY8A 1Z89A 2PB1A 2Y2WA 1DVJA 4KF1A 1NSJA 4FIRA 3T55A 2BSLA 4BJHA 5CXPA 5F4WA 2I1OA 1SM9A 1XYAA 3ANVA 2A6NA 1SO4A 1X1OA 2X7WA 4HA4A 1F5ZA 4OKDA 4YTUA 3ABRA 1YLVA 4HP5A 4BF7A 5K9XA 4YTRA 3U48A 3T42A 1FQ0A 3IS4A 1G4TA 3DUGA 3FDGA 2WSQA 3AHTA 3MCMA 3WDIA 3WLHA 1RP8A 5I5RA 1LLWA 1S2VA 1VLWA 2Q09A 3W7HA 3SCNA 2Y8KA 2PWDA 2V3EA 4DJEA 1WZMA 4US5A 2PDXA 4HNCA 2FTPA 4A8LA 2QCDB 4IP7A 4KCVA 3EBVA 4HTBA 2ZX9A 3H8AA 1XCXA 1CEOA 4MY8A 2NUXA 3AXIA 3T0BA 3AXXA 4S3BA 5D03A 3S6OA 2A3HA 1B54A 1KRBC 2DQWA 2DUAA 3PZGA 4AISA 1KCXA 5JUVA 3NXFA 3LLXA 4HNNA 1ZAJA 2J27A 4IT1A 3OEXA 3RU6A 3RU8X 4WDXA 4MY1A 1O1ZA 1CGTA 4JQ1A 4QJ1A 1MNZA 3LMZA 2A3EA 5T8GA 4ZE5A 1EDTA 3GTHA 3G3DA 1DWFM 1SGJA 1RLCL 1KBJA 2RGMA 1M3UA 5FSDC 3UESA 2J77A 1XP3A 2FPYA 2VZOA 4XBJA 3VNKA 1X6NA 2R8WA 5EB8A 3K1GA 1JYWA 3E2QA 1T8QA 2V5DA 4MG4A 4Q8UA 2I56A 1I6NA 4YYCA 3TDFA 3UG3A 1QOPA 2QVHA 4GINA 5HQEA 1KFWA 3M0LA 3N13A 1BLIA 2E6FA 4S3CA 1NDYA 3TYAA 1NOFA 1UA7A 2CFFA 1I0BA 4TX6A 3LRKA 4RZ5A 5CC7A 5EMJA 5HJXA 2W92A 1EJVC 1GJUA 1ITCA 3G1AA 3BLIA 1Q7ZA 3SZ8A 4E3VA 1OFBA 3TXZA 4LF1A 1Q6GA 2HWGA 3I7SA 3MKVA 2X09A 2CZ5A 4P61A 2BY0A 3RO8A 1IZCA 3IVTA 3GZAA 9XIAA 4DIAA 3PB2A 3GKAA 3PAOA 1W9PA 3SW6A 3B8WA 4E6MA 1VS1A 3BV4A 2IUZA 3UWQA 4TVCA 2HPMA 3VKJA 2QMKA 3W1XA 1YTDA 2ON3A 2PBOA 4QJ3B 3BCDA 1O66A 3TZNA 2C15A 3L4ZA 3VCNA 1M68A 2OO0A 1ECEA 2FZ8A 2GJNA 2QJGA 1ZGDA 3KOWA 1TV2A 2DZPA 1VPYA 2VC5A 1JI2A 2QAFA 1O94A 3VINA 3F5KA 3EWWA 2A21A 2GVLA 2QHAA 2TMDA 2VJXA 3U9IA 2FGZA 5AHMA 3H54A 3Q2DA 1W1IE 3ARZA 4DAIA 2WMFA 2DPEA 1QNOA 3DGBA 1OYAA 4J3VA 3S9IA 2YL8A 4DJFA 1SVDA 4MZ8A 1L6GA 4IP5A 1BVNP 1EKOA 1R9ZA 5BYWA 1E6PA 1IYXA 3W25A 1F7BA 1Z69A 4E4UA 4MWAE 2C0HA 4UZSA 3W1RA 3QZEA 1M41A 5CGQA 1LYXA 1DIOA 2OQLA 5J8LA 2ZIDA 1IIGA 3HQOA 4XISA 2J47A 2F2HA 1F8IA 1V0NA 4YTQA 5C71A 4ENLA 3DC8A 2E8ZA 3SCOA 4AHOA 1KRCC 1IHIA 2HK1A 3W26A 1VBRA 3EWXA 3W2JA 3LHTA 4Y6GA 1FCUA 1GQIA 3N6JA 4I6VA 2PCEA 3OLDA 2HRWA 2WYSA 4Y9OA 3ZR4A 3MKCA 3TK7A 