4FQCL

Crystal structure of pgt121 fab bound to a complex-type sialylated n-glycan
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
DISVAPGETARISCGEKSLGSRAVQWYQHRAGQAPSLIIYNNQDRPSGIPERFSGSPDSPFGTTATLTITSVEAGDEADYYCHIWDSRVPTKWVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqcL01
2QKIA 4CN4A 4JZNB 4NM4H 2J8UE 4ZNCD 1FYTB 1RPQA 3B6SA 4TRPH 4WENB 3HAEB 2DM2A 2DBLH 2H8PB 3PDOA 4MJ6A 3MROA 3SKJH 4Y1AA 4FFWC 3SOBL 3JSSA 1F3RB 1A6ZA 4XX1G 3S3JA 3H7BA 3ZSTA 4CKVX 1EO8H 2LVCA 1EZVX 1CLYH 2IQ9H 1FLTX 5F7KC 1HHKA 1OLLA 4ZMAT 2HN7B 2IPUG 4B0MM 2MCPL 5I19L 5FUOL 1FFRA 2KQMA 1LQSR 1WIOA 3KLAB 2D7PA 1ZT1A 1MRCH 1OAXL 5F70A 2ZUQB 1V7ML 2EH8L 2JIXD 5JIIA 4YBQC 5ETUA 1GHFL 1NGYA 3MRCA 1T1WA 4YHIA 3VD7A 5CINL 1E4JA 1BQLH 1CGYA 5FYJE 3N1QC 4JKLA 1KCVH 1U95A 4NP4H 2DQHH 2FX8L 4LSVH 4UIKH 3V79C 4GAGL 3RP1A 4UV4H 3GIVB 4F3FA 2DWDA 1QFHA 2AEQH 5CGYC 3VFUB 4S10A 3U1SH 2W92A 5DVMA 3TPUA 4QO1A 3MJ7A 3BDXA 4OZHB 4Z7VE 3CZFB 3T08A 4HWNA 3DO3A 1PFCA 3HMXA 1BFTA 3MFFB 4HLZG 3WFBL 5HI4C 1VFAA 4X99B 4XNMB 4PJ7A 5T5NG 2ZSWB 2Z4QB 4KPHL 4M7LL 4TPRH 1GGBH 4MJ2A 4NC2B 5DC0A 5HDBF 3CCHA 1J86A 5DEFB 1LEGA 1GAFL 4CNIA 3CUPB 4OT1L 4GSDL 3TIEA 5F7FA 3P4MA 2AXHA 3P77A 4LQFH 4PV8B 5L88L 1FCCA 2P5EB 2Q3ZA 3MRFA 1W0VA 3N06B 1XR8A 3KS0J 4G9FD 3RZWA 5JIPA 4Y1AE 3T77A 1IAMA 1FZJA 2J7LA 1QR1B 2WUBH 2Y36L 2FX7L 1BD2D 2HWZH 3LKNA 3QPQC 4LDEB 5KSBA 5GRYA 1ZANL 1UWGL 2C26A 1A0QL 4MSWA 1T7XA 5ERWA 4MLIA 4APQD 4I18B 4JRYA 1ZGLP 3GSXA 3QWOB 3BH8B 3U7WL 2AKRB 4JN1L 4C4KO 4KQ3L 2ZOLA 5INCA 1JUFA 4Y19B 3EYSL 3U9UB 3WFEL 1OT1A 5DJAB 2SEBB 4NBYB 3OR6A 4ZS6C 5IW3A 4DK6A 3MRNB 3RDTC 2GKIA 3ORJA 4LSUH 3MLVL 4MYWB 5KSBF 3MGOA 3QUZD 3G5YA 4AK1A 4L8BB 4GMTL 2A6JB 1MNUL 7CGTA 4HFUL 4IIQC 2AJVH 2IALB 3MRIA 3BDYL 3FB7B 4Z0BH 4KTEL 5LCVH 1I9IL 1A4JB 1NSNL 5KTEH 1OP9A 1I7UA 1R3IH 2X1XR 4NQCD 2BOBB 4EOWH 1PDKA 1YY9C 5DRNA 5I15L 1C8PA 4GRMA 3ECBA 4FXKB 5HYEA 5E2VH 3P4OA 1S3KH 1JPTH 4MA1B 2HT2C 3VXNB 3NBNA 5FIEA 1P7KB 5A16B 1GCFA 4PJ7E 4RNRB 4FZ8L 3ZO0A 5ID1A 4LEOB 3S9DB 1T04B 1WBXB 2M8XA 3KPNB 4L5FL 4LSTL 4Z8FH 1CXHA 1MCWW 3T0XA 4JG1L 5DD3H 2ILLA 1R3KB 3PWJB 1A1OA 1KJ2A 2QQQA 3CFEB 2GIYA 1S7SB 4JDTH 1ZHKB 3AREB 1CD9B 5MEPB 4U49A 4WWKA 2I07B 1V05A 4I4WA 3V7AE 4ISVA 4JFXA 2PO6B 5C0GA 1KCLA 1ZA3A 2IH1A 5KSBE 3AUVA 4M5ZL 4YDKH 4KRPB 3QHFL 2ZCHL 4BUHA 3HR5A 3LKPB 4ZUWB 3UJJH 5ADOL 4JRYE 3I6LD 4ONHA 3BE1H 2AGJL 5D1QC 3OKDB 2ZG1A 1T0NB 3ARBB 4K3HA 3VXQA 5LQBL 2X9YA 3S34H 3X3GL 5I66A 3R0NA 4AEEA 3RKDC 4GBXD 3QDGB 3NPSB 4Y89A 3TN0B 4QRRA 5I1DB 1FNHA 4CVZB 3ZZ1A 1VESA 3MODH 5L2KA 3IKKA 5FYKU 5IM7B 4X5XB 4DVBB 3MOQA 5HGAA 1INQA 5FM5M 2XZQL 1JGEA 5DJ6A 1AD9B 2YOCA 1ZKAA 4ZFZA 2VDLL 5TE6L 1EJOL 3EZ8A 4DGYH 1EA9C 5JOPD 1UM4H 5I73B 1T80A 4X4MA 1A9EA 5F21B 1IGFL 5FKAB 4CADB 3MV8D 4WW2B 1LO2H 3UJIL 3L5XL 5LXGL 2A6KA 1O7SA 2P7TA 3DX6A 2BRRH 5FF6A 1PKQB 5ACMA 4PLOB 1HIML 1LO0L 3O4LA 1F00I 1PLGH 2Z8SA 1DEDA 2QQLL 3SDYL 4FQJH 1OGTB 3SKOB 2WWMC 2C4FU 4EI5A 2FB4L 4YPGB 1XGTB 2WK2A 3TBVA 1D6EB 1W72B 4U0RC 3G6AB 4CMHC 4F7MB 1URLA 3B2VH 2XKSA 1FFPB 1LO3L 3HC3L 1VGKA 2CGRL 4ALAH 3GMMA 4RWHA 5C2BL 4Z7NE 2XIDA 2PETA 3U7YH 4GG6F 3LDBC 5GGVH 3KDMB 2G9HA 1YYMH 4JY6B 1A6WL 1NBVL 4QKXB 5IIEB 5AYQA 1A5FH 1XGPB 5C7XL 1CG9A 5J6GA 2HT4C 1CDJA 3UTZB 2F5BL 4YDJB 4X6CA 1PY9A 1NLDL 3FT4B 5I18H 3SCMC 3QUMA 4BA8A 2PR4L 5LGJB 1B4JL 2B20A 2F15A 5CP3A 4FQLL 4UI2A 3LQMA 1BJ1H 2WIIB 4QRRE 1FN4A 4FQHB 2DOCA 3EYVA 4WFED 4PJFB 1R5WA 5D6DC 5L2KE 2DWEA 4JFQA 3A6OA 3MREA 4NWTL 2X70B 1S9YA 1TQCC 2DWDB 1KEML 3MOAH 1NCDH 1NBYA 5A3ID 4ODBD 6CGTA 3X17A 1CVRA 3HB3C 5EPMA 4X4ME 1EAPA 1KFAL 3DMMA 3GB7B 5JR1L 3P3YA 3T0EA 3RWFA 5E1HB 3JUYA 5DURB 3T0VA 4K94C 5JPMA 2AVGA 4L8SC 3FQXA 4KK6C 3TH3T 4XCEB 3GUTA 2HRLA 5K93A 2ESVD 3O4LE 3V95A 3O3DA 4UV7L 1FJ1B 1FRGL 4XCFL 4HPYL 4NKMA 3PXHA 4URTB 1LEGB 1CVSC 4M6OH 5KBNC 4CNIB 5GRUL 3QCVL 5I1HL 4WHCA 5TF1H 3O41B 4MDJA 1MH5A 2VH5H 3P4MB 4UB0L 4BM7A 2C5DC 2FJFA 1HINH 3C2AL 3LQAC 3U46A 35C8H 1ORSB 1S9VA 4D9RD 2FNBA 5D1ZD 3PHQB 1YZZA 1EXUA 1RUKL 2V7NA 1EDQA 3PWVA 4ORGB 4RRPA 4TVSa 4IIQB 3RAJH 1H0DA 3Q6FB 1RVFL 2WUCH 3WCYA 5D93B 3KHOA 4YXKL 4JVPA 4H20L 4ETQA 5HHNA 2WAHA 3GSWB 2H9GB 3ZT7A 1YPZA 2Z35A 3D0VA 5F7EH 3MBEC 4D3CH 2AXFA 2J2ZA 1A7NL 4D9QE 5ESQA 1EEYB 2ID5A 3LQAH 2ZOLB 1FAIL 1I8LC 2E6JA 4U1HA 2IGFH 4X6CE 1UA6L 4J3XA 2DQEH 4N0UA 1J0JA 1I7RB 2BSRB 4C59B 1F3JA 1G7HA 4MXWL 3MGOB 4RFOL 7FABL 2NY0C 3HZVA 1I9JL 4O9HH 4DN4L 5FM5O 2V2WB 4POZD 1GXEA 4PJHA 3V0WL 4N5ED 5HHME 5E8OB 5MP6H 4IRSA 3VXUB 3VFRB 5KANG 3ZMRA 1JNHA 2Y23A 5DI8A 3ROLB 4JRXD 3P4LA 3D5OF 1YQVL 4PP2A 3T0EE 2LU4A 4H25A 3O81A 2GK0B 5L7XL 2JB5H 1UEMA 4RAHA 3ZKSD 1MWAB 4NQDB 5ADPH 3OXSA 5ESAA 3E3QC 1WC7B 4YHNB 4J8RA 4ELKA 5C07D 1FE8L 1A6VH 3KAAA 3EOTH 4ZUSA 1IAOA 5ENWB 3HAEG 3PV6B 1YQ2A 1SY6H 1RZIA 5I1GH 4FFVD 4JANA 4XH2A 1BIIA 5KG9B 4FQIH 3IETB 5T5FH 2J3SA 3BIKA 3GMNB 2OZ4L 3H3BC 4LP4A 4ODHL 4NNXA 4U6XB 4JQXA 4MHHG 4I4WB 1U8KA 2G5BA 4K8RD 3MR9A 4G7VL 3I50L 5E7FA 5JORB 4NO3A 3UTPD 4G3YL 2XPGA 2WZPD 2HJLB 4LSSH 1YPZE 2Z93A 3HR5B 