4FOUA

Structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
b'IYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structure of the PilZ-FimXEAL-c-di-GMP Complex Responsible for the Regulation of Bacterial Type IV Pilus Biogenesis.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Protein binding/membrane protein
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4fouA00
3SY8A 5MKGA 4ES4A 4F48A 3GFYA 4AG0A 3KZPA 4FOUA 2R6OA 3PJWA 4F3HA 3S83A 3PJTA 5MKGB 4KIEA 5MF5A 3PJUA 3PFMA 4FOKA 4HU3A 3HV8A 4HJFA 4RNJA 4LJ3A 3GFZA 4Q6JA 3GG1A 4J40A 5M1TA 3GG0A 3PJXA 4Y9NA 4RNHA 2W27A 4RNFA 4HU4A 4FOJA 3N3TA 3GFXA 4LYKA 3TLQA 4AFYA 4Y9PA 4Y9MA 3HV9A 4Y9OA 4RNIA 2BASA 4Y8EA 3U2EA
chains in the Genus database with same CATH superfamily
1AW5A 2AL2B 2VP8A 4QQUA 4AUBA 4P8VA 4O1AA 5I02A 4WGXA 2G4FA 2R82A 2JF6A 1OFAA 3A5FA 5G4EA 2OSXA 5KZ6A 1LUCA 2XIIA 3FAWA 3TTOA 4B5NA 3EWDA 1W1YA 3W1AA 3H2MA 3G5EA 4K1WA 1Q6CA 2UBPC 2VUNA 2VRJA 5AN7A 3T05A 2D2GA 4I8YA 4OWGA 3TYBA 1J0HA 2IPFA 5AZ0A 1E56A 6A3HA 1YBQA 3UETA 2PP1A 2PBOA 5LNUA 3QH2A 2EAWA 3W22A 2Y8KA 3OG2A 1CT5A 2V67A 4CU7A 3WFZA 1J10A 2GUBA 3G3MA 4GY7A 4Z2IA 1TPB1 3BPWA 4PCFA 2R1LA 2FH6A 1XL9A 3CTTA 5GNYA 2QV4A 4FZIA 4ZFCA 3SBFA 2DORA 3GR8A 1CNVA 1MDLA 4DWSC 5HQLA 4ZO9A 3LRMA 3LYEA 3GKAA 4O57A 1PKYA 2E3ZA 1RCOB 1F4HA 2OSWA 1AQFA 1HQTA 2ZUUA 1XI3A 1W9VA 4FXRA 3MBDA 1CGWA 4M56A 3L23A 3QKZA 2BG5A 3TXZA 2ZCGA 1IXOA 1VC4A 4QDWA 1QNQA 1PYMA 3UG4A 1ZTVA 3GC2A 1K4HA 2OQHA 2Y7DA 4UR7A 3LCXA 5K4ZA 1ZBVA 3VCNA 3ES8A 5CGMA 4Z08A 4PUNA 1JZ6A 2J47A 3OW1A 4RE2A 2OYLA 5GJPA 2ZFAA 4JPGA 4WDWA 3WF1A 2GK1A 5HWNA 5LGXA 5ABEA 1UROA 4EE9A 5AC7A 4R7WA 1T8XA 2HDJA 1IYXA 1ME9A 3AFBA 3AXHA 3E2SA 1E9YB 3SUTA 3QHMA 2Z1WA 4QDPA 3W07A 3CHFA 5BROA 5DMYA 1GQIA 4IPLA 3FAXA 3RCMA 3DI0A 2PGRA 1AL8A 4IH3A 4N6FA 3BAWA 3EOUA 4O1BA 3JUGA 4AC1X 1XINA 4QLLA 1C9WA 2VX7A 2ZYFA 3C5QA 3NQ6A 3LTSA 4DBDA 1M7XA 2CWNA 3PB2A 4CD6A 1E43A 3SSJA 3FDGA 1O95A 4MADA 3CPUA 4GI6A 3IGUA 4CCZA 1H2JA 1XM3A 1F8IA 4JKLA 3PG8A 4X60A 1SW0A 1HL2A 3EX3A 3F4NA 1WBHA 4GZJA 3G1DA 3OLDA 3B0UX 5FIPA 1XBZA 2BLEA 4HK5A 4Y9OA 1Z9AA 4HIBA 1JNDA 4DNHA 1TJ0A 3ELFA 4US5D 1OZQA 3SZ8A 3O63A 4GCXA 4NHVA 1TJRA 1E6NA 3WLSA 4AWSA 2V81A 3C52A 1HW6A 3MT1A 1R2RA 2CHNA 2ZWZA 4H41A 7ODCA 1D3HA 3M0LA 2VL4A 2W0UA 2Z1SA 3CL6A 3WNLA 3N9RA 1RD5A 1EPVA 2WVVA 4O17A 3HB9A 3ARXA 4MFEA 5IXEA 3MI3A 2PD9A 3PVFA 3AZRA 2QCDA 4IX2A 4LYPA 1K03A 1H4PA 3ZLGA 4UTFA 1CXLA 2JQXA 2YYUA 3HIJA 3WMBA 1GPWA 3NO3A 4KCVA 5FESA 2ACUA 4F0RA 4KIEA 3HQPA 4MUZA 3GU1A 2FZBA 1ZJIA 3F2DA 3V7PA 1RALA 1JRCA 3FJ4A 4WY0F 3SCPA 3S5OA 2VWSA 1G5AA 2X0HA 2IUZA 4EXQA 4Q4QA 2Z28A 4KH2A 3ENLA 9XIAA 4LRTA 3B05A 2FB3A 4QJ1A 3WJSA 2WSRA 1KM1A 3PZVA 2BFGA 4W7WA 2NXGA 4GC4A 5I03A 4DYKA 1FCBA 4XTDA 4WHBA 3L9CA 1W3IA 5AYYA 3MANA 4PRTA 3TXVA 1KCKA 1F05A 4R85A 5HK4A 4GUGA 4UMBA 2X09A 3DFYA 4HB7A 1F2JA 2VC9A 1UR9A 4AZCA 3OYXA 3F2CA 3G1HA 4Q4RA 4CEXC 1TVNA 1FWJC 1ZB5A 4L1WA 1CI1A 4ZB2A 4JFTA 3EZ4A 2ZUTA 3BJFA 2RH9A 3PK7A 2CZDA 1ODZA 2OELA 1NU5A 2ZXQA 3V1HA 3W2UA 1PS9A 4IGNA 3M16A 2CC0A 4LUIA 4HU4A 1MW0A 1D8CA 1VKFA 1L9WA 1KFLA 4UQAA 4OGZA 4AD4A 1RZMA 3UWQA 2FLIA 2JE8A 3QV7A 4IFKB 1VEMA 4MDPA 3WLOA 3G0SA 3TK7A 4J2PA 3BLDA 4LAMA 4BCEA 3ABSA 5FKYA 2CESA 4PL1A 3M64A 2TRSA 5EMUA 4H7VA 2VFEA 1A5OC 3PUGA 1J18A 2G4JA 2R24A 1Q8AA 2IW0A 1C93A 5KETA 4QAWA 3TA9A 5BW6A 2CWXA 3MKVA 4UTLA 1A0EA 4K8EA 4HA4A 2Y61A 1B3WA 3EGJA 1KD0A 2BSLA 1UKTA 3WYZA 4R9XA 5HJXA 1P6CA 4S3EA 3VYLA 2VZVA 4JFVA 5DY2A 2ZBTA 2WCGA 1TCMA 3M9YA 2WJFA 1K7XA 2J24A 3V4BA 6TIMA 5JQ9A 1JZ8A 4AVFA 1XDMA 5ABFB 4LRSA 4UFHA 4HSOA 5FEWA 4XD4A 1AJ0A 1MQRA 3HU7A 4AD3A 3UFYA 1W1A1 1X1NA 4HZ8A 4UMAA 4PULA 2EQDA 1DXFA 3LLXA 3K8KA 4F2TA 3N9KA 4ADUA 2GVYA 2I1OA 1J9YA 4E4UA 3AMKA 3QEZA 2GVLA 1O7AA 1BF2A 3W37A 5FF2A 4MLJA 5CZTA 3RYSA 2YB4A 4FK9A 3B3DA 1CXIA 2IKJA 3PPHA 1W54A 3WEOA 2Z1XA 2PP3A 4JNYA 3M0VA 3THQA 3VC6A 2V5JA 2OO0A 2Z4GA 2XSXA 1L6GA 3KFTA 3T40A 4E8CA 1HKIA 3AO0A 4Y6GA 2QR6A 4A35A 2RDXA 1UR1A 1H60A 5FEZA 3UXAA 1LBFA 1VFUA 2GUUA 4HNLA 5K9CA 2P50A 5DX7A 1XLGA 3EA3A 1VFMA 2NW0A 4R88A 3UP8A 3JRKA 3OJGA 3TTQA 2YDQA 3VMOA 3SDOA 3DYOA 3IIVA 4GNVA 3EXRA 3LHYA 3BLIA 4LNYA 2WZTA 5D32A 3I7QA 4PSRA 5HMSA 5C9WA 5DRIA 2X41A 4O1CA 5FD0A 1IZCA 3AS0A 3CV1A 2C3ZA 1XFBA 1C29A 2XFRA 1WKDA 3Q65A 3WF4A 2ZZ5A 3L12A 3EWCA 3VI2A 4M6UA 4EAMA 4DHGA 4GIAA 4H8NA 3UY7A 1TV7A 4XX6A 3USBA 3W83A 4UMCA 1R3TA 3W7EA 1A5MC 2OU4A 3OHMB 1L6SA 4LAOA 3E0VA 1BTMA 1XPYA 4FXJA 3S5SA 2ZZ1A 5TIMA 1U5JA 1W37A 2Y4SA 4S3GA 4KS0A 1TQXA 1RA0A 3SAZA 3B04A 2Z26A 1X7FA 4AHPA 1UKPA 2NQJA 5HWMA 4PMXA 4LX4A 1BGGA 3AZTA 1NFPA 1AD4A 2V3DA 3GIPA 3HPSA 4PSPA 1OVDA 2Z0IA 2XM1A 1FWFC 4PUKA 3L67A 4KETA 3ME3A 3UF9A 2OYKA 4I8DA 1VYPX 3S9YA 3AS3A 3W2LA 2Z1KA 4FR1A 3TC3A 4NQ1A 1THFD 2FZ8A 4X61A 4PTVA 4DPPA 3N3TA 1DJXA 2NX1A 1MO0A 2SFPA 4IMAA 1P7TA 3NPVA 2E7FA 1QJWA 3BCFA 3DECA 3LGGA 1J93A 2XJ7A 2POZA 4L4MA 3KCLA 4DXKA 4EKJA 4UZSA 3K1GA 4XZ9A 2Q02A 1KWGA 4X9YA 3TMLA 2G0WA 2WCSA 2J13A 1BVNP 5CAHA 3TE9A 2FGZA 3D46A 5FAGA 2I9EA 5J5RA 1KGUA 