1KV8A 1OCJA 4A29A 2I5QA 2X1TA 3BAKA 4JX6A 1Q6LA 1L8PA 3CT7A 5EBAA 4EPKA 3MP4A 2PF0A 5G4WA 3ANYA 4NJJA 9RUBA 5L9FA 4UOQA 3NVTA 3VUSA 1KFCA 2WSRA 2D20A 3NGJA 1TPH1 1OZQA 4YYFA 3FA5A 1MQRA 1BF6A 3G6MA 5D9PA 4C5YA 5DMLA 5C0QA 3NG3A 4JOMA 5FAJA 1XI3A 1V0MA 4PZVA 3ONBA 1LBFA 3GIYA 4LVAA 1J9YA 1EC8A 3FN9A 2BS9A 2IQ0A 3DH7A 4LYKA 3W2MA 3QOMA 3AYTA 3UT0A 2O9OA 4U2ZA 5K9DA 3LCWA 1TJ0A 4CKQA 4QHRA 4XAGA 1EBHA 3M5VA 3WJXA 3VD7A 3WF2A 4HPNA 2ODOA 6REQB 2DORA 2QV5A 2WM0A 4H4IA 8A3HA 4NZFA 1W56A 4RNIA 4X2RA 4H00A 5D37A 3BUVA 3RM4A 1IXOA 2YB4A 1OIFA 2QDEA 3TLLA 1I1WA 3D47A 3EOEA 1PBGA 4F2TA 3PUOA 1JPIA 4K3ZA 1TCMA 1W9XA 2NV2A 5BMXA 1QWGA 1Q6QA 1UR2A 3N2XA 4BWLA 5ABGA 4ROQA 5DMMA 3VI2A 2W6RA 5E6YA 2RDTA 3GVWA 4LY8A 4EANA 1RUSA 4JYDA 3O07A 3KOZA 2OT0A 4HNTA 2V0TA 1Q2SA 3WZ0E 4GQ0A 3DDMA 5E6ZA 4C7FA 3HGOA 1AFSA 4XUGA 3TWBA 1NY1A 2VC9A 3SB0A 3KRUA 4FLQA 3UCDA 2DIEA 5AHFA 5U7SA 4HA1A 5HDRA 4L9ZA 4W86A 4DLMA 3PWGA 4LVGA 4YN5A 1K02A 1DORA 4M80A 1L2QA 1TE1A 3IPWA 1AJ0A 3DHFA 3TWAA 3CHDA 4LCQA 3AYRA 5CJMA 3STEA 5JQ9A 4N4PA 1XSIA 3EWZA 4DF1A 3A12A 5A6SA 1YNYA 1FCVA 3PZOA 4W4QA 5D2XA 1YNQA 4OV9A 2CEQA 4PEEA 2CIPA 4FNQA 1CGWA 3EOSA 2NXHA 3EDEA 3CHCA 3GHTA 3TMLA 3C2OA 2BVDA 3PUGA 3REQB 4EE9A 5FCZA 3AU2A 1IXQA 4AWTA 4WOZA 1BXBA 3GDKA 3N73A 1LQ0A 3WNPA 1VYPX 2RDWA 1JFXA 1W1TA 4NF7A 3S5SA 3ZOAA 5EFFA 1C7SA 1ECQA 1QBBA 4J7RA 2P8BA 4E8DA 1BVZA 3QW4B 4F3HA 2XVGA 4PMOA 1X8CA 4NYUA 3WLSA 3NM1A 4DPPA 1Q6OA 4Q33A 2P0OA 1ZCOA 3AIQA 3DGRA 4I9AA 4Z08A 5PTDA 1J0HA 1U30A 2XSXA 3TA9A 3DAQA 3S9ZA 2VVNA 3DKJA 3GBEA 4O12A 2OQHA 4ZQCA 1QWKA 3IRSA 1MYRA 3B9EA 3C52A 3GH7A 3UXAA 2VEFA 4E8GA 2O55A 1OF6A 2DW6A 3TOYA 5HUPA 4UMBA 1W5NA 3RPTA 1OX4B 4F0RA 1BYCA 1K4HA 3PUDA 4E3TA 1RJQA 3L0NA 3TYUA 2FFIA 3LV6A 3OZYA 4RX0A 2J7EA 1YBQB 2ZDRA 4TV6A 2REQB 3A47A 2WZTA 4JQAA 1MZHA 3V75A 3O63A 4IQJA 4LOCA 3TJXA 1YXDA 3D3FA 1OG6A 4GUHA 1B3OA 1HO1A 2OYMA 4XAFA 3WFZA 5M5DA 3W88A 4HSOA 2ZWZA 4UXDA 2JKPA 2ZRWA 4BF9A 2QQ6A 