4FQEA

Kdgm porin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
170
Chain Sequence
VSIDYRHEMQDGHKDRLLISHRFANGFGLSSEVKWAQVSNGTEVVASYVYKFNSVFSIEPGFSLESGSSNNNYRPYLRGRANVTDDLSVALRYRPYFKRKGYTLTGNIDYTFLKDYTIGYELEYKKGTSYDITHNVKLSYKWDKNWKPYVEVGNVSRQTRYRVGVQYSFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the oligogalacturonate-specific KdgM porin.
pubmed doi rcsb
source organism Dickeya dadantii
molecule tags Membrane protein
molecule keywords Oligogalacturonate-specific porin kdgM
total genus 46
structure length 170
sequence length 217
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 4fqeA00
2WVPA 2WJQA 2F1CX 2X9KA 2WJRA 4CTDA 2JQYA 2IWWA 4FQEA 2IWVA 4PR7A
chains in the Genus database with same CATH superfamily
2MNHA 2F1VA 1OSMA 3C5OA 3HWBA 3O0EA 3HOEA 1BXWA 4QQ1A 3UPGA 2N2LA 2Y2XA 3QRCA 3A0HO 2XTRA 3DWOX 2IWVA 1ZHYA 3PGSA 4LSIA 4UB6O 5KAFO 3WI5A 5G26A 3TZGA 5DL7A 3SY7A 4AKMA 3AAAA 4O4UA 3T24A 3VY9X 2W80C 4LSEA 5ADXK 4JFBA 4C00A 3AA0A 2KDYA 5D5DA 4O4XA 3POQA 3SYBA 4AYMC 3SZVA 1Q9GA 2X27X 5JDPA 3POUA 2KXPB 4FRXA 4FZLA 3K19A 4O3ZA 4PR7A 2Y7SA 3PRNA 2R8AA 1YS5A 1GFMA 3PQSA 3T0SA 4U9CA 5GTHO 5B66O 2WJRA 3AA6A 5KAIO 4Z3TA 2QTKA 1GFQA 2R4PA 2FGRA 4N74A 4AYEC 4N75A 2XE2A 4RJWA 3BS0A 4E1SA 5H2FO 4GCPA 1HXXA 2PRNA 5T5FA 4AYDC 1QJPA 4C4VA 4GF4A 2J4UP 2R89A 5PRNA 4PUXA 3VE2A 5B5EO 4B61A 5G39A 1GFOA 4K3BA 3RBHA 3DA4A 3PGRA 2XTQA 4RLCA 5E79O 2IWWA 3SY9A 3VY8X 2M07A 2OMFA 1H6S1 4C69X 2K0LA 1P4TA 8PRNA 1BH3A 2AXTO 2WVPA 3NSGA 3AAAB 3VE1A 4E1TA 4AUIA 3LK2B 1MM4A 1ORMA 2KZ7A 2XE3A 3LK3A 1ZHZA 4FESA 4RL9A 4RLBA 4FQEA 4FRTA 5DL6A 3VZTX 3DA3A 3WI4A 3LK42 3AA1B 4JCHA 1Q9FA 1ZHTA 3JTYA 4LSFA 2XG6A 3AA7B 1QJ9A 3AAEB 3JCUO 5G38A 3VZWX 3SYSA 1MPFA 4AFKA 4N59A 5ADXL 2MHLA 3EMNX 1T1LA 1HXTA 4FMSA 4BUMX 2LFUA 1MM5A 2W81C 2F1TA 3A0BO 4GHBA 3UAQA 7PRNA 3HOLA 4KRAA 5G3AA 2O4VA 2JMMA 5TISO 4FT6A 1ZHWA 4F4BA 3PGUA 2ZFGA 4FUVA 3BRZA 1IZNB 2JQYA 3BRYA 5AFUL 4GCSA 2R4OA 3LK41 3A2SX 1BT9A 4O3YA 2XMXA 1ZHXA 4IL6O 4O49A 4XNLA 2WJQA 4AYNA 