4FQLH

Influenza b ha antibody (fab) cr8033
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
230
structure length
225
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFSFDEYTMHWVRQAPGKGLEWVAGINWKGNFMGYADSVQGRFTISRDNGKNSLYLQMNSLRAEDTALYYCAKDRLESSAMDILEGGTFDIWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords monoclonal antibody CR8033 heavy chain
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 225
sequence length 230
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqlH01
4FXKA 4M7JL 4Y8DC 2DWEA 3S37L 3BKJL 4G80A 4TUKH 1N0XL 3WUWB 2OQJB 1UXSB 3L3KB 4L3CB 2VLJA 3VFMA 2ZSVB 3ZO0A 1NBVH 3HNTH 4PJBA 1G9MC 3ARGB 4ZPTA 3ZDYF 4XBPA 2HG5A 1KLUB 1MRFL 1XR9A 3EJJX 3NZHH 4X6DA 5F21B 3ARFC 3UTQB 1HZHL 2BNUB 4HD9A 4JDVA 3TZVA 3RDTA 1I3GL 1BLNA 1OAZL 4QRPE 2EH7L 4LKCB 3MLPA 1DL7H 2Y5EA 5I1DA 1BD2B 3THMH 1YNTA 4ZDHA 2ATKB 1IM9A 1RSFA 3REWB 1F90H 4LLMA 4HS6A 2E6PA 4U1KA 2F5BL 3I6GA 4QHNB 5J11B 1FCCA 4P5TC 1LWRA 4FXGB 3I75A 5T1DH 3BPCB 1GOFA 1MJ8H 1Q9OB 4RFEB 4N8VB 1ZA6A 4ODTH 1KUMA 3MREB 2P5EB 1MI5A 1K6QL 1T83A 4JN2B 3N1PC 1II4E 5DJDA 4W6YB 3ZYZA 3SGJA 1RZ8A 5IB2B 2GAZA 3WN5A 5JTWA 3S8WA 3DSFL 2D7QA 2B7DT 1IEAB 1AP2A 5JMRA 3D0VA 4HX1A 3FQWB 2UY6A 5CJBA 2Y1VA 1HSBB 5HDBF 1A1OA 2JIXB 4LVOB 1J0ZA 3M17B 5I8CA 1I9IH 4NO3A 4Z7VA 3RFZC 2R29H 2UYLA 1JPFA 1IM3B 2F58H 4C4KT 4JZOB 1J0IA 3ARYA 1FGNL 4IM8A 4YO0B 3ZKMD 5DEZA 4KV5E 3D85D 2R39A 4NFBA 1ZAGA 4NJ9H 4V1DB 4XPFH 4M6MH 2YPVL 3OJVC 1L7IH 3HAEH 2AK4A 4PJXB 5SWSB 3MJ9H 5FECA 2ENSA 5CGTA 3JV4B 1RJLB 5F3BB 4TUKL 1A4JB 3QH3A 4RIRB 2HTLC 1Q72H 3L5XH 1D5BA 3GEWB 5TJWK 4K23H 3U9UB 5JLZB 3MR9A 1NBVL 3MRNA 3HNTL 1WBXB 4U6VL 4NO0B 3MRFB 5KG9B 1P1ZA 3BUTA 2WP3T 4HUUB 5F7NC 2EDYA 5ESQB 5ILTL 3HE7A 5I0ZA 4C55A 1P84J 3GK8H 4FQXA 3L3JB 3NZHL 5GRUL 1QPPA 2BVQA 1FYTE 2OTWA 2XA3A 2NLJB 4L8DA 4HZLA 4LLUB 3THML 4N90D 4Z5RB 4U1SB 3TIDA 1XGRB 4UIKH 1ORQA 1F90L 2FJHA 4I0KA 5I16B 4E0RB 1T2QH 2R0ZH 3QNZB 4MNQA 3L7FB 1SM3H 3WNNA 3KLHC 3M8OL 2VWEE 3BI9X 4GKZA 5T1DL 1IL1B 2W0FA 2FZ3B 1UWGH 4ODTL 3KPSA 3PWJB 2DLHA 4MLIA 1HHHA 5K9JH 1ACYH 3M45A 5T3XH 1NKRA 1Y18B 3V5HB 3FOMA 4J8RA 4BZ2L 4Y19B 3ZKQD 4OD2B 2FX8L 3MV9B 5FM4A 5TDOB 4D9LL 2NR6D 2BDNH 4YDJA 3FQXA 3TT1L 2OR8A 2B4CL 5A40E 3O6FA 4F3FB 4RAHA 3AFLA 3VFTA 5D7LB 1E6OH 1FNGB 5EOCH 4A6YH 1FZMA 4I5BB 4M7ZB 5ETUB 5JW4Q 5IHZA 1DZBA 2A6DA 4NSKB 3IETB 1KTDA 5IBLC 3H9SB 4Y4KD 5FHAL 1UB6B 5B8CA 3C6LD 4MZ3A 4TYUA 4NRYA 1I9IL 2VMFA 4UQ2A 3R1GH 2R29L 1ZWIB 1XCQB 5F96L 3U36B 5JW3H 5L8LB 4Q6IB 1E4WH 4XMKH 4LAJH 4HUXB 2VLJD 3HZYB 3WD5H 2HLAA 3WDIA 4NJ9L 4WTZA 2GK0B 4OZFB 1L7IL 3E8UL 1JYWA 1MAMH 3MJ9L 2NY4B 3RIFK 1JMXA 3PWVA 1FCGA 1ZS8B 2GITA 3DRQB 5C0JA 4U7MA 5ITFB 3QQ4A 1Q72L 4D3CH 4Q9RH 3GJFK 1NBQA 3EYQC 3KYOA 3OGCA 4I3RL 3TZVD 3RDTD 3VA6A 1T4KA 3QXUA 1JPSH 1UM5H 3JV5A 5C0GB 5IFJA 1JUFA 1MFDH 2XKNB 1QEWB 1J0HA 3X14B 1IM9D 3H7BA 1T0MB 4NO5B 3GK8L 3EDJA 1QFUH 4KTDH 2WSKA 1UB5B 1IKFH 1MFAL 3RKDD 3HE6A 4QRSA 4YHPB 3QDHA 5C0RH 2A73A 1N3NA 2C1OA 2ZUWA 1FL6A 4ZFFA 3CLEH 4WFHD 4U0RC 2DLTA 3VH8A 4ZPVB 4OZIE 4GMSH 1MI5D 5E70A 1UVQB 2R0ZL 5A2FA 1RK1A 2VC2L 1R3JB 3IJSB 4HKJA 1SM3L 4ZNEA 5E6IA 3OAUH 4HQQH 2ED7A 4IBLT 1UWGL 2WIIB 3FB8A 2H26B 4PRIB 4LPUA 3WXVH 5K9JL 5GIRB 4KWUA 3ULUD 5DO2C 5T3XL 1Q94B 1S9YB 5F7MC 1I8IA 1I85A 4IRSA 5SV4A 5ISZB 4F8QA 3L9RB 1RZFL 2W91A 1JWMA 4G42B 3EYVB 3OPZH 4OFKA 1OB1B 1WLHA 1NGZB 1ZHNA 2ZUXA 3LRSA 3TJHC 4QXTB 5D1XA 4IMLB 5DK2A 4KRPC 5EOCL 1CD9B 1UKTA 1QRNE 1FVCA 2OYPA 5ALCH 1LP9E 4NDMB 1HQRB 2AK4D 2X7LB 3PIQA 4P46C 5DA4A 3GSRB 4UIMA 3BP5B 4TUOA 3G5ZA 4ZYKA 1AQKH 2P8PA 2QHRH 1E4WL 1LVEA 4XMKL 5F6IC 3VFNA 4X6CB 2FJFA 2D4DA 3WD5L 3AY4A 4QNPE 2N4IA 4NC1C 4QRRE 2IAMC 3BHBA 3SDXE 5F6IB 3ESUF 5IV2A 1WITA 5CMAA 4N9GB 4APQA 4G9FD 4D3CL 4Q9RL 2J2ZA 5DD1H 1EO5A 1JPSL 1UM5L 2C3VB 3V8CA 1MFDL 5IW3A 1A14H 2W0LA 4N0UE 3VXTB 1CCZA 4JKKA 4ZS6D 2NTFA 3QUZC 1M7IB 1QFUL 4KTDL 4MNQD 4CGTA 3QJHB 1G6RA 3WFZA 2AKRB 3QUKA 1IKFL 3ZL4L 2WV3A 5C0RL 3W0WE 2PCPB 5IMKA 3CLEL 3W11C 1X5IA 3SGDI 1UXWB 1YPZE 1OTSD 1G7PB 2HJLA 4GMSL 3PWPE 3NFSL 1JZ8A 2FL5B 4AEEA 1SJVA 3AB0B 5DTFA 4NHUB 5DS8B 2OR9H 3OAUL 5EG6C 4HQQL 4OBRA 3SE3C 1BIHA 1PYWB 1FV1A 1M05B 2NW3B 3D48R 4K3DL 1JJUA 3QFJB 4NN5C 3UROR 3VXOA 3O6FD 1HOCA 5IM7B 4HG4K 1KCSH 3WXVL 5CJ8A 5AZEH 1S9WB 4C56A 5J1SC 4KVNH 4JFYB 1BZ7A 5MHSE 4PJ7B 5CZXC 5I1HH 5HI3D 3UTPE 3OPZL 3ZE2F 3REVB 1GGUA 1HQ4B 1ZHBA 4HIXH 4PP2B 3JV6B 5F7DA 3MBEB 3RY5A 4ERSH 5IW1B 5ALCL 2R1XA 3VXUD 4ODWA 4DK3A 1AQKL 1A6ZA 4G8EB 1KTKE 4WO4B 2QHRL 4PLKC 4MVBD 1J11A 1WWBX 3LEXB 2X4QB 4O2FA 4WUKH 5IR1A 5FO9A 5L0QB 5A2LH 5DGQA 2ERJB 4PJAB 3DO7A 2ZCLH 4OZFH 1A3RH 3GI9L 4UBDC 5TE6L 2OZ4A 4UV4H 4J1UA 1KGCD 3E0GA 3QIWB 5GGUB 3HZMA 5DD1L 3HE6D 4KKNA 4NQTA 2DTMH 4JFEE 4NOBA 2IADB 1OL0A 3HUJB 3MRRA 3MLTA 1IC1A 5DUPL 3ZYOA 4BELD 3KGRA 2IF7A 5EUKB 3CCHB 2W9DL 4MJ5A 2C4XA 3K8MA 3SGDH 5HPMB 4LLWA 3FONA 1YJDH 4KJPD 2Q8AH 4NQDA 3MLZH 2QQQA 4OCMC 5DEGA 3WNLA 1H5BB 4NQSB 5E6ID 2Y6SC 3BEVA 5GGTH 1DN2A 5IVXF 5FGCE 3BDYH 1KCUL 3MUZ1 5MEOA 4F57L 3TPKA 4IRSD 5ERWA 1NC2A 4TPRH 2K7QA 