4PTMA 1XFBA 4YNGA 3GTXA 5E5CA 3SCPA 5I79A 3MT1A 4TO8A 3QF0A 3VNJA 1JDAA 4XO7A 3ZVIA 4Q4PA 1E0TA 3CEUA 2INEA 1V93A 2NWSA 3R12A 4M1RA 1V3MA 4AD3A 2AQWA 1CENA 2FB3A 4O1FA 4GE8A 1K7FA 4NG3A 2ISVA 3SIMA 3TQVA 1KLYA 2GWNA 3ZJKA 1Q5MA 4KEVA 4A22A 2WHLA 2X1IA 1E6NA 5AECA 3BK0A 1VBGA 3LNMA 5E9AA 1HVQA 1XUUA 3LDVA 3UGRA 4JGDA 3UXLA 1W32A 4XD5A 3WK0A 1PO9A 4QIUA 4QS6A 1S5MA 1WDPA 2ISDA 2HS8A 2ZADA 2ZQ0A 1O60A 4JKLA 3H2OA 3UYCA 3O9NA 3WBAA 3T1GA 2A85A 4JTDA 3CQ0A 3NDYA 4IPNB 1HJWA 4LVBA 1RQEA 3ARPA 4H7ZA 4F0SA 3LTSA 3AROA 2AL2B 3EEZA 1U1UA 4M6QA 1E9IA 3WF4A 4QAIA 1GOXA 3W75A 3LGDA 4S1FA 1KWKA 1P7TB 2PWFA 3ID7A 3TR9A 3L67A 1EZ2A 5I23A 4V2XA 1GEHA 5A2AA 2GQ3A 3CYJA 3B0XA 2Z26A 1XGDA 5LNRA 2G8ZA 4O0KA 3THAA 2X8RA 4UFLA 5I06A 4ZSTA 3EPMA 1EA0A 1FA2A 4QLJA 1KXQA 4O0QA 3VX1A 3GYCA 3AMCA 1M03A 4YJ5A 2BVYA 1KLZA 1VFHA 1Q45A 3H26A 4IPIA 3DFTA 3MMUA 3VVGA 2OWXA 1QASA 1GZGA 4JY8A 3W07A 1OFAA 4MWAD 5IRPA 2VCBA 1VF8A 3MCNA 3BMWA 1JULA 1C9DA 3GFYA 4WEVX 4GFIA 4W7VA 3N15A 2ZTJA 1GVOA 3BSHA 1ML1A 2PP3A 3WEMA 1YBQA 4BR1A 3SJNA 1JRBA 3QQ1A 3M6DA 2WO5A 2BHZA 1EF2A 1XRVA 1PUDA 5I3GA 1VH7A 3EXRA 2Z7GA 5CC6A 1GYMA 4DBDA 4H6RA 2DVTA 3CL7A 2GL5A 2UWFA 1UZHA 2PLKA 2VDHA 4V1XA 2X0YA 2NUWA 1TTJA 2ZCGA 4OTKA 1UWRA 5I3HA 4DXKA 2NW0A 4BA0A 4M6UA 1W8SA 2PWGA 1QK0A 1BSIA 4PA8A 4WK9A 4C6OA 3V0SA 3RCNA 2DT0A 2XG9A 1MMFA 4JXCA 3GVRA 3VKKA 4D6CA 3N4FA 2WSPA 4GLEA 3QV7A 3RX4A 3M0VA 6CGTA 3GDBA 3KBSA 4MYXA 1MFVA 4X0NA 1R9XA 4QROA 2E28A 2HXUA 1JVNA 5T9CE 2XIQA 1UIOA 4DYEA 1XD0A 5C8BB 3GK0A 1QOXA 1BAGA 1W8GA 1EA9C 2Y7EA 4ZZ9A 1JDCA 3CLWA 3F4NA 3AHYA 1Q63A 2BGNE 5MKGB 2CXEA 1VAHA 3MSYA 3JZUA 5FJTA 4IXXA 4JN7A 3L12A 3T4CA 1OFRA 4RZBA 1DJIA 3K4AA 4FX8A 2DZXA 5D2WA 5F2IA 3WJZA 4UTLA 4UQBA 1YIXA 5A8OA 2E77A 3D3AA 4HZMA 4OUEA 4GIRA 3OG2A 1PS9A 1M01A 3THUA 2WLZA 4NJKA 5DRCA 4GGBA 1Y5VA 1ZBCA 1X7IA 5G1YA 2WMIB 3RX3A 2EJ1A 1VFSA 4GKLA 3S0CA 4X9SA 4R9XA 2ACUA 4JTFA 2BODX 1EHAA 4X61A 3UWVA 3R4IA 1T7LA 4Q4KA 