1XS2A 4UQBA 2V3FA 3T0DA 2ZXAA 3O0KA 3B4UA 3LU2A 3OBEA 1PTAA 4JX5A 3K5XA 1IV8A 3HV9A 2G3FA 3GH5A 3XINA 4W7UA 1SFLA 5AHIA 3WKZA 4O1DA 4BY3A 1UP3A 4RDZA 1E6ZA 1EX5A 2WSKA 4QX4A 4UB9A 4HNUA 4UWMA 1EHNA 4RNHA 5GQBA 3LY0A 3APYA 3LBMA 4L5ZA 3CLWA 3OODA 4J3XA 1EO7A 1UYQA 4GQRA 1ITCA 4XSLA 1O5RA 3SN1A 4DIAA 2DH3A 2VEPA 5H8UA 1TE6A 4NI8A 2PGEA 3B9AA 4NRRA 4TMCA 1OK6A 3H7VA 1ONWA 4M3PA 2QJGA 2EBNA 4A3QA 1IEVA 5H6HA 1NSJA 1Y0EA 3PZGA 1IEXA 5CSYA 5C9ZA 1PPIA 3EA2A 3NR0A 4WIWA 3VOGA 3DH7A 4Y9AA 2XSBA 2RJGA 5F2MA 1UW9A 5IHRA 4KPLA 2O9OA 3GXMA 2FH8A 4MJZA 2C71A 1GQLA 2R94A 2Z2AA 4MIMA 5D9NA 2AKMA 2WANA 1ISVA 3BLPX 3DXIA 4L6DA 2Y70A 1X1OA 1JPIA 2CHRA 5J04A 2C8NA 4LV9A 2DY3A 4XVEA 1M68A 2VGFA 2VOTA 3LNPA 1Q3NA 3MZNA 1OCNA 1GOWA 2ZXDA 1HP5A 1YW1A 3HJEA 1NWRA 2PC4A 3AIUA 4FLOA 5CZKA 1W5QA 2DSUA 1OFDA 3M0YA 1SZRA 3SRKA 3W9ZA 3QR1A 4QS6A 5JBDA 2JFEX 2BX7A 4MKSA 1VB9A 3C2VA 4O13A 4EP8C 4W89A 1QOXA 3L68A 1W56A 2GQ8A 4WR3A 1HKKA 4JKMA 2WC4A 3WQ6A 3WL0A 3OBAA 1Q6FA 4GH1A 3AISA 3NQMA 2QDGA 4Y7EA 2I5IA 3M5VA 1W1TA 3NSMA 4PMJA 2JEPA 4IXXA 3S6DA 3HN3A 1A50A 5AHLA 2VFIA 2WZHA 3MV01 3QZAA 2AQVA 1LWIA 3SGUA 1M5WA 2A6LA 4NJHA 2NVAA 1DBTA 3L4UA 1WKYA 3FLUA 6TAAA 3P82A 4O53A 5HBFA 4UFKA 1KLYA 5F1UA 3C6CA 3KS5A 2DSWA 3RNDA 1BWKA 1GEQA 1XPGA 2Z6JA 4U31A 3QSRA 5HXMA 2WHLA 3M6DA 1C91A 5CH9A 1RK6A 4ZMGA 2G37A 1MXGA 3O6CA 1PB0A 2W3ZA 4C1KA 1E70M 1PX3A 5EA9A 1E0XA 1QNVA 2R1KA 4ZO6A 3SUUA 4XIAA 3VCRA 2PFHA 1M7PA 3EX6A 4DI8A 1MVYA 4KRZA 1N7KA 4H2CA 2PRHA 4DB7A 2CFFA 4X2PA 3LPPA 1ZS2A 1RP8A 3GNNA 3MZ2A 3O6YX 1NAL1 3OBKA 4G7FA 3ITCA 1Y7VA 1K8ZA 3KXQA 1XF0A 4UZUA 1ZQ5A 1JCLA 4A4AA 1GORA 3BCDA 4K8HA 4ZXLA 3HURA 3K2GA 4CQBA 2WHJA 3EXSA 4RKAA 3S2LA 2QPSA 7REQB 2PDLA 1CX9A 4HOXA 4GXPA 3LCLA 1EJUC 2FVLA 2GWNA 5FJTA 1FDYA 1AD1A 3NQDA 5FJJA 3GDLA 4NVTA 4F40A 2QCEA 5I3JA 3EEZA 1GZGA 1VBJA 4ERGA 2A85A 3G1RA 4Z2GA 1KBKA 2MNRA 1JXKA 4GPNA 1U30A 3CZJA 4RPQA 8RUCA 5C2CA 1HIZA 4PFHA 4BF9A 1AFSA 3M7WA 4BWLC 4JIEA 1JF6A 4PTNA 2O7QA 2PTDA 1NQKA 4K38A 1P6WA 2QW5A 4Y2WA 2ZADA 3CEUA 4E38A 1I2PA 2BMBA 2PSNA 3LGDA 4CKQA 3NQ7A 1GGOA 3CQIA 1IEIA 4KWUA 1OM0A 4QRNA 3BMWA 1LL4A 1OGSA 3VNIA 3WJWA 1BEUA 2I16A 4X0VA 3VABA 4MY9A 4NX0A 3RHGA 4GJ1A 4DZ5A 3BMXA 3MMWA 3Q37A 2YL9A 3KRZA 3VGEA 2EG8A 2BXZA 4IPIA 3UXDA 4GRSA 4PBFA 2E4TA 2PLKA 1CPUA 2GVEA 1TJPA 1MUCA 3BSMA 4B3ZA 1K6AA 1EYWA 4BF5A 3ZVHB 1VBRA 3C0JA 3WCZA 1EYEA 1BLIA 2XVLA 1OGBA 3L2IA 2Z27A 5FJOA 3LENA 4O54A 5FL0A 4YJ5A 3F4DA 3FJLA 4PRRA 1Q6OA 4AEEA 1DJZA 2E09A 1HT6A 5CZJA 3BGGA 5ABFA 5ECVA 3WH5A 3R11A 4JYDA 3G6MA 5XIMA 4RL3A 3QV9A 3SN0A 1TV4A 3OGRA 2YBTA 4QG9A 2A3HA 4WSKA 2A3BA 3WFAA 3RG6A 3LTPA 3VIMA 2A3LA 1YRRA 2OT0A 1D7KA 5LHEA 3NQAA 5LA1A 3I4KA 4ONVA 1K9FA 1CGXA 1OEPA 3WDIA 3VNDA 4QEEA 4JHMA 5L9FA 4JQ1A 3G8RA 1B4KA 3FJNA 1OX5A 1EQPA 2TPSA 4NNBA 2OG9A 4HSHA 2JALA 4QNWA 1UG6A 4YL2A 1M41A 4DNMA 1HZYA 5EMYA 4JGDA 4FF5A 1PZ2A 4E0CA 5A6BD 3KP0A 1Q6GA 4O18A 1DWHM 4XWUA 3MHGA 3UBPC 1XYAA 1OYAA 3G1VA 2J78A 4GACA 3R89A 3ERPA 1B31A 1XIEA 3ZVIA 1CB7B 3KVKA 1A5NC 3CIVA 3HFYA 4RE4A 4WZHA 2R14A 2GZXA 1VZWA 4W86A 3WIJA 3E12A 4J7RA 3PBGA 2OVLA 3QW3A 4FX6M 4E3TA 1XLFA 2ZUWA 4DVOA 3IIZA 4GIEA 3UR5A 2A1YA 4JNZA 3QQ0A 2IKIA 2HBXA 3WD4A 1DOSA 3L5LA 1H5YA 1I2RA 3GKFA 4NL1A 3AHZA 3CXOA 1S5TA 4O0KA 1QBBA 3OGSA 1LYXA 5G2WA 4XZMX 1UCWA 2WKLA 2GGJA 4XKMA 2A7RA 4E4PA 3BZJA 4QGCA 5C9UA 2QUNA 3OVQA 3PG9A 1RA5A 3NURA 4LCQA 4RW5A 2ZTJA 4H4IA 4IIFA 4HNNA 2B0MA 2W79A 1VEPA 3GSMA 5HMEA 4AXNA 4S3DA 4M29A 5A94A 2D1ZA 1JUEA 1JQXA 3ABXA 3MU7A 4NYYA 3LN3A 3ZLFA 4B2DD 2VR4A 3GQYA 5DY3A 1TPEA 2OWXA 3E1F1 1S1PA 4QEHA 3FXYA 2W66A 5AZ1A 3W6LA 3NZRA 4PH6A 1OADA 3B8UA 1YPFA 3KVJA 4I6VA 1RJPA 4RCXA 5I3FA 2QJJA 3N2TA 4J4KA 4HBKA 1PKMA 1MUMA 4PTMA 1ME8A 3STPA 3PF3A 4O10A 2DPEA 1V6YA 5CPQA 2VKZG 1LBLA 1EX1A 4OOZA 1U2YA 3LK6A 2I56A 2QUUA 4RV8A 4D6CA 2BASA 5FJPA 1WV2A 1T6MA 2VGGA 4IG2B 4EPEC 2YGYA 3WDHA 8A3HA 5CC3A 4I9JA 3HQNA 3G6LA 2JF7A 2ICSA 1F61A 3HG2A 1T0OA 5FF4A 1R3RA 2YOCA 4H8VA 2PDKA 2ZE3A 1H7RA 4CN6A 2DIJA 3TA6A 4A8IA 4S3KA 2CZ5A 1XLDA 1TWSA 1XRFA 2J7GA 3RX2A 4GUIA 1Z69A 4BJHA 2DT0A 4D6DA 1ITUA 3R8GA 5K7JA 2QDHA 2G50A 3AUJA 2PDJA 2Z1BA 1UHVA 1KQZA 1R30A 3AS1A 4FO4A 2OZ0A 2HXUA 3FEMA 4CD5A 3TR9A 2ZDSA 4E2DA 2PTXA 4IHCA 4RNIA 3LHWA 4S23A 1DWGM 1UUQA 2PC8A 1I1XA 4TMBA 2EEXA 4ZE4A 4DZAA 3LQGA 1QI4A 2OXNA 3ICJA 4Q7NA 3GNOA 5FCZA 3L4ZA 2CW6A 2Y8VA 2PDGA 3BAJA 3B8SA 5KZDA 4HNVA 3QOKA 4Z0SA 1NF7A 3FKKA 3QYQA 3BGJA 1NWTA 1W2PA 3QW4B 1KR0A 4U28A 1PWLA 3W4RA 2OPJA 1Q4WA 1X8FA 4W7VA 3RO8A 4PCPA 5KINA 1QI0A 3PTDA 3GU9A 4MY8A 1OABA 1OX6A 3TCEA 1RCXB 4HMCA 1QNOA 3MUXA 1LLZA 4CU6A 3A12A 1FY6A 1CLXA 1XYZA 1RP9A 2P8CA 4GZ7A 3WFLA 3SY5A 4JEJA 4HHMA 4S2BA 1NEYA 4ZR8A 4NNAA 5AB3A 3FA4A 5LIXX 1GG1A 1EJRC 3B8IA 2QJHA 3KOYA 1U33A 3WDQA 4B4HA 4NXKA 5HWJA 1CWYA 3L0KA 3GZAA 2GQ9A 4AMAA 2PWFA 3R0UA 3RK8A 2WLZA 4QSFA 4GQ0A 3L4WA 4XZBA 4AYGA 1FWNA 2XIQA 1EBHA 3N34A 1JDFA 3P61A 3XIMA 3UWWA 5BU9A 1JD9A 3GG7A 5K4XA 2YDAA 4AZBA 3SRHA 1SMAA 4MPKA 2VUYA 1FWCC 3QBUA 2WVUA 3M7SA 4QDMA 3VMPA 1PV8A 5EMLA 3P8IA 1YE6A 4WDTA 