2C7UB 5J89A 3E6HA 5ICXB 2G5BB 5D1XD 1TQBC 2P5WA 1LQSR 1KCSL 4GXVH 4QO1A 5TGBB 1CE6B 2IAND 1UWXK 3IS1X 5HVWA 1FDLH 3ARRA 1UKSA 2WUCL 1AXSB 5T3XE 4KVNL 2BNRD 5I1HL 5J1TC 3HRZB 1DQDH 3BJ91 1GGIL 4GBXC 3HHRB 4XTRD 3EIFA 1JNJA 3VD3A 3UC0H 2DMBA 1AFVH 3LS4H 3DX9B 4M5YL 4YLQT 3QI9A 4XP9L 5CS7A 4OLZL 4GBXB 1QP1A 2IH1A 1GVIA 4DZBA 1CDJA 3RGVB 1HH6A 2VUYA 4APQD 3LKSB 1DANT 1VFAB 5L7XH 4WUKL 4HGMA 1AHWC 2DRUA 5BS0B 1OTTC 4DN4H 4L3EA 3IS0X 3PGFH 2V2TA 4IRZH 3ALXA 1A3RL 3P0GB 5HSFA 1EGJH 3HI6H 1AHWB 4DK6A 1IAIL 3S96A 3ULVF 4K55A 2JJVA 5ESVA 2V7HB 2CPCA 2DTML 1S9KC 3CX5J 1IGML 5DJXB 3MRMA 5JHLH 1D5XB 3FRPG 5FDWA 4OGXL 1SYVA 1YEDA 2VQ1B 2MMXA 5L6YH 3GSNB 3DNKA 3S35X 4PS4H 1FNLA 4B7IA 3T3ME 4KUZH 1YJDL 2Q8AL 2BVUA 1BMGA 3QQNA 4H26A 4G6AC 3CU1A 4LEOB 4LCIL 4U1IA 5GGTL 3HS0B 3P2TA 1ODAA 3TA3B 5EZJA 2V2WB 1YYMH 2AV1B 1H8OA 3MZTA 4E42B 5A1AA 1XGYH 4C56D 5DJCA 4EIGB 4TPRL 1NCWH 2VE6A 2EE3A 4KKBD 4NQCA 1I7ZB 3PWNB 2VLRB 4Y5XA 4HIHA 4C4KO 1MJUH 1KNOA 5CSZA 4GXVL 3BGFB 1HSAB 1L6ZA 2EIZB 3MACH 3P0VL 1FG2B 2P5EE 1MCCA 5CBAB 1DEEB 2XTJB 1MCKA 4NGHH 5I19H 1LO4H 1DQDL 3UZQA 4U2ZA 3V4VL 4YAQB 3AUVA 5HHVH 2QQKH 3U30C 3UC0L 1WAAF 3N1GC 3QP3A 2VZSA 3AAZB 3LS4L 1BBJA 5D9SB 1KIQA 4R96A 1TTGA 4G9DA 3IU3A 3FMGL 4GRMB 3DVFA 3NCJH 4RMWA 4LLQB 4GOSA 4WUUB 4M1CC 3RVVD 1GHFH 3GM0A 2JB5H 1DE4B 1I8MB 1FL5B 5T1MA 1I1YB 4MCZA 3EOTH 4CN6A 3VRIA 4X9IA 1S7XB 1K8DA 3VRJB 1S7WB 4IRZL 3O41B 3V0VB 4DAGL 5T1KA 3UXFA 1EGJL 4NRZA 3HI6L 4PJXE 5SWSE 4XPBL 2Q86B 3MA7A 4ZSOA 1OT2A 1RJZA 2NY1D 2L7UA 2V9RA 1J10A 1FZJA 4NQDD 3ZTNH 3QPQD 3UTOA 3S9DB 3MRPA 5F72S 5IK3B 1KJVA 1TZIB 3FFCB 3PE9A 5JHLL 1GAFH 1BVKB 2G2RA 3NCYP 1JZ7A 2ICWB 3QWRA 5BXFA 1HCFX 3WIIH 4KUCD 4U4BA 4Z0BH 4PS4L 1NC2D 2A77L 4PLJD 1SY6A 2DQGL 3ET9F 3ZHKA 3Q6FB 3ZT6A 4JFDB 5JHDB 2X1XR 3RPIB 4FQHB 3VFOA 4XHQA 3MRHA 5ID0B 1F42A 2FEEI 4ELKA 1RZJC 3MLUH 1RZ7L 2YUXA 1ZK9A 1XGYL 4JN1H 3S37X 1NCWL 3I85A 4F8TA 3HKFA 2RB8A 3UEZA 1EA9C 3ZE0F 3FB5A 2AQ3A 3LDBB 4JRYB 3ZSTA 1A7RH 4ZAKA 2Z0BA 4MYWB 1JF1A 5EB9A 4X7EC 3H6JA 2VITB 3PF2A 1B0WA 2NY5C 4NGHL 2GJZA 5JOPE 3H9HB 2JK5B 2PKDA 4Y19E 4HWNA 4ZFOA 3CFDA 3MV9E 4PJGF 3ZKMC 4KDWA 1Q9KB 3FN0H 5HHVL 5EPMA 5F7WC 2QQKL 1IFHL 3D3VA 2P8LB 2R0LH 4NNXA 5ENWB 2ADIA 4I18C 1L4IA 5D7LE 1WWWX 3JZ7A 3LPGA 4PJHF 4L3ED 2FIKB 3H9SE 4ORGA 2XN9A 1GHFL 4BH8A 4BSWB 4EIZC 2JB5L 2CMRH 1P4LA 1PDKA 4XMLH 5B3JF 5I2IA 3TPUB 3EOTL 2IPUK 2GTWA 4WNQA 3IXTA 3P73B 5B3NA 5LGJB 1EEQA 1DBJL 4S2SA 1C16B 3RL2A 3UTTB 3LV3B 2PYFA 1DQTA 1FNEB 2AXHA 4ZUWB 4XAKD 4WW2F 5F7HA 3ZTNL 1BWWA 1JZ6A 5KOMC 4L9LA 5IMMB 5EIQA 1GAFL 4GW1A 4RMRA 1KCVL 2X10A 3WIIL 3SDDD 3LN5B 1QSFB 4Z0BL 1HI6B 4GS7C 3VGEA 2W59A 3GSNH 2R2CA 2C4FU 3WHXB 5F9AC 2BK8A 1NGYB 2WINA 3RWIA 3LKPB 2ICWI 4UOW0 1H3XA 1PZUB 3MUGA 4RMQA 1LDPL 3MOQA 4XMPH 4XH2B 3MLUL 2ITCA 2JJSA 2NR6C 4JN1L 3C9NA 4UILH 5INCA 3SKOB 4BZYA 1HK6A 4M3JA 2V7NA 1J05A 3T3PF 4QRTA 4NKIH 2N56A 5CKGA 4PBXA 5C0CA 2XQYG 4S1QH 4XC1H 1VGKB 1A7RL 5F9JA 1VERA 3L3HA 2A9NH 3PWLA 4N68A 5EU7C 4ZXBB 4Y4KC 1J8HA 5E8OA 3O11B 4PRIE 4URTB 4XC3L 4LSUH 4ZMAT 3GI8L 4RAVB 4EQ3A 1N0LA 3EYOA 3U4AA 5I76A 2F54B 4QEGA 5E8DL 3QHTC 2Y4SA 5ISZE 3FN0L 4HMDA 2Z93A 4RMUA 3GUTB 4KI5F 1AJ7H 1KEMH 3PHQB 3N1MC 1LE5A 5K9KA 2YHGA 3CDCA 1FE8L 1GC1C 1HDMA 3QIBA 3FQTA 5T1KD 2BERA 1S7RA 1I7TB 3I6LE 4R4FH 1KLGA 2J3SA 1UACH 2X9WA 2CMRL 3A0OA 4ONGH 5T3ZD 4XMLL 1JZ5A 4MJ6B 4X6CE 1U95B 3BGMA 1A9BA 2YPLB 5HHQA 4FNLL 4WU5B 3SDAA 3KPRA 4FN0A 3QWRD 3OXRB 5D71L 3QEQB 3RKDC 1MWAA 4HJJH 4HK0B 3T2PA 3L3OA 4F7MB 1OGAB 3ARZA 4POZD 3IAGC 3VXPA 3ZKSD 2P7TA 4JAMA 2W60B 4QHUA 1UFUA 4N0YH 2AEQH 4OKVB 2BZDA 3SKNA 1K2DB 1AR1D 5J13B 4G6JH 2J7LA 3IFLL 3SGJC 1JWSB 3GSNL 4PJIE 1T89C 3HNVH 1F45A 5EU4B 3S88H 4OD3H 3RWEA 1V5JA 2FEEL 1Q9WA 1ES0B 5C0AB 1RZIA 5DDHA 3KPQA 2V5MA 5J12C 4PG2A 4PGDA 3CFBB 3ULUC 4ZAKD 3LN4B 2YR3A 2HAZA 4XMPL 4J6RH 1S8DB 2JELL 5JOFB 4JREC 4PFEA 4LPTA 4MJIB 2MNUA 4UILL 3UYPA 4ETQA 5KBNC 2QLVB 3FN9A 4YHZH 4EKXA 1X5GA 5F3HB 2NX5D 2UWEF 4GO6B 3B9AA 3RI5F 1KV3A 4Z6AT 3BP4B 4S1QL 4XC1L 4FHBD 1ETZB 1EPFA 3D3VD 4FFYH 3WFHB 4F37F 2MHAA 2V5TA 2A9NL 4OZHB 1WQVT 1EAJA 2R69H 5FA4B 3O81A 4LSUL 2X40A 3L3GA 5EOTB 1EO8H 3JTTB 1SJEB 4Z7OE 1OQXA 3ZKND 2XN9D 3QA3B 4PJ7E 1FFOB 1U8MB 3U4EA 1B0RA 4MA7H 3HLAA 4Z7NE 3GKWH 5I75B 1KEML 4RQQA 3U0WH 2ATPA 4R4BA 4HCRA 5DI8A 4MD5B 4MSWA 5F8RC 1Q9LB 2NTSP 4IHOB 5DRZB 4HUVB 2I07A 3IRPX 4YR6B 4CVWA 4R4FL 4X5WA 5BJTB 3HC4L 4LVEA 1UACL 4ONGL 3W39B 2ITDB 2KPNA 3U6RA 1TTUA 2EDDA 4PJAE 3DRTA 2NY3B 3LKNB 4LNRA 1QBAA 2XPGB 3HN3A 5BV7C 3GIVA 5ACLA 1OTSC 12E8H 4AIXA 1X5YA 1MVFA 5BW7A 1NC4A 1SYSA 1X6LA 2AEQL 2J4WL 2V5YA 5CJOH 3RP1A 1AD9A 1K9TA 3HUJE 4O02H 1C08A 2BCKA 3QXWA 5DYOB 2NY7H 1G7QB 4XP1H 2D31B 2J8UB 4WGVB 3J7HA 5KS9A 3CH8A 1BOGB 1EDQA 1IKNA 3LMJH 1DQJA 4P48A 1DBKH 4H8WH 4Z9KB 1CG9B 1T5XB 5IJVA 1QA9B 3GSQB 4OD3L 4GRLD 4MD4A 2OCFD 3O6FC 4UDTA 5FYJD 4YZFF 5JW5B 2D0FA 2BY3A 5C0CD 4Z7WA 5C3LD 4ZUVB 3DURB 1PSKH 3DPBA 4LCYA 3F7VB 3GMPB 3RHWK 5F89B 3KPPA 4J6RL 4DGVH 4YIQB 2Y07H 1J8HD 1F02I 3BUYB 3MSPA 2HN7A 3OAYK 5HI3C 3LS5H 5L2JA 3KS0H 