4FQQB

Crystal structure of germline antibody pgt121-gl fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
232
structure length
227
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTQQGKRIYGVVSFGDYYYYYYMDVWGKGTTVTVSSASTPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
molecule keywords Fab light chain
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 227
sequence length 232
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqB01
3V2AR 4U1NA 4JJHA 5IGXL 4M9PA 1S5IH 3X11B 4S2SA 3NH7L 2IPUG 2MQ3A 3UBXB 1QFPA 5BVJB 3TNMB 1Z5LB 1KCSH 3RWFB 4OLZH 3LQAC 3VW3H 4I3GA 1UEYA 1NLBH 4L3ED 5C0CD 2P4AB 5IV2A 1JE6A 1UKQA 4OKDA 1W8NA 3RL2B 1Q0XH 2DQEH 2YPLE 1T1XB 3U9UA 3IKCB 3DXAE 2V7HA 1XGPA 3VGBA 4XP1L 1XIWA 1TVBB 2DN7A 4NO3A 5HHNA 5GQBA 1LDPL 2VXSH 2JE8A 4PREA 4HUUB 4OB5H 2J3SA 4TVSa 3DROA 3TESA 1X5KA 4NP4H 3BPNB 2F74B 3W2DH 3ZZ1A 4OGYH 1UXSA 2O26U 3LZFL 1ZLVK 1CE6B 5SWZB 4MA8H 2E7CA 3BWAA 1F6AA 4N8CH 3FJTA 3GBMH 1L0YA 4CN6A 1MI5B 3O3BA 4Z76B 2HKFH 2NY5C 4HKZB 3DX9B 1EH9A 1UWXK 4PGCA 4YHYC 1FRGL 4S1RH 4LK4A 1M7DA 2V2WA 5L2KB 3JWOL 1G9MH 4CU7A 3GI9H 5I18H 5LVEA 4NUJA 4DZ8A 3L5JA 3ESUF 5ANMA 2CH8A 1NFDF 4QHUA 1K4CA 5TF1L 4DZBA 5GS0D 4M7JL 3I50H 4K07A 5A1AA 3DUUB 4U3XA 4XAWL 4G7YL 1FORH 4PYHA 4YBLC 3T3ME 3U2SB 5C0RH 5HGBB 5I1CH 2RBLA 5EUKB 2HJKB 3UDWC 2Q8BL 4GBXD 3I85A 1ZA3B 2V6HA 4PJ9C 4OT1H 5AEAA 4BM7A 1AI1L 2ZSVB 4F57H 5CMAA 1U2HA 1UA6L 2GFBB 5DWUH 1U36A 4X5LA 3SKUD 3EYSL 1ZHNA 3QWQB 1OSPL 4OCWL 4U1GB 1HILB 4D2NA 1FAIL 1UB6B 4M8QA 1OL0A 4RMSA 3DGGB 3B9EA 3MGOB 4K3JH 3RTQC 3TF7C 1RPQA 4ORGB 2H8PA 4UT7H 4ZAKC 3EGSB 3VXSE 3VFNA 4U1MA 2IBZY 4GG8B 4WI7A 3D85A 3C5SA 3IFOA 5FK9B 4CADA 4R8WH 4L4TB 4KZEL 4GO6B 4WEUD 5E08L 4P5TD 2Q6WB 4NYLB 3V7AE 1I3RB 3OTTA 1T1ZB 2BNUB 1NDGA 2VQ1B 3TP4A 3V7MA 4NNYA 1LEGA 2WUBH 4P9MH 1B9ZA 1F4AA 3U9PL 5ICYA 2BFVL 1KB5A 4O51B 4D9LH 3IJHB 2WINA 3PUCA 4O9HL 2BNRA 2DIAA 4NO5B 3I6LE 4ODVL 2G5RA 1CFVL 3TBSA 3QNXA 4L4VE 2HN7A 2W0FA 3E8UH 1ADQH 3T3PE 4HUVB 4OLXH 3KYOB 3NTCH 3L3GB 1G6RB 3CU1A 2B1AH 3PHQB 5FM4A 4M6MH 4PJAE 4WGVB 4YDJB 5IBLC 4W6YB 1X5XA 3QQ9C 1A14H 3EO9H 4PY7A 1GGTA 1SHMA 1VACB 2GTWB 1MAML 1CVSC 3ROLB 5H2BB 5L7XL 4S11A 3TBYB 5I1JL 4M3JA 1A5FL 4M7KL 4PD4J 2HFFA 3EO0A 4MS8D 5JMOC 1ED3A 1V7MH 5IROC 3NH7H 5MENE 3BN9C 4LQFL 1K8IB 4MJIA 5IMLA 1AHWB 1T7VA 3MV9A 2VDNL 1RUMH 3VH8G 3SCMD 3O81A 4JM4L 1GAFL 5CIPH 3EFFB 1HSAB 4AM0A 4XNUL 4P3DB 1WTGT 2VL4A 1NBZA 2FR4B 3JWDC 2XZCH 3DOSA 5DUBA 4PBXA 1HNFA 2A73A 2DL9A 1FFNA 2CIIA 3U4EB 2ICCA 1IL1A 2E6QA 1NCAH 4XP1H 5IBUB 3TO4B 4BUHA 5KG9A 2F54E 2AJZA 5F88B 1H9VA 2X4SA 4FXGA 1LDPH 3F8UB 2HFTA 4LSTH 2IG2L 4UMGA 1ND0A 4RRPA 4GRWF 4HS6A 4U3CA 2G75A 2JJSA 5FYKL 5B4MD 3LZFH 1LEIB 5FM5M 2QR0B 5DF0A 5DJCB 2AV1B 1U92B 4PJDB 1BVKB 1MFBL 2EEBA 4I3SH 4NM8H 1HYRC 3U4BL 3G6AA 4YHKL 2AEIT 4RMWA 2KQMA 1X5ZA 3S96B 5IB2A 3FTGA 3JV0A 3RX7A 4DVRH 5GGTA 3HUJE 1EEUA 4JFDD 4ELMB 4JFPA 4L3CB 3VI4E 1QRKA 2I9LB 2XPGB 5I9QB 3SGEI 3V6ZA 1HXMB 4I4WB 5KS9F 3JWOH 1WJ3A 3KPPB 3MNVA 3OAZH 5GRWA 4XVSH 1DBML 4NOBA 4G8IB 1BQHA 3GK8L 1GZQB 3MACL 5D1XC 1NC4A 3LQAH 4Q58C 5TF1H 4IBLT 3IDYC 4YDIL 1T21A 4XAWH 1AO7E 1OGAD 4G7YH 3FFCD 1U2CA 5DI8B 5GS1A 3T2NH 3ETBF 2XQBH 1G7MB 2XRAL 1N0XL 4NOFA 1EA9C 3CXDH 3VFVB 4J8RA 1QYGL 1UA6H 5IK3A 2CSPA 2A6JA 3TN0D 4WI3A 4K9EL 1UM4L 1D6EB 5F6HJ 1IGIL 2VDQL 4XT1C 1OSPH 2Q20A 4OCWH 1E28A 2EDOA 3DURA 4KAQL 2O5XL 1FAIH 4CAGA 4Y19E 1N3NA 1NC2B 4LLMA 3ARGB 3NVQA 3TWCL 3MV7E 3C87A 5TFSL 1XCTB 1MHEA 3L3DB 5IW6A 3VRIA 3B9KB 4KZEH 4EI5B 4EIGB 5AYQA 1QBMH 1BD2B 1TIUA 3OKKA 4XBPB 2HLFC 4QOKE 4XCEA 4HWUA 1FNFA 2A1WL 2NNAB 2QADC 2UWEE 1BFOB 5I1HL 4KK5C 3U0TA 3U9PH 2BFVH 5BS0E 3KPMB 1S78D 4A6YB 4O9HH 4ZYKA 4P2QB 4ODVH 4I0PD 1CFVH 1JZ4A 1OGAB 1YEKL 1L7TL 2D4DA 4L8SC 4XNZC 4LKCB 1D9KC 4X6EB 5ACMA 3BP7B 1ZVSA 1OY3B 4XXDA 3F65A 3L9RB 4BSVA 2EKSB 3RZCD 3L3JA 3TN0B 2JIXB 4QRSB 4M61A 1JN6A 1XGYL 3JZ7A 3CFKB 2DWEA 5EZLA 4A2LA 5DFVD 5KTEL 2D31A 4U1JB 4ZPVB 4LEOB 5HYFA 5L7XH 4EUPH 3BMVA 3AMKA 2GT9A 3NIDE 2ATPB 43CAA 3PWLB 5JPNA 2Z92A 4TVPL 4OZFH 3T3MF 4LQFH 4NQDA 1TZHA 1TQBB 5EOTA 3CUPB 3ZHDA 4P49A 2VDNH 4LGRB 5J3HD 4JM4H 1GAFH 1TETL 5FYKE 4XNUH 2NW3B 4L1HA 4N0RA 4NCC2 4MHHG 3SDYH 1SBBA 5FDWB 5HYEA 3MGAA 4NIKB 4E9LA 4YHNB 2P5ED 4ERSL 4OGZA 2BHZA 1WIUA 1CYGA 3DYOA 5E8NB 3D3VD 3KPOA 5EFIB 4HS8H 2NZ9C 3ZTJG 2RGSA 3JXAA 1KOAA 2IG2H 3BISA 3TPUA 4GAFB 4LCWE 1CFQA 3VRJB 5FYKH 3FO9B 1KB5L 1EXUA 1MPAL 1Y0LA 2X2YA 3GSWB 3MRNA 4EQ2A 2BC4B 2H26A 2I60L 2JJSC 4HZLB 1EFXD 1A3LL 5C08A 3HB3C 4XP5L 5C0BB 3VCLB 5DMGD 4LMQI 3T3PF 4CVZB 3VA2C 1F58H 2IH3B 5TGBB 2Y5TB 1DBMH 3MYJA 3G5XA 3PABA 4Q9RH 3GK8H 4PJAF 2AJVL 2VZTA 3MRBB 3ZYJA 4BH7A 4X99A 2Q7YB 4PUBL 5I74B 5C0GA 4KJQC 4YDIH 4W70A 1P84K 1FZMA 2FWOB 3QWOB 2P5WD 3QPQD 1JGUL 1ORQB 3C09C 1JPFB 5F1KC 3RJDA 3O4LA 1ZLWK 1PY4A 1DQML 3JWDH 2XRAH 5HVWA 1IC4L 1N0XH 1GYAA 4J4PD 3REWA 1I8KA 5EIVA 1IRAY 2LTQC 5INCA 1JYXA 1FNGB 4Y4FA 1QYGH 1KJ3L 2E27L 5KSVB 3ZDYE 1CDCA 2DM7A 3DVIA 1UM4H 4KTEH 4KJPD 1DLFH 5TQ2H 2R2EB 1IGIH 2VDQH 5GS1C 1JNHB 3ZTJH 1T5XB 