1DL7H 4PY7B 1OAUH 4AYFA 3EUUA 4HS3A 3BZFA 4ONHB 3U4AA 5DRXA 3TFKD 4NN6C 1I1YB 3RWJA 1QO3A 3EJYC 2OSLB 1T1YA 4GKOA 4M9OA 5K9QG 4NQVB 4N0UE 1U3JA 4NUGH 1QBLH 3OMZA 2NW3B 2V7HB 3WXVL 4KZEH 3PGCB 1ODAA 4MQXC 4CMHB 4K3JL 1EPFA 5HGAB 2Y72A 2Z92A 1U91A 3AROA 1TZGL 1I9RL 3EO9L 3O6FD 1CQYA 2W07A 1S5IH 3LDBB 4KHXH 4EKXA 1OPGH 2RFXB 3L3GA 1VDGA 4MS8D 4PJHE 3ULUF 4HGMA 3TVMC 1DUYB 1JF1B 2H26A 5T3XD 1XCTA 1EV2E 4LASH 4NNYB 5J1AA 5GZOC 3S37X 2F53B 2AV7B 1BQHB 2ERJC 4M7JH 3S96A 1RUAH 1AQKL 4LCIL 1YNLL 3SDAC 4WV1C 3NIGF 4M8QA 1D5XA 2YD8A 1MJUL 2NTFA 1CZ8L 1IAIL 3WNKA 2X10A 4BZ2H 3FJTA 4V1DD 4KJWD 4BSVA 1MFBH 2OR8A 3ET9F 5DD6A 3KLHC 3TBTA 5CJQL 5D1XB 3ZDXE 4PB9L 4NSKA 4KKBD 2V6HA 5TE4H 5FCUH 4XPGH 4M5YH 1P2CB 4JGMA 3GRWH 3QRGL 1XZ0B 3TA3D 5DK3A 3P11L 1OAZH 2D03L 2FDBP 2P45B 4R4BA 5CLWA 1YNTB 5T3ZD 5I8KL 2Z8VC 4GRWB 4IRJD 4U1MA 4BYHA 3QR2A 4YWGL 1SVZA 2EEDA 4U7SA 1L6ZA 4OF3A 3ULUE 4F9LA 5FYKD 5EZIH 1WCBB 1G7MB 2EZ0D 3PWNB 2P24A 4P3CL 1J8KA 4HJ0D 3MLRH 4GH7B 2VQTA 4HV8A 3UTSA 2UYLA 3QDMD 3BP6A 4ZQKB 3RIFF 3RJQB 2OI9C 1BWMA 4LCUA 4L1HA 3I3BA 2IF7A 1FFNA 1U8HA 1YEIH 4P23D 1ED3A 4UAOC 2CKNA 4IDJL 4MXQD 2YZ1A 1ZTXL 3MV7B 2NY6D 3NIGE 1ZEAL 5E8PA 2CDFB 4JZJA 4DGIL 3SDXF 5BW7C 3GKWL 2A73B 1J10A 4OB5H 2YUWA 2VXQL 4FXGB 3TJHC 2EYTB 5GJTL 4TUKL 1CLYL 3UC0L 3O2DA 3EKCA 3BP7A 4PG9A 1BVLA 3ZTJH 5F1NA 2YXFA 4XWGH 2ADGB 5F93C 5JTWA 3FQXB 2NLJA 3MBXH 3ETBF 3GUTB 1IILE 4M1GL 2YK1H 4H5SA 2R56H 4QNPF 4WTZG 2FWOA 3WUWB 4FFYH 1AKJD 3NABH 1TVBB 1A6UL 3GSQA 1DTUA 3C9NB 3MCLH 3EBAA 3NCCB 1B90A 4JO2L 4NQUA 4QRSA 1ZWIA 2M26A 5FDWA 1JGDA 3D2UA 3CDGA 4OD1L 4NO5B 2NY0B 5IQ9A 3O8XD 1T5XB 1BQUA 4LLYB 4W6YB 3SKMA 2F54B 3FO0L 5E8EA 3RVXD 3BW9B 1MHEA 43C9A 1N4XL 3AS2A 1KIQA 4UIKL 4OZ4A 1SYVA 3LKOB 2VLMD 3U0WH 5FOBB 2EDHA 4JHWH 3HE7A 2AEQL 5HHNB 4GW1B 3H9HB 3H0TB 5FAAA 2W9DL 3F5WB 3SDCA 4DN3H 5L2JA 3QQNA 4R96B 1T1ZA 1E27A 5MENB 3GSUB 4FQQA 3TIDB 2VERN 5TQ2L 3MRQA 1SEBA 1W72L 3BD4A 3QI9D 1K6QL 4N9OB 1XEDA 3FT3A 2EYRA 2IFFH 4MGXA 3UTSE 2YPLA 3GIZH 4X7SH 2AK4A 4HIEA 4N1EA 3T2PA 5GS0D 5LJYH 3AS1A 2ADFL 5L8KB 1MI5D 3SGEH 1NGZA 4QNPE 4Y0GA 1D5BA 3KPRA 1TMCB 4L1DA 4HX1B 1V3JA 2GFBA 2JB6A 3FN0L 1C5BL 4OZFH 1ADQH 2KKQA 3ZKMC 3KVQA 4GW5B 1V3KA 5CP7B 1KLGA 4M7ZB 1PQZB 2VDPH 4G42A 4R2GD 3RPIB 1AIFA 2B5IB 2C3VB 3L3KB 2VLKB 1A21A 4NN6B 1DN0A 2Y9RT 1GH7A 3P30L 3WEXB 4XPAL 5DEZA 2PYED 5JW3H 3OXSB 1MJJB 4ELKB 2Q7NA 3CLFH 3CNKA 2JJTA 3G5XA 3MJ9A 2X4PB 3OAUH 4NKIH 1JNLH 2Z31C 1JWUA 1FO0A 3IDGA 4JY5H 1XGQB 3TO4A 4OZGA 1BGXH 3G08A 5KVEH 4KK8D 1U8KB 3MR9B 4NWUH 2AXGA 3D87B 4XZUA 4Y16D 4NQEB 4Y4HC 5GZNC 4NRXB 1DVFA 4Z0BL 1L7IL 1U3YA 1G7LB 4U6YB 1LILA 1QG3A 2DI7A 2A74A 1U3HA 1UJ3A 5KTEL 3FHQA 1OGAE 5DRXB 2ERJB 3AXLA 2I25N 4M62L 4PLKD 1EERB 5GS1A 4JR9L 4EI6B 4WV1B 3HR6A 4LSPH 2BDNL 4PJEF 1A7RH 2IANB 3OKKB 3OXRB 2H2SC 1ITBB 4XCNB 1YEFH 4OZGF 2AJYH 1EFXB 2YPLE 2AK4E 1KB5B 5EOCJ 1CXFA 1PAMA 5FEBA 3LD8B 1U91B 4WFGD 4Y4FC 1FBIL 2ZKHL 3LN4A 2Z91B 4IS6B 2RGSA 2YD1A 3IAQA 4MJ5A 4UTBL 3KPRE 3LKQA 2HTKD 4WW1B 5C0JB 3JTSB 3IDJB 1QVOA 4MD0B 1YEGL 3VGHA 3U2SB 2EICA 3VRJB 4BSWA 4WFFD 3EAKA 5GPRA 4HKBA 4QOKA 4D0CA 4YDKL 3FQTB 5HYQA 2J6EH 3L3HA 2PUQT 5ICZB 4W4OA 4A6YH 3MLWH 2NTFB 4BZ1H 3I3DA 4NZTH 5IBLD 2VITB 4HWBH 3S34L 3VI3F 4QXUL 4UUJB 1UKSA 4H1LA 3BT2H 3NAAL 4UAOB 5CJOL 3WFZA 4LCWB 1K8DA 1VADA 4RFNC 3FFDA 5DD6B 3P9WB 1X6NA 4U1JA 4PRID 5IQ7H 3BKJL 4OZGE 4R97C 4CN1A 4OQTA 4DAGL 3F7PC 4PGBB 5E4EB 5JDSA 5C0RL 5DJ2A 2K1MA 2LABA 3WNLA 1AE6H 1UM4L 1QQDB 1ND0B 3L5HA 1EIBA 5DT1L 1MWAL 4HCRH 3MXVH 2YMXH 4LKCA 1LWRA 3PNWB 4UQ2B 5EZLA 1MCJA 1PZ5B 1UACL 5EBWA 3BZEB 3WS6A 4TUOA 4XP4H 3I02A 3G04A 5I2IA 5EIIB 4QWWC 4LHUD 2V9TA 3WLBA 1IEAA 1PLGL 4HV8B 4L3EE 3W11D 4X7CC 2UYLB 1LK2B 1LE9A 1SJEB 3CFCL 1S78D 3CAFA 4JREC 5KOVC 4CU7A 1FFNB 1U8HB 4ODUA 2K9UA 1ED3B 1WBYA 3ZDYF 3FB5A 3RVTD 1JRHI 1A7OL 2YC1A 4G9FA 5D5MB 1OB1A 4OD3L 1H3UA 5F3BA 4U6VL 3QDAA 5FGCB 2ICCA 4XCCL 4M9PA 1HHHB 5J57B 4HWEL 1GZPB 1IGIL 2OTWB 2XNAB 4HJJL 4KQ4L 5HHPA 4JLRA 5JQ6H 3VFSB 4APQA 1U8JB 2CMRL 2UUDH 5SWZA 2NLJB 3QWQB 3GBNH 4QOKE 3C5ZA 2VN7A 4HG4K 5TF0A 4HDIA 2YXMA 4MCYB 3SBWA 3DSFL 2VXSH 1S7VA 5D6CA 3ULVD 4JFZH 2P5WA 4FQPA 1BF2A 4X5WA 3U82B 3O2WH 4F8QA 2VDMH 4NUJA 3RL1B 4AEHL 1AQDB 1C5DA 2H2PD 3BESR 1MPAL 1N59A 3FT2B 3QZWA 1YN7A 1CLCA 4NJAL 3EDKA 3VW3L 3MRMB 4HIIA 5C0DA 4KY1H 4CAGA 4Q9QH 5CFHA 3V6BR 2LTQC 2RR3A 3EOYG 3T8XB 4D9LL 1QSFD 5INDB 2DQDL 5DYOA 4H88H 1Q9OA 2VISA 5AUMB 4LLUA 1Y6MR 2XA3A 3N9GH 3TBWA 5JMOC 2R0LL 4XRCA 2DM7A 4FQ2H 2K3TA 1SEBB 3KPSA 3KPPA 1DBJH 4CJ0A 4N5UA 4Z9KB 2Z8RA 1MRDH 4P2QD 1JFQL 2PXYD 5I71C 3RNKA 3H6JA 1LEIA 5BVJB 5TF1L 3FCTB 3LKRA 2QEJA 1RZJC 3QNZA 3K74B 2PN5A 4M6AA 1HXMA 1JP5A 2NY2B 4LGPB 2FRGP 4G9FE 2JB6B 5D7SL 1KXVC 4K94L 3K8MA 4Y4KB 1JV5B 4I0PC 3KPOA 4QT5B 1NANI 3ROOA 3HG1D 1J1OH 2X4OA 1BQHG 3F7QA 1FAKT 5SWZE 1DBBL 2EDQA 5E94B 4D0BB 1ES0A 2WQRA 3LQAL 1RZJH 2BC4A 1PG7X 4V2BA 5DMGC 2IGFL 1BAFL 3OJMB 1HDMA 2P5WE 2DQGH 4RWYH 1OL0A 4XBPB 4Z7OE 1PG7W 2FYYA 3TWCL 1QSZA 3OKLB 4HULB 3WD5H 1TXKA 4FNLL 5HI5D 