2YSSB 4P2RA 4IDJH 5EC2B 5KTEH 1JGUL 2QBWA 1RZJL 5GGRA 2FRGP 3I3BA 1JNNL 1WTLA 2VL5A 1F00I 4RGMB 3CSGA 2HWZH 1QVOB 1UZ8B 2R69L 1E4XI 3QUMB 3BZEB 2ADJA 2WK2A 3IDNA 3NCYS 1BWMA 4KJYB 4Y16B 1EO8L 3QIBD 4ZUSB 1MREH 1P6AB 2ED9A 4UQ3B 5T5NG 4OLEA 3ARDC 1G6VK 1A7PL 2EICA 1U8JB 5DVLA 4MA7L 1P6FA 2CRMA 2JE8A 2O61B 3GKWL 3K4ZA 2DMKA 5LXGH 3BIKA 1XGQA 5M95B 3ARDB 5ADOL 3SDAD 5SWZB 3KPRD 5KZCB 1JE6A 4L9DA 5EU5A 2XRAL 3NFPA 1R0AH 1X44A 3NN8B 2MCG1 2EDFA 3HE6C 2WUBH 3F6IA 3F7YB 4LCCA 3KXFA 2LAGB 4BYHA 4Q2ZA 5I6XB 4BH7B 2BC4B 1EEZA 1MJ7H 5J4MA 1X7QB 1U92B 1TZHB 4X98B 4TVPH 1FIGH 5BS0E 3MNZA 4NC2B 1WIPA 3QQ3A 3RVTD 4Z7UB 5IKCB 1ZGLP 5IVNA 3B5TA 5D70L 1EEYA 4KJPC 1OTUC 5E6IC 4HMCA 1KELH 4WI3A 3BZDA 3DUSA 4LLVB 4KQ3H 5F7LB 1YC7A 2NXZD 3QIUB 5MI0C 1JGVH 12E8L 2NZ9D 2GT9B 2OP4L 5CJOL 3GZKA 4O02L 3QDJE 2KZ1B 4XP1L 5C6WH 5JPNA 5FDYA 3FFDA 1I85C 4IRSC 4M61A 1TMCB 3LMJL 4H8WL 1UQSA 5CD3A 3QNXA 5D1XC 4X4XA 3VCLB 3VFPB 3VXQB 3VGHA 1NEZG 3QXTA 1PSKL 4M4PA 5FO8B 4DGVL 3O3DA 4K71C 2W65B 1ZHKB 2Y07L 3W5NA 1AO7E 3DYPA 3IDMA 3LS5L 4PR5A 2X09A 2ENYA 43C9B 1PKOA 4WEMB 5C07D 1G7HB 2XZZA 4IDJL 5D7IF 1UM4H 4XTRC 1CD0A 3ZDXF 5KTEL 1M71B 4F7EA 1N5YH 4X4YA 4XNMB 1E4XH 1A1NB 5KVDH 2PW1B 2VLRE 2ZUYA 4X5LA 1CGSH 4OJFH 4AK1A 4M48H 4TNVK 3MA9H 5I17A 3HC0A 1HYSD 2B8OT 4L8BB 4APQC 1GXEA 5EIIB 5HGBA 2N7BA 2CDEA 2FO4A 4QT5A 3TFKC 2XTJE 5DK3A 2NW2B 2DI7A 4R4ND 3RWHB 1FBIL 3DV6A 4RCAA 2VXQH 4R2GB 1VKXA 5CWSA 4JFQA 5LXGL 4YK4C 3ZYIA 4JZJC 4GFTB 2XWBA 2FIRT 3WDHA 4JJ5B 1R0AL 1KJ3H 3K2MC 4GW4B 1N4XH 2PTUA 2WUBL 3FTGB 4WUUE 1RUKL 4F58H 3QFDA 4FABH 4NQEB 1MJ7L 3Q2CA 1RIVL 1TVBA 2DLEA 4WHTA 2E6JA 4TVPL 5IF0A 3WMSA 1NC4D 3D18A 4RWYH 4JPKH 5JPMA 4Y4HB 4F2MA 4IOSD 1MNUH 1QQDA 3IDGA 2ICEB 5GS2H 4QGYA 1XIWD 3E2HC 1ORSB 1D5ZA 3VI3F 5SWQB 1KACB 3VRLE 3BW9A 4L8SA 4KQ3L 1B4JH 2BVPB 3WIHA 3QEUA 3S36H 1JGVL 4D0BB 1J7VR 3E2HB 3P4MB 5EOQH 1J0YA 4EXKA 5F7YC 3BP6B 4QTIH 5C0EB 1A5FH 4KKBC 3QHZH 1E6JL 4P2RD 1RJYB 5CJXA 2D7PA 2GSGB 3IGAB 2VISB 1TNNA 3EZJB 2B39A 3QZWG 5J9PA 4UNUA 3NCCB 5L2KB 4JFDE 5IBTL 1C12A 4WDIA 2X4TA 3PUCA 5J0BA 1DN0A 1G84A 2A9ML 3OKMB 1B0GA 3ULUL 1UM4L 4NKDB 2G75B 2W1NA 3P4OB 3LN9A 4MX7A 3FT2A 4YXKL 4YHYB 1FFPA 5JZ7D 1CGSL 3GMOB 4OJFL 4MXVF 2DYPA 1F4HA 4M48L 1S7SB 3MA9L 3WFDH 4IS6A 3QUMH 3RVVC 3TVMA 4GKNB 1TFHA 3GGWA 2FBJL 3QULA 5BOPA 4PJFB 4CVXB 5LVEA 2VXQL 5CAYB 2HVKB 2E5EA 4K94C 1U91A 1PVHA 3EFDH 2NY1C 1DBML 3DX8A 4LPYA 4GW5B 3CH1B 4FTVB 3JTSB 1PX3A 4OIIH 5C0IA 1KJ3L 3P77B 1N4XL 3QPQC 3SDYH 2E7MA 3KJ4B 3UJTH 2XFXB 1G9NC 4F58L 4FABL 3RWJA 4LIQL 1FSKB 1TCRA 4X8XA 1YMMB 4RWYL 1VSCA 4FZEH 1T1WB 5I1EH 1MNUL 5HGDA 3U0PB 1JF5A 4PLJC 3O4LA 4QYOB 4NQVB 5E2UH 4U6XA 3WDJA 3UTTE 4MDIA 1NCUA 1XH3B 3S36L 2B2XH 5JQ6H 2HKHL 3BO8A 1IQDA 2GTZA 2XI9A 4RISH 1WT5A 1IEBA 2JLLA 1U8LA 3MRGB 5IVXA 1MF2H 4QTIL 3GKZA 5TDPB 4CMHC 3IJHA 1WIOA 2DQEH 1A5FL 4ZUTB 1QSFE 3QHZL 2WQRA 4LHUA 4NQXA 1W72B 3F5WB 4P4KB 3CVHA 2CSPA 1BF2A 1MLCB 5TFSH 1HKFA 5EU6B 5TDNB 5D8JH 5E7BA 4K3HA 4MNGB 2P42B 3K2UH 5JNYA 4LSDA 4FQ1L 4BQ8A 3CD4A 1R5VB 3SJVB 2VNCA 3KNBA 5AUMB 4MXWH 3OG6B 5H35A 3L5IA 4OCSH 3OF6D 1IZKA 4TTGA 1N59A 2C3XA 1PKQE 1OAQL 1WVZA 3E1F1 2IGFH 2VDOL 4HWZB 2DQFA 4N0FA 3DIFB 3RTQA 5FA3B 4OLUH 3BEWB 4QRPA 4YPGB 3WFDL 4LQFL 3NH7H 3SOBL 3BQUB 3T04D 4Y5YB 4AL8L 5EU7E 3LEVH 2F54E 1GH7A 3IF1A 3O8XB 5DK0A 4ONHA 5SV3A 2R23B 3O9WC 2PYEB 5IB1A 1HKLH 4PP1D 3SE4A 4PJ8B 3KYMA 1D6EA 1HH9B 3EFDL 3O9WB 1JGDA 4OIIL 4OLXH 4MB5A 5CP7B 3SDYL 5HBBA 1AGDB 1HHJB 3MX0A 3TNMA 3UJTL 4MB4A 1PEZA 2BHYA 4KVCH 1WFNA 2YD7A 3SDDC 2F53D 4TVPE 2YPLE 4FZEL 4KMTH 1A6WH 2IFFL 3VFSB 5DMKB 1QOKA 5E2UL 4NJAH 4OIAA 5JQ6L 3MMEB 3MRCB 5TF1H 1IEHA 5K59E 5EA0L 4RISL 5D7KD 4X8JA 1MF2L 3SGKC 4OGAD 5HHMD 3UYOD 3MGAA 1ZHLB 3CXDL 1I7RA 3K4AA 3D39A 4HW6A 2ZJSH 1CXIA 2UZXB 3KHOA 5TFSL 3EYSL 1J1XH 4BKLB 3CXHJ 2A83A 5D8JL 4E41B 4QHKI 2ESVB 3RQ3A 1XEDA 2BP3A 5C0AE 3K2UL 4Z77A 3T77B 2DYPD 2GFBB 1T22A 5AYUH 5D1ZA 3WFEH 3SPVA 4ODBD 7CGTA 3VFUA 4MXWL 4MJIE 3V0WL 1QYGH 1H3VA 4OCSL 4ZOBA 4A2LA 2IPUG 5HJ3B 5DZOA 4K8RH 3BMWA 5F1NB 3X3FH 3RZCC 1PY9A 3DROA 3A6OA 3C8DA 4LCWB 1FYTA 4G7VH 1VADA 1B4RA 4X5XA 3R8BB 2AJZB 3QUYA 1F8TH 1KF9B 1OCWH 2EIEA 4OLUL 4OZHE 3RZCB 4GAGL 1BZ9B 2IBZY 1T2XA 3IDXH 4IRJB 4WTZG 4ZFZB 1AGFA 3CZJA 4MGXA 3LEVL 3HR5B 3GMLA 4MAYB 1BJ1J 4MZ2A 1HKLL 3KVQA 3HC3H 1LO0L 5FCUL 3HNSL 4ODHH 3IDYB 2BSRA 5KN5A 4POZC 4OLXL 5I8EA 4KY1H 1CFBA 3O4LD 4DKFL 3IFNH 2ZSWB 4KH2A 5E8EA 1BIIB 1MFEH 3AGVA 4EN3A 2XG5A 1AGBB 4CW1B 4KVCL 4LRIC 4LSPH 1N7MH 1AR1C 3HPLB 5DRXA 4JY6B 4GJTB 1PW3A 4LIQE 1MCNA 2FX9H 5GS0H 5CIPB 5BVPH 4RSVA 1A6WL 3O3UN 3BWAA 3EYFA 3RIFF 2IH3A 4ONOA 3TBVA 3NIDE 3ARXA 4HG4J 3ES6B 3VH8G 2VR9A 5D7SH 3QISA 4LHUD 2D7TH 4PV9B 1EJOH 4NZTH 3W5MA 1AQDB 5DUML 4ZAKC 5DMIL 2HFGH 4HLZG 4UNTA 5I1LA 2CGRH 3FRUA 2ZUUA 5AZ2H 1WBZB 3HPJA 3G08A 15C8H 1D6VH 2J8UE 4AT6A 2X4RB 5DRNB 4LPWA 1W72H 5DHYA 4UMGA 2ZJSL 3WLWD 3BPOC 4KI1A 4QHLA 3QG7H 4KXZI 1J1XL 4DKDC 3G9VA 5HHPA 1XF2B 3TEUA 1ZVSA 3RWCB 4LKXB 3JWOH 4LQ1A 3BPOB 4P3DA 4HAGA 3RTQD 1NUFA 2VO5A 3WFEL 4QRPD 3GIZH 4L4TA 