3O6FD 3FQXA 2ESVE 5DZOA 4KAQH 2O5XH 1S9XA 2CR3A 3RKDC 2R0ZL 4YBQC 4HT1H 1S5HA 2WM0A 1QSVA 1NAMA 2DQIL 3FT3B 1UJ3B 1OSZA 5TFSH 1MCWW 5JXEC 1G7HB 1GXEA 2X4TB 3RPKA 3WE6B 4Z7WB 3ZLQC 4HWZA 4UTBL 3VDAA 2A1WH 5I1HH 4YHZH 3D39D 4MZ2A 2MJWA 4PJHA 4K2UH 3GJEA 4JKPL 1ORSB 5C0AA 3UJIL 2GJ6D 4X7EC 3A67L 5ANME 3FO2B 4Y4KD 2PYEE 3UEZA 2VKXA 4NKOB 3VWKC 4PR5A 3V5DA 4LLYB 1YEKH 4PRHB 2WBWB 2NTFB 1QFUL 3P0YL 2Q76A 4HH8A 1Q9LA 5GGTL 1LEKA 4TVPE 2X4RA 2FO1A 4P23B 5JIPA 2A6DB 4CW1B 5IVXE 5F9OL 3HUJF 2EXWC 4R26L 3ELAT 3VI4F 3GNMH 1XGYH 2E8ZA 1SYSA 2YD1A 3T1FB 4PG2A 4V1DA 3EDKA 1BJMA 2HVJA 3MO1B 4YHPA 3RWHA 2BVTA 4TVPH 3HI1B 3KYKH 1L0XA 5FUOL 2Z31B 5JHDD 1SEBB 4M43L 3LN5B 4HIJA 5EZIL 4C56A 1U6AH 2NY2D 5JZ7C 4F33A 1BAFH 2VZUA 4RDQF 3ARFA 3GRWL 3W11C 4NN5B 1MRDH 5HYQA 1K5NA 4OM1L 4JE4B 3SDDB 3H0TA 5HDBF 5FKPB 1N6UA 4PV9B 2GJ6B 5D2NA 3MNZB 1FVCB 3WFZA 4PRIA 3VDCA 2BNRE 5CSZA 1NL0L 5EN2B 1RJCA 2CO6B 5F72S 3WNPA 4ERSH 4HG4J 3HNVL 4NKMA 1XF5A 2VWEE 1NGWA 1U41A 3LN4B 4MQ7A 1JV5A 4WFGD 4OI7A 3JV6A 1MJUL 4Z7UB 3ZDXE 4AK1A 1CFTA 2HT2D 2Y72A 4YFDB 5EB9A 3ARSA 4E0RA 4GRLC 2QKIA 1BX2B 4UBDC 5J4MA 3MRFB 2EKJA 4UZGA 4JGMA 1AQKH 2XN9E 4X7SL 1MPAH 4NQED 2UWEF 1DZBA 3U0PB 4OKVB 3QXUA 4FMFA 1ZTXL 1XF4B 4OV6F 4DTGH 4AEIL 4YGAB 1A3LH 2H32B 4MJIE 4XP5H 1MFEH 3BZEB 3I6KB 4GW5A 4O4YL 2PO6B 2GW5A 2LU7A 3CFBB 5FYJL 3AM8A 2IADA 3H9YA 1AE6L 1KIPA 2QSVA 2AJVH 2O5YL 1HXYB 5BMFL 3CFIC 3LKNB 1D5XA 1JGUH 2ARJA 2YHGA 1ETZB 3ARRA 5B22A 2AV7A 3BPOB 4Y2OA 3OKEB 1J12A 4IOFD 3SO3B 2LU4A 5DJ6B 3OKNB 1BQHG 1OD7A 4ZPTA 3NIDF 5FGSA 5DRNB 5I1EL 2MTPA 2WBKA 3W9EA 5GRVL 4XGZB 1A3QA 2IQAB 2E27H 5K9OA 4QGTA 5CD5D 2Z0BA 1LNUA 5DEFB 4F7MB 2CD0A 5TH2B 2J12B 4JO1L 2YR3A 2DTML 1CK0H 3HCVB 3P4MB 2C3VB 2P47B 1EMTL 4TRPL 4HHAA 3CX5J 4MB5A 5D1ZA 5D93C 4LVOC 3LDBC 5EBWB 1DVFA 2JB6A 1H5BC 2GIYA 4DFIA 1TVHA 4D8PB 4KHXL 2P8PA 1FYTE 4QRTB 3FKUS 4X6BA 3HRPA 1XT5A 1YY8A 5D7JA 3DX8A 1IGJA 4GKSB 1XEDA 1S7RB 4G3YH 5DQJB 5IT2L 4JKMA 2WZPD 4HDIB 4NQXB 1JPGA 2FECL 5BZWB 1NMBL 4WFEE 4GLRI 1M7IB 1HSBB 4UV4L 1G7LB 2W38A 5ELIA 4OZGF 4IM8A 2WAHA 3A67H 2DBLL 3LQZB 3X14B 2BY0A 1ZHLB 5E1AB 4P4RA 1XCQB 2BY1A 3MZGB 3KPSA 4JM2A 4KROD 3T0ED 1CGSH 3BO8B 1QFUH 3P0YH 1CFSA 1HQ4A 5C09A 3NCMA 4ZUTA 4B50A 5GGTH 1KIRA 1UWGL 1PEZA 3CSBA 3CC5A 3QQ3A 3MRMB 1ES0A 5IF0A 1QEWA 2I07A 4X7FC 1RZ8B 4R26H 3OXRB 1S9WA 5MP6H 1PW3A 1EJ6A 3QHTC 2M1KA 1VADA 2ZOKB 1KSRA 1O7VA 1U8MA 1GVIA 5DD5L 5CSGA 4P46A 4U1LB 3HZMB 4YPGA 3RKPA 3CIQA 2BVOA 4GKZB 1R5WA 1U8NB 1TTFA 4F7TA 5EZIH 1MIML 2ED8A 5KANG 2VDLL 4R90L 2XY2A 1JWUA 5GGQL 1QKZL 4FQXB 3GEWB 4D9RD 1LHZA 4OM1H 4M93C 3T0VA 3ZDYF 4CUCA 5HJ3A 5JR1L 4N8VB 1UACL 4R0LC 4WWKD 4KROB 1C5DB 4P2OC 3T0EB 3HNVH 4JREB 1NAML 1CGYA 1ZV5A 3ARFC 4NQCA 3GBNL 1C8PA 1MJUH 1LMKA 5IEKA 3BQUA 3IAQA 4F7EB 5AZ2L 5JW5A 2NY4D 2FX9H 2EDHA 3SDCB 2Z93B 1SEQL 1MRCL 4O00A 5JQHC 4TUOB 5CEZL 5FYJE 1U8LA 4XC3L 3L95A 3FONA 4YX2L 1NFDB 5B38A 5MEOA 3PGCA 3C60A 1F4WL 4WO4B 3C6LA 4ODWB 2D03H 5FHAH 3MGTB 1P1ZA 1ZTXH 4MNQA 3MODH 4R9HA 2MOVA 4AEIH 5I16B 3ZKXB 4JZJA 2BJML 3QDAA 4PGJA 2X40A 4NQDE 1B6UA 43C9A 2JJTA 4O4YH 2VN7A 2C1PA 3JV4B 2APWA 4XRCB 1GGBL 4PJ5D 1HIML 1C08A 2H6PA 1MCCA 2BVUA 5FYJH 5IVXF 1AE6H 1PG7L 5JIHA 3WCYA 2HFEA 5FECB 4LEXL 2O5YH 5BMFH 2YKLL 1XF3B 4RGNB 3G5VB 2EDXA 1AXSB 3BEWB 4I9WE 1BVZA 4M4RA 3VWJC 4YAQA 3IDJA 3JTSA 5MHSD 1YEJL 2GAZA 1IAKA 1NBQA 1RK1B 3QJHA 5E8PA 2FLRT 3AM8C 2CKNA 5DUML 5I1EH 3MCKA 2R0LL 3VG9C 2Z91A 1I3GL 1MFCL 5JW4R 4X6DA 1MUJB 2DTMH 5ERWA 2P42B 3ZE2E 1TZIA 2EDBA 2CUHA 1RK0B 4JDTL 2CRIA 2HA1A 4OCRL 5I1IH 4TRPH 3MUZ1 2VXVL 4LHUG 2DQFB 2D7NA 5F89A 4KHXH 1HDMB 1U8HA 4XCNA 5EPMB 5EC2B 1B0GB 1IC5H 2F53B 1NANI 1WZLA 3HZYB 4M9OA 1JZ2A 1S3KH 5IT2H 4PJ7A 1QOKA 4OM0H 5HGHA 5HYJD 2NY1B 1QQDA 5IBTL 5T1DL 1V7NL 1WBZB 3ZDXF 3C5ZC 25C8L 1JWMA 5FM8A 3FB7B 5KJRL 4UV4H 5E4IA 1T04A 3HR5A 4Y16A 5DK2A 2DBLH 1W0YT 2XOTA 3TVMA 3RHWK 4GS7C 5GGSY 2CLVA 1ZHBA 5FEBA 1QRNA 1R3LA 5EU6A 5DFWH 4F7PA 2BOCB 1S9VB 3QCTH 4CNIA 1CN4A 4P2YA 3LB6D 1N4XL 3HPLB 4HJGA 2GTZB 1UWGH 1OAXL 4Z5RB 3V0VB 1X5FA 1IC1A 4DKAA 2KDGA 3WDIA 5C2UB 1LO2L 5SWSB 1JPTH 3TCLA 3BP4B 1CDHA 1IZKA 1OTTC 1A1MA 4LSUL 2W91A 4YUEL 5C8JB 2DI9A 1HK6A 2WBJB 3EYVA 4PJ8B 4QTHB 3VDBA 3PIQA 2Q3ZA 4QRQB 5IEHA 5DD5H 4KKCD 1UADC 3VXMA 1IM9D 2NX5D 4JG0L 4S1DD 3PWPB 1FFRA 2X4OB 1H3VA 2X7LA 4BFIB 1Y18B 2V5SA 3GMNB 5J1AA 1NEZA 4GW4B 1MIMH 4O2FB 2YD7A 3EBAA 4F7CA 2HKHL 5ENWA 5IMMB 4NUGL 1NGYA 3BIBX 5GGQH 5GSVA 1ERNA 2WWMC 4PJXA 4GJTB 1F3RB 4P46C 5CEZE 2E9WA 3GSVB 3OKLA 5HHXL 3SE3C 4PJHE 3B2VL 5TDPB 4ODHH 5DJYB 3CVHA 1T66C 1UACH 1A7PL 3H7BB 3IF1A 1N5AA 4M62H 1MVFA 3RHWF 1JUFB 2YPLD 5CGYC 3MSPA 3QEUB 3MLYL 3DXAD 4K94L 3GBNH 3O8XD 3LOWA 3G08A 5EIIA 5F9WB 5DUPL 4PJCA 3ALXA 5AZ2H 3VXRA 4H1LA 5KS9B 1YC7A 1P5UA 1NUDA 2D0GA 2ZSWA 5IKCB 5I66A 2VABA 4IRSA 5CEZH 3OB0H 4MDJB 1RZGB 1N8ZA 1A7RL 1VFOA 5D9SB 1M6OB 4IMLA 1KFAH 3G5YA 3QUZC 5FUCE 3DVFA 3BQUC 4FQ2L 2EYRA 4MLIA 4V1DE 4XAKD 5DJ2A 5BCAA 5JO5A 2Y1VA 2W9LA 2Y7QA 2CKBA 4Y4HB 4O5LL 1MLCB 3QNYB 1T89A 3HG1B 3P9MB 5BRZB 3MBEC 3M17A 