1TVHA 4XAWH 1EGJL 2ATKB 4ZFGH 1UADC 2X4RA 4JG0L 3RGVB 1Z3GL 3IGAB 1XGYH 5F88A 3TO4B 3V52L 3QH3B 5F7LB 3TT1H 1IMHC 1MLBA 1I75A 4O9HL 2CDGA 1NKRA 2X09A 3MRBB 2XQYG 4K7PL 1DVFB 4L29B 4DKEL 1TLKA 3KHQA 3BQUA 4J6RH 4JHAH 1F4YH 5FO7A 1OY3B 5C09A 3I2CL 4J7RA 1GZQB 2X4QB 4TN9A 3G6JA 4Z76B 5IK3B 3KPSE 4DOHE 3NMEA 1RK1A 1FNSH 1W8OA 4UIMB 5DQJB 4GBXC 4U1NB 3UYRL 1UB6A 5F6IC 5JXEC 1TZHA 1OP5H 3SDDC 4N1HB 2Y07H 3KXFD 4TVPL 1ZHLB 5IKCA 4PYHA 4OV5B 1F11A 1BFVL 4R97B 5DUPH 2P47B 4FP8L 1QVOB 1U42A 2E27H 5GGSY 3QIBC 5KS9A 3UCRA 4P3WA 4Z95L 5BJTA 5JW4Q 3FFCA 3G6JF 3FRUA 1J1PL 1UG9A 2GT9B 2P49B 1R0AH 1DLFL 1F8TL 2XKNB 1RUQL 2DICA 4P3DA 5ACZA 1AHWC 3LS5L 3DVNB 3HE6D 2H41A 3U36A 3WUWG 3X13B 1A6TA 2JIXB 4XHJC 4OCYH 5CBEB 5GGTH 1QLEH 5A40E 1S7WB 5I1KL 3AAZB 3CVIH 3OJVC 1N2RB 2X9WA 4H26A 2VLLB 5IFHH 5K9KA 5D9SB 4JAMA 1RK0B 1EBAA 5KS9F 4PJFF 5I1AA 3GMRB 2ENYA 4O2FB 4XNQB 2FD6L 5ELIA 1YDPB 4KROD 3UPAA 4AY0A 5F9WB 1S5IL 1RJLB 5SWSD 3M1BA 1UEYA 3GGWA 3IDMA 1B0RB 4KI5C 1IM9B 1FZOA 4CVUA 5J3HD 5FYLH 4L8DB 5IEKB 3MV9A 1KTLA 4YFDB 1JYWA 3VH8A 5EUKB 1MUJB 2B4CH 5EZLB 5C09E 3ESUF 1JPSL 3RI5K 5BOZG 5E9DD 1NQBA 3G6JE 5IROC 4EQ2A 1I4FA 4YR6A 3BRDA 3GSVA 1RUAL 1T2XA 4JPKH 1LE9B 4LLWA 1AI1L 3T1FA 4F7TB 3IDXL 1A1MA 4F7CA 2HLAA 3JWOL 3NCJL 4IOFC 1Q0YL 3FB5B 4JFPA 3QAZC 4RZCA 1UT9A 4OLYL 1HHGA 4PR5A 1KENL 3WKML 3SKNA 5IB1B 2YZ8A 4OBRA 2JJWA 1WIUA 4M02A 4B41A 4CVXA 1BD2B 2I5YH 3PWLA 4I2XA 2LTQB 5A3IC 4HHAA 4JM4H 1K9TA 5J89A 5KS9E 4XPGL 4OUOA 4M5YL 4MB3A 3FFCE 2DM4A 4PGEB 4APQB 1EEZA 1NAKL 1GGYA 1S7QA 2CO7B 3W2DL 2WIMA 2E7HA 3QEGH 4ODSL 5BV7C 1NGQL 4G43B 5TDOA 2LVEA 2ZZUT 4LEXH 3V0AC 4PJ8A 5B39G 5E2JA 1KB5L 1HH9A 5LVEA 3VFMA 5F8QC 4YHYC 1EJ6A 3BGAA 4JFDA 3UPRB 3QEUB 3OL2A 1WIPA 5D1QA 5IGXL 1CE1L 4OCXL 4O02L 3QUZB 5EBLA 2Y4SA 1KCSH 4XCYA 1YMME 1RUML 3FRPA 5DLMH 3S5LA 4HIIB 2ITCA 3QUXC 5BV7H 5C08A 3SGKC 3QNYA 3F58L 3H7LA 4I0PB 5E6ID 4KKCD 2ZCLL 3ARWA 1HSBA 2E9IA 5DJZB 5LAXB 3LQZB 5BZWA 4YX2H 1W0WA 4JN2B 4NQCB 1XCQA 1FYHB 4MA8H 3MV9E 4WUKH 2OJZH 5DJCA 3B5HA 3MV01 3SQOL 3MBXL 2QV2A 3U0TB 4NO2A 3EJJX 3LV3A 1I7ZA 1IL1B 4HGKC 2YK1L 4XNZB 3I9GL 4HUXA 1LO5A 1Q72H 1MHCA 5E8DH 4POUB 5C07A 1I8KA 1S7RB 4F2MB 4HBCH 3LKRB 4PJBB 4JFOB 1H5BC 4OLWH 1UWXK 2NR6D 5ICXB 1HXMB 5BVPL 1JVKA 4DKFH 1AO7D 3HNSH 4NO0A 3MCKA 1KG0B 3ZT5A 4YBLC 2FO4A 1T0MB 1A2YB 4OFPA 3KPOB 1WT5A 2DJUA 1S7TA 2PTUA 3DJ9A 3NCYS 4I2XE 5DUBA 1HXYB 4LPTA 2GJZB 1ZVSA 3UP1A 2JKXA 2RHEA 5IEHB 1X5XA 4OCMC 4JHWL 1WLHA 3GM8A 3T0DA 5T1LD 3WIHL 4LCCB 1KUMA 3BPOB 3S36L 4XTRC 3QBTB 5KSAC 1ZT7A 4OAWA 4GUPA 2EE9A 3UZQA 3CK0H 3PHSA 3QXUA 1HDMB 4GBXB 3DX7B 1ZHBB 2BMKB 1INEH 4JFDE 4KMTH 5AZEL 3BUYA 2GTZA 3DVIA 4Z7QF 4H0HB 2R2EB 3GIZL 2F74A 3PUCA 1DQJB 2ARJA 4FFVC 3SCMA 5KSVA 1ZGLA 3C5SB 2X4RB 4K9EC 4CMMB 3GMQB 1OCWH 1ROWA 3GMOB 5JO5B 4XPHH 1I1FB 1S5HB 4K8RC 3QIBB 4GAFB 5C08E 3ZHKA 5D6DA 3NIFF 2EIEA 1N5YH 2YUXA 2VXVH 3MV8B 3L3JA 4JDVB 1OSPL 3ZKQD 1IEBB 3HI1B 1EEQA 1AHWB 5KJRH 3D6GA 2X4NA 4K9EH 1X5HA 5GS2D 5GHWL 5CJ5A 4LLVA 6FABH 1MCPL 1RZ8A 1U92B 2XACC 1JIBA 4L8SA 4HC1H 5TQ0L 1WFUA 1JWSB 3VWKC 5C07E 1HNGA 4WI5A 4V1DA 2R4RL 3DBXA 1RULH 3W9DA 4OUUA 4Y5XC 1U93A 3O6FC 5IKCB 1JNLL 4U33A 1JTOA 3O9WD 2HMIC 3MXWL 3W82A 3QFJA 5C0EA 1QBMH 3UTTA 1CGSL 1II4E 1X3DA 4MS8C 3QIWC 1NAMB 4P5TD 4TNWK 3TA3A 3O2VH 4FFZL 2VAAA 2NY1C 5J12C 4YHPA 1F4WH 2I60L 2X7LA 4X7EC 1VFBA 1MEXH 2V17L 1MCCA 4IRJA 2XY1A 1BZ9B 1TJIH 2VDRH 3C6LD 3IJYA 3NIFE 4WHDA 5HYJE 5EUOA 5IWLA 3VXTB 2Q7YB 3MBEA 2CLZA 4RGOH 1GGIH 4PGCA 5DVNA 4PB0L 1JPST 4DCQA 1IQWH 4HJGA 1WEJH 4P23A 3S97C 5AWNH 2H6PB 1RIHH 4Z5RA 1OTUD 2EXYD 2FLRT 1XF1A 3GJFH 4OCRH 2CIKA 2XZZA 4ONGL 2ORBH 4I3GA 1KIPA 2WINA 4PG2C 3WDJA 3M1BB 4P2OD 1AP2B 3MRGB 1BLNB 1GRWA 4R4FL 2O61A 1LMKA 1BM3H 4NOBA 3BKCL 1HYSC 3EYUH 1G1CA 4L8CA 4YIQB 4LVNB 4XB7A 4Q0XH 3G6DL 2VZOA 1KSRA 4XPTL 2ESVB 1N0XL 2VC2H 3MJ9L 3L5JA 1SY6A 2QSCH 3P40A 2HVJA 3A67H 4HJ0C 2R39A 1CE6A 1QR4A 2A6IA 2HFFA 4I1NB 4YHYB 3HZKA 1CCZA 4I48B 3T1FB 1DUZB 2BVEA 3QIUC 3FZUD 2IJ0C 3ARDD 1EVTC 4NDMB 5JXAL 4F7CB 5FYJU 5JW5A 3SN6N 4NZTL 1IEHA 3T04D 1Y18A 4NGHL 2NY6C 2DAVA 5BZDB 5D1ZB 4V1DE 5IFJB 3ARGD 1HHGB 3O8XA 4XMKH 5CCKL 4YXLH 1VGEH 4Y2DC 4LLMB 4N0FB 3ARPA 3OX8B 2XV6B 3DRQB 2VLJD 2AJXH 4J3WA 3MLZL 3QFJE 1R24B 5AEAA 1TJGL 3UTTE 4HH9A 1BX2A 5GSVA 5I0DA 1U8IB 2E7CA 3DYMA 3PHOA 1EEZB 5I74C 1UFUA 1N5AA 3IFNH 3MFGB 3D39D 4RDQF 4OM0H 1S9WA 1MIEH 4OGZA 1TENA 4Y5YB 2DQTL 4XP5L 3LSOA 4JFEA 5ITFB 3QI9A 3VWJD 3IFLH 4ZXBC 2M1KA 2W0FB 3B4NA 4PUBL 1UCBH 4FABL 3Q48A 1FP5A 4X0KA 2PCPB 4HD9A 4RGND 4JY4B 5I6XC 4N0YL 4MJID 4XBEL 4O58H 2NXZD 1H5BB 4O00A 1JGVL 4NT6A 4X9GA 3NACH 1MI5A 2V2XB 5L9DH 2CDEB 3NFSH 5EC2B 2F58H 2MQCA 1OARL 4OZIA 4YBLB 3TCLB 1QRNB 1QHPA 1DDHA 3ZT6A 1HSBB 4HSQA 3MRLA 4QXWA 4N9GB 4JRXB 4YGVA 3PGFH 1LDSA 1L0XA 3FB8A 5HGGS 1MCRA 3O11A 1J0YA 1QSED 3QJFB 2YPVH 2WBJC 4C56D 2YWZA 4U1KB 5IB5A 4NO2B 3TVMA 1I7ZB 2PYEA 4GAJL 2NY3D 2YEZB 2D4DA 1I8MB 4WIQA 1P84J 2HFEA 4JFZL 3SE3C 2VR4A 3RVVC 1FZKA 4J3SA 3U4BL 5DRWB 4MWFB 4XNYL 2W0LA 3EO0B 3GRWA 4WFHE 