4E5XB 4HV8A 1QYGL 2DWDB 1S7QB 3VWJA 4JY4A 5ICZB 4XCNA 4K8RL 4P23A 3X3FL 4YFLI 1WBYB 1P9MA 5HDQL 2H2PD 3PHOB 1W0VA 1F2XK 2QR0A 4G7VL 1KPRA 4H1LA 4UUJB 5EBGA 5IJKA 1A21A 2PTTB 3DGGA 3IDXL 4OZIA 5DGRA 1G7JB 2Z91B 4OAWA 3VXUE 1TITA 4PY7A 4NYLB 4IDLA 4L9LC 4XXDA 3ECBA 3LPWA 5I66B 4G8GE 1GSMA 5ID1A 1H0DA 1M1SA 4PRHB 4ODHL 2YPKB 3IJYA 5C09B 3T0WA 1MRCH 4R6UA 3FO0H 3V2AR 5MEQA 5SWZE 4U1NA 4PD4K 3IFNL 3FB7B 4G8FA 4K94L 3LD8B 3V4UH 5I1IH 1N6QH 3OG4B 2VDLL 3NIGE 1WTGT 1Y0LA 4LSPL 1N7ML 3QUXB 5D2LB 1VEOA 5EUOE 5GS0L 1C5BH 5BVPL 4JKPH 2CRIA 1G9NL 5DC4B 1Z6JT 2JJSC 4Y4FB 2IG2H 3B9KA 5E95B 1KC5H 1T6WA 4Z7UE 2YWZA 1QRNA 5GS1A 4GRLC 2D7TL 3VFWB 1PJ9A 3VG9C 1A7NH 3O2DL 1EJOL 4NZTL 4XPAL 1KULA 2A6IA 1LP9A 5T5NF 2HFGL 3ZT5A 4DTGH 1MH5A 2CGRL 2UZIH 2OSLA 4AYFA 3V52H 1GIGL 2YXFA 1CDIA 5AZ2L 2VLME 4KXZH 2DQTH 1D6VL 3ARSA 4P57B 2EKSA 4Q9QH 5KVFH 1CICA 1SMAA 5IEHA 4QRRA 2X6MA 3SDXA 3QAZB 5GSRA 3BRFA 3EGSA 2OK0H 3QG7L 2ZPKH 5GSVB 2W38A 3UPAA 3JWOL 1MOEA 5C08B 1FYTD 1IGCL 3HZKA 4GAYA 4ZS7H 3QUYD 3QIBC 2MPAH 3RU8L 3G5YB 3GIZL 5I73C 3T0VA 1BQHA 1JRHI 1FLRH 4K3JH 1K8IB 4MA1B 4V2CB 5I73B 3GSWB 2BNRE 4NUGH 1T7WA 4J3SA 3V5KB 3MCLL 3SDAC 4NWTL 2XOTA 1AIFA 3W0WA 1YPZA 5EZLB 3QXDB 2NNAA 1TVHA 4S1SH 4YDVB 5HHOB 4M5ZL 3PWPA 1VFBB 1D5IH 3U2SA 1EX0A 2ADFH 4EN3D 2R2EA 2WBJA 3C6SA 5DRWB 4TQEH 1U2HA 3L95A 2YD8A 3RVTC 4F9LA 1FNAA 5DUBA 1OARH 2XZQL 3MRIA 3WHE1 1FH5H 1YY8B 3MQIA 4MQXD 3BH9B 3BZFB 2DIAA 1MRCL 3FO0L 4ZFGL 2NXZC 3UAJD 4Z76B 3V4UL 5I1IL 4KKLD 2NZ9C 3GBML 1N6QL 2F74A 3I9GH 4OFDA 3N1QC 5MP6H 4WI9A 2AJSH 5GRJH 3FCTB 4UOJA 3SE8H 5E5MA 2OI9C 2W0PA 1NCCH 3QXAA 4P9HH 2HA1A 4WW1A 1C5BL 4JM2D 3LQZB 4D94A 4JKPL 5CIPH 1HHIB 4WCYL 1F3RB 5H2BA 1OPGH 1O0VA 1KC5L 3STZB 1NGPH 5L9DH 1MVUB 5DA0B 4MQ7A 1A7NL 3CDFA 3G6JF 1E4JA 5LWYL 1P7KA 1U6AH 4ZTPH 1NEZB 1O7SA 4TTDC 3HZVB 3UTSB 5IQ9B 2UZIL 3L7EA 1YEFH 2M26A 4FXLA 1G0XA 5IG7B 4U1HB 1KJ2B 1F6AA 2NQCA 2BVOA 2DQTL 4X6EB 2FBOJ 4NBXB 4Q9QL 2AXGA 4OGZA 1INQA 4UT7H 4YDIH 5LKNA 4YBLB 4R9HA 4XB8A 1LNUB 43CAB 1T20A 4N5UA 4OCXH 3BP7B 3VWJD 3HAEA 2ZPKL 1Q0XH 4P23D 3MJ9A 5T1LB 1JRHH 5J57B 4P9MH 5L2KE 1HYSC 4ZS7L 4PTUB 4JFEA 2OJEA 4DZ8B 1JFQH 2A2QT 2FECL 2OS7A 2VLKB 4FQQB 1RUPH 1D5MB 1OD9A 4R4NC 1FLRL 4K3JL 1SVCP 3IVKB 3CZFA 4Y2DB 2WLZA 4ZUUB 2YD5A 2ICES 5C0FB 1CFTB 3EOYG 1ZT7B 3MOBH 1A9EA 5DQDH 3QYCA 1KJMA 1IBGL 4ALAL 2PXYA 5E2VL 3IB4A 3PL6A 2AAVA 3STLB 1BFVH 4S1SL 5EBMA 3V6FA 3IDJB 2CDFA 4X80H 3IXAA 1AKJB 1D5IL 1DLHA 5BW7C 5FUZH 1IAOB 4PJFE 1KXQE 4TQEL 1NCDH 4PJCF 5I8OH 4F7TB 3DTXB 3DVNA 5F9DC 1OARL 1FH5L 1QSVA 3ARBB 3HRPA 3C8HA 4PY8J 4P2OB 1MSPA 1XIWC 1IKNC 3MCKA 3PQYB 5B38G 3B9KD 1T5WA 1FAIH 4NPYA 1QRND 4FTVE 2AQ2A 3WO4C 4BQCA 4HK3N 4PRNB 4EDXA 3BIBX 2YA2A 4KKCD 5D5MB 3I9GL 3LKRA 2AJSL 5GRJL 3SE8L 4R0LB 2CDGB 1NCCL 4P9HL 1P7QD 3MPCA 3WO4B 1Q0YL 2YEZB 3VI4F 2LU4A 2DQIH 1YMME 4MNHA 1OPGL 2XNAB 5L9DL 1QR4A 4A6YA 1CICD 1DANU 2ZNWA 4QRRD 4ZQKB 32C2B 2HJFB 3V6ZB 1H8NA 3TBSA 1NBZA 4PJCB 4JFFB 3LKOB 4WFGE 2AEPH 1ZLSL 2UUDK 1YEFL 1CT8B 2I5YH 1F3JB 4R7DB 2VZTA 4UT7L 3G5XA 1PG7H 4YDIL 3QDGB 5I1GH 1J9CT 5FHBL 3ETBF 4YX2H 4PJBF 4OCXL 5JZ7C 1A7QL 1TDQA 1Q0XL 1YEKL 4HFWB 4M6OH 5I1KH 5D6DA 2L7JA 5EU6E 1IE5A 2YRPA 1JRHL 4MNGE 2YD6A 4X6DF 2OQJA 1UXSA 3UO1H 3B43A 3W0WD 1JFQL 3AMKA 2ZSVA 1RUPL 2B1AH 4X7TB 4LCCC 3PWPD 1ZSDB 4WFFE 3ARGA 4X6BA 5FF6B 1PQZB 1KLUA 2WBJD 1KLFA 3G04B 3MOBL 2Q7NA 5HVGB 5J3HD 5D7JD 3UTQA 2BNUA 2RCSH 4RAUA 1ITBB 5E8PB 4DUVA 1MIMH 4LKCA 2VXVH 4YQXH 4PJBB 5EWIH 3S97C 4KTEL 3ARFA 2NXYC 3CLFH 2ATKA 4K7FB 2CIKA 4ZPTB 5HHNB 1DSFH 3REWA 1M6OB 2HG5B 2JCCB 5HY9A 2DIJA 3UJIH 5I8OL 4QHNA 4PJ5D 3UTPD 1AXIB 2PYEE 1BVLA 5HDLA 3TZVB 3RDTB 3ROOB 5E99L 1BLNB 1UADC 3GBNH 4YEEA 3T08A 1Q9OA 4RFEA 1FAIL 4N8VA 1K4CB 1ZLVH 3MREA 3NVQA 4P5TA 4NN7C 4U49A 1U8KB 3ULUF 1CF8H 2X44D 1FFRA 1JGEB 3EFFB 3H9YA 5TF0A 3KDMA 2HFFA 4Y5VB 5EBWB 5IB2A 1MAJA 4Z7VF 4MMXC 2H8PB 1YQVH 2OMBA 1E4KA 1ZA6B 3B83A 1OM3H 4YXHL 1HHKB 5D93B 1NGXB 4EJ1C 2AJVL 4L1HA 3FQWA 5KJRH 3TYFB 2AQ1A 2AEPL 2VABB 5FYJL 3WLBB 1KJ2H 1IM3A 4PJDB 4JFED 4YO0A 5FV2A 2E27H 1O5DT 4UAOC 1PG7L 3EOBB 4MJ4A 1NDGA 1R3IH 4M6OL 3VJ6A 4YUEL 4PJXA 5SWSA 4UAOB 4M8QB 4NNYB 3OMZA 4XX1G 3JV4A 4E41E 1RJLA 4NO3B 2ESVE 5F3BA 4Z7VB 5E8NA 4KRMB 3UO1L 5BZDB 2PXYD 3D9AL 3UCRA 3HG1E 3PL6D 3MXWL 4PRPA 1WBXA 3MRFA 3S36X 5GJTH 4HUUA 4KK8C 3EO1B 2AK4B 1G0DA 1B90A 1UYWH 4PP1C 3VW3H 4QHMB 5FECB 2NY2B 3L3JA 3OB8A 4NOFA 4LCWE 1D5BB 2BHZA 3P4LA 2RCSL 4JHZA 3MFFB 4GKSA 1MIML 3PV7A 3R0MA 4BQ9A 2VXVL 2H32B 2DQHL 1XGRA 4R8WL 4WGWB 5C92A 1DSFL 2EEBA 4JB9L 1U3HD 3HE7B 1CGXA 2Q1EA 5T3XD 1TQCC 3UJIL 4FQXB 3L7FA 4NM8H 3K1DA 5FKAB 2OTWB 3IYLW 3ZSSA 3VA2C 3MV11 3GBNL 4AEHH 5JOEA 1IL1A 2FZ3A 4HZLB 1LGVA 4OFYA 3PWJA 4KROB 3TIDB 4JZNB 2CKBB 3B8YA 1CF8L 4M7LH 1JWUB 2F19H 2BNQA 1INEH 1Y18A 3V5HA 3UX9B 4Y19A 4XNXL 4OD2A 5TDOA 3MV9A 2EYRB 5DD6B 5C9KA 5FO7A 4GKZB 1EJ6A 3U4BL 1H3WM 1NLBH 5E2TH 2EEAA 3GSUB 3ESVF 3F62A 2R56H 3KPSB 4F3FA 4HMEA 5D7LA 2CO6B 1U9KA 4FQPA 2V17H 4I5BA 5ETUA 5KJRL 3NIFE 4NSKA 4PB9H 2FDBP 3IETA 3FOMB 3H9SA 2AXFB 2UV3A 1HYRC 2DM4A 