4AZLA 2Y0HA 3FYXA 2R4NA 3POXA 2R88A 2GE4A 5AFUK 2XE1A 4D65A 2Y0KA 2M06A 4UB8O 2J1NA 4AKRA 5DL8A 2LHFA 4GCQA 4D64A 6PRNA 3LK3B 1E54A 4FSOA 3UU2A 5EE2A 2PORA 3LK2A 4G75A 4CTDA 4KR8A 2ERVA 1PRNA 3DZMA 3PQUA 5IYUA 5DL5A 2ZLDA 4KR4A 2N2MA 1G90A 3WU2O 4AYID 3NJTA 2F1CX 5GV0A 3AAEA 3AA7A 3VZUX 4O3XB 1T16A 2KC0A 3DWNA 4FSPA 3PF1A 4O3WA 5FVNA 3HW9A 1S5LO 4FOZA 3SZDA 3V8UA 3AA0B 1GFPA 2KZ7B 2K4TA 2FGQX 4XNKA 4C4VB 2ODJA 3KVDD 1THQA 4LSHA 3GP6A 1QJ8A 2Y0LA 3G7GA 3PORA 2YPVA 1IZNA 1PHOA 4N58A 3QRAA 2YNKA 4G76A 1OPFA 4PJ0O 3AA6B 2R4LA 4FZMA 4RJXA 1GFNA 4D5UA 1HXUA 2KXPA 2X9KA 2XE5A 4K3CA 3AA1A 4AKRB 3T20A 3KZIO 4FZNA 5GTIO
chains in the Genus database with same CATH topology
2WVPA 2WJQA 2F1CX 2X9KA 2WJRA 4CTDA 2JQYA 2IWWA 4FQEA 2IWVA 4PR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVP A;  2WJQ A;  2F1C X;  2X9K A;  2WJR A;  4CTD A;  2JQY A;  2IWW A;  4FQE A;  2IWV A;  4PR7 A; 
#chains in the Genus database with same CATH topology
 2MNH A;  2F1V A;  1OSM A;  3C5O A;  3HWB A;  3O0E A;  3HOE A;  1BXW A;  4QQ1 A;  3UPG A;  2N2L A;  2Y2X A;  3QRC A;  3A0H O;  2XTR A;  3DWO X;  2IWV A;  1ZHY A;  3PGS A;  4LSI A;  4UB6 O;  5KAF O;  3WI5 A;  5G26 A;  3TZG A;  5DL7 A;  3SY7 A;  4AKM A;  3AAA A;  4O4U A;  3T24 A;  3VY9 X;  2W80 C;  4LSE A;  5ADX K;  4JFB A;  4C00 A;  3AA0 A;  2KDY A;  5D5D A;  4O4X A;  3POQ A;  3SYB A;  4AYM C;  3SZV A;  1Q9G A;  2X27 X;  5JDP A;  3POU A;  2KXP B;  4FRX A;  4FZL A;  3K19 A;  4O3Z A;  4PR7 A;  2Y7S A;  3PRN A;  2R8A A;  1YS5 A;  1GFM A;  3PQS A;  3T0S A;  4U9C A;  5GTH O;  5B66 O;  2WJR A;  3AA6 A;  5KAI O;  4Z3T A;  2QTK A;  1GFQ A;  2R4P A;  2FGR A;  4N74 A;  4AYE C;  4N75 A;  2XE2 A;  4RJW A;  3BS0 A;  4E1S A;  5H2F O;  4GCP A;  1HXX A;  2PRN A;  5T5F A;  4AYD C;  1QJP A;  4C4V A;  4GF4 A;  2J4U P;  2R89 A;  5PRN A;  4PUX A;  3VE2 A;  5B5E O;  4B61 A;  5G39 A;  1GFO A;  4K3B A;  3RBH A;  3DA4 A;  3PGR A;  2XTQ A;  4RLC A;  5E79 O;  2IWW A;  3SY9 A;  3VY8 X;  2M07 A;  2OMF A;  1H6S 1;  4C69 