1MCLA 1T7WA 3N1PC 3V4VH 4XNMB 5DZLA 1JI1A 3T1WA 2A9NH 3OGCB 4C56E 1RJZA 1GGBH 4YO0A 3RWIA 1HIMH 1T03L 1YUHA 4HGWA 4DCQA 4RX4D 4QYOB 1X5GA 3LKQB 3BRDA 2RFXB 1PG7H 4ZG1A 3KR3H 4KVCL 5I1AA 1JPSH 4D0BA 1RJYB 1B4JL 5A2JH 4ZUSA 3KYMA 4DJMA 4J3OC 2YPLB 1YEJH 2JK5A 3C6SB 5TDNB 2F8OA 2NY6B 3EOBB 1TNNA 1DE4B 2VRAA 4HK0A 4PGEA 2EO9A 2Q86B 2DWDA 5EU4B 1MCOL 5F70A 4IOSD 4NRZB 5CZXD 4G6AD 1I3GH 3VXNA 4P3CL 4NT6B 4BJLA 1CICA 1KJMB 2V17L 3MRKB 2BZDA 3T0WA 4ZO6A 3C2AH 1MCSA 4U4BA 1NUNB 1I1YA 3INUL 3QEHB 4JDTH 1S9YA 4OCRH 2KUTA 4UIKH 2VXVH 1C12A 5T1MB 4Y5VC 1KG0B 4ONOA 1C5CL 2B5IB 4G8GD 3RBGA 5JW4N 5B39B 4PP1C 5LJYH 3ZE1F 1M05B 5IBTH 5T1DH 1PYWA 1V7NH 1BREA 1C7TA 25C8H 4P0DA 3S98A 4ZFZA 2WK2A 1T0MB 3C8KB 1JTOA 5KJRH 3OKMB 3PQYA 4Z95L 3RWGA 5J6GA 8FABB 1FCGA 3HE7D 1JGLL 3MLVL 4R3SB 5FA3A 4H5SA 4JFFA 2NLJA 1NCNA 4HPOL 1KENL 5DHYB 5C0EA 4IIQB 2X9XA 5CGTA 3SN6N 3TA3A 5HDQL 1RZIB 1F6FB 2FL5B 3DRTA 3KS0J 3X3GL 1PD6A 1OAXH 1IGML 3BMWA 3O41B 1PQZA 5JNYA 4NKIL 3K80A 3GSUA 3PDOA 1LO2H 4EN3C 5FFLA 3VXOB 5I30L 4LSUH 3BP5A 3GDBA 4H0IA 4YUEH 6CGTA 5E2JA 5J12B 4L8BA 1T20B 1NBYB 4L8CA 4PRNA 4FFWC 4PTTA 3GIVA 3WFHB 2HRPL 1ZT4B 5ESAA 1EO5A 2DMKA 3IDNA 2AXFB 4JG0H 4UT9H 1XGUA 4IRJA 5CJXA 3UYRL 3OF6A 1FV1B 4JANB 4OCYL 1B4RA 3RDTB 3AAZA 1TPXB 2QQQA 3VXSB 5I73B 3AS0A 4XHJC 3EZ8A 2VDPL 1HQRB 1MQKH 5MEND 3FB5A 5CWSA 1I1FB 2XFXA 5I1DA 2NXYB 3REVB 4ENED 1RUAL 2R4RH 5HHXH 1U3HC 4YHLL 3B2VH 5E95B 4Z7VA 4RAVB 4M5YL 5DVKA 1A7PH 3KPLB 3KPSE 2X4QB 3K3QA 3ZE2F 3KPQB 1RZJC 4R2GD 1DQTA 4I18A 1P2CB 3MLYH 1W0WB 3GMMB 2OZ4A 1IEAB 4KKAC 3CSPA 5DUPH 2F54D 4L29B 4L4VB 3HNSL 3D0LA 1VKXA 1EERB 1AH1A 4N5UA 3QUYA 5D6DA 2L4OA 3VFRA 3GMLB 4ETQA 1WZKA 1A7RH 1MF2H 5JZ7D 1NQBA 4GAJL 1PKOA 1LK3L 4O02H 1INEL 4HEME 5ID1B 4FQ2H 3OX8A 4KVNL 3DVGB 2YK1L 3AU1B 2P8MA 4HWBA 4O5LH 1GHFL 3TBVA 1ZGLB 3ZSSA 2F8VA 3MUY1 3ES6B 1JGDB 1MRFL 5C07B 1QLFA 3AGVA 1QSFB 4F58H 3C9NB 3QG7L 1G9NC 1KCKA 3G6JA 5B38G 1U93B 3DMMA 1LILA 4HQQL 3QXAB 2R23A 3GKZA 3QDMA 4R96B 4U1SA 1FO0A 5MENB 4BKLB 3HI5L 3VD7A 5DD6B 3LEYL 5HVHC 4DEPC 1J10A 1T89C 5FO8A 4P4KB 5J13B 3KYNA 1V3JA 1U91B 1A6WL 1KJ2B 3K1DA 5L8KB 3BDYH 4G9FA 4QCIA 1BFTA 1RUPL 1WBYB 3MRIA 4NQCE 5DC9B 3NA4A 1YEFH 1AO7D 1CDBA 4NRYA 1MCOH 2F54B 1TVDA 2FIKA 3D1MC 5C71A 1JK8A 4NSKB 5K59E 3SPVB 3O3EB 4P3CH 1IGYA 3F5WA 1NCWH 2RHEA 2CLRB 2V17H 3HNTL 3BFOA 3BH8B 5J9PB 5SV4A 1EAJA 2AS5M 5KSUA 4OZ4A 3V6FB 2AEPL 3INUH 5MI0C 4XC1H 5DHVH 2XTJC 3CVHL 5HHME 3OR6A 4LLVB 2V9TA 1C5CH 3V6OA 5D7KE 1J87A 4Y19D 5HGDB 3HS0B 1S7QA 3MLZL 1QBAA 1DL7H 3HUJB 3MV7D 2IFGA 5EULV 4LAJH 1OAQL 1ZT1A 2WUCH 3X17A 4C58B 2JCCA 4Z95H 4MAYC 1ACZA 4UDUA 1JGLH 2ZWLT 3MLVH 4G42B 2XIDA 4PJEA 1KENH 2NR6C 1EGJA 2WWKT 3MV8A 1QPPA 1FVEA 3IXTA 5HDQH 1H3PL 2CKBL 3MROB 2HJLB 1KLGB 4Z78B 3VMPA 4U2YA 1FZJB 1KV3A 4MVBD 1WT5A 4M1DH 1R3JA 4NKIH 3WLWC 3ZKNC 1QNZL 3NFNA 3F58L 4XB8A 5TQ0L 1DQQB 5I30H 1HKFA 4JFEA 3ZYOA 4Q6IA 1SY6L 2DQCL 4X6DE 3WIFB 1DQJA 1AGFA 1DQLL 5GRUL 2PTTA 1CDJA 3QG6A 4LSSL 4X9IA 4RWYL 4OZHA 1RFDL 4KUCF 3PWUA 3G5ZB 4YHYB 5H37G 5BJTA 2HFGL 4QT5A 2N7BA 4F9LC 1TQCC 4LDEB 3VXUA 2ICWB 4OCYH 1VCAA 4HUNB 4APQD 2OL3H 3S35X 4POZC 2VDPH 1MCBA 5CBEA 2Y6SC 3UJJH 4LHQB 4ZUVB 2PYFB 3FFDA 4IHOB 4Z7OE 1RUAH 4HIHA 4YHLH 5FA4A 3L3IA 4QOKB 4OLWL 3TH4T 4RNRB 4LNVA 5ISZB 3AY4C 5FYKD 4QXWA 1R5IA 2UWEB 1NEZG 1LP9A 2VTFA 1QRNE 4KI5C 4KQ4L 5BS0B 3AXLA 4PJ9B 1NMCC 5DJ8A 5EIQA 2DMBA 4EUPB 4QNPE 2VLRD 3H9HB 3Q5YA 1K8DA 2IFFL 1DJSA 3P4NB 4Z8FL 1I3UA 3X12A 4OZFB 4FQJL 4I18C 5KOVC 5IHLB 3MRPA 3S3SA 4MSWA 3RTQB 4LCWD 4ZAKB 3QDGA 4GAJH 1LK3H 1YEEL 1INEH 2FO4A 1Y6KR 4KVNH 2YK1H 5EO1B 2LABA 2KH2B 2H9GA 4LOUC 1IM3B 3IVKA 5IB1A 3Q3GA 3BN9D 4Y5XA 5D6CB 1GHFH 3SDXA 3VXME 3KXFE 3QUYC 5IW1A 5GGSA 3QG7H 2IEPA 5HY9B 3DUSB 5I8OL 5EORL 1MFAL 3HC0A 4HQQH 4LLUA 5DK0B 4MWFB 2P45B 1XZ0B 3FRUA 1IJ9A 3BEVA 5H37H 2R9HC 1YY9C 3DI3B 4PJXE 1KXTB 3IU3B 4HKBA 2PW2A 5B3NA 2XNAA 3FHQA 4XXCA 5BXFB 4KDVA 5EU5B 5IUSA 3DMMC 4U0RC 3DUHA 1A6WH 3STZA 5JOPE 5LKNA 4HH9B 5E0QA 4DKFH 1X6NA 3G9AB 1RUPH 1RIVH 5LGJB 2YOCA 4S10A 4LP5A 3W39A 2VIRB 5F1IA 3QI9A 3DGCR 2FGWL 4XX1G 1AIFB 3OKDA 1XIWD 1BIIB 3SE4A 3BD3A 3KPRB 3OHXA 2BNQE 5E6ZA 3HNTH 5IHZA 1UKTA 4GAYB 3ECBB 4OZGB 2AEPH 4BZ2L 3D69A 3GJFA 3VJ6A 5J57B 3CVHH 1VSCA 4KRLB 2YXFA 3F62A 2ZNWA 3L5WB 3THML 2C7UB 3QT2A 2PXYA 2GKIA 4A2MA 2OZ4L 1J1OL 4C59B 5IFJA 4X4XA 3MLZH 4U1NB 4DKDC 2OTPA 4JVWA 2IJ0C 2BDNL 4H1LH 2AK4A 2FX8H 1AQDB 1OAQH 3QUKB 2OTWA 3V6OC 1PFCA 5JOFA 3J7HA 1G9NH 4XX1E 3MR9B 1IGFH 2JF1A 5F9JA 1CGVA 3FB6A 1MY5A 2BRRL 5IV2B 1OTSC 2MKWA 1NEUA 2CKBH 4HWBL 4PGZA 5C0FB 4N0YL 1CD1B 1AP2A 2XTJE 4P2RE 2CXKA 1QNZH 1UXWA 5D7IF 5IHBA 3F58H 4NO3B 4TVPD 1FO0L 4QXTA 3CPLA 4FQQA 3BHBA 2DQCH 2PTVA 3GHEL 1DQLH 2QQKL 1CG9A 4LSSH 2XYCA 1AD9B 1R24A 1WT5C 4RWYH 2BERA 1NCCL 1NDMA 1RFDH 1JRHI 2GSGA 4YWGH 4MGXA 1G0DA 1I8IB 2ESVB 2YRPA 2VLLA 2R2HA 4JCLA 1SMAA 4CMMB 1T1YB 5IOPA 3DHJA 5D1XB 2P24B 1QLRA 4QWWC 3MMEA 3LRSB 4U6YA 2W0PA 3D85D 5KSAA 3IDYB 3LEXA 5DA0B 4GBXC 1R3IL 5K59F 3PQYE 3MXWL 3O45A 2AXGA 3U7WL 3BGMA 5IESL 4JFFE 3KHOA 