2ZP0T 1EHAA 1UCTA 2XT1B 5IMLA 1KJ2L 3GSXB 1URLA 1XCQA 3U36A 4Q6IA 5IW6B 2E27L 4HUXA 3VWKC 3VFTB 1R3IL 4LDOB 2Y25A 4O58H 2VDNH 4OZFA 2A6DB 3ARGD 2EC9T 1RAMA 3VWKB 3FL7A 1KYOK 5B8CB 1CFSB 4NRYB 3D2UA 1ZS8A 3DRQA 2ZG3A 5A16B 1CDBA 3UPCA 5ITFA 3AXLA 3CPLB 1I7UA 2HLAB 4AM0A 5C0GA 4KQ4H 5GJTL 1BD2D 1EHLH 2GYSA 4NHCL 1UYWL 3X14A 1YUHB 4KRLB 3VW3L 2QTEA 1CR9H 3NPSC 1T0MA 5D6CB 1N2RA 3A6BH 4U1GB 5GGQH 5IB4A 5TE7L 3PWVB 1BOYA 4PGEA 2MCPL 5FOJA 4G5ZL 1UB5A 5JIPA 1NQBA 3V6OE 2WANA 4YHPA 5GGTA 3MRJB 3T4YA 3WFBH 3JWNC 5BRZB 2XZAL 4Q7DA 2DBLH 4ZPVA 1JUFB 1X4YA 4ZODA 2P5ED 3ZT7A 1UM6H 1TJGL 5I71B 1UVQA 3VE0B 5JDJA 4HUKB 5CUSH 1JF6A 3L6FB 1FO0B 1UJ3C 2Y23A 2NMSA 4DKAA 1FL6B 4PRHE 4AEHL 5C09E 2WIIA 3GMQA 4X99B 1UJ3B 4QCIB 1X5ZA 3GNML 4PRIA 4PREB 4YHKH 4CN4A 4M7LL 4HBCH 3DHJA 2F19L 5GIRA 5DMYA 1INEL 1Q94A 4RWHA 4HKJB 5ISZA 3L9RA 1DBBH 4G42A 4UI2A 5D2LE 3EYVA 5FOBB 3X11B 1MCWW 2D9QB 2LFGA 1NCTA 1NGZA 1DBAH 4WI7A 4QXTA 3WLWC 2R56L 3X3GH 4UTBH 4V1DD 2C4FT 1JHKH 3C09C 4M7KH 4B53A 2FGZA 1EZVY 4L8CA 3QDAA 4EI5B 2LVEA 4HIIB 4PB9L 4MJ2A 4LRNH 1HQRA 2BOCB 2D7MA 2X7LA 4NDMA 2A6KB 5SWSD 3GSRA 3RTQC 3C09B 4K3EH 1MAKA 5FYJE 1ZHNB 4X6CA 4P46A 3W81A 3U1SH 3LVEA 4O58L 5MENE 2H2PC 4NM4H 2X4PA 2VXTH 1DEDA 3PIQB 4BZ1L 2Z35B 1EGJA 4J3WA 4PB0L 4UIMB 3B3IA 3F7QA 3MC0A 1J86A 5C08E 3VFNB 4RGOL 4S0TD 3DMMB 4Z8FH 2C3VA 4R97B 3KPNB 5IMOA 4M3KB 1EHLL 3VXTA 2P4AB 2DS4A 3D69B 1CR9L 2EEDA 4WHCA 3A6BL 4PJIA 3C60C 2R0KL 4JEGB 3NFNB 1EXUA 1M7IA 1YQ2A 3TIEB 3QJHA 2AKRA 2VYRE 4JCMA 1N26A 4HKBA 5I1AB 5ICYB 2VZVA 1UXWA 2DBLL 4OFYD 1G7PA 5HHOE 1YN7B 3WJLC 2H32H 4IJ3C 2NTFB 4LCUB 4BFBD 3IAPA 2QJDA 2FL5A 4Y19D 3QUKB 3O6KL 2EIDA 3MV9D 5DS8A 4IJ3B 2ZUQB 1F4YH 4WV1C 4OLWL 1PYWA 2QADB 1M05A 2BVTA 3QJFB 5IHUH 3QO1A 5DR5H 5IM7A 1OF2B 2AV7B 5D7LD 2CKBH 2P49B 2FWOB 2R2BA 1S9WA 2F8VA 3QEGH 3RY4A 5EO9B 3H9SD 5CCKH 4JFYA 5DTFB 3CDGB 5EU3A 4G8IA 4PJ7A 2KKQA 1R5WB 3LB6C 3F12B 2EE2A 3REVA 1DBAL 4HSQA 1F6LL 3QWOB 4NRXA 4UTBL 5FM5O 4PP2A 3OKLB 3JV6A 2AS5M 1JHKL 1BJMA 3MBEA 4Q74A 1KIRA 4LRNL 2VDKH 2XWTB 3E6FB 3TYGH 2NY4D 1BZ7B 4CADB 4PRAA 4K3EL 4G8EA 4U33A 3UTSE 4WO4A 4OQTL 1ZHBB 2HJKA 3LEXA 3MRBB 3VGFA 4BJLA 3U1SL 4OZGB 4JDTH 1GGCL 3C5JB 3N9GH 4PJAA 1HXMB 3ILPB 1X5HA 4NM4L 4W4OC 5KSBB 4PYGA 1FQ9C 1SJHA 2VXTL 4LGRB 5KAQG 2VWEC 1A6ZB 5CJQH 1K5NB 3QIWA 1NL0L 1RUAL 4UV7H 1I4FA 4O2FB 2IADA 5IR1B 1PLGH 1IC5H 3HUJA 5DQ9B 3V7AE 5FO9B 2VLKE 3KG5A 4EN3C 1D3CA 2J8OA 3FOLB 5EUKA 5EFIB 1T1ZB 3MLYH 5TH2A 4KUCF 3CCHA 4HXAL 3HA0A 4LP5A 3S7GA 3RUGB 3M1BA 2QV2A 4MQXC 4QXUL 4ISVB 3WNOA 1H5BA 1MQKH 4NQSA 2O5ZH 4LOUD 2MFNA 4CMMB 3MRRB 4FQLH 4KKLC 4EBQL 3T2NH 3PV6A 3DUHA 3QCTH 4IIQC 2COQA 1U8QB 3PGCA 4PRID 1IAMA 4LLWB 4JM2C 2BJMH 4IIQB 3T2QA 5ISZD 2XXMB 4NQDB 1BECA 1XFPA 1FO0H 4M43H 1AC0A 5IHUL 5DR5L 5FM5M 5ICXA 3PQYE 5A43C 5TGBA 1CE6A 1QFOA 2CKBL 1CXEA 5MEOB 3QEGL 5D5ME 5GS3A 1FRGH 1AXSA 5CCKL 1NC2B 4HLZH 1OSZA 3EDKA 3I6LD 4GRWF 2EYSA 3HCVB 3WJJC 3ARVA 2DLFH 4S1DD 4FRWA 1K4DB 1A6TB 4P46D 2P5WB 4KHTH 3VWJC 3DX9A 5ESAA 1RIHH 1P9MC 3JBG7 1NGWB 1RHFA 3P40A 4GBXA 4HKXB 3FO2B 2IBZX 4UINH 1GPOH 3RGVA 1ZE3C 3PXHA 4JFFE 1MFCH 3SCMB 1ZLUK 5IJKC 3DVGB 3LKSA 4U3CA 1VFAA 3CFCH 2GI7A 3PXJA 4JDTL 1I1CA 5BS0A 3QI9B 2H3NB 2GQHA 3N9GL 1NGQH 3QDGE 2H9GA 2IH1B 5J56B 1GL4B 4HIEB 1AHWA 5GPRA 4GRWB 1HH6B 5CJQL 4OBSA 2AJXL 2V7HA 1JTPA 4UV7L 3V79C 1VGEL 1T3FA 3WS3B 3C5ZC 1PLGL 2FD6H 5DJXA 3QDJA 3BZ4B 1D5XA 5GJSL 2VQ1A 2V2TB 1REIA 3KJ6L 1BM3H 3C5ZB 3GSNA 1KIPB 3W11D 5DLMH 4TNVF 3WNKA 3ZTJG 1CDGA 1HIMH 5ESVB 1F6FB 4HULB 1MQKL 2KDGA 2O5ZL 4LEOA 4LU5H 4OFIA 5HXMA 3VDAA 3HS0A 1NMCB 3TA3A 5B38B 4FQLL 3T2NL 4KKCC 1SYVB 1YEDB 2V2WA 3QCTL 1BFOB 3WL9B 5C7XL 2C5DC 1AO7A 2AV1A 4N1CA 3KR3H 4OGYH 4V2BA 2YBRB 2JCCE 2BJML 4RFNC 4HC1L 4LASL 3SDCC 3PWNA 4M43L 5HDOA 2VLRA 1CICC 4GUPB 5EZJB 1R3KA 2DM3A 3RWFB 3MBED 1WEJH 3CSYB 3V9FA 1FG2A 1YYLH 1OLLA 1FRGL 2DJSA 5CBAA 1DEEA 3CIQA 2WAHA 1EFXB 4NQCB 2DLFL 4YAQA 4WO4D 4Y5XB 3QHFH 1CXHA 2DTSA 3CMOH 5GRWA 1T6VN 3MODH 2G9HA 3R4DA 4NZRH 4KHTL 3AAZA 1UA6L 4Y8AA 2VL4A 5T5FL 1RIHL 1X3DA 4Y1AB 1XCTA 5F8QC 3F58H 4XT1C 4XCFL 2UY7A 4LLQA 1FG9C 4WUUA 1MFCL 2LTQB 1AXTH 4P3WA 1LK3H 3MO1B 3QIWD 3O6LH 3OHXB 1HNGA 4PJDE 3UP1A 1DE4A 1GZQA 1I8MA 1FL5A 1I1YA 1BBJB 3BE1L 1KIQB 1NGQL 2MWCA 4G9DB 1CL7I 5H37G 1A6AB 2WBJC 3O41A 2HRLA 1F3DH 5GZND 4XP4H 5HGAB 2J5LB 3AREB 5D7JC 5J3HC 3W9DA 4P99A 2Q86A 2BRRL 3U9PH 5HVHB 3FO9A 1TNMA 1YC8A 4NNPL 5BZWB 3OKDB 3MNWB 1IARB 1FHGA 3LZFH 2FD6L 4MCZB 2IMNA 3ILQD 5IK3A 1TZIA 1BVKA 1K8DB 3G6AA 1CVSC 1BM3L 1CD8A 3MA7B 4ZSOB 3I02B 1YEIH 4MXQD 5DJYB 4EXPX 1HIML 4HXBH 4LP4A 1FZJB 1H3TA 4LU5L 5KSUB 3O2WH 3MRPB 2GSIB 4JFDA 5IHLB 2BFVL 4FQHA 3O2VH 5BXFB 4HZAA 1QBBA 3TH2T 3CC5A 4L29A 5ID0A 5F71A 3KR3L 3S3SA 4OIBA 3SHSA 2X4NB 2E9BA 2VZ1A 3BIAX 1X5FA 4CVUA 1BGXH 4DOHB 2IFGA 1DDHA 3HI1A 3BOVA 2F53E 1J12A 5K9QI 3VFOB 3AU1B 4WU7B 5E6YA 1WEJL 5EZOH 4ELKB 1YYLL 4G6KH 2VITA 4GBXD 5D96B 4LHUG 4U1JA 2P44B 3EBAA 1BQSA 2EZ0D 3IT8D 3RGVD 3K3QA 5IT2H 3FB5B 1Q9KA 2X4SB 3UTZA 2XA8H 3QHFL 5J06A 4GAJH 1E0OB 3MODL 4NZRL 2P8LA 3G6DH 