5AOUA 4NZ3A 4JYFA 4R27A 3AMCA 2KX9A 4IUOA 4L9ZA 3VIIA 3KOXA 1B9ZA 2HVOA 4LU0A 1NOUA 4WRHA 1AH3A 1XBXA 3VD5A 2FKPA 1D9EA 2Q01A 4K3ZA 5AYBA 2NUYA 3ZLHA 3IGHX 2TYSA 1UD5A 3AHVA 1HX0A 3C2RA 2E8YA 2KAUC 1ZLPA 3U2CA 4EF8A 5FEPA 3NA8A 4RK8A 2QQ6A 3LHTA 4KW2A 2CZFA 2WK2A 1S2WA 1QWGA 3MUIA 5LNSA 4J3SA 3GXTA 3BQ5A 2VFFA 1OF8A 3B9OA 3RITA 4CQCA 2F6XA 2VR5A 1S2VA 2DGAA 4L80A 3IGSA 5JVLA 1HXJA 1YTDA 2I7GA 1W5NA 2I17A 3KBSA 1TREA 1IT8A 4JTTA 3N4EA 4C6BA 1CLVA 1GQKA 1RUSA 4IPPA 5FAJA 3QQ1A 1Q7MA 3BG3A 3CH0A 4LY8A 4HYVA 1NTHA 3PTKA 3G8EA 2ISVA 4D6FA 3QHOA 2ZVRA 1XICA 1BG9A 3NDZA 4IM4A 4QNEA 1H7PA 2O9PA 2XM2A 2GDQA 1A47A 1MZHA 3ONBA 4DO7A 2EJ1A 2JGQA 1PX4A 3DENA 1M65A 3UXIA 4HYWA 2G5WA 4AZ6A 4E6MA 2YPIA 1FBAA 3HOJA 1PIFA 3IUHA 1XW8A 2NV9A 1M53A 3HG5A 3CL7A 3GNXA 4BK9A 1F3XA 4FNTA 2QT3A 1P0DA 5DQPA 3SGGA 1HVXA 2VRKA 3DYPA 3W81A 2PE4A 3ARVA 3CHVA 3ID7A 1V4YA 3W84A 5CC5A 3H4WA 3K8MA 2UY3A 1XISA 4DUXA 1CB2A 2OZTA 4KEVA 4BFAA 1BKSA 4Q4SA 1TB3A 4DF0A 4JTCA 3R13A 2QCMA 1C8YA 1SSDA 3C0QA 4GNJA 4OOUA 1TV2A 5ENLA 1JL8A 2O0TA 4B92A 4ZOEA 3TJ4A 3QMRA 2HPMA 1AQMA 2IXUA 3KE0A 5HR6A 1XDJA 3SURA 3LCFA 3RRXA 3M46A 1Z42A 1TWIA 4GK8A 1WDRA 2JKEA 1ZZMA 1JI1A 2DSZA 3T78A 4KESA 1UUMA 1FTXA 1FXQA 4CLMA 5CBJA 3OYZA 4DO6A 1P0KA 3PAOA 4F48A 1JYNA 4C6QA 1BRLB 1J0YA 5BXPA 1DL3A 3REQB 1DTNA 4XBJA 4H83A 1BTCA 4FIQA 3N12A 1LLOA 1F5ZA 1EJXC 3GW3A 3W87A 3VIHA 4ZENA 2B4GA 1NOWA 2DUXA 1J11A 3LPOA 1BWVA 5DO8A 1EQCA 4C7GA 1C8QA 3GYCA 2OZ8A 4DWSB 3IK2A 3M07A 3NGJA 4CNUA 2GGIA 4GQQA 3W7QA 3VGGA 3Q94A 1I0DA 4QHRA 5E5CA 4LF1A 2W63A 3R79A 2GJLA 3KBMA 3GDMA 1N55A 4CGTA 3DI1A 3Q45A 1I2NA 4H9MA 4IWWA 5HUOA 1ZBKA 4F2BA 1DEDA 5BRPA 3R58A 3SCSA 3NL2A 5LZLA 2BY2A 5T91A 1T41A 3ZT5A 3DN5A 2FZ9A 1WKEA 1F3TA 3LHUA 2BVYA 3EWBX 4U2YA 3UG8A 3A64A 4JXCA 3PWAA 3NJ3A 4UQEA 2CLKA 5D8WA 2ODOA 4Z1BA 4H19A 8TIMA 3MMUA 3P93A 1P48A 3QHNA 3W2MA 4QCEA 2BOFX 2VEFA 4IMCA 4HA1A 3CUZA 2DT3A 4AVOA 3G1FA 1W17A 3CZKA 4ATWA 4LANA 3ZFHA 3LCWA 4M1BA 3JR2A 3VNMA 4MGGA 4B5WA 5DF0A 4XD5A 3UYIA 1E6RA 3M1ZA 1PL9A 4AY1A 1ISWA 1UR2A 2IXVA 1EJWC 2BHYA 4UFIA 5D09A 1KFCA 1A3HA 2G3JA 4WJEA 1XIHA 1J01A 4DJDC 3Q4DA 4HTYA 2EG6A 4H8UA 4NG3A 3MP3A 3E5BA 3LERA 5IFTA 3UJ2A 4LB3A 4L1GA 1LTDA 1XH0A 2J8GA 4MNMA 4YIWA 1JDCA 4U10A 3KRSA 4PMOA 3USZA 2CHOA 2BV9A 1P43A 6PTDA 4Y8EA 1B54A 1KFEA 4H9ZA 4C6CA 1UA7A 1QU4A 3BLOA 1TWZA 1G4TA 1ONEA 4DZIA 1X98A 3ZR6A 2KZHA 1HNYA 3M43A 4O28A 1FOBA 3WO8A 5LIWX 3WF3A 1VFLA 3IJIA 5AKQA 2D20A 1HFBA 2CXEA 2OKOA 2D2JA 3CUXA 3JZEA 3VNKA 4HNCA 1K8YA 3HGOA 4LY4A 1TCDA 4HHLA 2X1RA 1K9TA 4GYPC 2EPLX 4W87A 4YVPA 4KCTA 2R91A 4IGMA 1V3KA 3TOYA 5BOFA 4U5IA 5XIAA 4J35A 1F07A 2FTWA 1DTUA 4I9AA 1XBYA 3EWZA 5BYWA 1ML1A 1NDZA 3LQLA 2QJIA 4WK9A 3V3WA 1P0BA 1XLEA 5EB8A 3UZ5A 3HG4A 3O1NA 5FJIA 4W8LA 4IQDA 3O07A 1IEQA 1Y5WA 2IKHA 2ZRXA 4JNMA 3T0BA 4YYFA 3TR2A 2PWDA 1GHRA 3WQPA 1TMLA 3A9BA 1IF2A 4GIYA 2HBVA 1XSKA 4DJFD 5CPSA 3PZUA 2A3AA 1IHIA 2WLYA 1I75A 4NZJA 4NASA 2C1GA 3CUFA 1ITXA 5E1QA 2JKPA 1XQLA 3QMTA 2P53A 3RJYA 1ZBCA 1VFSA 3P84A 1KXQA 1UOKA 2VDGA 3AALA 3TFCA 1EF2A 4LBSA 4PA8A 1KTNA 1R3VA 3CZEA 3GAYA 2DW6A 3AXIA 1J0ZA 3E38A 3PM6A 3T2PA 1B3VA 4BA0A 2GQ3A 2VM8A 3QTPA 4UNKA 2PTWA 5EPDA 3TN4A 5F4SA 5G4WA 4JTDA 5C9RA 4CQDA 3C61A 3E2RA 2HZGA 3I68A 3C86A 3V75A 2VVSA 1UZ1A 3WSUA 3ITOA 4LVGA 1PHWA 3UT0A 3MO4A 5MKGB 2V30A 4WF7A 3CTLA 1OF6A 4A2RA 1HO4A 5D33A 3LMYA 1WZAA 4WY0B 1QRQA 3DHUA 1W6TA 4MWAE 4H2HA 2AAAA 5A6LA 4FP1A 2YLLA 5HUPA 1V3JA 2VQTA 3UQNA 1K70A 4PMVA 3S5NA 3QLLA 3RMEA 4PB5A 4HU8A 2ZUVA 4LVBA 4RPPA 1NOFA 3GX9A 3BOXA 2OQYA 2OCZA 2C1HA 2CZVA 2PDIA 1ZAHA 3TNBA 3VNLA 3WNKA 4EAYA 2HVNA 2INFA 4BHYA 3LA4A 3W01A 4BEUA 1FWRA 4DF2A 1M6JA 3F5KA 2F38A 4ECLA 4PEEA 4OU1A 4D6IA 3AAMA 4FNQA 1EZWA 1HKWA 1XLMA 3E02A 3T1GA 1QBAA 4NT0A 1BD0A 3A4WA 1RVGA 3VO0A 4X63A 4NAEB 1EA9C 2CNCA 3LCIA 1WCGA 3U9IA 3B4YA 6REQB 3ANUA 2WVSA 3ABRA 3WH7A 3RM8A 4MY1A 3I7RA 3CB8A 1WUFA 1SR0A 1MEIA 3WQ4A 4OIFA 3T55A 1XIJA 1YNPA 2VURA 3K4DA 3ES7A 3VD7A 4V1YA 3BG5A 1FWIC 1K7FA 1I0BA 4M6QA 5M3WA 1BYCA 4QG8A 3WDRA 2W6RA 1O6IA 4GQGA 2E6YA 1H0GA 3ZS4A 1EJVC 4BZYA 4JOMA 5DT5A 4L4OA 3KCOA 3RFAA 2E5CA 5AC4A 4G1KA 3C2EA 2YJQA 3QZEA 3E2QA 2CLFA 3EOOA 4HHPA 4ZCWA 2CLOA 4NJKA 4KIRA 1X6UA 1DKWA 1JCYA 1GOQA 1OB0A 3AJ7A 1L8NA 5EL1A 3H8AA 4D72A 3K8LA 3EMCA 4NZ4A 1DE6A 1D3GA 1Q2RA 2INZA 1I45A 4RW3A 1MFUA 1S2UA 2BP1A 4MB1A 4PFMA 1H63A 4J9JA 3ARZA 5K9XA 4IIGA 4QAIA 4GWEA 3RLGA 1R47A 3LEPA 4GUHA 4H6QA 3VE7A 1FCVA 3FVMA 3GH4A 3N2CA 4WOQA 3PPGA 4UTUA 3H2CA 5AC6A 2PURA 1W8GA 1X6LA 2OX1A 4NAFB 3TLLA 4DF1A 5M03A 1GOIA 3I4EA 4WKFA 1XD1A 1EB3A 1X39A 3M0ZA 2YCLA 1UPPA 1YBQB 3EB3A 4DYEA 2YDSA 3TONA 3PP7A 2DZXA 3TTYA 1SJCA 1OG0A 4XQ6A 5AVHA 2CEQA 1RV8A 3EB4A 1KA9F 5JBFA 2Y0FA 5JH1A 3HG3A 5I3GA 4X9SA 4F79A 3L21A 3AIWA 4D6GA 3W85A 1FHLA 3IV8A 1QVBA 3GXNA 2CIPA 3TOPA 1I2OA 1IZJA 3LX9A 5E09A 3GHTA 4LAKA 2Y89A 1ICSA 4EK7A 5J8LA 4P61A 5E6YA 3FYYA 3FXGA 1KXTA 4NJIA 3D3FA 4MTVA 1YIXA 3RDKA 1ELSA 1SJAA 1S46A 4N42A 2OKTA 4OECA 4DWSD 3NQCA 2QPUA 4G9PA 1V02E 4P7RA 3T08A 2PDNA 2QUMA 1CXEA 4H8HA 