3UTTB 3O11A 4R7DB 1YMMB 3K2UL 5ANMB 2PYEB 4GRMB 1C1EL 1RZ7L 1K4CB 2BNRD 3RWCB 2OP4H 2WV3A 3P4OB 5F7DB 2YZ1A 5KSBF 1IKFL 1XGQB 4G9DB 4G43B 3EUUA 4GKOA 3DECA 2BCKA 3PHOA 2WMPA 4OF8A 5KAQF 1FP5A 3H3PL 2Y36L 4FQJH 3H9SA 5IVXB 2WLZA 1H8NA 5K33A 3FO1A 1X6LA 2OYPA 4P5TC 4Z77B 1RHHA 3GMRB 4XPGL 3VFMB 2DLFL 5E94B 3E0GA 3EYUL 4KDWA 1EGJL 2GUOB 4TULL 3EYOA 3LKSB 5HGAB 4I2XB 3ROOB 3UJTL 2CRZA 2UZIL 1I85A 3BRGC 1GCFA 1MLBA 5I8OH 5EORH 3TPKA 2QADB 5DJZB 4XB7A 1A6VH 2SEBB 4KI5E 4WY7L 4XCFL 1K2DB 3D85B 3GSRA 4MJID 4LFHG 4NM4L 1FE8L 4JRYE 3MV9D 4L8SB 4XI5C 1FG2A 4XNZB 2IGFL 2IALA 3QRGL 5TE6L 1D9KB 4Z7VE 2XZZA 1E4JA 3OJ2C 2MPAL 3A6CH 1DN0B 4X0KA 4EXKA 3TO2A 5CSBA 3PWJA 3SKNB 5IP4A 4X4ME 2YUXA 2ZUQC 3NFSL 4UIMA 1MHCA 2FGWH 4UT6L 1H3XA 2ZCHL 2DLEA 4MD5A 3FOLA 4M6NL 1S8DA 2AKRB 3OWEA 4H0GA 5EZJA 4BZ2H 1RAMA 5LWYL 4F3FB 5TE7L 3PL6A 4Z7OF 3SCMC 4G8EA 2XN9B 4JN2A 2XWTA 4OD3L 3BZ4B 3K8MA 3OG4B 2W9EL 2OZ4H 2VQTA 1J1OH 3BZFA 1JCKA 1WVZA 3O3DB 2FB4H 1OWRM 5IMOA 1U95A 3Q6GH 5F3HA 3P77A 2QHLA 1P7QB 5DSCA 1JZ5A 4YXHL 3OKOA 4QNPF 2BDNH 3SJVB 3QDME 3U36B 1HHGA 4OSUL 1M71B 1UH4A 1AKJA 5LAXB 1KLFA 4MJIB 4TNVF 4WI6A 4JQXC 2PXYC 3ISWA 1CZ8H 1ZAGA 3QXVA 4WFED 2X70A 4FQ1L 5GGVY 1NBVL 3QIWB 1RJLA 3GSNA 4ONHB 5DVOA 2BRRH 4JGUA 5B4MC 1NBZB 2J8UE 1ZA6A 4WW2B 2WP3T 2BK8A 4HWBH 3DHMA 3IFNL 1NC4D 4N0YH 4BSWB 4PRPB 1QACA 3L3KA 1Q94B 4OZIA 1FO0H 3V52L 5CCKH 3HRZA 3NMEA 5JIKA 3RKDD 2OQJB 4QRPA 3CFCL 2I26N 1J05B 2UV3A 2ICES 4X6CA 1NCCH 4W4OC 5FUZL 3ARBA 3WUWG 4NQUA 4WENB 3EOAB 4PP2A 4QHLA 3K7UA 3V6OE 4Z0BL 1PSKL 5AD0B 1KIUA 3OQ3B 3LKRA 1GC1L 4ZFOA 3PGDA 1NJ9A 4M5ZL 1FYTB 1MJ7L 5FKAB 3FOMA 3VXTB 1XAUA 1A4KB 2KQNA 3VFOB 1TTGA 5CBAA 1R3IH 2JCCE 1AD0A 1TXKA 1BJ1H 1WFUA 3BESR 3U7WH 1CLCA 2DLGA 4J6RL 3TZVA 3K2UH 1CLZL 1OF2B 5INDA 3MV8E 1C1EH 2LTQB 4L9LC 1JNJA 1RZ7H 5KSAC 1N59B 3HPJA 5H35A 2DF3A 4FTVA 1IKFH 1ZS8B 5FF6B 3EJJX 4N0UA 1RU9H 3I02A 4JFEE 5F3BA 2ATKA 4J3TA 2CK2A 2Y36H 3H3PH 5IHUH 1PAMA 3EDEA 3RY4A 1A9EA 2QQNH 3JTTA 4XPGH 2DLFH 4DQOL 3D0VA 1A4JA 5FYJD 3EYUH 3D48R 5IVNA 3WYRA 1EGJH 3OV6A 4TULH 5I2IA 2OR8A 3UJTH 2HG5A 1QPXA 1F4YH 1NGZA 5SV3A 5A16B 1S78C 1N3NB 3CCHB 3VXUE 5I8CB 1R5VB 2NY3B 4I0PC 4LLMB 4R4FL 2VZ1A 3F7YA 4WY7H 4XCFH 4X98B 2YN5A 1E4XI 1H3GA 4TYUA 2AJXH 2YN3A 3VWKB 4NQDD 1MCKA 4NM4H 4PBVC 32C2A 2IGFH 3OKKB 5IFHL 3ARXA 4XCEB 5DJAB 5TE6H 4Z9KB 3RZCC 1I9JL 4KRPD 4GT7A 4HKXA 4LDOB 4PJFA 3LVEA 3JUYA 1QLEL 4JDZB 2X1PA 5F7MC 2YUVA 1UVQA 3OR7A 5DFVC 1FBIL 2H3NA 2D4FA 2EE3A 4MXWL 4NQVA 4LLWA 3UMTA 4C83B 3FQNB 4E42B 1FN4A 4I9WD 3ZT5A 2NY0D 3B3IB 4UINH 1KF9B 2IC2A 2J6EA 4UT6H 2BVPA 5GIRB 5E5MB 4HUWA 5FO9A 2MSPA 4MMXC 4ZDHA 3WS3A 4M6NH 4NO2B 3ESVF 4XNQB 3ZKQD 4W68A 4YIQB 3L3JB 5LWYH 4J12A 4DK3A 5TE7H 4JY6A 1VGKA 3WO4C 5ACZB 5J3HC 1MNUH 3V0WL 1MJ8L 1KULA 2DM4A 2HVKB 3QULA 2YD9A 2ARJQ 3M8OH 4I77L 4LF3A 2GYSA 3PF2A 4JFQA 2W9EH 5ACLA 2UVEA 1EEZB 3S4SA 1G7QB 3O3AB 2IANA 1N6QL 3GGWA 3SHSA 4G6ML 1X9QA 3PL6C 1P4LB 4OSUH 5ETUB 3NCFB 1RUKL 4C55A 4P3WA 3QO1B 4QXUH 3EZJB 4MJ6A 5F96L 2W9DH 4FQ1H 4HLZG 2V5MA 3RPIB 1IC7H 1G0YR 3ILPA 2UUDH 1HH6A 2EC9T 4D3CL 1HH9B 3IFNH 1RIHH 4DVBB 4OF5A 1F5WA 4KV5E 4GRLB 3I6GA 1U3YA 1PKQA 3EIFA 1VEOA 4CN1A 5J1SC 5L2JA 2VR9A 1VFAB 5FGCE 3ZDZE 1JZ8A 3BUYB 4FQCL 3V52H 1ZLUH 3BPLC 4KI5F 1A22B 4Y4FD 3CFCH 3TPUB 1YDPB 1ZSDB 1FPTL 4YDKL 4KH2A 1OLZA 1S7TB 5FUZH 3MBXL 3VFGH 4WW1A 4G6JL 3FHAA 3WJJC 3MRDB 4Z0BH 1MWAB 1PSKH 3BGFC 4Z7VF 5MERB 4HMCA 4WU7A 1GC1H 1ACYL 4KKBC 3B8YA 4M5ZH 1MJ7H 3N1MC 3ALWA 1FNAA 4MMZC 3R06A 1RZFH 4QF1A 3IJYA 4NHUB 2ZG1A 4J4PC 2A6KB 2YD6A 1WFNA 3UTZA 2AXHA 1YEDA 1P84J 3GJFH 4ZS6D 3SGDI 3UPRA 4PTUA 5FGBA 5CEZD 1S7SA 4LKXB 4YNYA 4J6RH 1IAIL 4YPJA 4MA3B 5C0AD 4G80A 1OB1B 4JFDE 1HOCB 3QXDA 2I9TB 3O6FC 3CLEL 5C0IB 4ZFFA 5HHPA 3S3JA 5DRZA 4UNUA 5GRJL 1FZMB 4P57B 3Q5OA 2DYPB 2YC1B 4HLZH 1OAUL 5BZDA 3QEQA 4WHTB 1KYOK 3LV3A 4BFGA 5BQ7A 1D5ZA 2DM2A 3OJMB 5TDOA 3TT1L 3REWB 4UDTA 5D93B 4LVOB 1JF1B 3LDBB 1J8KA 5INCB 2FJHA 1H5BB 5A2FA 5D7LE 2F9BT 4XP9L 1LGVA 4YH6A 2G5BA 4DQOH 4PJGA 4I5BA 3GSNL 1A6AA 2PW1A 3CDCA 1MJJA 3NIFE 4V1DD 4Y4KC 1BZ7B 4WI5A 4MD4A 2X4NA 4CVXA 4R4FH 2J8UF 5ITFA 2Q1EA 3QO0B 1OP3K 2ADGB 1YQVL 5SX4H 1G7IA 3B4NA 3MRLB 5DURD 2NY7L 3D2UA 3VRLE 3T0AA 3GSQB 4C56D 4HEPG 1I9JH 3U6RB 3ARFD 1LE9B 1QLEH 1G7PB 3L3OA 4KJYA 4KUCD 5A2KH 2ICWJ 5B3JF 4KKNA 3RWDB 3V5KA 1FBIH 1YEIL 2JELL 2FBOJ 4MXWH 1WIPA 4PRID 5I1GH 2R29L 3WEXA 4HFWB 4ZFOL 4CRPA 1GIGH 4HK3N 4Q0XL 1Q9KB 4F2MA 4LRNL 4JPIA 4RZCA 3MRCA 4GG6A 1LEKB 4AT6B 1E27A 3FT2B 4WDIB 1CU4L 4U1KB 3H9SE 1W8OA 4GXUN 4RFEB 1DBBL 2NY2C 2IAMA 2R4SL 3QFJB 3V0WH 3BYTA 1MJ8H 2E9BA 5DMKB 4JN1L 3C08L 4XPHL 5BV7L 4I77H 2J5LC 1FJ1B 3VFTB 2XWJB 4YHPB 3RWHB 1QVOA 1N6QH 4HIIA 5FB8B 1OGTB 3MRQB 4G6MH 2ZOLB 4M93B 3MFFB 5JLZA 1RZKC 1WAAA 5B8CA 3MV11 4X80H 1RUKH 2C3XA 1G6VK 4OIIL 4R0LB 1LE5B 5T1KA 4P2OB 3IXAB 5F96H 4YJZL 3RVUC 1DCLA 1YJDL 4RFOH 1DLHA 5CEXA 4RCAA 3E2HC 4BSJA 3V4UH 2WANA 1A1OB 3FQUB 1Z9MA 4O2CA 1IQDB 4D3CH 1V8HA 4U1HB 4LCCC 5ESVA 5CSZB 2H1PL 3SO5A 1JHTB 1OW0C 2NW2B 4BYHA 1FNSL 4XP4L 3TBWA 