X;  2K0L A;  1P4T A;  8PRN A;  1BH3 A;  2AXT O;  2WVP A;  3NSG A;  3AAA B;  3VE1 A;  4E1T A;  4AUI A;  3LK2 B;  1MM4 A;  1ORM A;  2KZ7 A;  2XE3 A;  3LK3 A;  1ZHZ A;  4FES A;  4RL9 A;  4RLB A;  4FQE A;  4FRT A;  5DL6 A;  3VZT X;  3DA3 A;  3WI4 A;  3LK4 2;  3AA1 B;  4JCH A;  1Q9F A;  1ZHT A;  3JTY A;  4LSF A;  2XG6 A;  3AA7 B;  1QJ9 A;  3AAE B;  3JCU O;  5G38 A;  3VZW X;  3SYS A;  1MPF A;  4AFK A;  4N59 A;  5ADX L;  2MHL A;  3EMN X;  1T1L A;  1HXT A;  4FMS A;  4BUM X;  2LFU A;  1MM5 A;  2W81 C;  2F1T A;  3A0B O;  4GHB A;  3UAQ A;  7PRN A;  3HOL A;  4KRA A;  5G3A A;  2O4V A;  2JMM A;  5TIS O;  4FT6 A;  1ZHW A;  4F4B A;  3PGU A;  2ZFG A;  4FUV A;  3BRZ A;  1IZN B;  2JQY A;  3BRY A;  5AFU L;  4GCS A;  2R4O A;  3LK4 1;  3A2S X;  1BT9 A;  4O3Y A;  2XMX A;  1ZHX A;  4IL6 O;  4O49 A;  4XNL A;  2WJQ A;  4AYN A;  4AZL A;  2Y0H A;  3FYX A;  2R4N A;  3POX A;  2R88 A;  2GE4 A;  5AFU K;  2XE1 A;  4D65 A;  2Y0K A;  2M06 A;  4UB8 O;  2J1N A;  4AKR A;  5DL8 A;  2LHF A;  4GCQ A;  4D64 A;  6PRN A;  3LK3 B;  1E54 A;  4FSO A;  3UU2 A;  5EE2 A;  2POR A;  3LK2 A;  4G75 A;  4CTD A;  4KR8 A;  2ERV A;  1PRN A;  3DZM A;  3PQU A;  5IYU A;  5DL5 A;  2ZLD A;  4KR4 A;  2N2M A;  1G90 A;  3WU2 O;  4AYI D;  3NJT A;  2F1C X;  5GV0 A;  3AAE A;  3AA7 A;  3VZU X;  4O3X B;  1T16 A;  2KC0 A;  3DWN A;  4FSP A;  3PF1 A;  4O3W A;  5FVN A;  3HW9 A;  1S5L O;  4FOZ A;  3SZD A;  3V8U A;  3AA0 B;  1GFP A;  2KZ7 B;  2K4T A;  2FGQ X;  4XNK A;  4C4V B;  2ODJ A;  3KVD D;  1THQ A;  4LSH A;  3GP6 A;  1QJ8 A;  2Y0L A;  3G7G A;  3POR A;  2YPV A;  1IZN A;  1PHO A;  4N58 A;  3QRA A;  2YNK A;  4G76 A;  1OPF A;  4PJ0 O;  3AA6 B;  2R4L A;  4FZM A;  4RJX A;  1GFN A;  4D5U A;  1HXU A;  2KXP A;  2X9K A;  2XE5 A;  4K3C A;  3AA1 A;  4AKR B;  3T20 A;  3KZI O;  4FZN A;  5GTI O; 
#chains in the Genus database with same CATH homology
 2WVP A;  2WJQ A;  2F1C X;  2X9K A;  2WJR A;  4CTD A;  2JQY A;  2IWW A;  4FQE A;  2IWV A;  4PR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...