3MBFA 3AROA 4QBXA 1QO2A 4XKYA 2DVTA 4A22A 3DUGA 1SZEA 1ICPA 4M6VA 3V0TA 4DELA 5LHFA 2YXXA 3BLLA 3KLLA 3KDOA 3L7RA 2Y85A 4WJXA 3CQHA 4QP0A 4UNLA 4CN1A 3E9AA 4ML9A 3ZJ6A 4HZ6A 1H49A 2RAGA 2YL8A 1DV7A 3W7HA 1RLDA 1YADA 2YCEA 3CM4A 3R4IA 1T96A 4L7ZA 3W7KA 1C7SA 1LQAA 1KXVA 1H1ZA 5E6ZA 2Z7KA 1E4LA 4JIHA 3REQA 2Q3OA 5C5YA 4YCOA 5I7GA 3BARA 3OLEA 1M04A 1LQ0A 3WQGA 3PHAA 5CC6A 4U3AA 3GVGA 2XYLA 4MWAD 3BV7A 4F0HA 4MPQA 1PAMA 4WDUA 2A6NA 4PMDA 1KR1A 2YXGA 3THUA 3EB2A 4DWSA 1G9HA 3W1NA 3WEZA 3W86A 1P6BA 3HBLA 5JU6A 2ISSA 3VOHA 1VYRA 1R3YA 1SR9A 4YXGA 1OK4A 4UC5A 2QCLA 1A0DA 2E8ZA 2XVGA 3GDTA 4ES4A 5A8OA 3P6LA 3PTQA 4KFPA 3UGVA 2WB5A 1OD0A 1X1ZA 5HQMA 4NF7A 2ESCA 2J8FA 1OFRA 2BXYA 4ML4A 3R8HA 1B1YA 4IISA 1V6XA 2CBIA 3OZMA 2AAMA 3THDA 1PTDA 1LRTA 2HV5A 1MXDA 4WXZA 1DJQA 3KTSA 1KBBA 1JNEA 1FDZA 1WXJA 3OOQA 5IBXC 3GWQA 4RNFA 3UR8A 4AEFA 3R10A 4KF1A 5CPLA 3KBNA 1H7XA 1DXIA 4C5ZA 4GUJA 2QCDB 2ZZ2A 1UR4A 2J79A 4GD0A 1UWRA 4KWWA 2CITA 3UA3A 4G6CA 4W93A 4C6OA 4MVAA 1MUWA 2NXIA 4DXVA 2C13A 3GVRA 1Z32X 4W84A 4B9YA 2A7PA 2QGHA 3JVAA 3N4FA 2WHKA 4FX8A 3SO7A 4Q4KA 1PO9A 1OX4A 3I6RA 3UCCA 4HJWA 1W1ZA 3WF0A 4LCRA 4W4QA 5DBUA 2WZEA 5FJRA 1VPYA 4HD5A 1G0CA 2XTKA 3G1AA 3N6JA 1OT1A 4RV3A 3MP5A 1WDSA 2XH4A 3BAXA 4NUWA 2QJMA 4O50A 3TW9A 1HN1A 4TXEA 2Y24A 4WOZA 3CPRA 2Z2BA 3GIYA 3NQBA 4PMZA 1A80A 4NX5A 2PDXA 3FS2A 4CNNA 3WZ0E 1BXBA 5AECA 2Z24A 2VGIA 2WZMA 5LGZA 3F5LA 2XN1A 4L64A 3AQUA 2DZUA 4KRTA 1GYLA 1A4MA 3UG5A 2PU1A 1CBGA 2P8BA 3SW6A 3GR4A 4IMFA 5AVNA 1GOXA 1XLCA 3SQMA 2E77A 3NL6A 2W67A 2VX4A 3PPFA 3KWSA 1S5WA 3SB0A 1U22A 5E0KA 6XIMA 3NAVA 2ZC8A 1WAWA 5G1MA 4JAWA 2ACSA 2QUVA 2VRQA 3FNDA 5BNKA 1UBSA 1FWAC 2Q71A 5HNNA 1ZCCA 1AJ2A 5A2CA 4B5TA 2J8TA 2YA0A 2NVDA 3S1GA 1TZZA 3A5VA 3NQVA 1VRDA 3QF0A 3KP1A 3WELA 4ZQMA 1UD2A 1XSJA 4EF9A 4TUFA 3BSHA 3OG3A 2FVMA 4Q32A 2Y5SA 1CENA 1PCWA 1H7OA 4XB3A 1J5SA 4FOKA 1V3HA 4Q4OA 3T0AA 5H8PA 1WOBA 1FXPA 3RPMA 4AD1A 2VNCA 1XWYA 4AHOA 1KRMA 1V0KA 4JTJA 1I1WA 1BVWA 4B91A 4C6IA 2G97A 2XZ7A 2D73A 2WKJA 3LTYA 4Q7BA 3XISA 1JUKA 3P2VA 3VKKA 3LSBA 4WY0A 1XIFA 5CGQA 4ZFMA 3UD6A 2WO5A 3CV7A 1J5TA 3KBVA 2BS9A 4JBRA 3ARYA 3E6EA 4GG9A 5JIWA 3TFXA 3L2MA 2ZX5A 2QMKA 2X1UA 3BLEA 2V2DA 4PCTA 3W23A 4JIIX 2BY1A 6CGTA 1KRBC 1JUBA 2WQDA 3NEHA 5HULA 3N04A 5DMMA 1JYVA 1BYAA 4K6AA 1XIGA 5I3IA 3TQVA 2CLPA 1DJGA 1LL6A 3W0KA 4B9ZA 2ONEA 2X42A 4TR9A 3MWCA 4BR1A 1W9XA 4DM1A 4MHBA 3LI0A 1AH0A 4QROA 2F61A 4ZO8A 2CLIA 3DESA 3ZT7A 5KZEA 1ZAIA 1EWEA 4PUDA 1PIIA 4Q8QA 3TTSA 1VHCA 2GGGA 3S1UA 3W1LA 2J88A 4LV4A 4CVWA 1VP5A 3VUPA 3MYOA 3M41A 5DEZA 5I09A 3G22A 1X8CA 1ZL1A 1JPKA 3VILA 2GDVA 3SEPA 1NWSA 5BWAA 2PDWA 1QW8A 1GVEA 3PWIA 3SECA 1QCWA 3N1AA 4NAEA 1L6YA 3C3NA 4OZOA 6REQA 3L4XA 1TIWA 4HZMA 1KFKA 5IRPA 1AA1B 2CLHA 1IXPA 1PUDA 5FA5A 1XLBA 2W4XA 2E9LA 1MZRA 4FOJA 2OFJA 1T40A 2CETA 3CAWA 5BOEA 1V0LA 4ZE5A 2FFCA 3TWBA 3QY7A 3QY8A 1UMYA 3BAIA 3ZIZA 2ISWA 1AODA 1MDRA 1E4IA 3NO5A 4JIPA 4WQ6A 2WWDA 1WP6A 4ZVJA 2P88A 3E96A 4W88A 4F4RA 1NFBA 1A3XA 3TCSA 2ISDA 4IIDA 1BSIA 5E0CA 1SFJA 5D2WA 3JS3A 1NP2A 1VR6A 5HNRA 2HROA 3UJRA 3MI6A 3TROA 4A8NA 2QCGA 1PEZA 4UTWC 3H55A 1V3IA 4HA0A 1YDNA 5CGTA 3VX1A 4HNTA 4DO4A 3DFNA 4EANA 5LIYX 4TVDA 4G5DA 1SW3A 5D02A 3A4JA 4XAPA 2YSWA 2PWEA 3NVDA 3RM4A 2ABAA 4K68A 2PTZA 3N13A 3WUEA 4D8LA 1AW1A 3N14A 3JU2A 3I3EA 4BEQA 4ZZ9A 1J2WA 4NZ1A 3LBOA 4I5UA 3NQEA 1XCFA 2OLAA 1PSCA 5F2IA 3GUWA 2DZVA 4ZODA 3OO2A 4JTGA 1CGUA 2VD9A 4FSAA 2EKCA 3T44A 2YBUA 5PTDA 4NAFA 1IWAA 1PCKA 1A5AA 3IVSA 2J6XA 5F1VA 3MCMA 4AHQA 2O9TA 4D8ZA 3B0XA 4QE5A 3RUBL 4MNKA 4ERAA 1ODUA 2ALRA 2DV0A 1GYNA 1LJYA 5TQLA 1JPDX 1ZFJA 3WD2A 1Q6QA 2WOQA 2DIEA 1ZSXA 4GHRA 2JBMA 3WX7A 1O60A 1GVFA 3GLCA 1VJZA 1YMYA 4AXKA 5F7UA 3STEA 3L4VA 1KBJA 2X8RA 3I7SA 3I65A 3W53A 1UUOA 2H3DA 5GNZA 2QKFA 3EPNA 5A6MA 4RJEA 3LLDA 4ILSA 2WJZA 4WCJA 4A8RA 1K4GA 3S8HA 3WLQA 5CLTA 3DFHA 4F9JA 4PEKA 1ONRA 2QF7A 3GS6A 2QZRA 3BE7A 1Q45A 1BVZA 1HG3A 4H04A 2J77A 1BKHA 1EXPA 3BLFA 1BG4A 2VMFA 4H9TA 2XSAA 1BXNA 1LLWA 3VIFA 1EIXA 1EBGA 3AOFA 3QMSA 1XFCA 3Q67A 1W5OA 3EPOA 3AMDA 3CQ0A 3S2CA 1US2A 4AWEA 3O05A 5U7SA 4G1NA 1RJQA 1B0IA 1J0IA 3LB0A 3D3AA 5AY7A 1E6QM 3L5AA 3U48A 1TVLA 3RCNA 3YPIA 4O0QA 2DQWA 3PFMA 1NP0A 3N2XA 4IXHA 1K3UA 3F4CA 3S1XA 5HMDA 3VFCA 3TQKA 1LCOA 2X1SA 3VZYA 4LS2A 3IANA 3TIMA 2P3EA 1X38A 3GFYA 1F74A 4QLKA 2QIIA 1UOZA 4O4VA 2YLAA 2CBVA 1MQPA 3GDKA 3NDYA 4GI8A 4LYQA 1B57A 4H3DA 1V08A 1GVIA 2NSXA 2CKRA 4U2ZA 3AIQA 2RDTA 1HJUA 4GYKA 3VA8A 4O11A 2FYMA 4POCA 1V7AA 4UCGA 4Q3MA 2VZUA 3GDBA 3PJXA 4D71A 1PHQA 1WQ5A 4K7YA 1VFOA 2Z2UA 1V3MA 5IHSA 4OQVA 4DY1A 3ATYA 1E73M 1IR2A 4ATDA 1E51A 4CCDA 3PZIA 4LS0A 3T81A 2ZRWA 4YU1A 3BWWA 4CNPA 1V51A 5C0QA 3RILA 2UZ9A 4JN7A 2IMRA 1P1MA 3TN6A 2JIWA 3VGBA 1WNOA 3W7OA 5CCZA 4AZGA 2FPVA 7A3HA 4JTQA 1US3A 3ARWA 3AICA 3SSZA 3WK2A 1OCJA 5BCAA 4GYFA 3T7VA 1S2TA 4YTSA 5HNTA 1TO3A 2E67A 2VZOA 1O4UA 3BDKA 4Z42C 4L4LA 1WZMA 1BYBA 4AAJA 4HCHA 3O3RA 3ABOA 3GTFA 5LXXA 1IEWA 3TNOA 3R94A 3KUMA 4WVXA 5H91A 2OQLA 3S9ZA 4HU0A 4HPNA 3V5FA 4QXIA 2QDEA 4S1FA 1E40A 3S2NA 4X22A 2I9UA 