1XICA 2OEJA 4F79A 3VGFA 3MCOA 4B3KA 5RUBA 4IQEA 2F6UA 2H9AB 4FR1A 1QNQA 3TLQA 4XTDA 1YPIA 2PDLA 4JKKA 2HVNA 1H41A 4M81A 1FBAA 3IJIA 3ERPA 3D5HA 3IIPA 1ADOA 4JZ5A 4FP1A 3ABOA 3E6EA 1A80A 3LN3A 4O11A 2PDBA 1R85A 2R1KA 4HZ6A 4KMQA 4EPBC 3QVQA 4HU4A 1G7VA 2W9MA 3VKAA 2F6XA 2XIIA 2XVPA 3SQMA 4N6FA 2VEPA 4K37A 1UYQA 1TIMA 2G3JA 3T0AA 1UKPA 2QUNA 3QHMA 2X2YA 3LS9A 5ECVA 3SDOA 1T41A 1THFD 1J79A 4PCFA 1RPXA 3A3XA 3KP0A 3PULA 4DXXA 1SZFA 4QISA 1G1YA 4IP4A 1HKVA 4UTTC 1YDYA 4FALA 3AS2A 4GXPA 1QTWA 4F0KA 4ZOAA 2XINA 4MWAA 3BCJA 4O10A 3LD5A 1IV8A 4W9TA 3HG2A 1ZJAA 1SO5A 1CLXA 1H61A 5I78A 1MEHA 3LM3A 5BZAA 3LHYA 1TG7A 3PJTA 3VNZA 4GYKA 3R79A 1UASA 2DZBA 2J8TA 4JTTA 3AIBA 4WSJA 4JTAA 4NU7A 3KP1A 4M6VA 1IWAA 1Q66A 3OLEA 5JBEA 3J7HA 2UV8G 5I03A 4JHMA 1KTCA 2VFHA 4JTCA 2F84A 3WYZA 3RNDA 4O1BA 4AZCB 4HJFA 2JF6A 3PF3A 2VX4A 4QLLA 2VRQA 2DUXA 1B3ZA 3UR2A 3DEQA 2AKZA 4NRSA 3SUTA 1X7FA 4LNCA 4XUYA 1JAEA 1E71M 2D3NA 3TR2A 1IZJA 2QIWA 3HTWA 3QYQA 3SBFA 4A8NA 1RD6A 2Y88A 4CCEA 4H8VA 1G01A 2PP0A 2TPSA 4NXSA 4GGHA 2ZRVA 1XLDA 4UC5A 5LGXA 1VCVA 3P3BA 4F0HA 1PIIA 5A6AA 3GR8A 3H2AA 5HANA 1ISVA 1MEIA 2YCEA 4LV4A 1FKXA 4Z0SA 3ITOA 4QG6A 3KRBA 4RPPA 1VPQA 1VENA 1HKKA 4D6DA 4IMCA 2ZRYA 1SMDA 3TJIA 2XSBA 1HJQA 3S1GA 3S1VA 4KFOA 5KZ6A 3MJYA 4O18A 3N34A 2FHBA 1DEDA 3C2YA 1TE6A 4YPJA 3WD3A 4MOZA 3PTKA 4EIVA 1JCJA 4HHHA 2OEMA 1C29A 4D2JA 1B3WA 3OZMA 3W2LA 2VQUA 4ZOEA 3HG4A 3GUGA 1UH4A 4FXFA 1KM5A 3H12A 3NPWA 1SR9A 3I4EA 5H2ZA 1JUBA 1EYEA 2MANA 1XG4A 4KS0A 2GSHA 3ZS4A 4EPEC 1XLAA 4MB5A 1JYXA 3SQSA 2DQXA 3SN1A 1X97A 1OFQA 3NM3A 4IISA 3HPZA 1D7KA 1KFLA 4OBTA 2Z2BA 3RLHA 3CL8A 2Q01A 1B3YA 4Z2IA 1N8WA 3DIPA 2VELA 2V3DA 1POKA 2ZVRA 1XH0A 4PMJA 4H6QA 5HJYA 2ZYFA 4LUSA 1LBMA 1ODZA 1UC4A 1U22A 2I7GA 1E1FA 1XBZA 3VDCA 1P0BA 3STFA 3LGEA 1EDQA 2QUVA 3CWHA 4GYJA 1FWSA 1W5QA 1LG2A 1Z9AA 4LU0A 4GIYA 1WDRA 1Z32X 4QRNA 4JN8A 4X9YA 5I3KA 3S6TA 3ARQA 3EDJA 3GFXA 2WHJA 4L1GA 5H6HA 3IK2A 3WO8A 3ABXA 3C2FA 4PTWA 