4N0RA 4PUBH 1HCVA 5BS0D 3KPSE 3DUUA 4YXLH 1CGWA 5TE4H 1EO7A 3F58L 1N5AA 5GHWH 1I9RH 5DEFB 4F80A 4JPVH 2GJZB 2O5YH 4EVNB 4DW2H 4ZFOB 4H88L 1AXTL 5AAMA 2PXYC 5K9OB 4GG6F 2X1QA 3O6LL 4BSWA 3A6CH 2OMNA 3I6KB 1FFQA 1LHZA 3TPUA 3QR2A 5F70A 3QDJD 5E94B 3AVEA 5CFHA 2YC1B 4IMKA 1NFDB 5LGJA 3H42L 1C16A 1CLYH 2AI0H 3VXME 3U9PL 3UTTA 3LV3A 2XN9B 1FNEA 1MJJB 4BH8B 4ZUWA 2DN7A 4W81A 1P4LB 3IFOB 5AAWA 5IMMA 3TA3D 3L1OH 1CIUA 1RJCA 1SEQH 3SO3B 1U3HC 2PNDA 1QHOA 1JL8A 2R4SL 4G6AD 1TPXC 3NGBB 1AO7D 1QSFA 1HI6A 5F9WB 2EDJA 4Q0XH 4D8PB 1YEIL 3H8NA 1GGYA 3G9AB 4HXBL 5F1OB 2AJUH 4HHAB 3WHXA 1CYGA 3L5WB 1NGYA 1BEYL 1C7SA 1PG7X 1U93B 3LKPA 3NABH 2CQVA 2VLRD 35C8H 5IFHH 4OZ4A 5C3TA 5BRZE 2J12B 3BKMH 4XH2A 1CGTA 1CU4L 5DSCB 5IVOA 3EHBC 3BRGC 1OAKH 4YNYA 4YHML 2B0SH 5DHVH 1WWCA 3BPLB 3ZKXB 2H45A 2XTJD 3SKOA 4PBWD 1CDCA 1BGXL 1PKQA 1LD9A 4YGVB 2D9CA 1RIUH 1VGKA 1V7ML 3VFGH 5DJ0A 4FFZH 1NDMB 4UDUB 5GGSA 4EEEA 4R3SB 5D6DC 5EZOL 3O11A 4YDLC 4I4WB 5INCB 4IOFD 4O00A 5IWLC 4YHIB 5IT2L 1I3UA 4WUUD 2F54A 5JW4R 4QRTB 4ZNEE 3RL1A 2XA8L 4GAJL 4PJEB 4YDLB 4I0CC 3G6DL 2FEDD 5F9JB 4PUBL 3L3HB 3ARGC 4GG8B 4M1CD 4YXLL 4H5SB 1J18A 4DCQA 2AVGA 5E8OB 5F93C 1F11B 5GHWL 1I9RL 3MLXH 5IEKA 2O5YL 1NBYB 3OJMB 5J6HB 1T21A 1I7TA 1WZ1H 1EUTA 2Z93B 1EH9A 2APXA 4F9PC 4MJ6A 1U95A 2YPLA 1INDL 1FGVH 4CNIA 5ACZB 4P4RB 4HLJA 3OZ9H 1E27B 5K9KB 1YECH 4PD4J 5GZOD 1HDMB 3FQTB 2X89D 5J11C 2AI0L 3GMNB 4HK0A 3TBWA 4F7MA 1ZLWH 1KSRA 1KLGB 3C2SA 4QRQB 4N5ED 2W60A 4RBPH 1HN1A 3BGMB 1SEQL 4JFDD 5JHDD 4OKVA 1K2DA 1NFIB 2RBLA 1JWSA 4HGWB 3V6BR 6FABL 2K3TA 5DJAB 4TULL 2AJUL 3GMRA 4G6ML 4QXWA 5EU4A 4S0SD 1E4KC 3BSZH 1MCOH 4JAMB 3NABL 3OX8B 5T3ZH 2EKJA 3V8OA 1FP5A 5C0AA 4XGZA 35C8L 5IFHL 3CU7A 1T89A 3CFBA 1HHGB 3BKML 3LN4A 1S8DA 5JOFA 8FABB 2WWKT 1OAKL 2JKXA 2OL3B 4LVOC 2AERT 1OWRM 4MJIA 4L1DA 5C0BB 2GCYA 7FABH 5HYIA 4O9HH 5F3HA 1SY6H 1AH1A 3OQ3B 4X83A 1RZIB 5D1QB 4WEBL 1NAKH 3BP4A 3VFGL 4JDZB 4FFZL 3WFHA 3W2DH 4OZHA 3BRDA 2AXJA 2I24N 4LGPB 1UZ6E 2XKSA 3FQNB 5FA4A 4K7PY 1DVFB 4U6HB 3JTTA 1YNLL 1B9ZA 2VR4A 4M6NL 3QA3A 1AY1H 1FFOA 4X6FA 1J0KA 1I8KB 1U8MA 2LE9A 3CFKB 1ERNA 4Z7QE 1I8LC 1T66C 1CFVH 4LMQI 1G9EA 3N85H 3DHMA 1Q9LA 3L3GB 5IOPB 4IHOA 5DRZA 4HUVA 1AR2A 3UBXB 3FZUD 1B6DA 4YR6A 1WZ1L 3UTTD 2YOCA 5BJTA 1U8OA 4OV6F 3HLAB 4G9FA 3W39A 2W0KA 2ITDA 5MERB 1TJHH 3RAJH 5KSAB 3OKOB 4H1LG 4OZGE 1XF1A 3GSVB 4K3GA 3K0WA 1YECL 1DL7L 5IB3B 5KSBE 1QSFD 5KS9F 1U42A 4JKLA 5F1KC 3T09A 5JIHA 5EORH 2PN5A 3MNVA 3ZE1E 4YHOH 5C86A 4PV8B 4QOKB 2VERN 4Z7WF 5LCVH 1H3GA 1D9KB 3ARUA 5DYOA 1G7QA 1MJ8L 2J8UA 2D4FA 2R1YB 4I0PB 5E1AA 4XBGA 1BOGA 3R06B 3RUGE 4N9OB 3U46B 2LU7A 3GIVB 1CG9A 1T5XA 1OWWA 1G7IA 3GSQA 3BSZL 1MCOL 2O93L 3CNKA 2B1HH 2BY0A 4ZUVA 3SKMB 3DURA 1C08B 4M7ZC 3F7VA 3GMPA 2RFXA 4O2CA 4TUJB 5F89A 5JR1H 2CD0A 5CSBA 1HINH 2ARJB 4ZXBD 4JCLA 1ZLUH 5E4EB 3BUYA 1FIEA 7FABL 2YA1A 4KFZC 5KAQF 5IJVB 1UJTA 4O9HL 4Q6IC 5EC2A 4ELMF 4MD4B 5A2KH 2F54D 1XT5A 3EKCA 5F7EH 4F15B 1OQOA 4LSTH 4EUPB 2Z9TA 2F58L 4BSVB 3W2DL 4JO2H 1P2CA 1QVOA 1YY9D 2NY4C 1UZ8A 3S4SB 4XPFL 4M6ML 4P2RB 3JWDC 1FN4A 1RVFH 3VXUA 4UQ3A 2ED8A 2HMID 3T0XA 1AY1L 1U8JA 1MCEA 4G8GA 3KWWB 2O61A 2HLFD 1H3PH 4L5FH 3L5XL 1CFVL 4TVPD 4K7PH 2P5WE 2YPLD 4K23L 3EDFA 2GJ6B 2Y36H 3N85L 3ARDA 2P24A 2BOBB 5SWZA 1YJDC 3HMXH 1T0PB 1BQHG 3NN8A 3NOIA 4K2UH 3F7YA 3MROB 5C6TH 5DC0A 4BH7A 2BC4A 5GRVL 5EUOA 1X7QA 1U92A 4X98A 3RAJL 2VAJA 3UBXI 4IOIA 4Z7UA 1XGUB 2EDBA 3C8KB 4H0HB 1VENA 4G43A 2PO6B 4UIKL 4HUWB 4LOUC 5EORL 1T2QL 3KXFB 4CJ0A 1WICA 4YHOL 4Q2ZB 3RX5A 4P2QB 3WEXB 5C0AD 5FB8A 1MEXH 2GT9A 5LCVL 2NYYD 5I74B 1NSNH 4AJ0A 3CGTA 3ALPA 1EEYB 3DYMA 4MJID 3DXAB 2ZOKA 3BT2H 1TIUA 3DUSB 1ACYL 1JNHB 1L0QA 4JLRB 1V8HA 5C1MB 2VDMH 5I1CH 3VXQA 1JI1A 2XTLA 2HT3D 2BDNL 4LVHB 4WEUD 5FO8A 5JR1L 3FFDB 2G60H 1HINL 3MJ8A 2W65A 4EOWH 1ZHKA 2IQ9H 1E6OL 2IANA 1JGLH 4RDQG 4A6YL 2OL3H 3B4NA 3MYJB 4HH9B 5IVZB 43C9A 1G7HA 2BSTA 5JQHC 1MRDH 4S1DC 1A1NA 2BNRA 1SEBA 4LSTL 2C9AA 3R1GL 4LLAA 3KLAA 2Y9RT 5JW3L 2D0GA 5I9QB 5A2IH 5FYKU 4JO2L 3KPOB 3O3DB 3QDMB 3K7UA 5DD0H 3KPMA 3IDMB 4L8BA 3A67H 3GRWH 5EIIA 1C8PA 1RVFL 3HAEG 1MAML 4XNZB 4X4YB 2NW2A 5C9JA 3RWHA 3DLQR 2VAAA 1H3PL 4L5FL 2DBJA 3G5VB 1NKOA 4J3TA 2XV6B 4UTAH 2Y36L 4W4NA 5I17B 4Y1AE 4JFHE 3HMXL 2NY3D 1QBMH 5GS2D 3FTGA 4JZJA 4K2UL 3NAAH 5C6TL 4MLSA 2BSSB 1U2CA 5B21A 1RK0A 3ROLA 3H9ZA 2E7BA 1J1OH 1JHTB 4HCRH 4Y4HA 2IMMA 3AB0C 3EDDA 2R8SH 1ORSA 5CLWA 4MD0A 2BVPA 5BQ7B 3ZDZF 4D0BA 2X70B 1MEXL 4WHTB 4NKMB 4PG9B 3H7LA 5HYJB 4P59H 3D18B 1NSNL 4LGSB 3BVNB 1QQDB 5J8OA 5C0EA 3OKNB 4RA0C 2KQMA 4L8SB 4ZSOE 4O51A 1RJYA 3IGAA 2VISA 1JV5A 4EI6B 1EZVX 1H15B 1IGYB 2WQ8A 4PJ5E 3OB0K 4X4ME 1X5XA 3MBEC 5L2KA 1MCSA 3GSOA 1T7YA 1JGLL 2OL3L 4AEIH 2WLYA 1CZ8H 3OKMA 3Q3GB 4WO4C 1MRDL 4NKDA 1F4WH 1Z9MA 5HI5D 3P4OA 1LEGB 3TWCH 4WIQA 4DOHE 2ZG1A 5L0QC 2ERJC 5J9PB 1SHMA 3GMOA 4G8GD 4EUPH 1AC6A 5CBEA 2ZOLB 1C12B 1S7SA 4WDIB 3ARDD 5DD0L 1PD6A 5SWZD 5LG1A 3A67L 3GRWL 3BXNB 4DWHA 3OR7A 3QIWC 1B0GB 1R6VA 3FT2B 4CVXA 4HIJB 2A6JB 1A47A 4FQIH 3JWDH 4OI7A 1R3HA 4H0IA 2HVKA 3NBNA 3RWDB 