5I24A 3LXCA 1A5KC 1YXCA 2X16A 4JQ3A 3IIPA 3IIXA 1BGAA 1Q13A 4JKKA 5AC5A 4KRUA 3H2AA 3NSNA 4GVHA 3S3GA 2DIKA 1SYTA 1UQZA 1HTIA 2PWHA 3O8AA 3SR7A 3KRBA 4HPJA 7TIMA 2WZIA 4AVNA 5CPTA 3W7PA 2TSYA 4M1RA 3GXDA 8CGTA 3P7YA 1ADOA 3VDCA 2GOUA 2YZRA 1SPQA 4M81A 2HNHA 1QXLA 1AUSL 1Y5XA 2BY0A 2DZBA 1VFHA 2AL1A 2HE5A 3E49A 3PUEA 3W1MA 3S2MA 4JTEA 3BMVA 1QNRA 1X7IA 3V36A 5C9XA 1PKLA 1FKXA 2UV8G 3SIZA 3O6DA 4B5UA 4LAZA 5A6KA 4WKAA 3U8GA 5KTLA 1G67A 2Y7FA 3NYZA 3VM7A 1WXYA 5SWUA 3MCOA 5EBAA 1LRQA 5LKYA 3RX3A 5C71A 3W73A 3DFSA 3GIQA 3CLMA 2WXDM 5K2ZA 1P0NA 3APTA 1E55A 3VM5A 1PE1A 1C92A 3GBEA 3PSWA 3QOMA 3VCCA 4LALA 2OJPA 1YKWA 1HJXA 4XZLX 2DZAA 3BQ6A 3DBPA 1RY8A 2VCCA 3MMDA 2PD5A 4WEVX 4QCFA 3B0PA 2YCIX 3EX2A 1YDOA 2B7OA 1RD6A 1POJA 5DBTA 2ZX6A 1TZ9A 4DBUA 3MCNA 5D9OA 2IPGA 3QYSA 5FI8A 4S3CA 1KBIA 3GY1A 4K37A 2RGLA 3DOPA 3L0GA 2WSQA 2V9DA 2OWCA 2DZPA 1R3SA 5DXYA 3S5YA 3GG8A 1PVNA 5EYWA 5I3KA 4HA3A 4GZIA 3LGEA 1AQHA 2GSHA 5CBBA 3GXPA 4PUUA 4LB4A 5MHBA 1O5QA 4J1OA 4ZTYA 4TQTA 1XUZA 5D38A 3FK4A 3DCPA 3K30A 3N11A 1XYMA 1H62A 3L2LA 5D2YA 1XP3A 4ZSTA 1ZALA 2VWTA 1RCQA 4AG0A 1Z89A 2ZA1A 1CXHA 1E5JA 4XTIA 2V5DA 2YKKA 4BWLA 4GJIA 5BXRA 3O6AA 3EX1A 2PBGA 3CNYA 4HPGA 3IJQA 3SCOA 4LUTA 1EO5A 4P7NA 1ADSA 4L61A 3WUFA 3MMTA 4GIRA 3SGZA 5D2TA 3P74A 4FEZA 1XYCA 2E6AA 5HAOA 4C6JA 3P0WA 2D0FA 5FF7A 3INPA 4OHQA 1V3LA 1K9EA 3IRSA 4E2OA 1O94A 1ZUAX 2AQOA 4D2JA 5C7VA 3EXTA 4RE3A 4WLCA 4ZB0A 3NL3A 2B31A 3MTWA 1GUVA 3UA4A 3KVMA 1J0KA 1L2QA 2E9MA 4K7VA 2I14A 5BZAA 3URBA 3PNUA 4B3LA 5KITA 2P1FA 4P7OA 1R0MA 4F3HA 1JPHA 1DJIA 5MF5A 4A3HA 3O9NA 2BGNE 5DELA 1D8WA 4J40A 1YX1A 1TRDA 3SQSA 5HQEA 1QW7A 4CNTA 4MNLA 3E3HA 1GQNA 1WA3A 2W61A 4P2VA 1OT2A 3C2OA 2YIHA 2RGMA 3UW6A 4AIBA 3OZPA 1R85A 3P8JA 1EGVA 1KM0A 3ZYZA 2FHCA 3W1XA 3WLRA 1G4SA 4AU0A 5CJNA 5BRBA 4M24A 3P3BA 1OQFA 1KKRA 1C8XA 5GJNA 1I4NA 1CXFA 2YA2A 2X1TA 3LUTA 3UG3A 1A5LC 1HGWA 4HCDA 4YNGA 1W3HA 2WBGA 3SM0A 4GY1A 4HKPA 4TV6A 4PUJA 2JK2A 1E9LA 3ZQ9A 3E0IA 2A0NA 4TU1A 1GVSA 1OZMA 2HVMA 2GYIA 3AYTA 2PWGA 3TYZA 1OJXA 3MJYA 4DJED 3C0LA 3FX4A 2GL5A 4XISA 4AF0B 3NCOA 3OGVA 2EGZA 4G7EB 3S6OA 4Y9PA 3CU2A 3M44A 2OB3A 5I23A 1T5AA 1UIOA 4UOQA 1XGEA 3BOFA 3TKFA 1OSEA 5TBOA 1L0PA 2V3GA 1NDWA 4DBWA 1FUYA 3H12A 2XVPA 1G6CA 2ZC1A 1RBLA 3UNDA 3DG3A 1Q7ZA 4TIMA 3VOIA 5A6TC 1JZ2A 3UPBA 3CWNA 4RLIA 5C54A 3RGTA 4JCMA 4JTKA 3WNMA 8XIAA 1ZY9A 1R8LA 4I7UA 5ABHA 3EBVA 2ZUNA 1E0TA 4QFUA 3QGKC 4M7SA 2VX6A 3CO4A 4PB3A 2PF0A 1REQA 4HZ7A 3F1QA 3W7DA 3SCVA 5BMWA 1VGAA 1R5YA 2ZUSA 4Z1YA 4NP7A 4FNRA 1E1CA 2WNQA 4JX6A 4D6EA 1F3EA 3U57A 2GJNA 1B2YA 1B30A 2HQAA 4R33A 4AZ7A 1TV8A 4I5RA 1CGVA 3VK5A 4BQ2A 1EOMA 2QCFA 4DJEA 1BQGA 1JDAA 1FH8A 4HN4A 3DGRA 3N6QA 3EWUA 1ADDA 2REQB 1R38A 1XYFA 4IOTA 2EPOA 1FWGC 2PDFA 4FNSA 3OLGA 3LHVA 4JN8A 4QTGA 3OIXA 3SUSA 1AJZA 3PJTA 1FWBC 2E9BA 4UQDA 1GJUA 4IIBA 3S42A 1SVDA 3IJDA 2Y1HA 1LQ2A 1CW2A 2OLSA 2H9AB 3B8WA 1YTKA 4GI4A 1K02A 2R8WA 4C6EA 4C6MA 3K13A 6XIAA 3H4GA 3ITLA 4LC8A 2OGYA 1GWJA 2AKZA 3W6YA 3CV2A 2HS8A 1EDTA 4PMYA 1R9ZA 2J75A 4RZ5A 3UCQA 4QS5A 3MSRA 1LG2A 3HZ3A 4QM1A 3W74A 3CBWA 4YTRA 3AIVA 2ZKMX 3WUBA 3CZLA 4FLRA 1H7NA 2AMXA 4HMDA 1RQEA 3WQOA 1FH9A 3GO2A 2VXNA 3HO8A 3TSDA 4LVDA 4O0ZA 2YW4A 3QXBA 3ITGA 3GVVA 2C19A 3WLNA 4HK6A 5HR7A 4I7WA 5BXTA 5HOSA 1E6XM 3TQ0A 2XGIA 3D5HA 3SY1A 3QPEA 3GDRA 3Q58A 4I90A 1LP6A 4PCSA 4DJFC 5G1YA 1OGGA 4Z2HA 3H2NA 3DG6A 4RXFA 5HPOA 1D2KA 4PMNA 4YMZA 1TPVA 4FI4A 1FX6A 1YHTA 1H50A 3AWOA 4MZ8A 3P5ZA 1EOKA 3IUIA 2BVDA 3G2GA 2E40A 5DMLA 1VEOA 3EKLA 3LD5A 5FF0A 3W7MA 1ZBWA 5CG7A 2OT1A 3CYVA 1GHSA 1KM4A 2OEMA 4IMDA 2F84A 2D2OA 3IVTA 3MWAA 4Q22A 3FYPA 5G4HC 3UJSA 3AU2A 3MDWA 3W3OA 4GCAA 1YPXA 1KM5A 4FNPA 4XAFA 2XVKA 4XZIA 5LA2A 5F2LA 2A2IA 2ZA2A 1IGSA 2WSPA 4AWUA 1JZ5A 3DDMA 2MANA 1QR7A 3GM8A 1E4MM 1JULA 5D37A 1KLZA 1ZP3A 2DT2A 3DFPA 4J2MA 3A3HA 3WY1A 3W1QA 4FOUA 3BXWA 3AHTA 1FCQA 2XVNA 2DQXA 1GOMA 4LFYA 1R46A 4UFJA 1VFFA 4JTIA 3OVRA 5C70A 4PE8A 4LH8A 2OODA 5CLWA 4N9CA 1UZ4A 3RLHA 2C0HA 2QCCA 3TZFA 3ZM8A 3ZSSA 3TUUA 1VCFA 4S3AA 3CQKA 5CZSA 5RUBA 1S5MA 4JTFA 3TX9A 4C7DA 4KCWA 3ITXA 1SW7A 3LOTA 3WQVA 4JD4A 2ZUMA 1KC7A 2A21A 3O15A 3GHRA 1LT7A 1F6YA 4IJBA 4D1IA 2D0GA 1JYXA 2MUCA 3TWAA 2PU0A 2YDRA 1V5XA 3KEHA 4LEFA 4A3UA 1GK8A 1EFZA 1NARA 3WQEA 3NXFA 4XD6A 3ARSA 3A22A 5TD4A 4QITA 3EWYA 3NQFA 3LRLA 1DHKA 4M8UA 4RDWA 2HNEA 3CHEA 3RJXA 3WBXA 4JZ5A 1MNZA 4DI9A 1TIMA 1TV5A 2IS7A 2R1MA 3UESA 3GE7A 4O52A 1XIDA 2ZZ6A 1TQJA 3RU8X 5G1TA 2J7FA 3UVAA 2PGWA 5EKYA 4UTMA 1B3OA 1WOAA 4JDBA 3AHYA 1L2UA 1ZP4A 5I5RA 4P8WA 4XAGA 1WZKA 2GVJA 4NIRA 5I06A 3LV5A 4MUPA 3KCJA 4F2UA 4UQ9A 1UIPA 2F9RA 1F6KA 5BU6A 3VXGA 1AW2A 4KWOA 5CSRA 1ZENA 1B4EA 3U7BA 3LM7A 4NJJA 3BVJA 1B5TA 5EFFA 3AIEA 3T2OA 4B90A 1ECQA 2PODA 3UZZA 3A3XA 3AYVA 4IFRA 1S38A 4LYKA 2RDUA 4QE1A 4LS1A 1TWDA 4Z0JA 4IMEA 5HJYA 1S5VA 4QIUA 1VJIA 4E4FA 1KV8A 2NLIA 2WV8A 4JN6A 3VKDA 4WUIA 1PXGA 1PKNA 5DN1A 1XV8A 2C15A 3G3DA 3KBWA 3VIPA 1KCLA 3SCRA 2YCKX 3V16A 2DH2A 2ZA3A 1EA0A 1Y5VA 1LF1A 5ABGA 3M0JA 5CQ1A 4JTAA 3K46A 1FRBA 3ZOAA 5EY5A 2PDPA 1L6FA 3MO7A 5H1WA 