2Y89A 4LVFA 2AL1A 1QO2A 1I0DA 4QBXA 1VEOA 3LI1A 3N2MA 2PDFA 5CPTA 4HMNA 3L68A 1TV8A 3HBLA 3RIKA 4YU1A 2J75A 2A5HA 5TF0A 5A6JA 1NH6A 2ZVIA 4PMYA 2QUTA 1XPYA 4GI8A 2NV9A 3MTWA 4C6NA 4C6BA 1F6YA 4UTFA 3BW2A 1VHCA 2PRLA 4FO4A 3P5ZA 3NQDA 4DWSA 3LHWA 2XM1A 4HU0A 3BLFA 3KL5A 3B8TA 4NSBA 4E2BA 2NQ9A 1FHVA 4TMCA 5JH1A 3GXNA 4Y9AA 2WNNA 4JX5A 4S3EA 3ZIZA 1B90A 3O0FA 1E15A 4DBUA 3VOIA 4FNSA 3CEPA 1MRQA 1CYGA 4PMXA 2KX9A 4AVFA 1Z7AA 3E2SA 4DM2A 3URQA 3JS3A 2W3ZA 2OMAA 4DBEA 4C6CA 1IZKA 2E9BA 2XFFA 4D8LA 4B9YA 4EACA 4PR4A 2JGYA 1RALA 3A3WA 4PEKA 2OGYA 2VC7A 3BANA 3AXKA 1W3NA 3GX9A 4FIQA 2DUZA 1VFMA 3WQDA 2EGZA 4NAFB 1KGUA 5AVHA 3B9DA 1TVPA 4O4WA 4ZA0A 5BOOA 3HN3A 2A6LA 4DRSA 4IX0A 4LAZA 3ZMRA 1UOZA 3VD4A 2J13A 2V5BA 3GXFA 4RDZA 3QMRA 2Y5SA 1OVDA 1NF7A 3T6CA 1OZMA 1ZQ5A 2H8ZA 4IL0A 4XVDA 1I4NA 3SR7A 1AK5A 5A6BD 3CTLA 1Q7QA 1S1PA 1GGOA 1B57A 4UMCA 1WA3A 4W87A 1LG1A 1SO6A 3NFUA 4RCXA 4D6JA 3A4XA 2L5HA 1BRLB 5GNZA 3GM8A 1TQXA 1HL2A 4N7QA 1FP8A 1UWTA 1CGXA 1LORA 3L4YA 4DO5A 1QPNA 3HIJA 1BSLA 1QHOA 2E3ZA 2BX7A 4RKAA 4OHQA 3P2VA 5EKYA 2YDQA 5L6UA 1DJWA 1OINA 2DT2A 2VRKA 3CAWA 4PUDA 4R7OA 3HGSA 1JUKA 1R30A 4JQ2A 5FL0A 1IR1A 2J7FA 3GS6A 4X60A 3CUXA 4Q8MA 1I1XA 4A05A 4IQDA 3GXTA 3P8JA 3WF3A 4WJEA 3G77A 2YSWA 1TWZA 4P8UA 2BB0A 3PC0A 2J6VA 2OSXA 2VP8A 3MDUA 3F5JA 4C6MA 3R8GA 3D6NA 3M5ZA 5E0FA 2AQVA 2C1GA 5AKQA 3QGKC 5CZKA 3KW3A 3E49A 1J8VA 5M3WA 3PBUA 1ITQA 5I6SA 4EXAA 1IWBA 4K1GA 1OCQA 4TTUA 2CZFA 4XSLA 1YQ2A 5HR6A 2DZAA 3LGGA 4JDBA 3BO9A 3LENA 4MPQA 2NQHA 4QNEA 1GYNA 2IKHA 3UZXA 3LCLA 5KINA 3H7UA 1M1BA 4LB4A 2OEKA 4ROPA 5ABHA 3HQNA 4HN8A 3AMGA 1FWFC 4FZIA 4FLOA 3EX3A 5D33A 1A5MC 3UD6A 3O0KA 1W31A 2E09A 3M47A 4V28A 3APYA 3UA4A 2QAPA 3H7RA 2Q8XA 5K4XA 2QJNA 2QCMA 3NO3A 2V2DA 3MUXA 2OX4A 5CEWA 3QMSA 2V8ZA 4KWWA 2PRHA 1NFBA 1B9BA 3R58A 2VD9A 3KCOA 1W5MA 3VGDA 3UY7A 2PTYA 3WD2A 3NDOA 1ITXA 2XHYA 4FF7A 4CN1A 2WSYA 2CESA 1R3RA 2LLEA 1BYBA 3BSMA 2FJKA 3EWCA 2CBIA 1GVQA 4JTSA 5G1TA 