4FQQB

Crystal structure of germline antibody pgt121-gl fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
232
structure length
227
Chain Sequence
b'QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTQQGKRIYGVVSFGDYYYYYYMDVWGKGTTVTVSSASTPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 227
sequence length 232
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqB01
1CIUA 2CH8A 1EFQA 5K9KB 4P5MB 1BIIB 2F19L 5GS2H 5IBLC 2NNAA 3TBYA 3OKLA 3UTQA 4PJ8D 2PW2B 1EBPA 5JOPD 4A6YB 4BKLB 3GHBL 4X6EB 4XVTL 4JB9L 1P4BL 3AGVA 5EZOL 3U48A 4ZOEA 5K9OB 3NAAL 3CGTA 2YRZA 1N7MH 2AEQL 1A6VH 4IDLA 5JOFA 4G6FD 2VH5H 3T4AA 3O3EB 4X7DC 1VFBB 4HT1H 3AAZB 4IRZL 2IG2H 1ZLUH 3DVFA 2ZSWA 1Z9LA 2DAVA 2X7LA 2BCKA 1MQ8A 4N5UA 1GZQB 3S35X 4WFFD 1MIMH 1JNHA 1CD1A 3CD4A 4JFFD 3VMPA 3F5WA 3L3OA 2G2RB 4K55A 4KROB 5ACMA 1XF2B 5HD8D 4KK5C 1KCUH 3LD8C 3TBSB 3S88H 1NDGB 3X11B 3LZFL 4MS8D 5FGCE 4IJ3C 3HMWL 1ETZB 5DHVA 5LG1A 1JIBA 2D9CA 3V0WL 5ERWB 1PX4A 3EOBA 1S7SB 3GSVB 1YEFH 5DMYA 2Y5TA 3FQUA 3TFKC 1CU4H 2EZ0C 3G5XB 4P2OB 1K3IA 1G0XA 4FQHA 3AREC 2V7NA 4XAWL 5E24E 3NPZB 4W70A 5C0DA 1FAKT 4P4KD 3N50A 3BSZL 3MLRL 2EXWD 2C3GA 3AREA 3LMJH 2HTKD 3CDGB 1Z0NA 3MCG1 1XF3A 2OJZL 1G0DA 4OGXL 4CMHC 3GK8H 5BO1H 2EEBA 1S7UA 2WWKO 4GSDH 2Q76B 1R3LA 5FGRA 5SWQA 5IMKA 3T0AA 1A7BA 2HVKB 1HH9B 3ARBD 4LSSH 5C3LD 1AD0B 5MI0B 4FTVB 1KTDB 2EDOA 3I6KB 3LN5A 4YHMH 5IKCA 4NQVB 2ICWI 4G42A 4ODBD 4JGMA 5EORL 3N85H 3ARGC 3EDEA 5IJVB 1MLCA 3OGOE 1MVFA 4OKVB 4R97C 1PJ9A 1P7HL 4PTTA 4BUHA 5I1AB 1ZLUK 1AGCA 4ORZC 2LABA 5DRXB 3ARGA 4C54A 2K3TA 3KGRA 3UO1L 4QY8A 3K8LA 1KPRA 2OMBA 3AXLB 3AUVA 1DEEA 5GGUB 2HJFB 2ZPKL 5IB1A 1OAZL 2ENYA 5DUBB 5DMKB 1Y18B 1RIUH 4LNVA 1N0LA 5JORA 3TM6A 2D7NA 5EO1A 1JMZA 1GOGA 1YMHA 5HVWA 3V8OA 1EGJL 3CUPA 1GPOH 4P3CH 2D7PA 3JVGC 1JI2A 2VUYA 5BRZB 4HF5L 4NM4L 3NN8A 1YEKH 5DD6B 1NLBH 4X6CF 4O02L 4IDJL 4PTUA 1U3JA 2YSSA 1QLEH 4AG4H 3UTZA 1D5IL 2ZSVA 1ZT7A 3JVGA 3QR2A 1AFVL 3MLSH 4YFEA 1BD2A 4Y5VB 2XPGB 2B7DT 2CD0A 2VXSH 4U6YB 3SQOL 1S8DA 2CLZA 4LQFH 1DP0A 2VDNL 3FFDB 1XR9A 4FQLL 4P48A 1ACYL 2D7TH 3GSUA 3BZ4B 5TPWH 4X9BA 5GSRB 5I66A 2AJYL 1MY5A 4PRIB 2D3VA 4F58H 2VXTH 4ONGL 4WU7B 1YY9C 3QEHB 5DFWH 1AJ7H 2XYCA 2DLGA 4QYOA 2DQHH 1TENA 4MJ5B 2DQFB 1VFAA 2XI9A 1UADC 5TE7H 4OZHF 5HYJA 5EUKB 1T22A 1BLNB 3OV6A 3QUKA 4HIHA 35C8H 3U4BH 1VB9A 2H2SC 2GEEA 4JFEE 2FBJL 5CUSH 4M93C 3SE8L 4G6JH 4XCYA 3VXNA 1YA5A 3BW9B 5ISZE 4U05A 4WIQA 2HT3C 1A3LL 25C8H 5I1KL 5E7BA 3C60C 1GZPA 4PJBE 5GS0D 3U1SH 2VLKB 