1E0WA 3MVTA 1E1FA 2OZ3A 1H1NA 1QATA 1XSIA 4QISA 4W8BA 3I3DA 2B7QA 3BZGA 3E5PA 2FB2A 2VEIA 2PUZA 3NDOA 4Q8UA 1TPWA 2ATSA 4TVCA 3AIBA 4KGJA 4AISA 4FAMA 2EHHA 1MI3A 2WNZA 2XG9A 3MJMA 2AGKA 4ZQPA 4S3BA 1OHLA 3NSXA 4JX4A 3GAKA 1N2VA 4IGHA 4EIVA 5EMKA 3MA8A 3LM3A 2QV5A 2E68A 3DHFA 4I6KA 4DAIA 5HPCA 1G69A 4K8GA 4RZBA 5KZMA 3KOZA 1IR1A 3OQ8A 4HJFA 4PB4A 1A5UA 1ICQA 4O8AA 2FMNA 1ZJBA 1W3NA 1TUFA 3KOWA 4K1GA 1WDDA 4B5XA 2G3MA 3FFSA 3I6EA 1XIBA 3CASA 1T7LA 1IQ8A 1XKJA 2WMJA 5AYIA 1JYWA 4D6HA 3WMSA 4GO9A 4JTUA 3GUGA 1LDCA 1B9BA 4AIEA 2QDDA 1M03A 3EMQA 1PBGA 3L4TA 2JIEA 1WYIA 3W70A 3BSGA 3KAOA 3W00A 4Q8TA 3ZJKA 1G7VA 4OJYA 3W02A 1MEHA 2YX0A 3CMFA 1R6WA 3PBYA 4ZQOA 2PEVA 2ATMA 2ISFA 1K7EA 4LGXA 3HGSA 4JFSA 3CUJA 3RPTA 2BY3A 4LW7A 3GK0A 4DJDD 4IX0A 4DYJA 1PWMA 3W72A 4BI5A 4GKTA 2ZIDA 1KGWA 2HTMA 2EPKX 5C2GA 3OLIA 4B16A 2O7SA 4AY7A 5JUVA 1XC4A 3QR0A 2V8ZA 3VE9A 1IXQA 3SCWA 1PYFA 1YYAA 2ALDA 4Q6XA 4UOZA 4R7OA 3SIMA 1E9ZB 3EDKA 3UJFA 8XIMA 3F7JA 2PZ0A 4IL0A 1EUAA 4NSBA 3R8RA 1OINA 3QN3A 4JTHA 4GABA 1BWLA 4A29A 1SM9A 3G77A 3WLJA 2ACQA 5HATA 4CQ8A 1VFTA 4LCSA 4N4PA 4LAUA 3MKCA 4QJ4B 3W24A 3UJEA 5FL1A 2QXWA 4MWAC 2B7PA 3RIKA 3H54A 1ME7A 1LT8A 4E2BA 2YYTA 3W7JA 5A95A 1KM2A 2VC5A 4YWSA 1PJ9A 1OFQA 3IAQA 3P81A 4DJDA 3FEQA 5K3VA 3T0TA 2Y6ZA 3MKKA 2A4AA 3ARPA 2WJDA 1H51A 2WC7A 4G2DA 4I9MA 4OUEA 1VIZA 1UR8A 2TAAA 2PWUA 1CDGA 4YTTA 4MZ1A 1HJVA 3DHDA 4AF0A 4DQWA 3HTWA 3H6OA 4G7EA 3DFQA 4UTHA 5CJ5A 4H9UA 3URNA 3TAKA 2EJAA 4HVXA 2EPMX 3W29A 1EP2A 2GVGA 2ZVIA 3IAPA 4L4PA 2YL5A 2ADAA 4Y96A 1TKKA 4ZSUA 4N9EA 4FF7A 1NF0A 1EJTC 3NIYA 3U4FA 2VCAA 1JI2A 2G3NA 1MW1A 4XUYA 4O1FA 2A3EA 2RKXA 2NSOA 4HMNA 4GYPA 1JXJA 3W7CA 1W1VA 1TVPA 1X97A 5AHFA 3BGAA 3B8VA 1JZ7A 3KZSA 3BJTA 3PB0A 4LNCA 1V77A 3C8NA 1XD0A 1DIEA 2WMIB 3WLLA 2Q09A 7ENLA 4ZGYA 5T26A 3V5OA 1R9XA 1IIHA 3AXMA 5FJUA 3T09A 3C0SA 3VGHA 3DFOA 1RPXA 1EC8A 4XG1A 2PDQA 1UD3A 2REQA 5DXXA 5EBUA 1KRAC 3LV6A 3A23A 3PANA 2WPGA 1UKQA 2HISA 4H6RA 4DBEA 1UWUA 3EWWA 1Q6LA 4A05A 2VZSA 1XLHA 3QSTA 1A5SA 2PPGA 1Y65A 1I8JA 1GJWA 2PI6A 2GJXB 1QOQA 2PLMA 2RDWA 1D3CA 3TYCA 2H9AA 4AEOA 4H9XA 3L4YA 3K4AA 2GQAA 2J7BA 2EO7A 3THCA 3U3HA 2R1PA 1NY1A 2W9MA 4GOAA 1EPXA 1TA3A 1FP8A 4IJRA 5AHEA 3VMNA 3P5YA 3MSGA 4CD7A 2H3BA 4RDVA 3VOCA 5A8PA 3IV3A 3F4VA 3MY9A 4US5A 2RJHA 4EXAA 1LOQA 3C2YA 4LYRA 4UTTA 4YLWA 1W9BM 2I5GA 2D22A 3H22A 2NQLA 4DBSA 3SFKA 2RUSA 3IEBA 3VD9A 2C18A 3W76A 3NPXA 1J79A 3OA5A 2FJUB 2CPUA 3LDVA 1XRSA 4ZEPA 2UWFA 3A4XA 3NQ8A 5KEZA 2C16A 3GXFA 2CKSA 4F0SA 2WC3A 1P5BA 3SN4A 1UR0A 1NFGA 2WW5A 4LUSB 3S6TA 3Q2DA 3EDJA 3VPLA 2J62A 4HU3A 1FWDC 2CERA 2ZQ0A 5JXQA 3F5JA 1JAKA 1NIUA 3JZUA 3H23A 2J4GA 3GTXA 1LG1A 4YHEA 1JCTA 1Z41A 1JCMP 2FGBA 4K2SA 1C90A 4GLEA 4EPBC 1UD6A 1EZ2A 3HM7A 2LLEA 1VHNA 4NY2A 3PPCA 2FZDA 2V2CA 2VO5A 4ZOCA 4E8GA 1S39A 1XX1A 4FLQA 3WLKX 4UTIA 1J0JA 1HL9A 4HMEA 3ZT6A 2XIJA 4C65A 2PLCA 4M7TA 1UWQA 5I6SA 3VGFA 1VYSX 3MUZ1 3FSTA 1SQ7A 4IP7A 4ZQNA 4C6LA 5E93A 1G4PA 3WMLA 4BS0A 5DANA 1JFHA 5AHMA 2WNNA 1VPXA 5TNVA 3N4AA 3N19B 2CLMA 1W91A 3WH8A 4QSHA 3G24A 3TYAA 2NZLA 3PZTA 2RHGA 3WN6A 4NJGA 4UBPC 3KTXA 2YCLB 1J12A 3R6IA 2NQ5A 4XD3A 3EDEA 4C1NB 2WCAA 4OUIA 1UH3A 3PUDA 3NM3A 1J2BA 5GPRA 5CZ0A 1SO4A 4Q8MA 3NFUA 3QFEA 4E3VA 3MSDA 1QI3A 5CKSA 3WBAA 3JW7A 3IJ6A 4ROPA 2VGBA 3ALFA 4OBRA 3WMCA 1HJWA 1KCXA 2VQUA 2XFFA 4V33A 4QE4A 1Q8JA 2F7FA 4NU7A 3DC0A 3T4CA 1EH9A 3FHAA 1XQKA 1GKRA 2JKAA 1MRAA 3LLFA 1GVRA 2VEMA 4PMUA 3RPDA 1VD6A 4IP4A 4JFUA 1QFEA 1UJQA 4IPJA 1LBMA 1R2SA 2Q8LA 4L6OA 3W71A 3A24A 1ISXA 1POKA 4ZA0A 1GQJA 3GNRA 3MUCA 4NZCA 2FDMA 1UQYA 4JIRA 4XKYB 2BNJA 1TFVA 3IPWA 1HUVA 1AH4A 1ENUA 3WJYA 2V69A 4PBGA 4D1JA 1TSIA 4M51A 3SRDA 1VCGA 3F2BA 4WKHA 4MF4A 4YVXA 2OLHA 4Q6JA 4HHHA 4DPQA 1RBOB 1SGJA 3LBCA 2Y2WA 3OVPA 2FPTA 1W9UA 2X7VA 4GVIA 5AYZA 4MFDA 4GQBA 4MJ4A 4YPJA 1AZ2A 4X0NA 3WEMA 5G2HA 1DXEA 4JICA 1ZRQA 5JBEA 3D0CA 4AZ5A 1GT8A 3QRHA 4Q33A 4HYRA 1AL7A 2IQTA 2OGJA 2V5KA 1QOPA 4UQCA 1XCWA 3OP2A 4YN5A 4W9TA 3VKBA 1YNQA 4LPCA 2G8ZA 1W5PA 3GBDA 3VGDA 1T99A 1V79A 1JVNA 1UB3A 1LRNA 4U33A 1R3WA 4DN1A 2Z6IA 3SUWA 4CD4A 3UVIA 4RNJA 2PA6A 3P62A 4MJ2A 2BBFA 1RQHA 3B8TA 3UZXA 1H61A 1X6NA 3KL0A 1O5KA 4MSSA 3PY2A 4JS3A 3RO6A 2PDBA 3KZPA 5HJLA 2BOGX 3BTNA 4H1ZA 2E1WA 3ECQA 5IM51 2YBVA 3S47A 1KWKA 3MB9A 4AD5A 3VX0A 5D04C 1OC5A 2XU2A 3N2OA 4LC6A 1E6SM 1R86A 4XK2A 2JGYA 2BVTA 2I57A 1RY0A 3TW6A 3GRIA 1H0IA 1AVAA 3EX4A 2VFHA 3EOSA 4DLFA 1JDEA 1GJPA 2D23A 1FH7A 2ZX9A 2C0AA 5A2BA 2F6KA 4FA3A 3AS2A 2AL2A 1ECEA 1LORA 4DUWA 3ZSTA 1Q66A 3DKLA 3PJUA 4L9XA 4LXFA 4RX0A 1GVOA 4F0LA 1DQWA 2E28A 4LEQA 2IQDA 3VKCA 2PWVA 2QIWA 4FNUA 5LYRA 3OZOA 1HO1A 3B97A 2NWSA 1OX4B 3DX5A 4FXFA 1ZCOA 4HNOA 3VD4A 2AMGA 1FCUA 2XN0A 1JZ3A 1IGWA 3TN5A 2J7EA 1JR1A 1U1HA 2Q3RA 3TC6A 1F9CA 4A3YA 4AWTA 4IQJA 2UY2A 3BJSA 4Z2JA 2J9XA 4JEQA 2C79A 4N9BA 4LVFA 4KFOA 1TELA 3DFTA 3WQDA 1WDPA 1GW9A 4ADTA 4H01A 4DO5A 4Y9MA 1QNPA 1OFBA 2GOKA 1JPMA 3NZPA 2BOEX 3U2ZA 1I2QA 4NXSA 2NT0A 3E2VA 1XG4A 4FPSA 1VBHA 1J4EA 4CD8A 4JR5A 4MMWA 1CYGA 3V0UA 4F0MA 2XINA 3UPWA 3PTMA 3CIXA 3KVLA 