4FQEA

Kdgm porin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
170
Chain Sequence
VSIDYRHEMQDGHKDRLLISHRFANGFGLSSEVKWAQVSNGTEVVASYVYKFNSVFSIEPGFSLESGSSNNNYRPYLRGRANVTDDLSVALRYRPYFKRKGYTLTGNIDYTFLKDYTIGYELEYKKGTSYDITHNVKLSYKWDKNWKPYVEVGNVSRQTRYRVGVQYSFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oligogalacturonate-specific porin kdgM
publication title Structure of the oligogalacturonate-specific KdgM porin.
pubmed doi rcsb
source organism Dickeya dadantii
molecule tags Membrane protein
total genus 46
structure length 170
sequence length 217
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 4fqeA00
2WVPA 4PR7A 4CTDA 2WJRA 2WJQA 4FQEA 2JQYA 2IWWA 2X9KA 2F1CX 2IWVA
chains in the Genus database with same CATH superfamily
5B66O 4AUIA 2XMXA 1H6S1 2ODJA 3HWBA 4K3BA 2R89A 4PR7A 3UU2A 2R4NA 4D65A 5AFUK 2LFUA 2WJQA 1BT9A 1QJ8A 1OPFA 4FSPA 4UB6O 3VE2A 3EMNX 2XE5A 2XE3A 5FVNA 6PRNA 4AZLA 4FZNA 5G26A 4C4VB 1THQA 3VZUX 1T1LA 4PUXA 1ORMA 2M06A 2R88A 1ZHZA 2X9KA 3BS0A 4N59A 5B5EO 3BRYA 2Y0LA 3RBHA 4AYDC 5GV0A 3A2SX 4KRAA 3UPGA 5ADXL 5DL8A 3C5OA 2Y2XA 1MM5A 2M07A 4RL9A 1OSMA 4C69X 1Q9FA 3T20A 3QRAA 4CTDA 3PORA 2PRNA 1HXXA 2WJRA 3PQUA 4N75A 3AAAA 5E79O 3SZDA 3NSGA 3VE1A 1QJPA 2R4OA 2W80C 3DZMA 2Y0KA 2J4UP 3AAAB 4BUMX 2MHLA 2XE2A 1ZHTA 4AYNA 4AKMA 2F1TA 4FT6A 2JQYA 1IZNA 3VZTX 4E1SA 2XG6A 1G90A 1ZHXA 3FYXA 3SYBA 1P4TA 2OMFA 5KAFO 2PORA 5ADXK 3NJTA 1QJ9A 1S5LO 5TISO 4AYID 1ZHYA 2Y7SA 3LK42 1GFOA 2ERVA 4QQ1A 4FESA 3PGRA 2IWVA 2YNKA 5D5DA 3QRCA 3SYSA 1MPFA 2MNHA 4XNLA 3DA4A 3DWOX 2XTRA 3AA0A 2ZLDA 3TZGA 3DA3A 4KR8A 4FQEA 2R4PA 1MM4A 3AA1A 4KR4A 3WI4A 5H2FO 5GTIO 4JCHA 4FUVA 3AA0B 3HW9A 2KC0A 4O4XA 3WU2O 2X27X 3AA1B 4O4UA 3VY8X 5T5FA 3V8UA 1GFQA 5PRNA 4AYEC 3K19A 4GF4A 3JTYA 2K0LA 2AXTO 2JMMA 4RLBA 1YS5A 1GFMA 5G3AA 1PHOA 1T16A 4RLCA 1GFPA 3KZIO 4G76A 3PGSA 4O3XB 2FGRA 3GP6A 3AA7A 3JCUO 4RJWA 2F1CX 2QTKA 4IL6O 3LK41 4K3CA 5DL5A 5JDPA 2Y0HA 2YPVA 1PRNA 3AA7B 3SZVA 4GCQA 1IZNB 2N2LA 2R4LA 3AAEA 4FMSA 4FSOA 5KAIO 4O3ZA 