4GC4A 1VYSX 2IS7A 1JQXA 4XIAA 2PD9A 1SJCA 3TCSA 4X2PA 2XUCA 4XZLX 4WGXA 3E5BA 3UA3A 2YBVA 5I2UA 1DYSA 4QM1A 3TC7A 3TTYA 2HDJA 1Y0EA 2J62A 3E74A 3WQGA 4ZO8A 3PJUA 3V35A 4UQDA 2ALDA 1OGBA 3MUIA 5HA7A 2BNJA 4BS0A 3LHUA 1UUOA 2YLLA 3W7LA 5K3VA 1FH9A 2E40A 4RLIA 1TR9A 1IE7C 4HOXA 1VLIA 1CXKA 2ATMA 3QY7A 3RLUA 2BHUA 2YFNA 2VFDA 4KCWA 3H23A 1XLHA 3R6IA 2VEKA 3LXBA 4Y2WA 1V77A 3W2KA 3WJSA 5HWMA 1EUNA 3S5NA 2I5GA 1EZWA 3TN4A 4HBKA 3W71A 4I9JA 3BC9A 3MMWA 5D8ZA 4XIMA 1XINA 4LAUA 4HK6A 2VX5A 5D8WA 4PUKA 4U5KA 3IVSA 3DKLA 3BAJA 4XD3A 4AY1A 3CWNA 1H7XA 2F38A 1ELSA 1VBHA 4H9ZA 2DV0A 2OLHA 5CSRA 4C7GA 4HCDA 1DWIM 1TTQA 2V3FA 3PTMA 2PURA 2Y70A 1V6TA 1WXYA 3AAMA 4PRTA 3AI0A 5AC5A 1VKFA 3CO8A 3PSVA 4DWDA 1F3TA 4M51A 4K7YA 3UXDA 1CB7B 5F7UA 3UJSA 1MFUA 4HMCA 3H21A 4PMRA 2J24A 4LANA 1UUQA 3TNBA 1NP2A 4HMDA 3HOJA 2BOGX 4U10A 3B3DA 1DJYA 3VNLA 3PSWA 1V3KA 1W1B1 1IXPA 2RDUA 4UIOA 1H7PA 4OBRA 3PG9A 2JKAA 2XVKA 3MVIA 3UWEA 3LQGA 5A6LA 4S2CA 4ATLA 2O92A 1CT5A 2I9EA 2PU0A 1PKMA 2CZVA 3T44A 2IW0A 2CITA 2QCNA 1AMKA 1CXLA 4OUIA 4U4MA 1UZDA 4KGLA 4KT2A 2DZWA 1SO3A 3VE7A 2ANUA 2HE8A 1XD1A 3WK1A 1QNPA 4KEZA 5HUOA 3WEOA 4BQ3A 5TBOA 6ENLA 3XINA 5KITA 2YCJA 3IJLA 1KTNA 3MSRA 1Q4WA 3SIZA 3QEZA 1WKDA 3GU9A 1DJQA 3L9CA 2E4TA 3OVGA 3HV9A 3NO1A 1CXIA 1SR0A 3LB0A 4QQUA 3KZSA 2OWWA 1OFDA 1YE4A 1TVLA 2PRMA 3C6CA 4MHBA 1PZ1A 3O05A 3IAPA 1J5TA 4G56A 1S2WA 1OHLA 1FDJA 1O5KA 3OU8A 4UOZA 1LOSA 1FKWA 1J12A 1H1ZA 1VEPA 3ZJ8A 1R47A 2PDYA 1GOQA 1RA0A 3KFTA 3OG3A 1V08A 1XLJA 4FXJA 3RG6A 4R9OA 4NX0A 4H3DA 3W7QA 3UG8A 1GKRA 5AYYA 4RDWA 1TPB1 2G0WA 3W2UA 1AZ1A 2WVSA 1KW1A 3CZEA 4MADA 2EKCA 4L80A 2BBFA 2FQIA 1VZWA 1PHQA 5A6KA 2C13A 2QR6A 4DUVA 1U2YA 1WOAA 4Q8WA 3GR4A 4YHGA 2V2CA 2NQZA 4HGXA 3G18A 4QEEA 1XLKA 2C16A 2DSUA 4E2VA 3N25A 3FX4A 2C91A 2ZC8A 4A3UA 1ZCCA 4IJBA 1O12A 4EPDC 3ANUA 3VILA 3GE7A 5DCBA 4ZQPA 3QR3A 1UR8A 2QUUA 1HJUA 4H19A 4NI3A 4NZ5A 4ZQOA 3RK8A 3BZJA 1A0CA 3NA8A 1SMAA 1Q8AA 4GH1A 3ZO9A 