5DC9B 1OW0C 4IMLB 2EXWD 4TTDD 3SDAA 2UZXB 3QQ3B 1LHZA 1LO4H 1B0WA 4UT6H 5JOFA 5GGRA 2EEAA 4HFWA 3CH1B 1X9QA 1QFPA 4HQQH 1C12B 3E6HA 1P9MA 1S7TB 2CLVB 2R0KH 4OLVH 1H3PH 3OV6A 3EOBA 1I1AC 4R2GC 2GTWA 2DLFH 4CW1A 2FATL 3VG9C 3EFDL 3S8WA 3EDDA 3GMLA 1NJ9B 4LOUD 4AEFA 2AK1H 3RUGB 1YMHB 1MAML 4ONFH 4PTUB 1NC4D 5I1LB 5TE7H 4JFEE 5C0IB 1N0LA 4GXVL 2GTZB 15C8L 1DQDL 5D70L 1FVEB 3VXMA 5DHVB 4X4ZA 3A6CL 3WFDH 3F6LA 1MCFA 1LE5A 4P2RB 4R26L 5CAYB 4Y5XB 3O6FB 1HEZB 3OWEA 1MI5E 4XAKE 1CDCA 1E4KA 2NMSA 2FHFA 1RI8A 3C6SA 1P7QD 4RFEB 4OZIE 4JFFA 1FSKB 3DXAE 2APBA 5DR5H 3WSQH 2VB5A 1GC1C 3HNVH 2Z9TA 1Z6JT 4UT9L 2IBZY 4Z0XA 1EEUA 1KF9B 3DRTA 4JCLA 2BJMH 1UZ6F 4C54A 5KN5A 1LP9B 4M4PA 4PLKC 2HVKA 1V7NH 3N1GC 5K9JH 4JQIL 4F57H 4LPCA 4YXHH 5TDPB 2D31A 4X7TA 3LY6A 4R3SA 2V5RA 1RY7B 2BSTA 2EE2A 3WLWD 4AM0B 1S8DA 3DBXB 1P69B 2AERT 3V5DB 1GC1H 2VXUL 4NKOA 2WBWB 3DUSB 2AJ3B 3THMH 3B9KD 3IVKB 3TPKA 3PP4H 1QBAA 4L9LC 3KLDA 5ISZA 2ZJSH 1X5YA 3S88L 5ABDE 1IQDB 1DQLH 2B1AH 5CIPH 4ZFGL 2HTKC 5E95B 3TT1L 3EJZD 1XAUA 4MA3A 4AG4L 4PRNA 2EDTA 3PQYD 2X7LB 3CFDB 4LVHC 1VFBB 5EZOH 2EDNA 3OKEB 4KJPC 4LSRL 4KJQC 4PJ5D 1KPRB 3MLYL 4K23L 4J6RL 3BIBX 5TGBA 3WS3B 1CDBA 1I8IB 1CFTB 1CF8L 2ZOKB 2ICEB 3JV6B 3ARTA 5EUOB 3VGAB 1IGYA 1WFOA 5ESVB 1JPFB 4KGJA 2GCYA 1T21B 3QDMB 5IR1A 3PL6D 1HI6B 3LEYH 4WI6A 3IJHA 1VFMA 3DLQR 1UZ6E 1X4YA 2YRPA 4OZFA 4P23B 1ADQA 4MNQA 4HT1H 4L4JA 2NY6B 3VXME 3RZCC 1HOCB 1ONQB 5FA3B 4CU8A 1X5FA 4FQCH 2P8PB 2Y07L 4Q9BA 3L7FA 4X6BB 2W38A 4KV5F 4M1CC 5D5MF 5DUMH 5FDYA 5IVNA 1LNUA 5DUPL 2BNRD 3AMLA 1J0ZA 1DQQA 4JFFE 4FG6D 4OLXH 4PLJD 5C6TH 3EO1A 3MOBL 4L8CB 3A6BH 5I74B 1HKFA 1IGCH 2LE9A 3RWIB 1OWRM 4XC3H 1A02N 3QULA 1R0AL 1T2QH 2XRAH 2BVOA 4ZFOB 1J5OL 1J12A 4OFYA 2Q86B 1WWCA 4U1GC 1AKJB 2BOCA 3TJEH 5IFAL 3VG0L 5HGHA 1ZA6B 2J1KA 2B0SH 4M6NL 5MHSD 1N3NB 3N1MC 4JM2C 1RHHA 1QLEL 5BRZD 3MLSL 4PRAB 4QHLA 2OR9H 5MEOB 5HJ3A 3RVTC 3CVIL 4NJ9L 3L3DB 3RTQC 3O8XB 4AIOA 1NC2D 5ISZE 4P4KD 5F7MC 3QO0B 3GHBL 3JV4B 2CQVA 2Z31A 3RNQB 3FOMB 1X4ZA 1UZ8A 1FVDB 4JQVC 4KV5E 3FO9B 1YYLH 2DLHA 2L4OA 2IPUK 3TO2B 5FYLL 4X8XA 3NA4A 4HZAA 1CFNB 3DSNA 5EU5A 4GW4A 4UU9B 3DV4A 3OKMA 3QI9B 4Y4HA 5DJYA 1OF2A 1FGVH 3IYLW 1UM6L 1XH3A 3D9AL 2O5XL 3SE9H 4UDUB 4P2QA 4YHLH 3L95B 3WHXA 2O5ZH 4X0KB 4JPKL 4S1QL 3NFNA 3WIIH 2H2PC 2HH0L 2XFXB 3TYGL 1ITCA 1NAML 4KU1A 4MNQE 1OTSD 5HHXL 5IHLB 5GSRB 2P42B 5D72L 2FX9L 4IHOB 2EDLA 3HLAB 4NKQB 1G6RH 3R1GL 1M71A 1T03H 1DDHB 3GO1H 3OGCB 2J6EA 4JKPL 4E0RB 1ZSDB 1KNOA 4P46D 1Z0NA 4Y4FA 1OAYL 5D8JH 3HG1A 4YGVB 1NBZA 4ZUVA 2A1WL 2CO6B 1AH1A 1I1AB 3CFKA 5CD5C 4R2GB 5E5RB 5GISL 4A6YA 4DUXA 4NFCA 2HKHH 3VG9B 2OK0L 5FYJD 1BECA 4HIJA 3X12B 2PYEB 4NRZA 2J88L 2VUYA 4NC1C 1MFEL 2HFEB 1NDGA 4YDLC 1KJVA 1ZK9A 4M43H 4K3DH 3DO7A 1F97A 3U6RB 4GMSL 3ARRA 4HS8H 2XXMB 3RWDB 3C60D 4W6XB 4WDIA 5SX4I 1PX4A 4HFWB 3EYFA 4MQSB 3PP3H 4JGJA 5IMOB 2HFTA 4GRLC 2P8MA 2FEDD 2QR0A 4P57A 5SWQB 2VL5A 43CAB 1IBGH 4I9WE 4KWUA 4Y16B 1AD0A 4Y8AA 5IT2L 2B1HH 4P5KB 2V2TA 5DD5H 4K7FB 4OJFL 4DGVL 1TIUA 2C7UA 3IJSA 2PF6A 1DE4B 2IBBA 3DI2B 5DQDH 5LBSL 2L7UA 4J4PC 2OYPA 3SE8H 3BP5A 3JVGC 5C9JA 1TTUA 4PJCB 1SQ2N 4ELMA 2A77L 3X14A 3VXOA 4PREA 3TH4T 4Y1AD 1FNGA 3LMJL 4KVCH 3VFTA 4Z7UB 3BVNB 4P2QE 4PRHA 2ZPKH 1T3FB 4OQ1A 1KCUH 4IOIB 1Q9KB 5KVDH 2Q8AH 5CZVH 1KPUA 5CJXA 1OAKH 2JJSC 3FQUB 5CEZD 1F4XL 4L9LB 4YFEA 4OI9A 2XA8L 5J1SC 1MIMH 2D0FA 2DQUL 1YA5A 2EO9A 4UBDC 3RL2A 2VABA 3JTTA 3O3BA 4OKVA 4LSQL 3BN9C 5F9OH 3H3PH 1CGXA 1DBMH 4EUPH 2EDFA 3ES6B 4ELMF 2VDNL 1JPGB 1H3XA 1QFWM 5D7JC 3QDHA 3CLEH 5JW4N 1RZKC 3L5WB 2HVKB 3RY6C 1XF3A 5L8JB 3VGFA 4G7YL 5IVXA 1U8NB 5EORH 2CJUH 1KJ3H 3MMEB 1RJYB 4NNPL 1KTKE 3QNXB 3EYOA 4PGDA 1D5ZA 5C0FA 5CZXD 1G0XA 5GS3A 1FNEB 3HZYA 2VSDA 4GKNA 5GQBA 3FONA 3ALXA 1HHJB 2VZ3A 2XTJE 5K9OB 4NQSB 4PRIB 1XIWC 3JV0A 4FMFA 4PJGA 1RUPH 3ILQD 5CSGA 5CSZA 2DL9A 4X98B 1RZKH 3MQIA 1SEQH 5C0NC 4P9HL 3P2TA 1ZLSL 4LVOC 2EE6A 5KZCD 4PP1D 5HYFA 1T4KA 4EQ3A 5JOEA 3BEWA 1WJ3A 2W9EH 3NIDF 3G5ZB 2BNQA 4OGXL 2WWKO 5A2JH 4F37F 4AH2A 3HCVA 2PW1A 5DD0L 3BD3A 4C55A 1DSFL 1AXIB 1CDGA 5E9DA 2X5PA 2GY5A 5F7HA 4LHUB 1TITA 4ELME 1IKFH 4PD4K 4KTDH 3BAEL 4PRHE 4HC1L 4WWID 2DDQL 2FGZA 4GQ9H 4K8RL 5J9PB 1FL6A 1TCMA 2H3NA 5KAQG 5IBTH 3GNML 2AJUL 4JRYD 3V7MA 3KPQA 1GOGA 3L5IA 4KUCF 5EWIL 3T0WA 4DZ8B 3PABB 4NFBA 5FUZL 1I7TA 4HF5L 2R69H 4RQQA 4ZSOA 3MLUH 5J3HC 3O2VL 3NFPB 1NLBH 3OPZH 1NMCB 2R2CA 1B2WL 2BVOB 4QTIL 1D9KD 4TOYH 3RWHA 2P44B 2ARJQ 5EU6E 4MDIB 2FBJL 2UVEA 4J1UA 3OJDB 3ARFD 1C7SA 5IVXE 1BOGA 2JCCF 3F7YB 3RIFK 5HGHB 1F6LL 1Q9LA 3MLXL 5DD1H 3FTGA 5IOPB 4G5ZH 4O5LL 1GGIL 1ZLVK 1F90H 5HJ3B 4HUUA 1FV1B 3V6ZB 1RIHL 5EC1B 5T3XL 3KJ4C 4O2EA 4PJGE 4OCRL 2AEWA 3DX9A 5DK2A 1QSFB 5LGHL 4PJAB 2AJZA 1T7YA 3UBXI 4TULH 3VE0A 2DI9A 3BPCB 3CD4A 2BNQE 1X5LA 2IBGA 3MRPA 2NZ9C 4G80B 4Q9CA 2E7LC 4IDLA 5A43C 1DANU 5SX5K 2I9LA 1WGOA 2DLGA 4N8CL 5IG7B 1D7FA 3SOBH 3RWEA 2HKFL 3CPLA 1H15B 1A9BB 3A67L 2PXYB 4ZFFB 4YDLB 4YO0A 4WWKD 4GXUM 1Z9MA 3C5JA 1CD1A 4XP9L 2MCPH 4HLZH 5I19H 1UKQA 2VZUA 5JMRA 5FUOH 4LNRA 3B9VA 