3VY9X 3UAQA 3O0EA 3G7GA 3KVDD 2KXPA 2XTQA 5EE2A 5DL7A 4F4BA 8PRNA 1HXUA 4N74A 3A0HO 2FGQX 2KXPB 2R8AA 2XE1A 3VZWX 1ZHWA 3LK2A 3POXA 2WVPA 3AA6A 3HOEA 4PJ0O 3SY9A 4LSEA 3A0BO 2ZFGA 4G75A 4E1TA 3DWNA 3AA6B 4LSHA 4D64A 7PRNA 2N2MA 3POUA 2GE4A 4U9CA 4B61A 5IYUA 2J1NA 4AFKA 4O3WA 4UB8O 3BRZA 4C4VA 2IWWA 4O49A 1Q9GA 2W81C 1E54A 2KDYA 4FZMA 4O3YA 4FRXA 4FZLA 3SY7A 1HXTA 4FRTA 2KZ7A 5GTHO 1GFNA 4Z3TA 2F1VA 3WI5A 1BH3A 2O4VA 4FOZA 2KZ7B 4LSFA 5AFUL 3HOLA 1BXWA 3AAEB 3PRNA 4N58A 4C00A 4GCPA 4D5UA 5G38A 2K4TA 4JFBA 3LK3A 3PQSA 3T24A 4GHBA 4RJXA 5DL6A 4LSIA 3LK3B 4AKRA 4AYMC 3LK2B 3PGUA 5G39A 3T0SA 4GCSA 4AKRB 3PF1A 4XNKA 2LHFA 3POQA
chains in the Genus database with same CATH topology
2WVPA 4PR7A 4CTDA 2WJRA 2WJQA 4FQEA 2JQYA 2IWWA 2X9KA 2F1CX 2IWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVP A;  4PR7 A;  4CTD A;  2WJR A;  2WJQ A;  4FQE A;  2JQY A;  2IWW A;  2X9K A;  2F1C X;  2IWV A; 
#chains in the Genus database with same CATH topology
 5B66 O;  4AUI A;  2XMX A;  1H6S 1;  2ODJ A;  3HWB A;  4K3B A;  2R89 A;  4PR7 A;  3UU2 A;  2R4N A;  4D65 A;  5AFU K;  2LFU A;  2WJQ A;  1BT9 A;  1QJ8 A;  1OPF A;  4FSP A;  4UB6 O;  3VE2 A;  3EMN X;  2XE5 A;  2XE3 A;  5FVN A;  6PRN A;  4AZL A;  4FZN A;  5G26 A;  4C4V B;  1THQ A;  3VZU X;  1T1L A;  4PUX A;  1ORM A;  2M06 A;  2R88 A;  1ZHZ A;  2X9K A;  3BS0 A;  4N59 A;  5B5E O;  3BRY A;  2Y0L A;  3RBH A;  4AYD C;  5GV0 A;  3A2S X;  4KRA A;  3UPG A;  5ADX L;  5DL8 A;  3C5O A;  2Y2X A;  1MM5 A;  2M07 A;  4RL9 A;  1OSM A;  4C69 X;  1Q9F A;  3T20 A;  3QRA A;  4CTD A;  3POR A;  2PRN A;  1HXX A;  2WJR A;  3PQU A;  4N75 A;  3AAA A;  5E79 O;  3SZD A;  3NSG A;  3VE1 A;  1QJP A;  2R4O A;  2W80 C;  3DZM A;  2Y0K A;  2J4U P;  3AAA B;  4BUM X;  2MHL A;  2XE2 A;  1ZHT A;  4AYN A;  4AKM A;  2F1T A;  4FT6 A;  2JQY A;  1IZN A;  3VZT X;  4E1S A;  2XG6 A;  1G90 A;  1ZHX A;  3FYX A;  3SYB A;  1P4T A;  2OMF A;  5KAF O;  2POR A;  5ADX K;  3NJT A;  1QJ9 A;  1S5L O;  5TIS O;  4AYI D;  1ZHY A;  2Y7S A;  3LK4 2;  