4FQCH 4ZXBA 1CXLA 2GCYA 3CH1B 5EU3B 1TJIL 4LNRB 2PUQT 1REIA 4UOJA 1QBBA 4LSVH 4OLUL 1EK3A 3PDGA 5JPMA 3MBXH 3MRGB 5KVGL 2A83A 2CIKB 1WWCA 2UYLA 5D1ZD 4XMPH 3HN3A 4Y2DA 1CT8B 1DVFD 1ACYH 1KTDA 3LPWA 1EPFA 2J6EL 5CAYB 1W0VB 4IOFC 4JQVA 5D7JD 4HPYH 3LSOB 1AGEA 2AGJL 1IGCL 1MHHB 4GW5B 3S37L 1B0WA 3VWJB 4E41B 2DQUL 3IDMA 5DJXA 5CD5C 1IAIH 2IADB 5I1LB 3BKML 3O3UN 3T2PA 3CLEH 1MCRA 4I0KA 3VG9B 3KPSD 4K8RL 4JM2D 2FHBA 3KJ4C 1WFOA 4MNGA 2BY3A 2FJGB 3P11L 2FDBP 1DEEB 1S7XB 5FGBC 1JYVA 4ZQKB 1X5IA 3O9WB 3TT1H 4KU1A 4F80A 1H3UA 1OARL 4WNQA 4H88L 2F5BL 3W0WB 4PJBF 1QR1A 3BD5A 4XP9H 4QRPE 1H15A 2P5WE 3PNWB 3VMOA 3SE9L 4OD2A 3QAZC 3GSNH 2EDJA 3CGTA 3IJSB 1BQUA 4JZNB 1AR2A 2R0WL 3C5ZB 3S5LA 5IVZB 1T2QL 2VZSA 2V5YA 4P46D 1J8HB 3BXNB 5EOCJ 1YQVH 1J0YA 4XCYA 3X3FL 4X6BB 4UQ2A 2NY7H 2VLJB 3FQWB 3OAUL 3KYAA 4GS7B 4HGMA 3MJ8B 3PP3K 4M03A 3KLSA 1T66D 4RMVA 4X6FA 2ZG2A 4NJ9L 3ZDZF 3VXQB 5E2UL 1CFNB 2F15A 4DUWA 5D2LA 1D6VL 3GMPB 5FOBB 3BJ91 1HE7A 3PXJA 1F90L 4XP6H 1Z3GL 1INQA 3MJ7A 4GUPA 3GBLA 1PG7W 1YEIH 2JELH 5DS8A 3QDJA 1WBXA 2ADJB 3QJFB 2R29H 2GSIA 2YMXL 4YDVA 3QXWA 2VO5A 4TUJA 3WD5L 4E5XB 5GXBB 4PS4L 1T22A 3VXPB 4Q0XH 1BZ9A 1FAKT 5C0JA 4FTVE 4LRNH 4NQCD 3D39E 1YPZA 2R1XA 5ESQB 4H8WC 3BQUD 4N0UE 2VKWA 3MCG1 3IETB 5DVNA 3X11A 3T8XB 3UBXA 5BVJA 3OAYH 3TNMA 1DBBH 1Z5LA 3O4OC 4RIRA 3RWFA 2R4SH 4K7PL 1AGDA 1V3LA 1VADB 3C08H 5CP3H 1SJEB 5C7XL 3C60D 5HHMD 3C6LD 3PP4L 4W81A 4WWKC 3RL2A 2CJUL 4P46B 4JQIL 3IKCA 2IPKA 5D7IB 3TIEB 1YQ2A 2MFNA 1GGUA 3P0GB 4UQ3B 1R5WB 3CFDB 1EEQA 4PFEA 3P9LB 2VLKB 1F00I 3QHFL 4HUUA 3S4SG 1E6JL 4OJFL 2X6MA 4PJFE 4ONFL 2VISB 2F74A 5DHVB 4U3HA 4F8TA 1EO8L 1JI2A 4PJIF 3DETD 4NQSB 2AEWA 3V5HB 4YDLC 1CE6A 2IWGA 4JHBA 5SWZA 2H1PH 2J4WH 3RNKB 4OCNC 3NIFF 4XZUB 5D4QA 1FNSH 1MI5A 4Z76A 3QUZB 2EDQA 5IEKB 4HKZA 3DX9A 3BQUB 1F11B 4DOHE 3HE6B 5GSRB 1TJIH 1MQ8A 2FHFA 4OLUH 3MUJA 5E8OA 1TCRB 4NHCL 3VRLF 3R0NA 1QSEB 3MBEB 3SKOA 5L2KA 1HKLL 4OD1H 1PX4A 5KVGH 2VDKH 3MPCA 4WUUB 3PGCB 2HT3C 2MQCA 5JDJA 1V5JA 3QYCA 4KK9D 2X9WA 4JEGB 1P1ZB 3RIFF 2J6EH 2IANE 4NZRL 5KSBB 2FIRT 3DUUA 3U2SA 4JFOB 5HPMA 5GGUB 2QSCL 1CXEA 3VGEA 6FABL 5HGBA 1ZHKA 2ORBL 1QO3B 2AGJH 4QY8B 5EUKA 2HJKA 2DQUH 3N9GL 1ZA3A 4Y2DC 1CQYA 2ZSVA 1RZKH 4FNLL 4L4JA 4JCMA 5HHOB 2GFBA 4Y16D 2HFEB 2YS4A 5DJ0B 4HIEB 2X4UB 3GMOB 4ZD3L 1QRND 4K8RH 1HILA 1GGCL 2KL6A 4X5WB 2LE9A 2OS7A 3JTSB 1E4KC 3P11H 1F3DH 1VFBB 1UB6A 4HCRH 3DGGA 3MGOA 2D7QA 4ORGA 5I71B 4H88H 2F5BH 2OL3B 4H25B 3EGSA 5CKGA 5J7CC 5C0ND 4Y5VB 4NO0A 4GG8A 2Z91B 5FK9A 2E7LA 3SE9H 4L4TA 3O0RL 2Q6WA 3QBTB 4NYLA 1TDQA 1I3RA 1PEWA 4Y1AB 5D7SL 5GS3A 2VC2L 2VQUA 1T1ZA 2BNUA 2VQ1A 5DO2C 2AJSL 4O51A 1T2QH 3IJHA 3VXMD 4FXKB 5I15L 1B90A 1VEPA 2BVQB 4ZOEA 3RL1B 9CGTA 3X3FH 5E1HB 4ZTOL 3UC0L 5T1LB 4BZ1H 4EDWL 5GJTL 5L88H 2H45A 4NJ9H 3WDHA 4HUVA 4MCYB 5D8JL 5E2UH 3KYOA 3ZO0A 1JWMB 3L3GA 1G6RA 4O2EB 4MLSA 3PHQA 4YDJA 2YUWA 4NN7C 1F90H 5DK2B 4NKDB 4JJ5B 1F3JB 2EH7L 4EN3B 1NKRA 1BQLL 1VACA 2GTWA 1QRNB 1GPOH 5JOPD 4U6TA 4JPWL 2YMXH 3IDUA 4FQPA 1DUYA 1U58B 5H2BA 3ROLA 3WD5H 4PS4H 3SY0B 3N85L 4JO2L 3TBYA 3QEQE 3MXVH 2P7TB 3CXHJ 3SDAB 1U8IB 3X13B 1T7YA 3AS3A 4ZO9A 3VXRD 5EUOE 4N9OB 1K8IA 3GO1H 1AHWA 2ZUTA 3OAYK 4IRSD 4JHAH 2B4CL 4K7PH 3ULUC 4P9HL 1BFVL 3WL9B 3FB8B 4PJGE 5JOEA 4H20L 1OAKL 3EFFA 1HSAA 1JIBA 1KCVL 4ESKA 4P3DA 3PIQB 3PP4H 2FR4A 4Z18A 2OR9L 2CJUH 3VXMB 4JQIH 3KXFB 5DYOA 4JRXB 5EWIH 5F7YC 1U3HB 1CD8A 3MLWL 3TO4A 3O8XC 2BMKB 2L7JA 4XPFL 4LRIA 1NLDH 3IKKA 4Q9QL 1CXHA 5F88A 3QIUB 4WI9A 1JJUA 2QQLL 4P59L 1MSPA 4RBPH 5EOQL 4ONFH 2YD3A 2H2PC 1X5LA 1LEIA 3RUGF 1IMHC 2QR0A 3Q48A 5CJOL 5DJCA 3GUTB 2AV1A 5GGVL 5C6TH 1U92A 1N5AB 4PJDA 1BVKA 2CDGB 3MUGA 1VEMA 1A0QL 3S96A 2XTJD 4P2RD 1OHQA 3WS6A 4PPTA 5L8JB 1T2XA 2AJUL 4M6OL 4H1LB 4LCUA 4ELMA 3BDBA 4L3CA 2BNQB 2XPGA 4NHCH 3S37X 1CICD 1JNLL 1SJHB 1F6LL 1HXMA 1HKLH 5DEGA 3KPPA 4UOW1 1NGQL 4ODTL 5ADOH 1BWWA 3WN5C 1U8QB 4G8IA 2A38A 5CINH 4WV1A 3ULUL 5HVHB 5E00B 4DEPB 3OJDB 3NGBC 3TJHD 2QSCH 5DI8A 1P6AB 4BK5A 2W60B 2OX5A 5CUSL 1EUTA 1G7MA 1EFQA 5F7WC 2DJ4A 4G6AC 3VFVA 4FNLH 3PQYD 2A77L 4PRBB 4OLVH 1BJ8A 3ZKND 4JFFD 1D6EA 2V2XB 3TA3D 1GGCH 4WUKL 3RGVC 4PJ5E 3TBTB 1HHKB 5MI0B 1NC2A 5DXWA 4JFYB 3ARGA 4PGEB 3SOBH 2XTJB 4P2RB 1KPVB 1G1YA 1J1PH 1XCTA 3HI6L 1KTKE 4M6AA 3L3DA 1YEGL 2H2SD 3B9KA 3O0RH 3CSGA 1HEZB 1MFNA 1UH2A 3BJLA 4EI5A 5HBBA 1BD2A 3U48A 1O7SA 5D7SH 2VC2H 2NNAA 1KN2L 3HE7C 1BFOA 4U7SA 3NAAL 1NUFA 1S9KC 2AJSH 5JUEL 2DQGL 1Z0MA 5F9DC 5CP7B 4A6YA 5FGRA 1JPST 4XWOC 4ELKB 5I15H 4P2QA 4MAYB 4AIXA 2MKLC 2E7LC 1UZ8B 5DVLA 1NGXB 1OGAA 3OF6D 1F97A 1LO5B 1CR9L 1CGXA 4WU5A 3MA9L 4EDWH 4NQTA 5GJTH 5C6WH 3ZL4H 3BP7A 5D8JH 2FLBT 1D5BB 4PV8B 3S5LG 2ZUVA 2F5AL 3L9RA 2EKSA 3C5JB 3PQYB 3DWTA 3RWGB 1VA9A 2JIXA 4QRSA 3CFKA 3VA6A 4JPWH 2BVYA 4U1JA 4ZPVA 4LEOA 4JO2H 4ISVB 3I9GL 2AQ3A 4MNGE 1BVLA 3FCTB 3H8NA 4U6VL 1FFPA 5D5MA 1PQZB 2ITCA 2ATPA 3WFBL 3O2DA 4G6FB 4DWHA 3PWLA 3TJEH 1JP5A 1WTLA 3AB0C 1Q72L 3QUYD 2HT4D 3RVTC 3AFLA 2B4CH 5B21A 3CUPA 1I7ZA 4ENEC 3DTXA 4H20H 1OAKH 3U0WL 1KCVH 1H0DB 1OLLA 3KNBA 3FT4A 