3OR6B 5GZNC 3MV01 4IS6B 2Y7QA 1MCQA 3TVMB 4GW5A 3CH1A 1QBML 1A14L 3JTSA 1H5BC 3P77A 5EN2B 3NCMA 1LK2A 2XFXA 3NAAL 1S5HB 3ILQC 1KIUA 3QIUD 1MCRA 2DF3A 4P5KA 3K4DA 3CFEB 1MHCA 1OTUD 1YMMA 2VLMD 4YJZL 1J1OL 1CFNB 1AI1H 1T1WA 1T1YB 4MXQC 1BX2B 4QXGH 3U0PA 4UT6H 1NFDE 2R8SL 4QYOA 1PEWA 1DP0A 5BMFH 1CDYA 1BQUA 2JF1A 4LVNB 3O2DA 2PETA 1XH3A 5HGHA 3LSOB 5KANG 2B5IB 2ORBH 5L8JB 2OR9L 4P59L 3IFPA 5FK9B 2KBGA 5TDPA 3O4LB 4ZUTA 4YDKH 4N1HB 4N8VG 3ULSB 1W72A 3F5WA 5AZEL 2ADGB 1MLCA 4LPCA 5EU6A 5TDNA 1CE1H 2WMPA 5LGHH 3RRQA 2FR4B 4MNGA 1WCQA 3K80A 2D3VA 5IVXB 4HIXL 2DLGA 3IJHB 4JVUA 2EZ0C 3RGVC 1R5VA 4NQXB 4HWEH 5AEAA 4ERSL 5AUMA 1GGBH 5JO5B 1F4WL 5LQBH 2LV4A 3TCLB 4OUUB 1KYOJ 4R7NB 3OWEA 3TWCL 4JKWA 4XCYA 3MJ6A 2CK2A 4R2GD 5JORB 1CLZH 3TFKD 5JNYB 3DIFA 5FA3A 4YPGA 1KPUB 3W9EB 2ZCLL 4J23A 5I30H 5H35B 3BQUA 4FQ2H 4LMQE 1JK8B 4UV4L 5E4IA 2R23A 4NQED 3JWDL 4PJEE 2DQFB 3DOSA 4PJ8A 1KPVB 3UDWA 4I3SH 3M07A 1HH9A 1U0QA 1FYHB 4Y4HD 4JQXC 4PGCA 3O9WA 3U82B 4OV5B 5CILH 1AGDA 3B5GA 3VD9A 4NBYB 3TA3C 5DK0B 5EDXA 4Z0XB 4QY8B 3RNKA 3MLZL 1HILA 2QSCH 3RVXD 3U0TA 3KYMB 3VFSA 4M1GH 1AI1L 5DMKA 4QXGL 3BDYL 4KV5F 4UT6L 2WWKO 1VACB 3SDDA 4JJHA 1BD2E 3TNMB 5MEPB 3ZTJH 3MRKB 1F4AA 2Q7YA 1CFQA 4S11A 1KENH 5C6PB 5EBLA 3BGFC 5M94B 1KXTB 1V3JA 5L2KD 5F7FA 2CK0H 3EZ8A 2XTJC 4NZDA 4M03A 4YDKL 4ZOEA 5DD5H 2DOCA 3EJZD 1A7BA 1FDLL 3SGKA 3ZDYE 3WIHH 4P5MB 4K8RD 1CE1L 1WFTA 4BKLA 5LGHL 3MUJA 4JG0H 2ESVA 4HF5H 1IILE 4J3XA 4X8JB 3T77A 2NPLX 3HG1A 4IOFC 1AFVL 1YMHA 3OKKB 2M1KA 4HWEL 4JVPA 1GGBL 3D39B 3MGOB 5LQBL 2H6PA 2WP3O 4AENB 5C0BE 2FEDC 5HJ3A 3TO2B 4Z77B 4HDIB 3DYOA 4LCWA 1BAFH 1T22B 3QO0A 2QEJA 5L7XL 2AJZA 3D6GA 5D1ZB 4G6FB 3OKEB 3RZCA 4HJ0D 3SPVB 1XR8A 4DN4L 4DVBA 4IRJA 4V1DE 4M9OA 4FTVD 3PGFL 4OZFG 3PNWB 2C3HA 4FQ2L 4ZFZA 3VMOA 4MAYA 3DROB 5D4QA 5TQ2H 3OXSB 4YC2B 5GISH 4B50A 4X5XB 5GS0D 4F7CB 5GZOC 3MRLA 4I3SL 4D0DB 1YMMD 1GZPA 1FORH 4HH8A 4HGKC 1VCAA 4OI8A 5HI4D 1T03H 1LE9A 4JO1H 5FUOH 2ZSWA 4N5EC 5L6YL 1KTLB 5HDBE 1DQQB 4KUZL 2ZG2A 1AGBA 4D9QE 3TJEH 4CW1A 2Z8SA 4WFGD 2QSCL 3HPLA 1PAMA 4JY6A 2DJUA 4OF3A 3Q1SH 2EDNA 1FVDA 5CIPA 4M1GL 1YEGH 4AQ1B 1YYML 4LRIA 5I8EB 4W6WB 2FX7H 2VIRB 1JPGB 1WISA 4P4KD 4OSUH 1KCKA 4F37K 2H41A 3LDBC 1AQDA 2ARWA 4DUXA 5CEYB 5EU6D 5JUEH 4U1LB 2EC9U 4QOKE 5E9DB 3EYFB 2CK0L 1WBZA 5HGGS 2VSCA 1LDSA 1MJUL 3TBVB 4KC3B 5DD5L 1YZZA 2GKIA 2YUZA 1RZKH 3EOAB 3MACL 3QPXH 4WFFD 4QRUB 1XF2A 5I19L 1ZT1B 1U58A 4JG0L 1LO4L 4HF5L 2NX5A 3RWCA 5I1LB 4LKXA 5IGXH 4PBVC 3HPJB 1I3RA 3SY0A 1S5IH 1T7ZA 5FUCE 4AT6B 4E5XA 4OZIF 2DWDA 3X17A 4AY0A 3BKCH 3BQUD 5ICZA 3NCJL 4XXCA 1C5DA 4TVSa 1KG0A 4JPIB 3PHOA 1BAFL 1P4BH 2PYED 4IMKC 4PJ8D 3FZUC 3QCUH 4L4TB 1AGCB 2PTTA 2QSTA 3O9WD 1A6VH 1CQYA 1G7JA 2Z91A 4P23B 1E28B 4NYLA 2QSVA 1UG9A 3LEYH 1W0VB 4PJGB 3VGAB 5GISL 4QGTA 2BMKB 3UJJH 1P5VA 5I66A 4GG6A 5J6GB 4PRHA 4M93B 1I1AC 5I18H 2GJ6E 3NZ8B 2YPKA 5C09A 3DGGB 4H8WC 1NCNA 4JO1L 5FUOL 5BVJA 5IB5A 4H0GA 4PJHB 2GHWB 3FB7A 4AMKH 2BHUA 4PY7B 1I1AB 4XP5H 1LP9F 4PJ9B 3ECBB 1BF8A 5DJ2B 3TJEL 4AZ8A 3QUXA 5D2LA 5ID1B 3Q1SL 4ZG1A 1V3KA 3K46A 3MV8B 4OB5H 1YEGL 3UPRB 1R24A 3MLWH 1R3LB 4S10A 4Y4FA 5MEQB 4U1NB 4DEPB 2FX7L 1T80A 3B9EA 4QNPF 3SDXF 4OSUL 3DBXA 1S7TB 3SBWC 4WWKB 3ULVH 1JN6A 3KXFE 4GRLA 4WW2B 4E41D 2APTA 2ESVD 4P2QE 1YN6B 1G1CA 4ZXBC 2IALA 3KPLB 4NO2B 1PGRB 1S9XB 3B9KB 1BVZA 5CEZH 3HG1D 4P57A 1HXYB 1QRNB 5GS1B 3QPXL 4KK5C 5MENA 3DXAE 4XB7A 1OAYH 5GSVA 3GDBA 1MY5A 1MH5B 1VB9A 1YY9C 3TN0B 4Q58C 3DV4A 5EOCJ 3TO4C 5C08A 4LCWD 1IMHC 2R0LL 2HFEB 3LRHA 5C71A 1S5IL 3RZCD 2EKSB 2VTFA 1YNKH 1YPZF 3NA9H 2HMIC 3I3EA 3T1FB 5IEHB 3TO4B 4IRJD 5GSRB 4C57C 1K8IA 3BKCL 4B0MM 2HLFC 3EW3B 2WNGA 4MAYD 3GSWA 3ZZ1A 4LF3B 4NN6B 1P4BL 4KDTC 2DMCA 3LAFA 2XYCA 4GAYB 1G7MA 1ONQA 3FO1B 3T4AB 3QDME 5BOZG 3FAXA 5EZLA 3QXDA 2HYMA 3C5SA 4YDVA 3X13B 1ZGLB 5HYSA 1QBLH 4RGNB 1VFBA 4Q6YA 4KI5C 3TNNB 3LEYL 5DRWA 3K8LA 1X4ZA 3QNYA 4PGJA 1OW0A 4K9EH 5J13C 4JHAH 5JMOC 1F5WA 2A1WH 4HS3A 1YY8A 4NZJA 4R90H 4XVSH 1S7VA 1BBDH 3WXWH 5I18L 3BH9A 1RZGB 4RDQF 1X6NA 3PWPB 5CEXA 4AMKL 3OB0H 3U2SB 4XP5L 3QEHB 5IP4A 2GEEA 2NYYC 3C6SB 2ICCA 4OCRH 1IAKA 1OGTB 4HJGA 1A7OH 3MRIB 4OB5L 1MHEA 4M62H 3MLWL 2APWA 4P2CG 1MVUA 2FYYB 4HWBH 2F74B 2HT3C 4UNVA 2BXZA 1UKQA 3AMLA 3RIAK 5FXCH 3ULVL 3MJ7A 4ZTOH 4WW1B 4HKZB 1XMWA 3HZVA 3UTSA 5IG7A 4NKIL 5J7CC 2DLIA 4U1HA 1KJ2A 2HH0H 5EC1B 1OP5K 5HYJE 3BFOA 5DURD 4X6EA 2FCBA 2EYTA 1P5UA 3QFJE 1RY7B 4J7RA 2APVA 3GJEA 4MQ7B 1CWVA 2W9LA 43CAA 1ADQH 8CGTA 1OAYL 3BP7A 5C07A 5D2NB 1HEZA 5I75C 5GGVY 5CHNA 2EDXA 1OP9A 5T1LA 4PTUA 1YEHH 3CFJB 1MPAH 1SMOA 4DZ8A 1AJ7L 1IQWH 2AXGB 5HYQA 5AD0A 2VLKA 4FQQA 2YRLA 1T20B 3QWQB 5CP3H 4I9WE 4Y2DA 4ZUUA 5C0FA 3Q6GH 1DUZA 1CFTA 2UWEB 5E56A 2FGWH 1BFSA 5CD5D 4QF1A 4WI6A 1N0XH 4JFEB 2NY3C 1N8ZA 4PRHD 4ETYA 3STLA 2YWYA 4ZOCA 5C09D 3V5DB 2CO7B 3IDJA 2Z8RA 1AKJA 3JUYA 2PW2A 1KBGH 4HJJL 3OGOE 1AGEB 1KB5B 1IAOA 1NUDA 3ZE2E 3DTXA 1A9EB 3QUXD 4JHAL 4K9EL 2A1WL 3ARBA 4R90L 4XVSL 1BBDL 2X1OA 4XHJC 3WXWL 1I3GH 4N0YL 4P2OA 5FGCB 4Y4FD 25C8H 1L0YA 5ANMB 2EH7H 2CDFB 4G6JL 3RA7H 3VGDA 