3KLLA 2D2JA 2A7RA 4H2HA 2OZ8A 3CIVA 1MXDA 2WOQA 4W93A 4K6AA 4ZQMA 1U5VA 2FVKA 4YTTA 3QMTA 4QFUA 3S2CA 4DJED 1F4HA 2WB5A 1PDYA 1YDVA 3SCVA 5B7ZA 3K8MA 2HPIA 2YLAA 5FKYA 1JPDX 1VBUA 3FJLA 1R7OA 4PTVA 3K4DA 2ZDSA 1TPWA 3GDRA 3NOYA 4FX7A 3ONCA 2X05A 1P5BA 1W6TA 1E70M 2RJGA 5H8PA 3VFCA 3HGRA 1OGGA 2E6YA 3ZZ1A 1E1CA 2ASHA 1UPPA 5D04C 1GQNA 1LM1A 4H7VA 1E72M 1GUVA 2C1IA 3W3OA 1W1ZA 5CPNA 4PCPA 1HG3A 1EEXA 1ZALA 3FOKA 4A8RA 2JQXA 5TAOA 2HEJA 1O7AA 1O5QA 4NNBA 4DLFA 1HP4A 1X98A 5A8QA 5M17A 2OGJA 1KA9F 2VNCA 5LIUX 1UROA 1UD3A 2NX9A 1TPUA 4P8VA 4JHOA 3AWNA 1DJGA 4EWJA 4DVOA 4FAMA 3R43A 2VQTA 2PA6A 1XPGA 3HQ1A 4S3JA 3PZTA 3KVKA 5KTLA 4A2RA 2NUYA 1XBXA 4QDMA 3WBEA 1R9YA 3CUGA 1XF0A 2R9RA 5FJJA 3VO0A 4PFMA 2NT1A 4GH3A 1LJYA 3RAOA 1PZ3A 3CMJA 3PR2A 2ALRA 3RM9A 2QCLA 1EIBA 1BVWA 4XQ6A 3WH7A 2OLSA 3NSNA 3L2LA 1JIBA 3P6LA 2WQPA 4U3AA 3GYEA 1NU5A 4AB4A 1E5NA 3S5YA 3FYPA 2AOSA 1JZ5A 5CAKA 2QW5A 4KQNA 2X40A 4H9XA 3W7JA 3W28A 3S5OA 4CVUA 5CLTA 2AGTA 1W1PA 5K2ZA 2RJHA 1PWLA 3CLMA 4IMAA 1SQ7A 4EVZA 2BMBA 1XGZA 1D7FA 4QQ3A 1SPQA 4KRZA 1XR2A 4FXSA 2GWGA 1GJPA 1G4SA 3UWWA 4ACZB 5D9NA 4AYSA 3QBUA 4BK9A 5EMUA 1LROA 3AMDA 3WH6A 5HR7A 1BQCA 1J0KA 1WKFA 4LGXA 2OT1A 2WNWA 1DTNA 4XZHA 3IGHX 3S42A 3FNDA 3PP7A 3CV2A 2PP1A 3RR1A 2Z1BA 2P8CA 7TAAA 1W37A 3VIHA 3U4FA 3FA4A 5H8UA 1XSKA 3WKZA 4YL2A 1YPXA 4W5ZA 4DBSA 4O0ZA 3GU1A 4REQA 4R34A 5FJPA 2NQJA 3FJNA 3DG7A 4DF2A 1QVBA 4Q4MA 4M29A 4ZVJA 2YXOA 3AFBA 2AGKA 4UQCA 3NPUA 3SUUA 3V5OA 1PV8A 1RAKA 4DJDC 3PJXA 4YS1A 1H5YA 1PE1A 2V6AA 1G4EA 3FKKA 3DESA 4FB7A 1IXNA 1QI4A 2GVYA 2QJHA 3SEPA 2CNCA 5DBUA 1A3XA 4HN4A 3M46A 4P7OA 1LBLA 3EX4A 5AC8A 1BTMA 1OT2A 3IK4A 2GGGA 3C4UA 1E5JA 1KCZA 2EPHA 2CLKA 4PMDA 5C9ZA 2HBXA 4K2SA 3BZGA 4JIQA 4ERIA 1HN1A 2I5IA 3WLPA 2I17A 1A5OC 4GACA 1N8FA 3USZA 3KVLA 3CZJA 1IGSA 1DP0A 1EWDA 3DHDA 1C90A 4WF7A 1FWGC 4AD0A 2WC4A 2A3LA 3DECA 4PB3A 2IXUA 1XYMA 1NOUA 2P10A 1IIHA 5HXMA 3WJYA 3SN4A 1EJ7L 1DIKA 2EPNA 5EPDA 3TSDA 3W7DA 