2NW3A 5BOPA 4HSQA 1X5JA 4JKLA 3UBXG 5FDWA 4LPVA 4LFHD 4R2GC 2D0FA 1UB5B 3MLWH 4X9FA 4YHNA 3BP6B 1INDL 5E8NA 1OAYL 4XBEL 4PRAB 1QA9A 3DMMD 3AAZB 5EFIA 1U8JB 3VFPB 3QDMD 3WHE0 1NMCB 2FH6A 1LVEA 2QQLH 3E6FB 3VGAC 1KPUB 5EOQH 3PV6B 5D2LE 2NX5E 1PDKA 4JRYB 4POYA 3VRJA 4Z7VB 3JWOC 1GZPB 3FO9A 3QIBC 1P6FA 4LRIC 5CJOH 3QDJE 2K9UA 4NDMB 4LBEB 1X7QB 4G9FD 3ULUE 1NCTA 3GSWA 4I18B 5E2WL 3L5IA 2CRMA 5JHLL 5CS7A 4ZO8A 4ETYA 2BC4A 3WLBB 1WFTA 1GL4B 1YPZE 4MB3A 4UAOC 4HZLA 1FL5B 2AJUH 4M6OH 3OMZA 3UTSB 1VKXB 3QUYB 5IG7B 5EG6C 4LASL 4ETQB 3A6BL 1G6RL 5C0BA 4H26B 1FQ9C 3VCLA 4CVZA 3QUXA 4ODTH 3DLQR 5IM7B 2IH3A 5TGBA 1T3FB 2Y5TA 3TNNB 1HHHB 3D9AL 3OX8B 4DK6A 5CJ5A 3WS6C 4OQ1A 4FP8L 4KK8D 3MRBA 1OPGL 1WISA 2QSQA 2Q7YA 3ULUH 2PKDA 3P40A 4BELD 4PGDB 2FWOA 1ORQA 3HAEB 4NNXB 3VFUB 1JPFA 3DMMB 4U0RB 3IFPB 2CLZB 1SM3L 4XAKE 3QDMB 1OTSD 3T4AB 5CZVH 3K8LA 4OIAA 3K81A 4WV1C 1FNGA 2APFA 2A77H 5KSVA 2C5DC 5EUOF 1SYVB 1J18A 4S1SH 2R2EA 1T5XA 5IVOA 4LLDB 4JDVB 2J8UB 4WUKH 3MV8D 2CPCA 4IS6B 1VGEL 3MRIB 1FL6A 2Y4SA 3FMGL 2M2DA 3ARWA 3FT3A 1H3WM 2EYSA 5K9QG 1EZVX 1T6WA 1UJ3A 1KCUL 4HMDA 4L3EB 5C0CB 4K23L 3HI6H 3VI3F 2V2TB 3AREA 2YRZA 1YEGH 3MLRH 1G7HA 4JFED 2X4TA 1IGYB 3WE6A 2ZCLL 3SKMB 5KSUB 5L2KE 1R0AL 4R7NB 3CDYA 1JFQL 3LN9A 4BQ9A 3NAAH 1UC6A 1ORSA 5BO1L 4QWWD 2VYRE 5JUEH 3FO2A 1YC8A 3SBWA 1IZJA 5I1KH 3ARUA 4AIZB 1WCQA 2F19L 3B9KC 4LLYA 4PRHA 5H8DA 3VXUD 2NTFA 1CR9H 3PJSB 1CBVH 3MA9H 4MVBC 4LSPL 1YYLH 4P23A 5HXMA 1QFWH 4NZTL 2C3HA 1BLNB 2A6DA 2F5AH 4CW1A 1ZGLM 2X10A 2WIIB 1ZT1B 2I24N 4NC1C 1HN1A 1K4DB 4G8GE 3HC4H 4L3AA 5LGKA 3RRQA 3ARDA 4LLQA 5IMKB 3T1FA 5T5NF 1TFHA 2FJFB 4IMKC 5CJQL 4ALAL 3MO1A 4LCYB 3BZDA 3WFBH 2KKQA 4U6XB 4APQC 4XPTH 4QRRA 3HI1A 5D96C 3H42H 2Z31A 3QUMB 1Q72H 2CRYA 1SEBA 3LN5A 4RMTA 5AUMB 5I8KL 4L4TE 4QRUB 2BSSB 1J11A 1FDLL 2HLAB 1DBAL 5JXAH 5KN5B 3U0WH 1BMGA 2WW8A 3QDGD 2C4FT 5MEPB 3QP3A 1BF2A 3SDDA 5FKPA 4N90D 4UOW0 4GBXB 1DUZB 1FVCA 2OR7A 3CAFA 3MNZA 3VE0B 3PDDA 5EN2A 4XI5D 2JTDA 3ZE0E 3ZHLA 1INDH 1OAYH 3LN4A 4XBEH 3EYQD 1Y6MR 4BFEA 4MCZB 3M45A 4N0FB 2C3GA 5DD0L 5CBEB 3N50A 4HIHB 5TF0A 4EI6B 1DBKL 5IR1B 1HYSC 2DQTL 1BX2A 4TQEL 4EDXB 3MRFA 5IBUG 4OGXL 5A3IC 1A6ZB 3PWNA 5IGXH 4AG4L 1EIBA 5E2WH 4A6YL 3O2WL 1E0OB 1U8OA 4OKVA 1CD0A 1WF5A 3LRGA 1HHJA 4JO3L 3QI9D 4P5TB 3BIKB 5EC1B 4J3XA 3T0DA 4WTXA 2H32A 4LASH 3MC0A 3BZEA 1G6RH 2BSED 3WIHA 4OAWB 2PO6A 3B43A 4X8JB 5E8EB 3CFBA 3HMWL 2FO4B 3TV3L 3D9AH 4R97B 3U79A 4K9EC 1ZT7B 1OPGH 1CDIA 1HXYA 3SKJL 1IGTB 2PXYD 5IQ9A 3PV7A 3LKNA 1D7FA 3QUXC 1ETZA 4PJBB 1RURL 4D94A 4B53A 2NXZC 4YFLI 3O2DL 1SM3H 4HKJB 5DJ6A 1XIWC 3OKNA 2GITB 3BVNB 3Q0HA 4XPBL 5DRNA 2AK4D 2ZUQB 1CQKA 2V9QA 4XGZA 5I74C 2IQAA 3EFDL 5DEZA 5DEFA 4KC3B 2VXTL 3QCVL 4F7MA 2K7PA 4XVJL 3MYZA 2CUMA 3HCVA 3P4MA 2C1OB 4IEFB 1JGEB 3P4LA 5EBWA 1FRGH 3W39B 3FMGH 4D8PA 3DVNB 3SCMB 4QRTA 4K23H 3VFSB 2Z4QB 4GKSA 4ELME 1S7RA 5DQJA 1ONQB 2ZCLH 3GSXB 1R0AH 4NQXA 5BZWA 4M7JH 5D7LD 1JFQH 2ED9A 4HAGA 3BWUC 3D69B 1R3KB 3TYGL 1M7IA 2R1YB 3GJFB 4C57C 1HSBA 1G7LA 4NJAL 1UJ3C 2K3TA 5BO1H 1O0VA 2FGZA 3LQZA 1ZHLA 2Q8BH 4FMKA 3AREC 2XKUA 1AI1H 2EH8L 2DMCA 2V7NA 3BO8A 3BN3B 4WRLA 3KAAA 4JRWA 2HH0L 5LGHL 2VLME 3GRWA 3JVGA 3QDHA 3ULUF 3EYSH 3RWJB 4LSPH 5ICZB 3Q5TA 1YPZF 4QTIL 2OSLB 5KSAD 1FLRL 3WXVL 1KLUB 2OTWB 3MRMA 2G2RB 1RZ8A 3EYFB 2IH1B 3OXRA 5HYSB 5DQDL 3IRZA 1DDHB 1IEBB 2ZOKA 5DZNA 2PETA 3MLTB 1BGXL 3DYMA 1K3IA 4JFDB 1OQXA 4P23C 5GRYA 4OGAD 3HA0A 4JAMB 3FQTB 1HHIB 2ADFL 5HVGB 5E08H 3HZMA 4R4ND 1V05A 2XKSA 2ZG3A 2HWZL 5F7LB 1UXWB 4GKZA 3ARDC 1U8NA 5LBSL 2VR5A 3TCXA 3CDGB 3DPBA 4DN4L 5I8KH 3H9SD 2LU3A 1BD2E 1FDLH 3ABZA 3D87B 5D7LB 5CFHA 4ODXA 4FQXA 4PJIB 3UZQA 1CL7L 3FFCB 4HUKB 2VZ3A 2G60L 4XWGL 4ORZC 1NDMB 2QL1A 5HI3D 4YQXL 1EJOL 1C7SA 4WGWB 4IDLA 4N8VA 4NC1E 5E6YA 4P2QE 2AERT 2EDRA 3DSNA 1C5DA 3B5HA 4X9BA 3SE8L 4JLRB 5A2IH 5IB4B 2VWEC 3NN8B 4NN5C 4F7EA 5DD0H 4L9LB 1DSFL 4NKQB 1MAMH 5DVMA 5KSAB 3SDCA 2Z93A 3FO0L 4CJ1A 5I1JH 1DBKH 2ILLA 4ZTPL 1A5FH 2DQTH 4ACPA 4AEHL 3EHBD 4HF5L 4TQEH 1A6UL 3P0VL 1YN6B 4M7KH 4TUOA 2APXA 2EIZB 5DC4B 1NFDA 5F7NC 3O6KL 4WO4A 4A6YH 4ODWA 2ZUUA 4PGBB 2AP2A 3TIDB 2YPKB 1TZGL 4JO3H 3RP1A 3MGTA 2AXJA 5D5ME 4K3DL 4AIOA 2EXYD 2EYTB 2PCPB 2VUYA 5I16A 5CILL 2HJFB 2QSTA 3JV4A 4XRCA 5CD3B 2ICWI 2F8XC 4I0PB 3FO1B 2YA2A 2VLRE 1FC2D 3HMWH 3B9DA 3BH9B 3GMQB 3DJ9A 3PL6D 5EBGA 3WIIL 3KWWB 1A3RL 3MRJA 1IKNA 5FECA 1DEDA 3EYOB 1XF3A 3G5VA 1AXSA 3DBXB 4LPCA 3BEWA 3AS1A 4B5EA 3RZCB 4OCMC 1RURH 3QFDB 1VDGA 4JGJA 4NPYB 3O2DH 5C9JB 1RK1A 5ADPL 1I1AA 4XPBH 1AKJD 1MFBH 2OI9C 3U4BH 4YHKH 4YFLF 2IALB 2VXTH 1A9BB 5E9DA 4XVJH 1MUJA 1VB9A 4UI2A 3QZWB 4JG1L 5DD3L 5GS2H 3IS1X 2DQFA 4G8FB 1RMFL 3V0AC 3LKPA 2AJ3B 3WO4B 1HDMA 3CMOL 5EC2A 3G04B 2F53A 3HZYA 2YUZA 3OAZK 3MACH 3QNZB 3FOLB 4U1IB 4ZS7L 2B20A 5C0BE 4P5KB 1WBZA 4KKBD 2ZNXA 4QRPD 2P5EB 3S97C 5F7KC 3FB7A 4NJAH 4QXGL 3D3VB 4FFVD 3ARBD 4M1GL 2DS4A 1X5AA 4LHUA 2EH8H 2BOCA 4YR6B 2DLTA 1S9VA 4ZOCA 1A7QL 2HH0H 3EDJA 1U95B 4K9EH 3HPLA 2GTZA 3ULVL 4Z5RA 3V0VA 1J0IA 2N56A 3GI8L 4QTIH 3U46B 1FLRH 3WXVH 