1KIUA 3HC0A 3PJSA 2JCCE 3QQ9D 5T3ZL 1IKNA 1OAXH 4GAYB 5KSUA 1AY1L 4PJIB 1V7MH 3OBAA 5JXEA 2EH8H 3SDDA 4PRPD 5HGBA 2BCKB 5FYKL 1GHFH 3HG1B 3MRRB 4ZSOE 3A0OA 4O51B 5CINH 1KT2A 1D5IH 1YY8B 4NN5B 3WNNA 4JKWA 1R3LA 5GGTA 4OF7A 2EEBA 2FSEA 5MERB 5L2KD 1Q38A 3RWCB 2FX8H 4FQXD 4NRZB 2A6DA 4K7PX 4GAGH 5D2LA 5TFSL 3UAJC 2VQ1A 4G6AD 3GSNA 1VPOL 4JPIA 3E8UH 4F7PA 1JHTB 4E41A 1QNZL 3OG6B 4ZUTA 4QXGL 3K2UH 3EHBC 1OSZB 4O58L 3ZTNL 1W0YT 4EDXB 1JYNA 3ARQA 1AR2A 3TZVD 3NACL 3VXRA 3WFBH 5B8CC 5L9DL 4XVJL 3MO1A 4GT7A 4RAUB 4HKZB 2FGWH 4EXPX 4RBPK 3BEVB 5BQ7A 4ZFOL 4KRLB 1GAFH 2C7UB 1X44A 3OAZK 32C2A 4OT1H 4GSDH 4UMGA 5EU7E 3T3PF 2HG5A 5F1IB 5EOCL 3QXVA 1FVCA 2GSGA 1EHNA 3BH9A 5L88H 4JZOA 5IW1A 4N0RA 1CDHA 4ODVL 5F1OB 2X2YA 3VXOB 3VFVB 5HGDB 2Y36H 2ITDB 2KPNA 4QTHA 3S37L 3AU1A 5EBGA 1ZANH 4A2LA 1UWGH 1E28A 4JE4B 3V0VA 3WL9A 3IS0X 5IMKB 1K4DA 1A0QH 3KXFB 3KYAA 5C8JA 5FECA 4Z78B 1KPVB 1B6UA 1Q1JL 4L3CB 5D2NC 1Z5LA 1QZ1A 4ZAKC 3U7WH 3O9WA 5BCAA 4JN1H 4D9QD 5DFWH 4KQ3H 1N64L 2R0WL 2ZNWA 1GIGH 3LAFA 1LO4L 4UT6L 1KYOJ 3EYSH 5F7YC 1WTGT 3CSYA 4LVOB 1KLUA 4DK3A 4HKXA 4HQQL 5H35B 1L0QA 2VWEC 1NFDA 1NGXB 4KI5F 5AD0B 1L9NA 4NYLA 1NEZA 3WJLC 5IMMA 3MLVH 4MQ7A 4XPFL 3CVHB 3QFDB 4PRDB 2VO5A 3S4SA 3C6LA 1MHPH 3HE6B 1JRHL 1MQKL 3HPLB 3F7VB 4GMTH 1NFIA 5GS0L 1G7PA 1MNUH 3WFHB 4MVBD 1RV6X 4E42A 3BDYH 1TPXB 5D2LE 3VXSA 5TE7L 4KJYA 4EN3D 4KTEH 4PGDB 1AC0A 3T4YB 5C0FB 1I9IH 5ANMA 4GKNB 4QF1A 3FONB 4LIQL 4P2CG 1WAAA 4E41E 5I15H 3DMMD 4JO1L 3T0ED 1FGNL 2BZDA 4KROB 3VXRE 3CC5A 1NCAH 4I3RL 3U30C 2IBZX 4QCIA 5SWSB 3WNMA 4FZ8H 1QBBA 4U7MA 2DI8A 4LSTH 4L5FH 3VFOB 5LG1A 3BZ4A 4AENA 3B5GA 4JG1H 3V9FA 2QLVB 4ZPTB 3SGKA 3B8SA 5DA0B 4ORZC 3FAXA 3ZHDA 2NNAB 5E9DB 2DMKA 4Q6IA 4NKDA 3R06A 2IAMC 3MRKB 2C1OA 4K55A 4L4VA 1WAAF 3GBML 1DZBA 1ORQA 3WN5C 1U8LA 1FHGA 1IAIM 3NZHL 4X6DA 3HUJA 4IOSD 1S7XA 1I1CA 5E7BA 3QHFH 1G7QA 4XVSL 2ZCHH 3QO1B 2EXYC 3BUTA 4KRMB 2AGJH 3KJ4B 1WFNA 5I76B 5L8LB 4UILL 3VDAA 5LQBH 4NQXA 4WI2A 3BO8A 3X3GH 3MUHL 2X1QA 1JI2A 4HXBL 5GRWA 2NXYD 3SY0A 5FUCE 1NFDE 4MAUL 3MUGA 2W65A 2X89A 1KTDB 5ALCL 2XZQH 4PJDA 3RWHB 2H1PL 4WO4A 1NMBL 4NZUL 4X6DF 3HUJF 4X8JB 3U4EB 4XWOD 2VDLH 5TE6H 1EJOH 3KNBB 5H2BA 5IW6A 5FHAL 1BVKA 1D5MA 3W81A 4DFIA 1D6VL 4HUMB 5SX5H 1XF5A 4ZG1A 3OR7B 4N1CA 3VXSE 3ILPB 5CD3A 3LEYL 1OM3L 4IRSD 2PTVA 2X4TB 3B9AA 5ANME 3UJIH 5KSAA 2W0KA 3ARGC 3ARZA 4WJ5A 3WFCL 1JWMA 4HUUB 1WAAE 1HIMH 1LO0H 5T33H 2IFGA 2QQLH 1MY5A 3S7GA 5E6IB 2AV1B 1NKOA 4PJDF 2FB4H 4K3EL 4HUWB 5HVFB 5C6TL 4MNHA 4C56A 3DROA 1BZ7A 1T5WB 1LO3H 4MAYC 2UZIL 1BBJA 5EZJA 1MVUB 2CGRH 1VB9A 3MJ8B 2E8YA 3UXFA 5C2BH 3VWJC 2J5LB 4HIHA 4UTAL 3VGBA 5IV2A 2FJGA 5HBBA 1E4XI 4L4VE 5HI3D 3NGBB 3P9MA 3U0PA 1A6WH 1NBVH 4EZMA 3TBSB 3BJ91 1INDL 3BPLB 2NXZC 4MXVF 4X6DE 3HUJE 3SJVA 5C7XH 4YPJA 3LEXA 4YFLF 3O6LL 1AO7B 4L3AA 1CICC 5B8CB 3EW3B 2NW2A 1EMTL 1N8ZA 1NLDH 3VWKA 4OTXL 3ULUD 1XR9B 2AQ2A 2PR4H 3KPMA 1G0YR 1B4JH 3DX8B 4FQLH 5AYUH 1FZMB 5J13B 2Y6SD 2C4FT 5T1LB 5J7CC 5BS0A 1IE5A 4RBPH 3BPNC 3QIWA 2HTLD 4GOSA 1DP0A 4PJDE 3OAZH 1KELL 4NWTH 4KRNA 2NY3C 3RUGF 5DA4A 5DFVD 1KEMH 2BNUB 2CIIA 3GSNB 1F3DJ 3GJFA 4W4NA 4LLQA 5GRVL 5DHYB 4RGNE 1KFAH 2PNDA 4RAVB 4WVRA 5JR1H 5FO9B 1PD6A 4BH7B 2EXWC 1F6AB 4TTDC 2NPLX 2UWEA 4ZAKB 5HPOA 1RURH 1I85A 4X7FC 1XGUA 1RZGB 3UTOA 1UM5L 5GGVY 2QSTA 4UV7H 4XNUL 4HAGA 1FRGH 4MXVE 4XCFH 2C3HA 1J8HD 4HPYH 4U1SB 4NRYB 1KULA 1FFOB 3QCVH 2X4UB 1TTFA 3ZE1F 5EIQA 3ULVL 4UB0H 5EU4A 4LCYA 4DTGL 3C2AH 4TUJB 2A83A 3HKFA 1AFVL 4LHUG 2YN5A 5F9JB 4C56E 3X11B 4QRUA 3DTXA 1LP9F 2NY5L 4D0DB 1CIUA 4R4NC 2BVPA 2UWEF 4OLZL 4EBQL 1XGRA 2GQHA 4YXKH 1M7IA 2X4SA 3BFOA 3V0VB 1UYWL 1FDLH 3Q3GA 4R7DB 4U1IA 5FO8B 2EDOA 4KDWA 3SJVE 1A7NH 3HPJA 1FAIH 3HN3A 2N1KA 1KIRA 3KWWB 5DDHA 4P5TB 4OLUL 3ISWA 1NUNB 1QA9A 3CFBB 2E9JA 2QADD 4YHML 1UA6H 3IXAB 3HAEH 4OF8A 4Y8DC 4KMQA 1G9NC 3PWUB 4UNVA 4NYLB 5EO9B 4YNYB 4JJ5B 4L4TA 1NGWA 4CUCA 4OCSL 5BS0E 3S4SB 5IVZA 4RFOH 4PJ9D 7FABH 3IFPA 1U8PA 1I9JH 4DN4H 2IAMB 2R2HA 3OHXB 3V0WH 3ZE1E 4KK5D 5E6YA 3WN5B 4XC1L 2ZUTA 1BVZA 4PTTA 1K4CB 1UKTA 1YEKL 4XMPL 5I17B 1M05A 2JK5B 1IGTB 5F9DC 1CFQB 3QUYA 1F6FB 1Y6NR 1YQVH 3DOSA 5EBMB 3B9KC 1G9NH 2MHAA 3ARVA 1R5IB 3DGGB 2UWEE 4OLEA 1ZXQA 4ZXBA 1Z9OA 1AGBA 4MD5A 3T2OA 3NN8B 5L7XH 3EYQD 4XVTL 1MCKA 3EJZC 2BNRA 4P2OB 5D7LB 3S35L 4ENEC 5CMAB 5IB3A 1RQ5A 4ONOA 2EC9U 1OAQL 4KK9D 1FE8H 5HHOD 4LQ1A 3AM8C 4GS7C 3KYNB 2CLRB 1LEKA 3FO1A 3MZGB 3B9DA 3NCBB 2FH6A 2OZ4H 3D2UD 4ODHH 5ID0A 3BSZL 1J0IA 1C5CL 3PL6C 1XFPA 1ORQB 4WU5A 1C16A 2G5RA 5EORL 4G7VH 1QHOA 3ARDB 2WBJA 3I50H 1L7TL 1EFQA 1S7XB 4G3YH 3AGVA 4F7EB 3TT3L 2YSSA 3HE7D 5GGUB 4JPWL 3ARGB 1YUHB 3L7EA 5BXFA 4XI5C 3SDCD 2BFVL 2XWTA 1CL7I 1U8OA 1NC2A 1Y0LB 5EN2A 4HW6A 1VENA 2VLJB 2VLRD 4WU7A 1IFHL 3SE3A 1A4KA 1OGAD 1B4RA 3V4PL 4YHKL 3WE6B 4NQXB 1FL3B 2ATPA 4QRQB 4GKSB 3IU3B 4JPVL 3V8CA 2CRIA 3D85A 3WXVH 1HH6A 4FTVD 3VDBA 3D39B 2YPLD 2AK4D 3L6FA 4YHZL 3CIQA 4L4TE 2COQA 1TZIB 3EDEA 3MYJB 5I0ZA 1TZGH 4P4RA 3EO9H 3VWJB 5E6ZA 5H37G 2EKSB 3ZL4L 4JJHA 3KPRD 4QXTB 2F8XC 5HDLA 