3MUY1 2WMGA 1W1B1 4PUMA 1AG1O 2QJNA 3B9NA 3QJAA 4GBDA 3NPUA 4PN2A 5CJMA 7CGTA 1Q85A 4NZ5A 5IBXA 1TR9A 4PRWA 1MFVA 1FVPA 2PS2A 4M80A 2FFIA 3SUVA 4G56A 3WENA 3QC0A 1UP0A 3QFWA 2HEJA 4W8AA 3V1PA 3CMGA 3THAA 4J3TA 3POHA 4MKVA 3C4UA 2GUYA 4IMGA 1IWBA 1LROA 3DBNA 2X0SA 1XLJA 4C6PA 4S3FA 2PB1A 4PZVA 3ITTA 1KV5A 1J8VA 2DUZA 2J7CA 2VX5A 4ZOBA 1XLLA 4O16A 5A2AA 3CT2A 1UPMB 3NPWA 5M2FX 3CAKA 3COTA 3ONCA 1CGYA 4JYEA 1VLWA 2VC7A 1S5NA 2FDSA 2P0OA 4V15A 1XRTA 5JMUA 2VHLA 4AZIA 1SU5A 2ZZ4A 4R34A 3H2FA 1NDYA 1GPFA 4JHOA 4TV5A 3RLUA 4XIMA 3S0CA 3I10A 2BGSA 1OC7A 1U1JA 3GB6A 1WX0A 3GZ3A 1W32A 3NZ1A 1Q6DA 2DJXA 1OFEA 3IGXA 4KWVA 4D8AA 3ORWA 1X96A 3LNMA 2QULA 1PX8A 1ZGDA 3FIGA 3UZYA 2PLJA 3GNPA 4RXGA 5C2XA 1UKSA 1TG7A 3PBWA 1VBUA 4IIHA 2WMIA 3U6WA 1QHZA 3PULA 1XKYA 3FGCB 4OBSA 3GC4A 2DFAA 2VEGA 3N2MA 5FEXA 1P1XA 3NM1A 4GFIA 1GVQA 1RHCA 3RN6A 3R12A 4EWND 5A8GA 1Q4NX 2V68A 5A3HA 3M5XA 1U5VA 4GFSA 1WE5A 1MNSA 4AYSA 2XWEA 1A4LA 4IPNB 3ZR5A 1F4AA 5U4NA 3NTYA 1A49A 3UR2A 3B40A 1IE7C 5CSUA 1VIWA 1OCQA 4L6HA 3FY1A 1EC9A 2GJXA 2JEQA 4B5SA 1UWIA 5HA7A 2EXOA 4PBEA 2BDQA 3BW4A 3IACA 5KMYA 5I79A 1HJSA 3DHPA 1WBJA 1ZNNA 4TX9A 2L5HA 2G41A 1AQ0A 4CVUA 5F4XA 3HMCA 1W3JA 3MV11 3GG1A 1U83A 4FMVA 6ALDA 1M7JA 3FW6A 2BB0A 1J6PA 3BK0A 1HF6A 3MS8A 4Y90A 3W1TA 1JJKA 4BKNA 4DUOA 4C6KA 1AMKA 4BI6A 1UR3M 4Q4MA 2DJLA 1CLKA 1GG0A 3RF9A 5CEWA 2Y63A 4EX4A 4YHGA 4S38A 4PL2A 1N8FA 1F3WA 2D0HA 5LNVA 3W7RA 3BCJA 4EXBA 2P0IA 2NUXA 4ZQRA 1O12A 3W82A 3UR7A 1TTPA 4OT7A 2Y8UA 4P8XA 5DCBA 1G01A 2OMAA 5HINA 4F66A 4LUSA 1FWSA 2J7HA 1GW1A 1XGDA 2IPWA 2POTA 3PJWA 3BLKA 2Z00A 1OG6A 1DJHA 1U1UA 4C91A 3LZ5A 3HGRA 3WD3A 2YW3A 4Z1CA 4ASTA 3CT7A 4YVVA 5CC7A 5AC8A 3W75A 2DZTA 2ON3A 1FWTA 4IFKA 3AWNA 2CBUA 3MQTA 2FPYA 4BQ4A 4NZFA 3VDBA 3O06A 3LCHA 3B06A 3W88A 4M19A 3STGA 2PF8A 1IT0A 3WK3A 2ZX7A 3GC5A 1EKOA 1VJSA 1OCBA 3CUGA 2IKGA 3UERA 5M5DA 1GVYA 3PFRA 3W38A 4JY9A 3N9SA 4NRSA 1QPNA 4H6EA 1BHGA 1HVQA 1KW1A 4TX6A 1ZPTA 3HPAA 3QPYA 3BV4A 2OX4A 1EP3A 2YA1A 1PTGA 3SJNA 3HF3A 3EYPA 1Z3NA 3RM9A 1MMFA 1RVKA 3QVQA 3R0DA 4RZ6A 2UY5A 3MVIA 2J7DA 3N25A 3A9IA 3PZ9A 2V3EA 4GJJA 4GGBA 4XV0A 5G5IA 1Q65A 3CGTA 1UASA 2ZTKA 2GLKA 1DQUA 5TAOA 4ACZB 3WQFA 2IQ0A 4D9PA 1S3TC 3CUIA 4C1NA 2GDUA 5HANA 2BHZA 1ZHAA 5I3HA 1J6OA 3DU0A 1TPFA 5D2VA 5GNXA 2NLYA 5LA0A 1H5VA 2DZWA 2AQWA 5A5WA 4GUFA 4IJCA 2XFYA 1TTQA 3U5YA 1KQYA 1LL7A 3KLKA 1I9CB 4Y8FA 1UZDA 2OEKA 4GBUA 3W7GA 2R1NA 1YXYA 1JRBA 4ZO7A 5A1AA 4QG6A 4BQ5A 4LWWA 2EPHA 3W27A 4OKDA 3S1WA 1OBAA 3C2FA 4LOCA 1A53A 1PDZA 2RFGA 1OYBA 1K77A 4M5PA 2CU0A 4N6EA 3N15A 4MM1A 1UKOA 4AIOA 3H7UA 4UTWA 2WMKA 2PDUA 4HTBA 1XR2A 3KWXA 3VIJA 3WLHA 1V0NA 3LRKA 1DJWA 3ATZA 3H21A 3P67A 1OC6A 5H8MA 2XH2A 3V0SA 1XBVA 2NV1A 2PCEA 1Q6RA 1VRXA 1YE4A 4PC8A 1OD8A 4NILA 1E3ZA 1E5NA 1MWOA 2DVXA 4FALA 5A6SA 2QEZA 4H00A 5IOBA 3KL5A 3WNNA 2YB1A 4LSBA 5M1TA 4OTKA 5FF3A 3LCGA 3SADA 4UCFA 2Q6ZA 1B90A 1U5HA 1G94A 1E9IA 3GTIA 4O15A 2ZRVA 5AHNA 1SJDA 2VCBA 3GTNA 3PN8A 4NNCA 1IWPA 3AJXA 3VDGA 1FWWA 3RU6A 1B3ZA 3R5EA 2VDHA 4IQEA 4I7VA 4PMRA 3LI1A 1Z48A 1PZ1A 2QS8A 4WD0A 4RUBA 3TEVA 1XXXA 5EU9A 3FA5A 5DCEA 2OTDA 4DRSA 4Z1AA 1SZNA 1N82A 1XIMA 3AMLA 4C6FA 4DJEC 2GSJA 3BH4A 4AX6A 2J27A 3DC8A 1ZAJA 1QMLA 3K4WA 1YXDA 4N7QA 4H9VA 4UUIA 1EGZA 1OIFA 3UNTA 4H7ZA 4ADSA 4S3JA 2EG7A 2FJKA 4GNKB 4XVDA 4Q8OA 3EKGA 3T2QA 5A6BA 2GGHA 3BAKA 5D30A 2XHYA 2WMHA 2BVWA 4IICA 1KTCA 1E4NA 3UU0A 1AZ1A 2HPIA 3W1RA 4EWJA 3HMJG 2OOFA 4F9DA 1H3GA 1W3TA 1EUNA 3WQCA 3T8LA 1F76A 4HOZA 1NM9A 1UMLA 1JAEA 1EDGA 3M0MA 4KFNA 1RXOB 3VNZA 1UZHA 1Q5MA 3U5UA 3TSBA 4AW7A 1KXHA 2XIBA 4REQB 1N8IA 3URQA 3OVGA 2J25A 3W6MA 9XIMA 3QM3A 1A5BA 2PAJA 4ORIA 2QVNA 4M0XA 2G96A 1EC7A 3WNOA 4MAZA 2GFTA 2E1DA 5C7HA 4JFWA 1HJQA 1L8PA 1DQXA 3LXAA 3KHDA 3OQEA 4P7LA 3LSCA 4HK7A 4WSHA 5D03A 1EP1A 3ISIX 2HRWA 4E8DA 4B2DA 2NX9A 2C91A 1WAUA 5CPOA 4C7FA 1JG9A 3VFLA 4XBKA 3O7UA 4Q7IA 1GTHA 3PUOA 1NELA 3VOFA 2X40A 4GO8A 3WQWA 3PBMA 5M17A 1M7OA 1XG3A 4PODA 4UXDA 4FS9A 3WBYA 5FSEC 2ZICA 3CHCA 3M47A 1O1HA 3BL3A 4MYAA 3PZOA 3O16A 1RQBA 4LF2A 1DWFM 3AYRA 3RAOA 3EKZA 2DEPA 3ITYA 4UTKA 3IJ7A 3LZ3A 3NOEA 4A8LA 3ZJ8A 3EA1A 4GC3A 1ITQA 1DWAM 3OB8A 3BANA 3CC1A 2BXVA 2VZTA 2X7WA 1V8EA 3QLDA 1UH4A 2HE8A 1KNWA 1E0VA 4C1LA 4IIEA 1ISZA 1UH2A 3ZMRA 3EEGA 2C7FA 3VD3A 3VVGA 1QI2A 2NQHA 1G1YA 1FQ0A 2O92A 4UR9A 4TO8A 4Y9NA 1Q6EA 5HNUA 4B3KA 3E74A 3T4WA 3EDFA 2QCNA 3R1ZA 2FIQA 1A0CA 3FN9A 4W5UA 1BAGA 3W7LA 3P80A 1A5CA 1TZ7A 4JCLA 1AMYA 5E9XA 5CPMA 3G0XA 1XJBA 2VENA 5I00A 3M0IA 4XO6A 1CXKA 4V1XA 3TP4A 3ZR4A 5E0FA 2CZEA 4EOUA 2GGEA 4TX8A 3N3MA 4FIRA 3N29A 4A6GA 2PDMA 5DLCA 3T42A 3UPMA 4A21A 1VPQA 4IP5A 2WYSA 4GKLA 2F8QA 1OIMA 3W1UA 4RDYA 4ZB5A 3WJXA 1YLVA 3KHJA 1M1BA 1XYLA 1WZLA 5L6UA 1XC6A 2FZNA 1C3FA 1TTJA 3A6OA 3BC9A 1UD8A 1EGMA 3M0KA 3BG9A 4CNSA 4RR4A 3QR3A 4YTUA 4URIA 3SCNA 3LPGA 1EJSC 4Z2LA 5DMNA 5EMJA 5D4YA 1CTNA 3CWHA 3RR4A 2QMJA 5I77A 2R6OA 1M9HA 3SFWA 2A7NA 3IARA 5IDIA 1VENA 3CMJA 2ZE0A 3FGCA 3W7NA 1W9PA 3T9PA 1VAHA 2XPKA 4J3UA 2XIMA 3QY6A 4US6A 1OY0A 3VNJA 3QGAC 4LUTB 4ALDA 3TJIA 2PZNA 