4FQ0C

Crystal structure of flig-flim complex from h. pylori
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
KNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSYFPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flagellar motor switch protein
publication title Structural basis of FliG-FliM interaction in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Motor protein
total genus 20
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14841 FliG_M FliG middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.30 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4fq0C00
3HJLA 1QC7A 3USWA 4FHRB 4FQ0C 3USYA 3SOHB 1LKVX 3AJCA
chains in the Genus database with same CATH superfamily
3TW5A 1HVDA 4MDVA 1A8BA 1AVRA 4EVHA 1BCZA 1AXNA 3ANYA 3ABRA 1R8QE 4FHRB 3USYA 1YJ0A 3L8NA 1W7BA 2H0KA 2HSNA 1DM5A 1HM6A 1BC1A 1DK5A 4Q2SA 1C1KA 1AVHA 1A8AA 4L5MA 2K6XA 2OY9A 4A4PA 4JK1X 4MDUA 1YGMA 2HYVA 4D7QA 4Z21A 4FQ0C 2R0DA 2Q4CA 1AIIA 1ANNA 4JMOA 1BC9A 3LTLA 2R09A 4C0AA 4OIYA 1S9DE 1AOWA 2XO2A 3ABQA 2HYUA 3ABSA 1YIIA 1QC7A 1N41A 4KMUX 2IE7A 4JMIA 1ANWA 1RE0B 2VXGA 1BC3A 3HJLA 3AO0A 2ZOCA 1N44A 1BCWA 2IICA 3USWA 4D7RA 4EVFA 1LKVX 1BCYA 1G5NA 2RANA 1UPTB 2H0LA 2IE6A 1BO9A 1HVEA 1AEIA 4KN7X 1ALAA 3BRXA 4JWLA 3SOHB 2XO3A 1BC0A 1M9IA 1N00A 4KN4X 1Q8DA 1ANXA 1I4AA 1XT0B 4C7PA 1HVFA 1XJLA 4X9PA 2ZHJA 3SWVA 1W3WA 1XSZA 1HAKA 1W45A 1R4AE 1SAVA 2H0MA 1PBVA 2ZHIA 4HREA 2HYWA 1YCNA 3AJCA 1KU1A 1N42A 1AVCA 1R8ME 1R8SE 2QEZA 1MCXA 1HVGA 2II2A 4JXHA 3ABOA
chains in the Genus database with same CATH topology
3TW5A 4L5MA 1QC7A 3SWVA 2K6XA 4KMUX 4A4PA 4JMIA 1RE0B 4JK1X 1XSZA 3HJLA 1PBVA 4D7QA 1R8QE 4D7RA 3USWA 4FHRB 4Z21A 4FQ0C 3USYA 3L8NA 2R0DA 1LKVX 3AJCA 1KU1A 4JMOA 1BC9A 2HSNA 3LTLA 1R8ME 1R8SE 2R09A 4KN7X 4JWLA 3SOHB 4C0AA 4OIYA 1S9DE 4KN4X 1Q8DA 1XT0B 4JXHA 4C7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJL A;  1QC7 A;  3USW A;  4FHR B;  4FQ0 C;  3USY A;  3SOH B;  1LKV X;  3AJC A; 
#chains in the Genus database with same CATH topology
 3TW5 A;  1HVD A;  4MDV A;  1A8B A;  1AVR A;  4EVH A;  1BCZ A;  1AXN A;  3ANY A;  3ABR A;  1R8Q E;  4FHR B;  3USY A;  1YJ0 A;  3L8N A;  1W7B A;  2H0K A;  2HSN A;  1DM5 A;  1HM6 A;  1BC1 A;  1DK5 A;  4Q2S A;  1C1K A;  1AVH A;  1A8A A;  4L5M A;  2K6X A;  2OY9 A;  4A4P A;  4JK1 X;  4MDU A;  1YGM A;  2HYV A;  4D7Q A;  4Z21 A;  4FQ0 C;  2R0D A;  2Q4C A;  1AII A;  1ANN A;  4JMO A;  1BC9 A;  3LTL A;  2R09 A;  4C0A A;  4OIY A;  1S9D E;  1AOW A;  2XO2 A;  3ABQ A;  2HYU A;  3ABS A;  1YII A;  1QC7 A;  1N41 A;  4KMU X;  2IE7 A;  4JMI A;  1ANW A;  1RE0 B;  2VXG A;  1BC3 A;  3HJL A;  3AO0 A;  2ZOC A;  1N44 A;  1BCW A;  2IIC A;  3USW A;  4D7R A;  4EVF A;  1LKV X;  1BCY A;  1G5N A;  2RAN A;  1UPT B;  2H0L A;  2IE6 A;  1BO9 A;  1HVE A;  1AEI A;  4KN7 X;  1ALA A;  3BRX A;  4JWL A;  3SOH B;  2XO3 A;  1BC0 A;  1M9I A;  1N00 A;  4KN4 X;  1Q8D A;  1ANX A;  1I4A A;  1XT0 B;  4C7P A;  1HVF A;  1XJL A;  4X9P A;  2ZHJ A;  3SWV A;  1W3W A;  1XSZ A;  1HAK A;  1W45 A;  1R4A E;  1SAV A;  2H0M A;  1PBV A;  2ZHI A;  4HRE A;  2HYW A;  1YCN A;  3AJC A;  1KU1 A;  1N42 A;  1AVC A;  1R8M E;  1R8S E;  2QEZ A;  1MCX A;  1HVG A;  2II2 A;  4JXH A;  3ABO A; 
#chains in the Genus database with same CATH homology
 3TW5 A;  4L5M A;  1QC7 A;  3SWV A;  2K6X A;  4KMU X;  4A4P A;  4JMI A;  1RE0 B;  4JK1 X;  1XSZ A;  3HJL A;  1PBV A;  4D7Q A;  1R8Q E;  4D7R A;  3USW A;  4FHR B;  4Z21 A;  4FQ0 C;  3USY A;  3L8N A;  2R0D A;  1LKV X;  3AJC A;  1KU1 A;  4JMO A;  1BC9 A;  2HSN A;  3LTL A;  1R8M E;  1R8S E;  2R09 A;  4KN7 X;  4JWL A;  3SOH B;  4C0A A;  4OIY A;  1S9D E;  4KN4 X;  1Q8D A;  1XT0 B;  4JXH A;  4C7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...