2HFGL 4M1DL 4PBWD 2Y5TA 4MJIB 4NN7B 3QA3A 3P0VL 2NXZB 3MNWA 1S9XA 3W5MA 2CK0L 1JZ2A 5I1IL 3IRZA 3BKMH 4GQ9L 1CICB 2AAVA 3TH2T 4RMWA 4RMRA 1AQKH 1T7VA 2XWJA 4LCIH 4OGAC 3RGHA 4DEPB 1YNLH 3TNMA 3E2HC 4MA1C 4HK0A 4HEME 3UPCA 3CVHL 2BNRE 1MJUH 1QSVA 3OZ9L 2KZ1B 1L4IA 1CZ8H 1QSEB 3IF1B 3L3IB 1IAIH 3AY4C 5C0CB 3EZJB 4MNHB 3LKSA 4G6JL 4JVUA 3IT8D 4YZFE 3TESA 1CFVL 1FQ9C 5TDNA 2ARWA 5CJQH 2NY3B 2ZSVB 4PB9H 4G6KL 3P9LA 4Z7WB 5IV2B 4F58L 3B2UD 3N50A 3AREC 4MD4A 3LRSB 2JELL 3QJHB 5CIPA 1A6AA 5AAMA 1HQRB 3P11H 1ZHNA 1QFWI 4OFVA 3PGDB 4AIZB 1KBGL 5LKNA 1CIDA 2D03H 1M6OA 1PG7L 1FYTD 2PO6C 3QXDA 5F71A 5I8KH 4O2CB 3H9ZA 2F5AL 4YWGH 1S7UA 4KRPC 3FMGL 4DKDC 1U3HD 2ICWA 2D7OA 4IMKC 4HZLA 1ETZB 5JUEL 4A2MA 3ARBC 3VFWA 3FQRA 2DF3A 1GOHA 4L3ED 5DRZA 3FQNA 1MHHA 1RZFL 4MCZB 5EA0L 2LAAA 3W0WB 4IDJH 1ZTXH 3UJTL 1MF2L 2XOTA 1ZEAH 4IJ3B 2APTA 4DGIH 1CK0L 1NC4B 2C4XA 3GKWH 2OX5A 4HLJA 5CHNA 4D8PB 3W39B 2VXQH 3H2WA 3OQ3B 4LF3A 5GJTH 1QFUL 4TUKH 2I9TB 5EOTA 3OG4B 3UC0H 1AGCA 5I73C 3MACL 4B7IA 3QDJE 2C3XA 3C60C 1IRAY 2VE6B 4WW2C 5MI0B 4OIIH 2CSPA 3N85L 4J23A 4N8VB 4M1GH 1T22B 3KYMB 4QOKD 1P7QB 1B6DA 2IEPA 3P0YL 2GITA 3HA0A 5DSCA 3I75A 3RZCA 1CT8B 3L3OB 1A6UH 5EO1B 5EU4B 5KVGH 5GGRY 3MRHB 1JNJA 2L0DA 3QUKB 1VACA 2IQAA 4JO2H 4M4RA 1D5IL 3OB8A 5JLZA 4OD1H 1QD0A 2DBJA 1LK3L 4KKLD 1AXTH 4KTYA 4AT6B 3FO0H 1A3LL 3GSRA 1YEHL 1N4XH 1V8HA 3DV6A 4XNXH 2BVQB 4AMKL 4YHOL 2W9DH 1NH6A 3E8UL 1X6LA 3B9KB 4MX7A 3ZYIA 4I3SL 3LS4L 4K71C 3K2UL 3MRJA 5TQ2H 5B38A 1EX0A 1W72H 2DYPA 5DGQA 2NY7H 4I5BA 5DF0A 1K6QH 5HYSA 3PQYB 2CUMA 3S3SA 2G60L 4ODWB 4OD2A 2VDOL 3RTQA 2KUTA 5FCSH 2FGWL 4GS7B 4PJ5B 2ZNXA 3D0LB 3D69A 3QEQA 3I6KB 4G8FA 2YD4A 3MUY1 2ADFH 5DO2C 1GJIA 1IM3B 1FG2A 3BP4A 3IFPB 3DYOA 2XQBL 3M8OL 4BFIA 1K5NB 4I0KA 4MNGA 4LPYA 3PL6B 1IAKA 3FN0H 1C5BH 4BKLA 4JQVA 4S1DC 4PTTB 5EO0A 3N0PB 1XF4A 4LLAA 3ULSB 1M05B 5E03A 4OCLC 1IVLA 1EHLH 5FK9B 4LAQH 4JM2F 1HWHB 3HMWH 2OL3A 5CEXB 4GFTB 5DTFA 1OQOA 5CEZE 3FO2B 5CJ8A 4GG8A 1QLFA 5SWZD 1HSAA 1MCQA 3RA7L 1NCNA 3D18A 3FN9A 3P30H 3C5ZD 3FB6B 4XPAH 1GIGL 2MQ0A 4PP1C 5D7KE 3DETC 5IB3B 5ITBH 4PV9B 1C08A 4KDTA 4R7NB 2P5WD 4KMLB 3SPVB 4E5XB 1JHLL 3TCXA 5J0BA 5FB8A 3GSNL 5KVMC 2XN9B 1D9KA 1F4HA 3T65B 5FA4B 3ARFA 5HDBE 1MHPL 2NCMA 1P4LA 3D3VA 3TP4A 3BKYL 1UVQA 4HK3N 3V5HA 2PYFB 2R1WB 5D93C 5BRZB 1L7IH 3K46A 1U41A 4HUVB 4M8VA 1SYSA 3JUZA 1TETL 4QRPB 1NC2B 5EN2B 5HDOA 4P4KB 1J7VR 4G8GE 5JW4R 2ZWLT 4M62H 3RBGA 1K3ZA 1BJMA 2FL5B 5I16A 2NZIA 4JR9H 3E2HB 2R9HC 2BDNH 4FZEL 3UTQA 1NCAL 1CQKA 3KPSD 1Q9WA 4LBEB 2HAZA 5E5MA 4PJAF 1RJZA 3OJ2C 4WNQA 5IB4A 4YBHA 1CFSA 2P8LB 4GRLA 1YEDB 2J8UB 3F62A 3QEQE 3GSOA 1A8JH 4BQ9A 1FBIH 2ZKHH 5BMFL 4UTBH 1RFDL 2WBKA 3OKOB 1AGDA 3IKCB 4QYOB 5IB2A 4MNGE 2OQJA 4J4PA 4NZDA 2PTTB 3QDGD 2B2XL 1YEGH 4DZBA 3FOLB 1HCVA 2EDYA 5F3HB 5IF0A 4QY8A 2VUOA 2CKBB 2FZ3A 2DKUA 4X4YA 2R1YB 4EUPA 3H8NA 5IJVA 1QOKA 1IGML 3KPLB 1SBSL 5F72S 1UWEL 3REVB 4ACPA 2R4SL 4KVNH 1XMWA 4P46B 4PRPA 5DHXB 2FR4A 5J6HB 4P5MB 3HHRB 2JJSA 5K33A 3AS3A 5HPMA 3F12B 2W60B 4QXUH 2VZSA 3IRPX 1DEEB 3NAAH 1K2DA 5CJOH 1X7QB 2EO1A 5GGSB 4XBGB 5TDNB 3QEHA 4FQXA 2NYYC 3BKJH 3LH2H 4X4XB 4DAGH 1AR1C 4YBQD 4U1LB 5E1AA 3LRGA 2G2RA 5D7JA 5C0RH 3D3VE 1BFOB 3IDIA 3BWAB 4WWKC 4QHMA 4XXCA 3WV0A 2DQFB 1R3HA 3RY6A 4OFKA 1M6OB 4X6EB 2G75A 2QBWA 4Z7VB 2H32B 5DT1H 5EFIB 1MWAH 5AAWA 1T20A 2YR3A 3C60B 1HQ4A 3IFOA 2EYSA 3TZVA 1CU4L 5F89B 4GG6A 3BQUD 4NC1E 3TYFB 1U2HA 1UACH 5GIRA 4LPVA 1R3JB 3UBXB 4KGLA 5C09D 5JA8B 3L9RB 1A22B 2C9AA 3OGOE 5E2WL 5T33L 1KN2L 3TF7C 3NZ8A 3CFCH 1MHHB 3FQNB 3TLRA 2ZUVA 2OTUA 1XIWA 4LLDA 4F9PC 3S4SG 3SO3C 1U58B 3NCFB 2QKIB 3RJDA 1DLHA 2IADA 5HI4D 1JF5A 1A7OH 4JFHD 3B6SB 3H9SA 3MLPA 4OD3H 4MJ6B 4M7KH 2D3VA 3JV5A 3PDOB 3MROB 4U6VH 4Y1AB 1VKXA 2UY7A 2R2BA 1A6ZB 4G6AC 3H7BB 5D7IF 1EO5A 3EOAA 5DJDA 4XCCH 3JWNC 4HKJA 4HWEH 2UV3A 1IGIH 4HJJH 4KQ4H 1B9ZA 3T0AA 1A1NA 1WWBX 2IH3A 5CBAA 1ZS8A 1HHKB 2CMRH 3FFCD 4K71B 1RIUL 1OP3K 1ZT1B 4JO4L 5SV4A 1UXSA 4YQXL 3DSFH 5IHZA 4WY7H 2PW2A 4NZRL 3CDYA 4PRPE 3BMVA 3RX7A 2NX5A 4EI5C 5ETUB 5CEYA 1NGYB 4AEHH 5DURD 5AYUL 1IJ9A 4F8TA 3GI9L 3MRCB 1T1WB 4YHIB 5C0BA 4LRNL 1MPAH 3S3PA 3DUUA 4FRWA 2MKWA 4OM1H 4NJAH 1U95B 5I8EA 3VW3H 1Q94A 3MA9L 1YMMD 1JMXA 4AIXA 5KW9H 5ICYA 5D1XC 4F3FB 4EN3A 4ZS6D 3RDTD 4D9LH 3VI4F 2CD0A 2DQDH 1YJDL 4EIZC 3TPUB 5JNYA 3MJ7B 3C08L 4JFYA 1CD8A 1TCRA 2R0LH 3MV9D 3QSKB 4GG6E 5B38B 1AJ7L 1RURL 3O45A 4NCC2 1VFAB 3CFIC 5KZCB 4PJ7B 2APVA 4PLNC 3I84A 1P4IL 3CX5J 4HS6A 1JFQH 2DIAA 1MREL 4C83A 3CCHB 2DQCL 1DCLA 1YY9D 3TIEB 3P77B 2HT2D 5FGRA 5CSBA 5JHDE 5D7SH 3H9SE 3MRFB 1W0VB 2X05A 1XR8B 4K94H 4GRWH 4LSDA 3T77B 5EO0B 4M6MH 2E7LA 1FZJB 3LKNB 3AC0A 5KSBB 3N1FC 5DEGA 2WLZA 3WMSA 3CFJA 1FDLL 3DMMC 4MSWB 1DBBH 5ERWB 1UGNA 4HPOL 4JRYB 3GSXB 3VI4E 5F6HI 5FFLA 3BHBA 1JUFB 5INCB 4ZS7L 4R0LA 4XX1E 1J05A 4WGWB 1BAFH 4PJ8D 3V6OC 3EIFA 4JFDD 3TWCH 2NX5E 1QPXA 3OR6B 1GYAA 4FNLH 5T5NF 2MCG1 1EGJH 5C0BE 4LDOB 5D1QD 1T1XA 4JG0H 5TH2A 1Z3GH 3V52H 3ZE2F 3ARFB 1RU9L 1RZ7H 4G8EA 5DMKA 3EFFA 2XWBA 1A7PL 1UH4A 