5SWSA 4JKKA 4P99A 2X05A 3KS0H 2OMNA 1IARB 3OL2A 1HINL 3WIHL 3HZVB 1T6VN 4HBCL 5DQDH 3TWCH 4I13B 1RJLB 5C8JA 5I19L 1BGXH 1EFXB 2WBJA 4PJ8A 5I17B 1X44A 5IB5B 15C8L 1WEJL 4X4YB 1UJTA 1ZA6B 2VSCA 3BPLB 4MQSB 4QTHA 1EHXA 4QRQA 2VB5A 5LQBL 2ADFH 5C2BL 1B6DA 4YFEA 3PWPA 2X4OA 2HWZH 4FTVD 1CXIA 4BFIA 1Y18A 1KEML 1I9RL 1RQ5A 3GMNA 2O93L 5LBSH 3BGFB 1QHPA 2DIBA 4GW4A 5CLTA 1FZKB 4DN4H 4O2FA 1QR4A 5IMMA 4QRPB 2P5WB 1L7TH 1CL7H 1AXIB 3RUGB 3GSVA 2G60H 3L7EB 4MHHI 1VERA 4RFNC 5TDPA 2VUOA 4YQXH 3L3HB 5DJYA 5C3TA 5E03A 4EJ1C 1M4KA 1FIEA 2BXYA 3H7BA 1T7XA 1JUFA 4BUGA 3LKRB 4PRHE 4KJWD 3SE8H 3QEUA 3TFKC 1Z9SA 1PJ9A 3RY6A 4OTXL 2R2BB 3TLRA 1DSFH 3O6FB 5KTEH 2GI7A 3FOMB 2AABL 1KJVB 3NCYP 3WNKA 3FO0H 5KS9A 2BRQA 5CBAB 2J2ZA 1G84A 4ZTPH 3DX6B 4Y5YA 1JHKL 5IKCA 4HF5H 1A6UH 3P0VH 2BSRA 4MDJA 2Z8VC 3OXSA 1RZGA 2W0LA 5D9SA 3JBG7 3ZKMD 1M6OA 5EBMB 4FQHB 4OFYA 4PLJD 4MDIB 1U3JA 3O6KH 4NWUL 2Z8SA 1KELL 1TZGH 3SDCC 1JMXA 1I8MA 4Y4HA 3QNYA 4K3DH 2QLVB 4GW1B 1TETH 1KNOB 3HG1A 3P9MA 5CILH 5BRZA 3D39B 4QHKI 4QRRE 2AEQL 2G9HB 4XNMA 3I02B 5F97E 4Y4KB 3BE1L 3OGCA 3KHQA 1WV7T 4JZOB 4PG9B 3HLAB 2FRGP 4MJ5A 4QYOA 5T5FL 3LKQA 2A74B 3FZUC 4NFDA 2RFXA 4GSDL 4KRPC 3WIIH 4KXZH 4GMTL 1ITBB 1I3VA 1RJYA 4X5XB 3RX5A 2LAGB 1NGZB 4K8RD 3RVUD 2YPLA 4JVPA 4NBXB 3VU2A 3C6SA 3IGAB 5TDNA 2NY0C 2IAND 3EOBA 2DQHL 5ADPH 1DE4A 5KZCD 3R8QA 1QG3A 5EU4A 2ZKHL 1KB5H 1XF2A 3I2CL 4NRZA 4URTB 32C2B 4AYFA 2GY7B 4NT6A 3MRKA 1T2JA 3ARZA 2ZP0T 1GRWA 2A0LD 2I60H 2DI7A 4NBYB 4O58L 3QEHA 4JG1H 1CGWA 1I1AC 4YHIB 5EO9B 3MREB 3OR7B 5JHDB 3MZTA 1RMFH 2HMID 5T1MA 2V5RA 1KG0A 2NY2B 4OUOA 3V9FA 3MV9E 5AAMA 4I3RL 2B8OT 5B39A 2CDFB 3RFZC 4Y8DC 2PF6A 1DQDL 2GK0B 1M05A 1KBGL 4K3EL 2J5LB 4ZS7H 4PUBH 2R69L 2L7UA 1OTUD 3C8KA 1T0MA 3NABL 5EO0B 1U8PB 3OKMA 2KPNA 4MX7A 4QXGH 1AXTL 2UVFA 8FABA 4M1GH 4R3SA 1DQMH 4LVNC 1IC4H 5HD8D 5DHYA 1C5BL 4UU9B 2ZZUT 4IIQA 5SWQB 2X4PB 2NY1C 1RZIA 1KJ3H 3D5OF 3D18B 2FL5A 1DTUA 3E2HB 4JY4B 5IJKA 5L9DL 5KZCB 5FAAA 3O41A 1BWMA 5E99L 2D7TL 5D5MF 2GEEA 4LCCB 5CGMA 4NQEB 1FLTX 3VXOA 3N1QC 2R0ZH 2RB8A 4Y4FC 4HBCH 2DQIH 5I19H 1DFBL 1F4HA 1T20A 1NBYA 3NZ8B 4XNYL 2X1WL 3WXWL 1UGNA 3E6HB 5GZNC 3WFHA 5LQBH 5FV1L 5C2BH 1ZT4A 2EDFA 3L7FB 1Z9OA 4LVHC 3DO3A 4UTBH 3CZFB 5AYUL 1FZOB 1D5IL 3QEQD 1T0NB 3I3DA 1FV1A 1EDQA 4K55A 4JANA 4LIQL 1KEMH 2Z35B 4JKPH 3UJIH 3RDTA 3VXSA 3U82B 4KDTA 2XKNB 1HQRA 3DX7B 1I1FA 1ZE3C 3REVA 4OFIA 4FXLA 3B83A 4ZS6C 5TE4L 1CTNA 3UTPE 5IB3B 5K9KB 5IW3A 1XF1A 3MFGB 4F15C 2PR4L 4RAVA 3V4PL 4OFVA 1RVFL 2X4QA 5F9OH 1L4IA 4UB0L 2HRLA 2KZWA 1P2CA 3OZ9L 1WUNT 5MEQB 1JF5A 1W0WA 4K7FB 3GMMA 1IEAA 3L5XL 4OTXH 1T5WB 1CXKA 1A64A 4HS3B 2AABH 4HGKC 4L29A 1FFOB 3IJYB 4L4VA 4WJ5A 3D2UD 2O5ZL 3MOAL 3B6SB 4N8VG 1JHKH 1OD9A 3HR6A 1H8OA 3GMLA 3W82A 1KTLB 4PTUB 1W72B 3EO1B 5FUOH 3RY6C 4G80B 4NWUH 1KYOJ 3DVGA 3QXDB 3AU1A 4M43H 4PG2C 5FUCC 3NCBB 1D5MB 3QH3B 4Y5YC 1I9EA 3QAZB 3I75B 3GRWH 3ES6A 1JGDA 5C07A 1QSFA 3C9NA 2AEQH 3UTOA 1U93A 1I7TB 3QXAA 3BE1H 3JWNC 4R96A 3O6ML 5EUOB 1NL0H 4BKLA 1GGYA 5T5FH 2MHAA 4PB0L 2IAMD 1OVZA 4GSDH 5DD6A 3MRRB 5FO7B 4P4KA 4GMTH 4QLRA 3RZWA 1U91A 5D2NC 5GISL 1KJ2A 4MD4B 4ZSOB 2VMFA 4P5MB 2MCPL 2DQHH 1WBYA 1UZ6E 1FNEB 1AFVL 5DRWB 2EO1A 1BQSA 2F54A 2ZKHH 2JLLA 4X7SH 3I2CH 3D2UB 1EEYB 4NSKA 4N9GB 5T1KD 4R4BB 1NFIB 3SPVA 3O3EA 2R56L 2CLRA 3KLAA 4WEMB 2R1WB 4N0CC 3BH8A 5J9PA 3RVWD 4O58H 2P43B 1NFDE 5L0QC 4V2CB 3RI5K 4LLVA 2I25N 3BW9B 4BH8B 1GOGA 3O4OB 3WEXB 4J23A 1FFQA 1I7RB 1MREL 3CD4A 4MB4A 5CJBA 1JBJA 5HGDA 4RZCB 2HT3D 3HS0A 1DQDH 3LRHA 4CMHC 4ZXBD 3SQBA 3HUJA 1J86A 3VGDA 4WWKB 4MD0B 1XGRB 3NABH 1EAPB 4BQ6A 1VHPA 2I27N 1AXTH 4OLZL 1T4KB 1G0XA 4G42A 2W59A 1C5BH 4TN9A 2NY4B 2O61B 2FD6L 3MJGX 4Y2DD 2HAZA 1OP9A 2DQEL 3MROA 1RD6A 3ZT7A 4MXQD 4I48A 2HJLA 5DJDB 4Z78A 1FZJA 4JO1H 5E99H 2D7TH 5J6HB 1EMTH 1FL3B 2COQA 4YDLB 4EZMA 3EJZC 2ENSA 1DQQA 4IIQC 4OFPA 1XR9B 1PLGL 3LS5L 4RAUB 3T4YB 5E9DE 3WIFA 1DFBH 4FQIL 4OB5L 4XNYH 3WXWH 3F12B 1ZLVH 1IVLA 3AUVA 3W2DL 5C08E 1VPOL 4OGYL 4Q6YA 5ESVB 1BECA 3G5ZA 5D1ZC 1L9NA 4MA8L 1NMBH 4PJ5B 5AYUH 3RI5F 1DVFC 2Q8AL 1JYWA 1D5IH 1BOGB 1WQVT 3GBML 3HHRB 2F53E 2ICWA 2AJYL 3MA7B 1AC0A 4K94C 1BBDL 4ZMAT 1UWXH 2DQJL 4IJ3C 5KANI 5DO2D 1Q0YL 5D7JC 4D0DB 3BAEL 3T65B 3TH2T 3G6DL 5I0DA 2ADIA 4ZUVA 2PYFA 4IHOA 2E9IA 3BKYL 3PE9A 1ZWIB 4DKEL 4QOKA 5JPMB 2R0KL 4RNRA 2PR4H 3O4LE 5ISZA 4XBGB 1UKSA 2UWEA 3V4PH 3GI9L 2X41A 1RVFH 2UYLB 5BS0A 4LARL 4UB0H 2FYYB 4PJ9A 4Y2DB 5C0DB 1KTDB 4JM2C 3RU8L 4NBZB 2NXYC 4EUPA 3I50L 3H9HA 5D70L 3IRPX 1C16B 4GMSL 1FORL 2E7BA 3QA3B 4M02A 2GJZB 3MOAH 2P44B 5SWSE 4OZFA 1TITA 3IDGB 4LPTA 4TSCL 4F57L 3B2UD 3HTLX 3RTQA 4ZFGL 1U42A 3OGOE 4ZAKA 5DTFB 1YNTB 5LCVL 2B0SL 5EO1A 1IM3A 3QDJD 2FNBA 5HYJB 2VDLH 4HXBL 4R90H 3UAJD 3VFWB 4GRWB 1SJVA 1QKZH 3ULUD 4ZUWB 4L5FL 5HY9A 1JWSB 1KT2B 5C0AE 4UT7L 5JW3L 1EV2E 3O6MH 5JR1H 1X4YA 4MWFA 5HHVL 1XZ0A 2YPVL 4HUXB 2VL5B 4PB0H 4NZJA 4M48L 1NAMH 1CFBA 5BXFA 1YN7B 3S35L 2ZUXA 5EU5A 1JGVL 5D1QA 1B0RA 5GISH 2Y9RT 4HH9A 1T1WB 1SEQH 5ALCL 1MRCH 3JSSA 5LGJA 4K3HA 2MCPH 1WC7A 2VIRA 4NN7B 