2HMCA 4HCLA 3IJ9A 3L65A 1QI5A 3S83A 3C3UA 4Z2KA 2WHMA 5A69A 1QPKA 4U3CA 4V2XA 1KGXA 3B03A 4L65A 4WJ8A 4AD0A 2ZXBA 5BOOA 4LTSA 1S2AA 2O4MA 2C1IA 2ABBA 3TDFA 1H09A 1GZJA 1E71M 5REQB 4R9OA 1W3LA 1XLKA 3FHQA 3NWRA 4J5NA 4CQ9A 2V0TA 2WNWA 1HGYA 5F4WA 1GNXA 3MW7A 5LIKX 3ARQA 3NQGA 3SJ3A 3O0FA 2DDXA 4C90A 4YS1A 3UYCA 4IT1A 5K9DA 4AH7A 4ICCX 2E5DA 4M82A 3GU2A 1SZFA 3IK4A 1XDLA 4UOJA 7REQA 1XHGA 1DORA 4KWSA 5E9AA 1IXNA 3UWYA 4CNOA 1GOKA 4S39A 2Z1VA 3KTCA 4R3UA 4JDYA 5CG0A 3GW0A 7XIMA 4IUGA 1YQ2A 1TYGA 4IQLA 1I60A 3NQ2A 1W8SA 1QPOA 5EGRA 1SFSA 5GVJA 3IWPA 2DSVA 2PDCA 3TW7A 4ACYA 3EOLA 2TMDA 3WK0A 3H70A 1E6PA 5T9CE 3UY8A 3RX4A 3VUSA 2V2HA 2VYOA 3CQJA 2Z7GA 2Y5EA 3V5CA 4ROQA 4AB4A 3RXZA 1XIIA 2ANUA 4WSJA 4LUJA 2EF9A 5LIUX 3HQ1A 3WF2A 1MW2A 3FSUA 4WDXA 1UWTA 3OHIA 3H7RA 3QV6A 3QKEA 4DAFA 4M6PA 4GY0A 2XH7A 2D24A 1OFPA 5T8GA 2ASHA 3NOYA 1UWAA 2Y62A 4N0RA 1FHUA 2ZRYA 1ZU8A 4FX7A 1UP2A 4U5KA 3GNDA 4PMQA 2BGQA 4B5VA 2A5HA 2D69A 3FOKA 3TVAA 3N17A 3FDKA 4P7QA 3WH6A 1VS1A 3DG7A 1DPMA 3ZVHA 1REQB 3D6NA 1FP9A 3NVTA 3CWOX 4PYSA 1RPKA 3C8FA 4B15A 4IGSA 3ARRA 4Q8PA 3P0XA 3AIRA 4ICNA 4HSNA 4ACZA 1E1CB 2BTMA 3TSMA 2QHAA 2VELA 3QV8A 4EVZA 1MSSA 4PGLA 2GPTA 3KOFA 4IFOA 4OE7A 5KSWA 5DCDA 2HK0A 3U4AA 2X30A 1TPDA 4NKCA 4GI9A 5A6JA 4AQLA 3KW3A 1EL3A 2V63A 1UC4A 4MWAB 2XGZA 3MHFA 4I3GA 3PR2A 1VH7A 3IJ8A 4GVGA 3R7MA 3TC7A 2ZWYA 1EHAA 4J28A 1V0MA 4JQAA 3UGRA 5JH2A 4AMCA 1MQQA 5I0DA 3U0HA 5GJMA 5FOOA 1DWIM 3G1YA 2D3NA 4GX8A 1BSLA 1RBAA 3AZSA 1C9DA 1RLCL 3M4HA 3W26A 2Z25A 1US0A 4XO7A 1BPLB 5A8QA 5IFPA 4L56A 3EPMA 1DJNA 1UJPA 2ZOXA 4I5XA 4Q4PA 4E5TA 1R9YA 1DE5A 4PUWA 1Y8BA 3SI9A 1E1EA 1S1RA 1V93A 5LNRA 3GH7A 1JFXA 3W7IA 1V7YA 1BF6A 4KKXA 4N9DA 2QPXA 4EPDC 3ZZ1A 5IDZA 3BUVA 3EWXA 4UIOA 1DIDA 3PBVA 3ABQA 2J6VA 3CEPA 3S9IA 3TZNA 3TU9A 1GCYA 1IIGA 4R7JA 3KRUA 1MW3A 3WK1A 1JEZA 1E0UA 4OBTA 3HA1A 1DVJA 2DU2A 6ENLA 5CBIA 3STFA 3WD0A 3ANYA 3IS4A 2GJPA 1O66A 1FDJA 3CH9A 1QPQA 5ABTA 5E70A 5DFAA 2XN2A 1YDVA 3G0UA 3OTRA 3GHSA 2HSAA 2WJEA 1MYRA 1FWHC 2Y5JA 2FTPA 3SCUA 1W0MA 1CZ1A 3ANVA 2IPJA 4GA8A 4LJ3A 2VFGA 3MPGA 3G1XA 4DUVA 2FQIA 3EDDA 1KM6A 1FA2A 4TVUA 4MOZA 2NV2A 1EIBA 2YCJA 1KO0A 3VNYA 3GXIA 3E0LA 3UEQA 3WLTA 2PMQA 4WX2A 4GISA 2CLLA 2BHUA 4HT3A 1FFRA 1Z6KA 2DP3A 4IF2A 3LHZA 4TOQA 4KBXA 3W25A 1MXSA 1VBGA 3AMGA 3UCDA 3OEXA 2H8ZA 5D8ZA 3DGBA 2QAPA 5EMMA 1V03A 2VTFA 4UTTC 4IG2A 3RMJA 2QNEA 3EOEA 4MZYA 3T8QA 4FB7A 4PUEA 4KT2A 1XH1A 4TTUA 4REQA 1F73A 5F2GA 3B8DA 3S4TA 3B0VC 4V27A 3URAA 2BWGA 3C56A 1W1PA 2PDHA 4HQVA 4MLRA 1WDQA 2WMFA 2J66A 4HP5A 1TWWA 2HK1A 1QAPA 2V82A 1V6WA 1IT7A 4AX7A 2VD8A 3ITVA 2AGTA 4DJFA 1L6WA 3LPFA 3GFZA 1Q63A 3AC0A 4IL2A 3CAVA 3CUHA 4Q8VA 4S2CA 1DP0A 2OWWA 3WLMA 5LNWA 4AZHA 3RR1A 2X1IA 4MB5A 3VDAA 2VVNA 2X05A 1R2TA 1EF3A 1JZ4A 3GVQA 3NNTA 4TTGA 4LBUA 2ZZ3A 2DW7A 4R53A 1V6TA 2NQ9A 3MYPA 3F4WA 4C6DA 3CJPA 3FA3A 3KL3A 4ENLA 2A79A 2C14A 4MNJA 4GZEA 3A13A 4UNIA 3H53A 1XRVA 3V18A 1SUXA 4HPHA 4JL1A 3DKJA 2OYMA 2W5FA 1LM1A 2FHBA 2VT0A 1KFWA 1TPUA 1DYSA 4P5UA 1H41A 3IJLA 1EJ7L 4LUYA 1R87A 4EACA 2ZDRA 3T6CA 4HGXA 5BMXA 2E25A 4KCUA 3TYUA 2W92A 2E6FA 4N2YA 3MI2A 2HCVA 4O1EA 1LWJA 4W5ZA 1CGTA 2OEJA 3NGFA 4W85A 5BWFA 4XAYA 2HXTA 3M6YA 1K8CA 1TUXA 3R43A 3QZ6A 4H9YA 3L5MA 1KTBA 5G2IA 4GX9A 4O4WA 1RSCA 3UWZA 1MEWA 2P3ZA 5B80A 3BURA 3GD6A 3S1VA 4YCPA 3CYJA 3A47A 3P60A 3W2NA 1BFNA 3H2EA 1M3UA 4MDOA 2CCRA 2QLYA 7PTDA 4FLSA 1Q7QA 1YNYA 3M5ZA 3LMZA 5D2XA 2YFOA 3FJ6A 5ECUA 1F8MA 5D05A 1K1DA 3CIWA 2XFWA 1YTEA 3H26A 3WL1A 4DZHA 2PTYA 4PTXA 1H7WA 3L0NA 3PZMA 3MSYA 3B9EA 3M0HA 3PNZA 1V6VA 3PAJA 3AHXA 4E2VA 2WWCA 3HPZA 2X2YA 2FHFA 5HDRA 1SO5A 3OIHA 2P5NA 5HMFA 1DWJM 1QPRA 3RLVA 3LG3A 3GVWA 2XWDA 3GG0A 5LSMA 1TMQA 1XYBA 3R25A 4ZL1A 1CCWB 4ZOAA 1PIGA 1CECA 3QQWA 5J5DA 3APGA 1QNSA 1JDDA 2V5BA 3W28A 2VC6A 1JCJA 3EMZA 3NUKA 3VZXA 3R0KA 4C5YA 1WUEA 2NX3A 3MDUA 4WXYA 4QJ5B 2Y7EA 1RR2A 3DZ1A 3HJZA 1FFQA 4MG4A 4AD2A 4QLJA 3UWEA 2O9RA 1ZJAA 1VF8A 3T0CA 4FXSA 3IIOA 4LBRA 1KFBA 1CIUA 1LUCB 4L1XA 1TJ2A 2FMOA 4BF7A 1TRIA 2F2HA 1WPCA 2OR2A 1OYCA 2AOSA 2Z29A 3FV9A 1B3XA 3WNPA 5A6AA 1KM3A 3OU8A 2PGFA 1I6NA 5A8MA 4J27A 1TJ1A 1JGIA 5I07A 9CGTA 4JIQA 2V6AA 3PWGA 3RCYA 1QK2A 2R9RA 1JD7A 2XUCA 4KEZA 3KS6A 4RE0A 3S5ZA 2VI0A 2WBKA 2O4QA 3HPXA 4XZNX 1SO3A 3FCPA 4GINA 3UXKA 1JF5A 4UFLA 4A3RA 1NWUA 1QHOA 2VJXA 5REQA 3VDHA 3VIKA 3VINA 2O56A 4NYUA 4YTQA 3TQPA 3UWVA 3VZZA 4C6NA 5C6MA 1NH6A 1NQ6A 4UFMA 4O12A 1IZKA 2CBJA 2FTYA 3W2JA 1BXCA 2I5QA 7TAAA 1V6UA 1BYDA 2P76A 3PZNA 1T8QA 4DXXA 2WKGA 3DEQA 1KRCC 3TLQA 4FR6A 5CXPA 5AFDA 1G7UA 3T07A 2V5LA 4KERA 2OOGA 3VTRA 4OVXA 2VR2A 2XZ9A 5DRCA 1FWEC 2D3LA 1QW9A 3CHDA 4K36A 4F8XA 3H2OA 3MP4A 1Z7AA 4KEUA 1TPC1 2VDIA 3IRDA 2E6DA 2GK1B 1W2VA 1B3YA 5I3DA 2EKGA 1TPH1 3LXBA 1PZ0A 1YDYA 1GYMA 3WQ5A 1O1ZA 2H90A 1SMDA 2E0PA 4JTRA 1LOSA 5H2ZA 3G1SA 3CPGA 1HL8A 1BRLA 2PRMA 3DERA 1QT1A 2DSKA 2DT1A 2YZ5A 4ZTXA 4O19A 3W2KA 3HPFA 4G8TA 1QTWA 3VIOA 4JHZA 2FGLA 5CAKA 1JCXA 3R2GA 4JQ2A 2ZZ7A 3ZWTA 1SJBA 4DM2A 5C8BB 3IVUA 3KM8A 5B7YA 1S3HA 1WXZA 3BO9A 3M0XA 3MUAA 3CS2A 1EXBA 2PP0A 5BXSA