3G5YB 4RIRA 3RKDD 1TDQA 3V6FA 4K7PH 3VRLF 5C08D 3MRIB 2Y25A 2ZG3A 4DKEH 4MZ3A 1AGEA 4G8IA 3MPCA 4PIRF 1I7UB 3NCMA 3I2CH 5DRNB 4PRBA 4XHQA 4GRMB 1G9NL 1SM3L 4POYA 3ECBB 2EKJA 3B3IA 3P4OB 1MLCA 3GJEA 3UYRH 1PSKL 2B8OT 5ID1B 1BEYH 1DBAL 1SMOA 1G84A 2YKLL 4M61A 1ACZA 3ZLQC 4TVPH 4HWZA 4N0CC 3TV3L 1A1OB 1KJ2B 3PF2A 2LFGA 4XWOC 1BFVH 5MEQA 2WWMD 4KXZH 4FP8H 5C71A 4NO0D 3HI5L 4WWKB 4Z95H 1T83A 3QQ4A 4QY8B 1J1PH 4ISVB 4JFXB 3ZE2E 5C0GB 2ZUWA 1ZA3B 2IH1B 4YGAB 4EVNA 1DLFH 4N8VG 1F8TH 4M7ZC 1RUQH 4U6HA 4YDVA 3LS5H 4P99A 3VRLE 2JF1A 2B5IC 3HS0A 4JDZA 4TSBL 5HYJD 1JK8A 1PJ9A 3MLTA 1ZT4A 5HHQA 4N8PA 5D2NA 1OTTD 3CXDL 3VXQB 5I66B 1WTLA 4QRRB 3SO3B 5I1KH 1K2DB 2HT4D 2CR3A 5L2KB 1SJHA 1LD9A 2O93L 1QLRA 1RHFA 3QEHB 4FQXB 3RRQA 5HDQL 1INQB 3SCMD 3HFML 4NM8L 2FD6H 1JGEB 5DJ6B 5E1AB 4X6FA 4ZFZB 3TNNA 5F7UA 4UNTA 3JWOC 4JQXC 3MCG1 1R3HB 3K4DA 4ZPVA 2NY4D 4KAQH 1A9EB 3O3AA 4HIXH 1UQSA 1IZJA 3FQWA 2ADJA 2FEEI 2A6KB 2P7TB 3DX6B 5FF6B 1JPSH 3MNZA 3BKML 3M17A 3O4LB 5C70A 1J8HA 3DVGA 3HB3D 5CWSA 4ZUUA 1AI1H 4OSUL 1OP3H 4EI5B 3IDXH 3LN5A 3SGDH 3TBVB 3JWOH 3NCJH 1KN4L 1MVFA 4RISL 2BX5A 2IADB 1Q0YH 3REWA 2R1XA 3F65A 4OLYH 3WKMH 1KENH 1T6WA 1VGKB 2WM0A 3LD8C 4UINL 2OM5A 3GMMB 1HZHL 3QFJD 3Q6GL 3UTTD 2G9HB 4ZYKA 2I24N 1X4XA 4BQBA 1PEWA 5LWYL 1NAKH 3MV7D 1BWWA 3SDXA 3W2DH 4ODSH 1JZ7A 1CG9B 1NGQH 5J6GB 3HRZA 2OJEA 3MTRA 1I9EA 1MFAH 3I6GA 4X6CB 1KB5H 2BHUA 1UB5A 2W91A 1G0DA 3QUMB 1AGFA 3F7RA 2I27N 5J4MA 1BQSA 4LRIC 2QL1A 3LEVL 5DJ0A 5JZ7C 5D2NE 3STLA 1U8QA 2MSPA 3MBED 3BMWA 3GM0A 5IGXH 1CE1H 4U3CA 2OCFD 1UH3A 4O02H 4OCXH 4XXDA 5CGTA 1FN4B 2KH2B 3EYVB 4PJ9A 2A0LC 1R5WB 2DWEB 1RUMH 4JFQB 5I8EB 2Y06H 3MREB 2CKBL 2Q76A 1SJVA 1MJ8L 2J4WL 4PJXA 3VXPA 4QRTA 2VWEE 1S9YB 3F58H 5HHMB 3AVEA 4EN3B 2ZCLH 5DQ9A 1G9EA 1NBYB 5E4EC 2R0ZL 5EPMB 2IPKA 3C8KA 1EAPB 3DMMB 1NCBH 4B53A 4HGWA 5EU3A 3T0EB 3RWFB 2GJ6A 5JPMB 2F54D 5ILTH 3SQOH 3EGSA 4KKAC 4OIIL 5F7DA 4F9LC 3O3DB 5FYJL 1J8HE 3CSGA 1NMAL 3I9GH 5H94A 4NKMB 3MGTA 1MFDL 4ZTOL 1BJ1J 5HHOA 4PJXF 2LU7A 2DLIA 4MDJB 2D0HA 1MH5B 2CH8A 5KVGL 5MEND 2FJFB 5F96L 3RVUC 3U46B 4WFHD 5BVPH 1S9VB 3GKZA 2IPTL 3SE4C 2XYCA 1EXUB 2V7NB 3PWVB 4HK3J 1AXTL 4ODXA 1H0DB 1A14L 2UUDK 4TNVF 4MAYA 1UXWA 3WNPA 1WF5A 3QXAA 2FJHA 4KHTL 2BSSA 4XNXL 3LHPL 4ETQB 4JCMA 3VFGL 4DWHA 3WIHH 1YPZB 2Z35B 3D0VB 3SDXE 2AXFB 3NOIA 4ZD3L 3S36H 2VLRA 1OGAA 5DZNA 5ESQB 1G9ML 12E8L 1I3RA 2QSVA 4R0LB 4IBLT 4U1HB 1ZLWK 2NY7L 3O3EA 2BVYA 4JFED 5AZEH 1H8NA 4N0UB 4FTVA 5DWUL 5E99L 4F37K 3LPGA 5I9QC 3WHE1 1T1XB 1U3ZA 1F3JB 5F97E 1G7HB 5LGKA 3EJYD 2QTEA 4XAKD 3HZVB 4RIRB 4PJXE 1JTPA 4PJHB 1IC5L 2YPKA 1N6VA 4IRSB 3BRFA 3DXAD 1OSPH 1JNHB 2AABL 3HE7C 4U4BA 4WHTA 5DI8B 5C0AA 4CGTA 1EHLL 4CN6A 3GDBA 4LAQL 4PP2B 3PWPA 3UBXG 4PRBB 3HMWL 2GJ6E 5E00A 3H42L 4H25B 5A2KH 5GHWH 1MCPH 4YUEL 4PBXA 3TVMD 5TQ0H 4RMUA 1MCOL 2JJVA 5ESAB 5ITBL 5FKPA 5HHOE 5GZOD 2Z0BA 2GHWB 4J8RB 2RIKA 2AI0L 2R4RH 3WIFA 4ZUSB 1IAOB 4LU5L 1RZIB 4JANB 1NDMA 4PJEA 4XH2B 1BIIB 3R4DA 5B3JF 5B4MC 3MXWH 3SDAD 5MEQB 1CGSH 3BIKB 3VD5A 2NY2C 4NNXB 3LN9A 4WUUA 3B8YA 3VJ6A 4FFZH 4UT7L 2FCBA 1EFXD 1FLRL 4Y4KC 1GVIA 2G5BB 4JZNA 2I60H 3HMXL 3LB6D 1FYTA 4NO3B 2V17H 3HAEA 2H8PA 2XPGB 3KLHD 4U6HB 2V5MA 2Z93B 2VLRE 1IC7L 3BZFB 4HS3B 5IHUL 1FH5L 1JK8B 1ZT4B 3RWJB 1QO3B 1R5VA 4C58B 4L3EA 2HN7A 4LMQE 1T1YB 5E0QA 3RVWC 4PB0H 4FTVE 2BXYA 2DB8A 3KLAA 1Q0XL 1F42A 1RIVL 1QPPA 3VXMD 5CJBA 3HC4L 2Z92B 3X3FL 4ONGH 3RGVC 5DC4B 3TO4C 1OT2A 5JPNA 2X9XA 3L3GB 4R4FH 1MCWM 3BKCH 4ZPVB 4JFFD 1P7HL 3FQWB 1DVFC 2H26B 4S0TD 5B38G 3LZFL 5C0AE 1XCTB 3G6DH 5J1AB 5GRJL 1JF6A 4XPTH 1N0XH 3MJ9H 4OF0A 3GIVA 3PWPE 4AL8L 4RA3A 3TJHD 4WTXA 2MJWA 3KS0H 5AG8A 3VFUA 3S96B 1B88A 3DVGB 2QSQA 5GS1C 1YNKL 4MA7L 4KVNL 1OP5K 4OZHA 4M8QB 2OZ4A 1D5XB 3CZFA 5JXAH 4OI7A 3SKUD 4NGHH 4OCNC 3MFFA 1NUFA 3NVQA 4X99A 2GY7B 4XNMA 3REWB 5JQHC 1WZ1L 1WITA 5CCKH 4BSVB 2V5YA 2ZSWA 2Z4QA 4PJEE 3IS1X 1BF8A 3TBTB 1P1ZA 3MLZH 5ISZD 5DEFA 1TJGH 4NSKB 3V7AG 2DTML 3CUPA 3LH2L 5DJXA 4DQOL 2FHCA 4WUUE 1NCWL 2R8SL 1MAKA 4PV8A 2R29L 1FYTE 4R4BB 2P5EA 1MFNA 1CGTA 2YD9A 4OZHF 4OFDA 4U1MB 1QR1A 3I6GB 2QADB 2DQTH 4XP5H 3SGJC 4FA8A 2P24B 5DZOA 1FIGL 4W4OC 4JKKA 2OXHA 4PUBH 3CJJA 1KJ2L 4FABH 2XZAL 4TTGA 3UTSB 3BP6B 4I18A 4LCUB 4N0YH 4XBEH 4R90H 3QWOA 1JGVH 2AKRA 2KDGA 2APWA 1M1SA 4PJ9B 4Y19A 4MNQD 3S35X 1VEPA 5F7NC 3MNVA 3U9UA 1TFHA 1OARH 5E8PB 4Y5VA 4JZJB 1QKZH 5DJAA 4M7KL 2GI7A 4FS0A 3VI3E 3MRNA 3IXTA 5F9WC 4K3GA 1N6UA 1JZ8A 4R6UA 2GEEA 3BP7B 4PG9B 1BVLB 5F1NB 3BD5A 4L8BA 2A6JA 4OIAA 3EGSB 4W81A 2QQNL 4GAJH 3FB7A 3ZKMD 3STZA 4JVWA 3PDGA 4H5SB 1A4JA 3O6KL 2EE3A 4WY7L 4OFYD 2FWOB 5F8RC 4OZHE 3U4BH 4FXKA 1ZLWH 4XNYH 5I9QB 3GSQB 3RU8L 3OKYA 5I1JL 4I8DA 4S0SD 1QTYT 3VXNA 4QRSB 1ZWIB 5FDWB 5DFTA 1JGDB 3D2UB 5A16A 3CDGB 4RNRA 4MLSA 3LVEA 4OM1L 4LEOA 2A9ML 5FM8A 5IQ9B 1T04A 1WBXA 1EK3A 3SKMB 3KPNA 3WXWL 5E8EB 4WTZA 1MHEB 43C9B 5KW9L 2XZCL 1KIQB 4I9WD 4OZ4B 1SYVB 1E6OL 4XMLL 4OI8A 1R3KA 3HE7B 3PWJA 2Z31D 4I77L 4KH2A 3VMOA 3WDIA 3CFEA 3ZDYE 3GHEL 1S7SA 3SDCB 3CGTA 2FATH 5L2JB 1ZHKA 3EFDH 