3M5YA 3R2GA 3H6OA 1HJVA 2WMHA 5FACA 3HPFA 3AIVA 3TV8A 2C0AA 3QGAC 3DFPA 3N3TA 3RILA 3T2QA 4WZHA 2Z00A 2BY1A 3HURA 1U83A 3FJ4A 3GTIA 1G94A 3IVUA 1N2VA 4QAWA 3NVDA 1OG0A 3W01A 1J2WA 4LUYA 3M0MA 2Y0FA 3GLCA 4JTKA 1QNVA 2NWRA 3DC0A 3K46A 5FI8A 2XWEA 5HAOA 2CPUA 3KRSA 2P0IA 3H4GA 2GDVA 4YVXA 3ZR6A 1BKHA 2QULA 3LHVA 3UPBA 1K8ZA 1T0OA 4UFHA 2E68A 4Q8QA 3CUIA 2XH0A 1HIZA 3R10A 4H41A 4NIRA 3UWZA 4D9PA 5LZLA 3A22A 3N2OA 4QDPA 1Y5WA 2I9UA 2ZX5A 3W38A 3VX0A 1XLIA 1LZOA 3OLGA 3EKLA 3TSBA 2ZUMA 3KVJA 4Z2KA 1XYZA 1UD4A 1PEZA 2XYLA 3KDNA 2Q3OA 1WXZA 2XVNA 4LUIA 2CWXA 1H09A 3FAXA 1FH8A 5MHBA 3IWPA 4LVDA 4HU8A 2P1FA 5C70A 1EL3A 2OB3A 2CBJA 3CMGA 1V6VA 3L4VA 3PBGA 4MPKA 3WCZA 2BHYA 3GBDA 2BY3A 3KRZA 3HB9A 4NL1A 1HX0A 1A5KC 1BWLA 2QGHA 3RR4A 3EAUA 2X2GA 4HJWA 4GY7A 6A3HA 2VR5A 1JI1A 1JXKA 3HO8A 3BGGA 3FIGA 3BGAA 1P1MA 3THDA 2EBNA 3QV6A 4LUTB 1XG3A 1A5AA 3P84A 3IJDA 2WVUA 1GVYA 1OFOA 2OSYA 4Q8PA 3NIYA 4I8YA 4ERGA 4N4QA 3UWUA 4C1LA 3GU2A 4O13A 3GTFA 1J5SA 2PC4A 1W3HA 2DJXA 1ONRA 3VIGA 2GVGA 4MZ1A 4BKNA 3L65A 1SU5A 4D8ZA 1UP2A 2JFEX 4IGSA 4ZO6A 2YZ5A 1A5UA 2YCLB 3GAYA 5E0KA 5I09A 5FEPA 3BSGA 2D0FA 1LUCB 4ZEPA 1NWTA 4M1BA 3M41A 1IT7A 3VDHA 2ACQA 6REQA 3TROA 2CKSA 4PULA 2CHRA 5A6BA 4J2MA 5EMMA 3BLOA 3W1LA 1RSCA 1MW3A 1HGWA 1YTKA 3B0YA 1W17A 2OO6A 1SFTA 1TZ7A 4JFUA 2NVAA 3EB3A 3W86A 3FA3A 2XFRA 4XO6A 5IFTA 1VCFA 3I6TA 2FZMA 3OZPA 2PSNA 3S83A 5E70A 2YCIX 5FEXA 1QATA 1VGAA 1XIBA 1OT1A 1WE5A 3E02A 4W7WA 5KZMA 3PZUA 5AYXA 2ZZ4A 4W7UA 2Z7KA 4QE1A 5C9WA 3C0JA 3DI1A 5DY2A 4G7EB 4LWWA 2A3CA 1YTEA 1FXPA 4C60A 4CQ8A 3EXTA 3QH2A 5IFPA 5FJIA 3ME3A 2OG9A 1TREA 3B9OA 4JCLA 2C8NA 1AW5A 4JKMA 1RBOB 2WZHA 1MNSA 5BU9A 2SFPA 2CYGA 1VPXA 8TIMA 3LV5A 5JVLA 1KV5A 4MB3A 3VKCA 3CIXA 1XM3A 1TTPA 3N18A 4L56A 1H0IA 1F2JA 5DY3A 2ZX7A 1SSDA 4I8DA 5F1UA 2DT3A 1V6YA 1VRDA 4ZODA 4XAZA 2Y7FA 4UQAA 3TTQA 5HNRA 4YCPA 1V79A 2OOFA 4WOQA 3NCOA 1M7JA 1X6UA 1E43A 2NLIA 3UU0A 1XLGA 1YW1A 4INFA 4A3QA 2IPGA 2EJAA 2ZTKA