3E3QC 3WFCL 2H2PD 4XC3H 1AFVH 4YX2H 5BVPL 1AIFA 4P4KC 3CFEA 5KBNC 4YEFA 1BIIA 1N2RB 1F4WH 2DIJA 3KPRA 4EBQL 1ODAA 2R56H 5CEYB 2YEZB 1T83A 1IM9B 1WCBB 3KLHD 4GAYA 2NX5B 4OZGA 4Q9CA 4CU6A 4YGVB 2BJMH 1YNKL 2EECA 5IROA 3MJ7B 3QWRA 3EO9L 4EVNA 3QDJB 3C60C 4M1CC 3L5WA 3C6LC 1MREH 4TUJB 1SY6A 5ID0B 1BZ9B 3HG1E 3LD8C 4QHNB 3RAJL 4GQ9L 1MI5D 4LDLB 4B41A 1YPZB 3LMJL 4JZJC 4LEXH 5D2NE 1V7ML 2OJEB 2YKLH 1R3HB 1B2WL 4PRIE 1AQDA 2V5TA 2JJTC 4EKXA 3L1OL 3D25B 3QUKA 4RIRB 3VGHA 2X1OA 1JZ3A 5L2KD 3DXAB 4JO4L 5B39G 1AGDB 3MR9A 3O8XB 2EEDA 1RUML 4JR9L 1MCFA 5DUMH 1JNNL 3EAKA 5DLML 2R0LH 2FD6H 1G7JB 1EVTC 3DETC 1BBJB 2XZCL 2E3VA 2YBRB 3EDDA 5GRVK 5C0FA 2VR4A 1MFCH 4LPUA 2IPKB 1CD1A 3CFJB 1FGVL 1NCAL 4MZ3A 3KPNB 3TYFB 2EZ0D 4PRDB 1PLGH 5F21B 3RGVD 4ZNEA 3LS5H 1KPRB 4ZUUB 1F2XK 2XY1A 4FQIH 4LSTL 4N5EC 1ZXQA 4RSVA 1NGPL 1AD9A 1VPOH 1XH3B 1KJ2L 2XQYK 3K1KC 1I8IA 2ESVA 4KK9C 2Q8AH 2AVGA 4I3SL 1UENA 4NM8L 5C70A 5E5RB 2AJYH 1BBDH 2Q7NA 2DQJH 3WN5B 4CMMA 1I7UB 1Q0YH 4DVRL 1T1YA 3BAEH 4OF6A 5D1XA 4AH2B 1UZ6F 4CDGC 2P24A 5CLWA 3G6DH 3LRSA 4KPHL 4NO0D 1YMHB 4XWOD 4Y0GA 1XGTB 1P7KB 3BKYH 5E8OB 5F1NB 4L4TD 1I1CA 1N4XH 1DANT 3SKOB 4DKEH 3NGBB 2R0KH 1FSKC 3CJJA 4YK4C 3DRQB 4Y16C 3B8SA 4XVSL 3UTTA 3QQ4B 4R7DA 3TVMC 4LARH 1YMMA 4L9DA 1JYNA 2L0DA 2PYEA 4GRMA 3RU8H 3TEUA 5ALBL 5GGRB 3LQAL 2VAAB 3RWCA 2FZ3B 4GKNA 5D70H 3V7AG 1WZMA 4GMSH 3P4OA 5F7DA 5H94B 5HPMB 4FG6D 1ZHKB 3T2NL 4AQOA 4U6HA 1XGQA 5TPWL 4G9DA 2XQBL 4G43A 4XTRD 5C9KA 2CUIA 2LQRA 2LVEA 4KTYA 3RGVB 5C0NC 3NCCB 5IVXA 4TSCH 4G8GB 2AQ1A 3CXDL 3M07A 4ZFGH 3BX7C 4Z77A 5LCVH 3GMRA 2B0SH 4N1EA 3VFMA 3P30L 2K1MA 5E94A 3L6FB 4HXBH 4ONGL 2GUOA 2HKHH 2P8LA 3LKSA 2A6IB 4NUGH 4I2XA 5DFTA 5HGAA 3ROOA 3RVTD 3MRHB 2ERJB 1VFMA 4L5FH 5LXGL 1S7WB 3HE7B 3T77B 1A7OL 5DJZA 5JW3H 4RGMC 2SEBA 5HHVH 2YPVH 1K2DA 1CGUA 1ZKAA 4NO0B 3ULSB 4TUKL 2FSEA 4M48H 1Q9OB 1QBML 4K94H 4L8SA 5C09E 3F6IA 2NY5L 4WHYG 1A7NL 3S35H 1D9KA 2BSTB 5I75C 1JGVH 2Q3AA 1DN0A 4LGSB 5ALCH 3SKNA 4X7TB 4YEEA 2DOCA 2UY6A 1KUMA 3WFCH 1AC6A 4PJAB 5ICXB 5BVPH 3OB0K 3TO4D 3QIBD 1WIOA 5CIPB 4DFHA 5D1QC 4EBQH 1AJ7L 3DV4B 5FM5O 3RIAK 5FXCH 2AKRA 1I4FB 4LSQL 5EBLB 4RQQB 4IRSC 1YNKH 4F3FA 1GH7A 4MQTB 4BFBD 1MCDA 1A2YB 4XVUD 4P48A 3AB0B 1N5YL 3I84A 2XN9A 3BPCB 4KY1L 3S8WA 4WFFE 3KDMB 1DUYB 3BZ4A 1T03H 1OT2A 4FZ8L 1T83C 5C07E 1QSFE 2DTSA 3O3DA 3MNWB 4GQ9H 4KVCH 3RAJH 5E56A 3LMJH 2LV4A 5F71A 3HZKB 1P7QA 1QZ1A 2BVEA 4F9PA 1B4JH 1B2WH 1MVUB 3SJVA 3U36A 4LGPB 1M71A 1MH5A 1PZ5B 3L1OH 5LAXA 5JORB 4R2GB 3E3QE 4UUJB 4JO4H 4R6UA 3MLPA 3PWVB 4GXVL 4JR9H 3SGEH 3QIWA 1JNNH 2CDEB 5DLMH 4Y7MA 3WNOA 1MCEA 4ONHA 3ILQD 1R6VA 3SDYL 3VGAB 4WW2A 4D0CB 5DYOB 4BSWA 2EIDA 4PRPA 4WHYH 4FFZL 2BY2A 2VLMD 1FGVH 3QIBB 2OMBA 4LSDA 4Z6AT 1Q94A 1YECL 2XG5A 4HS8L 3W9DB 4PJHF 2WIMA 3PG2A 2OTUA 4MNQE 3ZMRA 4Q2ZB 1CICC 2OQJA 3HFML 5CHNA 3RIAF 1J05A 1NGPH 3VH8B 1NH6A 4UAOB 1RV6X 1LK2B 1TTUA 2D2OA 1U8KB 3P73B 1KJ2H 3EOAA 3BSZL 4RDQG 4IOIB 3MUGB 5AD0A 2DICA 4C4KO 1NC2D 1NPUA 3T0BA 3ARGD 4QHMB 2Z8RA 4OUUA 3TJHC 1FYTA 4HPOH 1VENA 5FKAA 2OCFD 2NMSA 4KPHH 4LCUB 3W5MA 3VXTA 1A4KA 3VFOA 3B9KD 4MQXD 4EI5D 5DEGB 3VGFA 1BD2D 5JDSB 4XH2B 3X3GH 1EHLL 1IGMH 4TSAL 3S34L 2VNCA 1AO7B 1F58L 5I8EB 1PGRB 5DDHB 4AL8L 1XR8B 4Q9RL 3WUWA 1J0HA 1OF2A 4WV1B 5ALBH 3TA3C 1N59A 3FQRA 3BKJL 3C8HA 4P2QD 5IIEB 2XA3A 2FATL 5A43C 5I76B 4AENB 3FN9A 1ZLWH 3WDJA 4M7LL 5TPWH 1A21A 1ZS8A 1KIQB 5FF6A 3JWDL 2HRPH 1F8TL 3F6LA 3F7RA 4DGVL 1NMAL 3LIZL 2H2SC 3IU4L 4EUPG 4GH7B 5HDBE 3IDIB 4Y19B 3UYRH 2N7AA 2JIXD 2A2QT 3LH2L 3P30H 4KTEL 4RWHA 1DLFL 5TQ2L 1F3DJ 1GJIA 1LD9B 5JXEA 4ONGH 4PJ7E 1TNMA 3MV7B 4OZFG 4NZDA 4JFXB 5A16A 3LKOA 3CCHA 5DQ9B 2DKMA 2HTKD 1R5VA 5I8CA 1PVHA 4YBLB 4HT1L 4IRJC 5CJXC 5LXGH 1A7OH 1YZZA 5D71L 4X98A 4M5YH 1S7VB 2ITDB 4TTDD 4NZUL 3VWKA 5EU6E 5D72L 4ODUA 4TUKH 5EOCL 3MCLL 4PLNC 1ZK9A 2NY5H 4FHBD 2EE2A 1A7NH 5DJAA 5ISZE 2XWBB 4JDZA 1MOEA 4YHZL 3HNSH 3MLSL 1A1NB 4K2UL 2YZ8A 3NCEB 3MUHL 5DR5L 3ET9F 5GS2D 1NFKA 4C83A 3FQNA 4E42A 1A6TB 4J3VA 1HYSD 1BZQK 3B3IA 5E70A 3U30C 4WU5B 5GIRA 5C86A 3GM0A 5E5MA 5A3ID 2ICEB 1AJ7H 4L1DA 4NN6C 4DGIL 4NO2A 4XNQA 2HT4C 4LSQH 4YIQA 1MRFH 5D6DC 1FVDB 1JVKA 1AGBA 1L9MA 4LMQE 3GNML 5ACZA 4APQB 3F7VB 5D96B 1N5YH 2HVKA 4KY1H 3D6GA 4FZ8H 1Q9WB 3HI5H 4DUXA 3RVVC 3LEYH 1BVLB 3WFEL 1EEZA 1FFPB 5D5MB 1G7QA 3IAPA 3O3AA 2ITCB 5HI4D 3CLFL 1P4LA 5ETUA 2BOBA 3KYKL 3DO7B 3VD3A 3QO1A 1P69B 3BYYA 1IAOB 3RNQB 3RWEA 4V2BA 1U6AL 5C0BD 1I7ZB 2VLRB 3CSYB 3QUXD 1BAFL 3DTXB 4GXVH 2NXZD 2V9RA 3AS2A 3MJ9A 3RPIA 3KNBB 4PJCE 1MRDL 3FT4B 3PGFL 4F9PC 4OV5B 3NZHL 5JW4M 2BHYA 1XFPA 3VXRE 5DGRA 1HH9A 4L8DB 2GHWB 4DVBA 5HHQA 4FFZH 4GRLA 5FYLL 4HV8B 4LCWB 3V79C 1P5VA 2VITB 2EC9U 3QIWC 1QA9B 1YECH 1VFAA 3KPRE 3BUYA 2JJUA 2EIBA 4GFTB 4WW2C 3PHSA 3HFMH 4OZGE 1YDPA 1ZSDA 2OLDA 3ZTNL 4UILL 4JM2F 3ARVA 1S7TA 5F7EL 1N6VA 4HJ0C 1AQKL 3BDXA 3BSZH 4S2SB 3MRDA 1MWAA 4KK8C 5E4EC 1BEYL 2C9AA 5MERA 4HK3J 2ZJSL 5IJVA 4TSBL 1B88A 8CGTA 2YWZA 4DTGL 1KB9K 4X7DC 1EHAA 2BX5A 3ARED 4NHUA 1H3PH 2A6KA 1MFEL 3B5GA 3U9UB 1EHLH 3QUXB 4TSAH 3S34H