2P5EE 4APQC 1T1ZB 5MEPA 1JZ6A 3Q1SL 2OR7A 1OGAB 1E27B 3MA7A 2I07A 2WNGA 3CDCA 4FQQB 1MFCL 3RY5A 1MAMH 3T2QA 3MRQB 3NA9L 1TTGA 1V3MA 3SBWC 2EH7H 4Y4HD 5GZND 4GXVH 1E4XL 15C8H 1DQDH 1VERA 5D70H 3FT3B 2EYRB 3QCTH 1T66D 3LKPA 2YPLB 4ZUWA 2AK4B 4IMKA 4HIEB 3A6CH 1KXQE 4R26H 3OKDA 1T0NA 3ARBA 3MUJA 4Y19E 1NGZB 3QUZC 1Q8MA 1D5BB 4OV6F 3UYOD 3KPRB 3ME0A 4EXKA 3QG6A 3TN0A 2YUZA 2FECL 2GFBB 3QDGA 3QP3A 5I1DA 4CVZA 2Q3AA 4ZOCA 4ZODA 4M6ML 4X5XA 4DVBA 5IM7A 1GL4B 4UT9H 4UOJA 4Y4FD 3DWTA 1O7VA 4S1RL 1KLGB 1AD9A 3QUML 2HJKA 4G42B 1AIFB 1A47A 4JQIH 1DN0B 1MCIA 2GYSA 4IRZL 2MKLC 5FKAA 4CADA 4WW2A 4XNZC 3ZHLA 1WZKA 1PKQA 3G5XB 2VXUH 1QRKA 4UOW1 1CLOL 4C57C 3HTLX 1JWUB 3AB0B 2XTJD 1FO0B 3S88H 3IDGB 1OGTA 1YECL 3NTCH 4XPBL 4OZGB 4YPGA 2MTPA 1RZ7L 1XGTA 3G08B 1D6EA 2D7TL 3VJ6B 4AG4H 5DMIH 1W72A 4F7MA 3G6AA 2Q6WA 2AXGB 3BIAX 4XZUB 1FFPA 4LSRH 2HJFA 4Z7VF 3MLYH 2EDRA 2A74B 1U3HB 1IZKA 1UJ3B 4K23H 1RD6A 4WW2F 4Q58C 2N56A 4LCCC 1HKLL 1CF8H 3KDMA 3AXLB 3BPOC 4JY6A 2KQNA 1T89C 1R5VB 5IIEA 1SHMA 5GS1B 4L3EB 1XGPA 3GZKA 3QCUL 1OLZA 5CKAA 4BELD 3SGEI 4PRHD 3UTZA 1BEYL 4YDJA 3CDFA 3FT4A 4QWWD 1O5DT 3LN4B 5LGJA 3E1F1 4MJ5B 3VD4A 1CDIA 5JPNB 4TQEL 3LKQB 3ALWA 2WIIA 3QDGE 4FQHA 2EDBA 4PJFA 3MOBH 5EOQL 2DMBA 1P6FA 1QYGH 4BSWB 4J3UA 4BJLA 2X70A 3BQUC 4HKBB 4QOKB 1NUGA 4D0CB 1DQML 5HYQB 1J5OH 1FORL 5EU6D 3U9PL 2OMNA 3L3HB 1YC7A 5IFAH 3VG0H 2IMMA 1IM9D 3GB7A 3DHJA 2Y7QA 3T4AA 4M6NH 4S11A 4BK4A 3MLSH 1RMFL 1PKQE 4XCEA 4H1LB 4NJ9H 5DZLA 1J1XL 4ZOEA 1K8DB 1VADB 1MJ7L 4RRPG 4X9IA 1FJ1A 1YMMA 3FFDB 3PDDA 5JIHA 1P1ZB 2VDKL 4U1JB 3GHBH 4F15B 5HVHB 5DJXB 4XB8A 5GRZA 3O41A 4U2YA 3RDTA 4PS4L 5JDSB 4R8WH 5DJ2B 1ORSA 3PHQA 3LOWA 3O0RL 4KAQL 2BNQD 2ZCKL 4ORGA 1PEZA 3IU4L 4HIXL 4IIQA 3GEWB 4KUCD 3Q6FA 4LKCB 2VL4A 1P5VA 3V4VL 5EBWB 2VRAA 2X1WL 4TUOB 1UM6H 2VKWA 3I02B 3D9AH 3G04B 5I2IB 2AJSL 2O5XH 2V9QA 2DD8L 3WLBB 1IEAB 3GSWA 2H9GA 4PJ7F 3R8QA 5I30L 1FPTL 5CUSL 4NHCH 4DUVA 2GW5A 2W1NA 4RSVA 4S1QH 2HH0H 3C8HA 3TYGH 1NAMH 4U0QB 1EEYA 4ODUB 3GJFK 5HHXH 1JHKL 1WBYB 4HAFA 1CL7L 5D72H 4JFHE 3MNVB 2FX9H 4Y5VB 2YC1B 4G9FB 3R1GH 1OB1B 1JL8A 5FM4A 5F3BB 1I7RA 2V5SA 2BSRA 4JKPH 4KDVA 3QYCA 4CVWA 5E08L 3IXTB 1OAYH 5I1EL 2A1WH 3ESVF 4OGYL 4PFEA 3ULUL 1UH2A 4PJFE 5GISH 5HHPB 4JLRB 2OK0H 2V2WA 5SWZB 3VA2C 4LVNC 5E56A 3WKNA 1MOEA 5E8OA 3C5ZB 4I0PD 3STZB 3VXUA 2J88H 3VFRA 1MFAL 4HDIB 1MFEH 3ROLA 1S7VB 5D6CB 4BZYA 2P5WB 4X5WB 4NUJB 5KOMC 5TPWL 2YD5A 1WZMA 4WRLA 5J06A 1C5DB 4GMSH 1N59B 2GK0A 3QZWB 1YN7B 5D1ZC 2EDJA 2EDXA 1MWAA 4NQDA 5DMGD 2Y06L 1WC7A 4YHNA 5C0DB 3BRGC 5IT2H 1U0QA 4Q9RL 4OJFH 4DGVH 5ENWA 3NPZB 3PV6A 1F58H 2P46B 4Z6AT 4CU6A 1YEJL 1EO7A 2C3GA 5KG9A 5DYOB 5LBSH 1Q9OB 3IETA 2VISB 3WNOA 3GMNA 1NCBL 4LLUB 1NGPL 3MA7B 3O3UN 4U6XA 2Q8BL 3TBWB 1ZAGA 4HH8A 4XRCB 1MQ8A 1J0HA 1KXTB 5ILTL 2A77H 3KPSB 4Y5YC 4PJ8C 3LMJH 4DOHB 3KPPB 5JORA 4Z18A 2OXGA 4DVRL 2HJLA 5HHVL 1QFWL 4PY7A 3RNKB 5CILL 1LEIB 2O5YH 4EIGB 2BHZA 2MMXA 1F4XH 1I1YA 2OSLA 3QNZB 1CXIA 2XA8H 3MSPA 4N68A 4F9PA 1DQTA 2DQUH 4NQVA 1PVHA 3QG6B 4POZC 4Z7NF 2NW3A 4N5EC 2V7HA 2VZVA 3PGCA 4LSQH 5I1CL 1SVCP 5JXED 3SDDD 2CR6A 2VIRA 3RWGA 2VDNH 3ROOB 1KGCE 4TSAL 3PG2A 2HJKB 1ULVA 2X4OB 3C09C 2RFXA 4P9HC 4G7YH 4LARL 4KZDL 4ZNEA 2A9NH 4JB9L 3GMPA 5HYJA 3QIBD 1ES0B 2APFA 3VXUE 1DUYA 1JF1A 2BC4B 1XF2A 4NNPH 2ED9A 4NNYA 3ZYZA 3H9YA 1N26A 2F53A 2FYYB 2AV7A 1BQHA 4P9ML 1TVHB 4E41D 5KVFH 4DUWA 5F88B 4NQDE 4XHJD 3O2DL 5FYLD 3VXRD 1MLBB 4P9HH 1ZLSH 1DR9A 2CDGB 5TJWK 3QWRA 5FGBC 2Q6WB 1WT5C 3M45A 4OGXH 2HJFB 5DD0H 3CMOL 1FIEA 3BQUB 2R23A 5D1XA 1DSFH 5FO7B 5C09B 2YN3A 1KLFA 4G6ML 3TFKC 1P2CA 3G6JB 1IC4L 4KUZL 1XZ0A 1OTTC 4KI5D 1OD7A 1RK1B 1YNTA 1ZVHA 4M93C 3BAEH 4WI8A 3V4UH 2DDQH 1UB6B 4K8RH 4Z77A 1TZHB 2WWKT 3GNMH 1WCBA 1G7MA 1I3UA 1DFBH 3PWNA 3KR3L 1Z9LA 2IG2H 2AJUH 4YE4L 3WUZA 4V2CB 2EDDA 4ZQKA 1F11B 4GO6B 5EWIH 3VA6A 4JGUA 2DJSA 5FUZH 4Z7QE 4HF5H 1V5JA 4ERSL 5KS9B 2NY4C 3N1PC 1FSKC 5BJTB 4IOFD 3MV7A 3FFCB 4M7LT 3FRUB 3DNKA 2CDFA 1B2WH 4NIKB 4QTIH 2A73A 2AEPL 1A3QA 2RB8A 1YC8A 4FXGA 4GRWF 3OSKA 2FBJH 4P3DB 1EGJA 5ACZB 3B83A 5DHVH 2EYTA 4WHYG 4HXAL 4ZNEE 3U36B 4X6CF 4K2UH 3T2NL 1A6TB 4HMDA 2Y7QB 3T4AB 3MLXH 2QHRL 2ADGA 2D7NA 3VXSD 4O5LH 1ZMYA 5EDXA 4DW2L 4I13B 1I8LA 2F53E 5EIVA 4Q7DA 3QG7H 4H26B 5K9KB 2VZ1A 4KJWC 3V6OA 4JAMB 1YMMB 5T3XH 5I1AB 5H8DA 3WUWA 2QQKL 4KKBC 3QT2A 1TVBA 3RDTB 5I8OL 5LGHH 3C9NA 4AJ0A 3TA3C 3IDMB 3GGWB 2DQIL 2DQJH 2XG4A 3S6CA 2Y1VA 4U05A 4ODTL 1FZOB 2D7MA 2MPAL 4NO5A 2AS5M 1T7ZA 1T5XA 4LLYA 3MV9B 1KTLB 2F54A 3VH8B 4IRJC 3QUXD 3BW9A 4N8CH 2HKFH 3LKOA 2F9BT 3V8OA 5FOBA 2EZ0C 2HRPL 4GW1A 3DECA 3H9HA 3H0TA 4FQ1L 1BJ8A 3F5WA 3VGAC 1I4FB 4YR6B 5IWLC 3GSVB 4PGJA 1MRFL 4JO3L 4R96A 4L4VD 1FO0L 4LLWB 3I3EA 3O4OC 4XP9H 4GRWE 1A1MB 5MENA 2FIKA 3GSUA 2CXKA 3TIDA 2HLAB 1F2QA 1GGCL 4P23C 1B0GA 5E2UL 4MXQC 4JFPB 5T3ZH 4RZCB 4PR5B 3SKNB 1AY1H 4NC0B 5BO1L 1YN6A 4CVXB 3PWLB 1KV3A 5FYKH 4I2XB 4HHAB 1JGUL 4P59L 1BBDL 4LAJH 3QPXL 3MV7E 5A1AA 1S7QB 1YPZF 2DKMA 4HX1A 1N7MH 5FV1L 2X89D 1DANT 1QRND 5TDOB 1AXSA 4WO4D 4PJ8B