1GFO A;  2ERV A;  4QQ1 A;  4FES A;  3PGR A;  2IWV A;  2YNK A;  5D5D A;  3QRC A;  3SYS A;  1MPF A;  2MNH A;  4XNL A;  3DA4 A;  3DWO X;  2XTR A;  3AA0 A;  2ZLD A;  3TZG A;  3DA3 A;  4KR8 A;  4FQE A;  2R4P A;  1MM4 A;  3AA1 A;  4KR4 A;  3WI4 A;  5H2F O;  5GTI O;  4JCH A;  4FUV A;  3AA0 B;  3HW9 A;  2KC0 A;  4O4X A;  3WU2 O;  2X27 X;  3AA1 B;  4O4U A;  3VY8 X;  5T5F A;  3V8U A;  1GFQ A;  5PRN A;  4AYE C;  3K19 A;  4GF4 A;  3JTY A;  2K0L A;  2AXT O;  2JMM A;  4RLB A;  1YS5 A;  1GFM A;  5G3A A;  1PHO A;  1T16 A;  4RLC A;  1GFP A;  3KZI O;  4G76 A;  3PGS A;  4O3X B;  2FGR A;  3GP6 A;  3AA7 A;  3JCU O;  4RJW A;  2F1C X;  2QTK A;  4IL6 O;  3LK4 1;  4K3C A;  5DL5 A;  5JDP A;  2Y0H A;  2YPV A;  1PRN A;  3AA7 B;  3SZV A;  4GCQ A;  1IZN B;  2N2L A;  2R4L A;  3AAE A;  4FMS A;  4FSO A;  5KAI O;  4O3Z A;  3VY9 X;  3UAQ A;  3O0E A;  3G7G A;  3KVD D;  2KXP A;  2XTQ A;  5EE2 A;  5DL7 A;  4F4B A;  8PRN A;  1HXU A;  4N74 A;  3A0H O;  2FGQ X;  2KXP B;  2R8A A;  2XE1 A;  3VZW X;  1ZHW A;  3LK2 A;  3POX A;  2WVP A;  3AA6 A;  3HOE A;  4PJ0 O;  3SY9 A;  4LSE A;  3A0B O;  2ZFG A;  4G75 A;  4E1T A;  3DWN A;  3AA6 B;  4LSH A;  4D64 A;  7PRN A;  2N2M A;  3POU A;  2GE4 A;  4U9C A;  4B61 A;  5IYU A;  2J1N A;  4AFK A;  4O3W A;  4UB8 O;  3BRZ A;  4C4V A;  2IWW A;  4O49 A;  1Q9G A;  2W81 C;  1E54 A;  2KDY A;  4FZM A;  4O3Y A;  4FRX A;  4FZL A;  3SY7 A;  1HXT A;  4FRT A;  2KZ7 A;  5GTH O;  1GFN A;  4Z3T A;  2F1V A;  3WI5 A;  1BH3 A;  2O4V A;  4FOZ A;  2KZ7 B;  4LSF A;  5AFU L;  3HOL A;  1BXW A;  3AAE B;  3PRN A;  4N58 A;  4C00 A;  4GCP A;  4D5U A;  5G38 A;  2K4T A;  4JFB A;  3LK3 A;  3PQS A;  3T24 A;  4GHB A;  4RJX A;  5DL6 A;  4LSI A;  3LK3 B;  4AKR A;  4AYM C;  3LK2 B;  3PGU A;  5G39 A;  3T0S A;  4GCS A;  4AKR B;  3PF1 A;  4XNK A;  2LHF A;  3POQ A; 
#chains in the Genus database with same CATH homology
 2WVP A;  4PR7 A;  4CTD A;  2WJR A;  2WJQ A;  4FQE A;  2JQY A;  2IWW A;  2X9K A;  2F1C X;  2IWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...