2M2DA 1DLHB 1L7TH 1T2JA 1XIWA 5D5MA 1PX4A 2NY0B 1CDHA 3KYNB 4UU9B 3O3EA 3HNVL 4OCRL 4R0LA 2CDGA 4TSBH 4KMLB 3S88L 1A7OL 4PRDA 4KJWD 3Q5TA 1RFDH 2OTUB 4MB3A 2XNAA 3FB6B 1T5WB 4NPYB 4DKEH 5MEND 4ZQKA 4HWBL 32C2A 3V6ZA 1B3JA 4BQBA 4YHZL 2L0DA 4JFFA 3LKOA 4K7PX 4RGMC 4RNRA 2I9TB 2HH0L 5C08D 3DSFH 4FFYL 4Y16C 5HI5C 2R2HB 1U3ZA 2G5RA 3OV6A 3QDGA 5H94A 1ADQL 3WUZA 2IC2A 3D5OF 4HFWA 1JNLH 3T3MF 4NFCA 2JB6B 3RNQB 1MCLA 4ELMA 3O6MH 4RX4D 2Q76B 2MKLC 5TQ0H 4XZUB 1B2WH 1MPAL 1U8NB 5IVXE 1IQWL 3U0WL 1JHLH 3L3DA 4L4JA 2IQAB 2Z31B 5HHOD 3DECA 3FQRA 1ZSDA 5GGVH 5I6XC 1NUGA 1PQZA 4Q9CA 1F58H 5DHXB 4RA3A 2FGWL 3G04A 3OJDB 5E7FA 1JTTA 2XWJB 4DFIA 4H25A 5E8PA 2SEBA 5IHBA 4K07A 5KVGH 4LLDB 2ZUVA 4AG4H 2GK2A 4U6VH 1MQ8A 3QIUC 1LEIB 4X6BB 4K7FA 1KBGL 5HHNA 5T33H 1M6OA 5ILTH 2JCCA 3HB3D 5GRUH 3GHEH 3MRQA 3I2CH 4RAUB 3CUPB 3ROOA 1GJIA 25C8L 1JMZA 2NY7L 4M9PA 1K4CA 3ARFB 3RA7L 2CIKB 1L7TL 1U8KA 1JGEA 5HY9B 3EFFA 1IGTB 1EAPB 1DBKL 4JHBA 4TSBL 1QKZH 4Y5VA 5EBWA 4D9RE 1FJ1B 5E08H 3M8OH 1VFOA 1BVLB 3UTSD 3VG0H 1RFDL 2H8PA 4TTDD 4P5TB 4DKEL 4JRXB 1HHKA 1JPST 1NGXA 3B8SA 4X4ZA 1U8PA 2MQCA 4PJXF 1QZ1A 2HFFB 3KDMB 3TYFA 3ULVE 4BZ2H 2XXCB 4UOW1 2FX8H 1NMAH 2VABA 3D25B 4D9LH 3WLBA 5T1LD 5HVFB 3VFVA 1QSEB 1Z9LA 2NCMA 4OQTA 4PJDA 3TT1H 2B4CH 5CEZE 1EHNA 4BA8A 2HWZL 3EOBA 3N1FC 4J4PD 2VLKD 4XVTH 4M02A 1DQMH 4R2GC 1JNLL 4Y2DD 2YS4A 1MREL 4JFOB 4M8QA 3OF6A 5FHAH 3O6ML 4NNYA 5TQ0L 5C0NC 3IKCB 5F96H 1B2WL 3WS6A 5BZDA 2Q6WB 2EIBA 1JHLL 4X9HA 1NDGB 2CRZA 3K8KA 2XQYK 3D39E 5GGVL 4LSSH 2RGSA 3OTTA 3EO1A 3VJ6B 1AKJD 3E8UH 5D7IB 4QHMA 3LKQA 1F58L 1XF3A 3LCYA 5CINH 3S98A 5E8NB 4Y4HC 1ND0B 3PGDA 5F88B 2DQCH 3ARBD 5KW9H 4I3RH 3FT3B 2V6HA 1CVRA 2XY2A 4P2OD 3MFFA 3VDCA 5KVGL 1FIGL 2NY6C 3PQYD 4PRPB 2H1PH 4AG4L 4GQPH 5E6ZA 1XGTB 4D0CA 4JFXB 4I48B 2H32A 2LQRA 5T33L 3RVXC 5ECJE 1C1EH 2NY6B 3DI2B 1KB5H 1KELL 4I8DA 3DX6A 3GHEL 3T8XB 2C3WA 3P9LB 3T0DA 5L8KB 5FKAA 1MFAH 4W6XB 1QO3A 4XNQB 3I2CL 1WAAE 2F53A 4MWFB 4GKSB 3FFCE 2DM2A 4JZNA 2CKBA 3VMNA 1JWUA 2VQTA 1Y6NR 3RBGA 3TBYB 1QKZL 2VC2H 1NAMB 2FH6A 4JFFD 5E08L 2EYRA 4JFPB 5DD6A 5SX5H 1XF4B 3VG0L 3Q0HA 3EJZC 3MGTA 4Y2OA 5JHDE 3GSUA 4NCDA 1XGPB 5KANI 5FKPA 4K8RC 3QDGD 4YHYC 3O3AA 2BNQB 2CR3A 3PP4H 2AXFA 4OUOA 4ODUB 1NMAL 1N5YL 1RZFH 3NTCH 2HFTA 1E4XL 5FO7B 5KVDL 3GSXA 5E9DE 5IW6A 3OAZH 4JRYE 1A2YA 1VEMA 4XVTL 1DQML 3PJSB 1T1XB 2FLBT 1EFQA 3VXMA 3VWKA 1CFSA 1WWAX 1ZA3B 3CVIH 5IMLB 4HJ0C 5DWUH 5A16A 3CPLA 4AH2B 1XF5A 3KJ4C 4LSSL 1RV6X 5FFLA 1YUHA 4AQOA 2GY5A 2CIIB 5D6CA 5GS0C 1FSKC 3D2UB 3EDEA 5CINL 3B9VA 3FAWA 1BFTA 1QLFB 4IEFB 2NXYD 5F6HJ 2DQCL 3ZE0E 2CKNA 3AXLB 5HI4C 5KW9L 5INDB 1I7UB 3MRJA 3WNMA 1G7LB 1NCBH 3PABA 4AM0B 5BRZA 1F13A 2H1PL 4L4TE 4JPKL 3P4NB 1NANI 3R8QA 2KZWA 1C1EL 1N2RB 5IB4B 5KSVA 1KB5L 3VE0A 3Q5OA 4PGEB 1B4JL 4HC1A 4X9BA 4PJGE 3ZL4H 1G9MH 3FT4B 5HYEA 3L6FA 1FO0A 4NKOB 2VN4A 3T4YB 5EOQL 4P4KC 3J8F7 4JY5H 1LMKA 4PJHE 4X99A 1UJ3A 4QCIA 4OM1H 4PREA 3DX7B 3BJLA 3JWOC 3NFSH 4DN3H 2X2YA 4U0RB 2LVCA 2OX5A 3I50H 3NA4A 1Z9SA 3D87B 5FOBA 3X11A 1JYNA 3MV8E 3BYYA 5B3JE 2Z4QA 4X6CF 4K3DH 4PLNC 3GMQB 4DGIH 1U3YA 4XRCA 4EI5A 1M7DA 4HIIA 3BD3A 3PP4L 2BOCA 2A6KA 4Z78B 1IGJB 3NTCL 3VFRB 1U8IB 2EH8H 3SKJH 3BQUC 5E00B 4WHDA 4GMTH 3C87A 4Y5YC 5FYJU 1DUYB 3BD4A 4L8CB 2DB8A 1T0NB 4KDVA 3VXSB 3QUML 3SGEI 3BH8B 3O8XC 1EVUA 1T04B 2Z35A 4KRPB 4PJIF 4PJ8C 3CXHK 3CVIL 3UDWC 2NY2D 1YDPA 5DWUL 4C83B 4KK8D 2I9LA 4YEFA 4Y88A 3BN9D 1ZMYA 1MCFA 3O45A 4P46B 3GO1H 5F1IB 4LFHD 4U6TA 2Z92A 3DMMA 3TLRA 1JIBA 1FFNB 3KPNA 1IZJA 4ZOAA 1I3VA 4ODXB 2X4PB 5FEBA 1WCBB 3D69A 5EO0A 3GI9H 3F7RA 5TE6H 3HE7D 3H3KA 3NFNA 3B3IB 4FQCH 4FQXD 1NANH 4UZGA 1M4KA 2IAMB 3T3PE 3TIEA 2X41A 4FFWC 3JVGA 2Z8VC 5I1AA 5ICYA 1NCBL 3C60A 5FYLH 1IAII 5I1EL 5IMOB 2FJGB 5DUPH 2J88H 1YN7A 4KROD 3ORJA 4RZCB 2W9DH 4RGNE 1OP5H 3QEQE 3BWUC 3H3PH 4PJIB 4WFEE 4LCUA 1EXUB 3SQOH 2B2XL 1OGAE 4Z7OF 1G9ML 1ACZA 4PJ7F 3WJLA 4BFEA 4FA8A 2ZUSA 4HKBB 2DIBA 4TRPH 5C2BH 4KI5E 3QUZB 2GIYA 4Z7NF 3QJFA 5HD8C 4JY5L 1N6VA 3KPSD 1OF2A 2AV7A 4OM1L 2DQEL 1KCUH 4WV1A 4DN3L 2FWOA 2E8ZA 4F7PB 4F57H 1QFWI 5EO9A 4F33B 1NAMH 3CDGA 5JXEA 3I50L 1R5WA 3MV7B 3RVWD 1ZLVK 3F12A 1P53A 4YE4H 4QTHB 4U2YA 3QWOA 1KCRH 3QO1B 2DKMA 2YD9A 3LOWA 3OKLA 4DGIL 3SEPA 4PJAF 1PBYA 3MCG1 2R2BB 4NN5B 2WUCH 2XWTA 3E6FA 1EMTH 3VXMD 2D0HA 3TBTB 3VWKD 1CD1B 1JYXA 5EU3B 1HE7A 4G8IB 4CADA 5LAXA 3SGEH 1GGIH 2EH8L 2HVJB 2IGFL 4IRJC 5AG9A 4NRXB 3MRBA 3SKJL 3HUJF 4GMTL 4M5YH 4OZGA 1CLCA 3LIZH 3C5JA 4XP9H 4MAYC 1KIRB 1HXMA 3ILPA 4OLZH 5KSBA 2CR6A 1Z2KA 5DVOA 3MRDA 3NH7L 4NZUH 5D2NE 4BFGA 4XWOC 4J2XA 2A74A 4PRAB 1K5NA 2AEWA 4W4OA 3IDYC 5C8JB 4LSVH 2HJKB 1W8OA 3GO1L 4I2XB 5DJZA 5JDSA 5DQ9A 5BRZD 3FOLA 4N8PA 5EFIA 1T1ZA 1SJHB 5E0QA 4P9HC 1ZGLM 3RUGA 1IAIH 4OQ1A 4FQCL 5EO1B 1AD0B 2YMXH 4ISVA 2UWEE 3WCYA 1WJ3A 2VQUA 1I4FB 1ZXQA 4CMMA 5FYLL 3VXRB 1IGMH 3P30H 4KMTL 2A0LD 4OGXH 2J88L 2R4RH 5TH2B 4MCYA 2RQ8A 1U8QA 3R0NA 2X4UA 3H3PL 3M1BB 4NJAL 3SQOL 1U36A 5TF1L 4IIQA 4ZO8A 4TRPL 1ZT4B 2ICWJ 4P2YA 4LCIH 5B39A 5C2BL 4JM2A 3S5LA 1QFWH 1SQ2N 1JPTH 1A1MB 2P8MA 3PV6B