3FQTB 4XXDB 3DO7B 4ZFOB 5GHWL 4OLZH 4JO1H 2FNBA 3C60A 1UJ3B 4M43L 4NHUA 3T0EC 5DJDB 1NUNB 2F54D 2A6IB 2W0FA 4GAJL 3HZMB 4PRHD 4LLUB 3I6LE 3RVXD 2NW3B 2Q87A 3MV01 4X5XB 4F7TA 1JNLH 4XRCB 5E5MB 5EG6C 1MHCA 5ID0B 3T0EA 4X9GA 2CDEB 5T5FH 1EO5A 2EYRA 5IFHH 3EOAA 5SWSD 1A7PH 3QQ9C 4HLZH 4YHPA 1YQ2A 1JV5A 3BP5A 4K3JL 4LAJH 3MLZH 3G6JA 4WFFE 4KTYA 5L0QB 4GKOA 1KJMA 2FIKA 4JFFE 3IF1A 4EI5D 4WNQA 1XEDA 3RHWF 4XZUA 3U0TB 1LGVA 4NKDB 3PE9A 3TGXA 2OTWA 5FA3B 3RL1A 2NY0B 3E6FA 1YEDB 4PG9A 3FT4A 5FCUH 4KKNA 3U7AA 1P4LA 4OZGF 4MCYB 4L29A 1G9MH 1IQWL 3BWAB 1OL0A 4JY4B 1TVDA 4UBDC 4F57H 3F8UB 2HJLB 1NFDF 2Q86A 1RUMH 2J8UE 3CLEL 4O51A 5H94A 2A77L 2L7UA 3W5NA 3O0RL 4GXVL 4GKZB 4O2EB 4BH8A 4HG4J 4PJ5B 2P5ED 3LOWA 1YEJH 5TE4H 5ANME 1KCVH 2MWCA 4GS7C 2WV3A 4PV8B 3SE4C 5D1XD 4Z77A 1DEDA 5E95B 4ZUWA 3L3KB 3L5IA 3P77B 3Q6FB 3BH9A 4YHZL 3G08B 3LQAH 5B4MD 3KJ6L 4QHNB 5DURB 3KYNB 4PRBA 3SE4A 1KGCD 4HPYL 5KS9F 1NGXB 3BPOB 3UTTD 5CP7B 1MJJB 3RDTD 4NN6C 3D39A 3HCVA 3IJHA 3RRQA 2EYSB 2ZOLA 2FHFA 4RFNB 4D2NA 4JY5H 5IHUL 2W60B 4G3YL 2ED8A 1NCTA 3VH8A 5HGDA 2HLFC 4KRNA 2Z4QA 1DQMH 1RJYB 4V1DD 4FP8L 4LLVB 2AXGA 3V2AR 4UT7L 3HRPA 5HPMA 1OP5H 2EKSB 1UQSB 2IADA 3DXAB 1RD6A 3MCLL 1AE6L 2VE6A 4K94L 3ZKNC 3LAFA 4YUEL 2CIKA 5EBWA 4U6HA 5F6HI 1U8NB 1EPFA 4LPUA 1IZKA 3H0TB 3SPVB 3VXOB 4GAGL 1H3TA 4OGZA 3VE0B 3FOMB 3VCLB 2VL4A 1IGFH 4L3AA 2BNRE 1CI5A 3IT8D 4CUCA 1NFKA 5EUOA 3QWRD 5FHBL 1YPZE 1T80A 4FQXC 3C5JB 5EH1A 4X6DB 4ZFZB 3WBDA 4MAYC 5CSZB 1NANI 3FL7A 2FJHB 2N7AA 3FJTA 4BSWB 4YHYB 5CBAA 3WD5H 3FO2A 3RIAK 4JZNA 2HMIC 2BNUB 1Q9OA 2GK0A 4O58H 4Z7WF 4FQXA 5LGJA 3DO3A 4MAYA 1UACH 1OAKL 3QUYC 1KEMH 2FL5A 3WO4B 4GRMA 3D85A 5ESAB 2FECL 3BKYL 3NIGE 2WQ8A 2ICES 4ZXBD 1SJHB 1WAAE 4NO5B 1NGQL 4LMQI 3F58L 4NM8L 5FYKH 4N0RA 3BHBA 3QUYA 2QQLH 3GSOA 1H15B 4BZ1L 4HUVA 1HHKA 3CFKA 1A1NA 3HNTH 4FMKA 4NKMB 4UTBH 3QI9D 3SE9H 4ZFGH 1KELH 1EAPA 4M4RA 3W0WD 4PJCE 1PKQE 4OF7A 5I76A 4CMMA 4JFZL 4XP6L 3DRTB 3QJFA 4ZNEE 4PJDE 3VFUB 4LLDB 3WUWG 4XMKL 1EMTL 3IGAB 3DUSA 1AGFB 1WZKA 2AJSL 2P5WE 2V2TA 2VWEE 4KY1H 5GGTH 2R0ZL 1HH6B 1H0DB 3QPXH 5HGBA 1S5HA 3EYSH 4HW6A 2BSTB 1P4BH 1OP5K 5DJ6B 5F9JB 1LVEA 3FMGH 3KPPB 4L8SC 5KJRL 4MMZC 4WW1A 1F11A 1FJ1A 5KSAB 3OJDA 1ITCA 3F12B 1QSZA 4IMLA 5E94B 3O41B 2NX5E 2E9WA 5J12C 3PWNB 4L8SA 5D4QA 3RIAF 3QEUB 4LSUL 4NO0D 1VGKB 3UTSD 1TXKA 1OWRM 2GJ6D 3OXSA 4N0FB 2A38A 4ETYA 4GUPA 3BQUB 1DSFH 4XCEA 4LKCA 4MDIB 3SE3C 4K3GA 5C0CE 2YS4A 5BZWB 2B5IC 3HI6L 3MODH 4LLAA 4MD4B 2EDJA 6CGTA 5FCSH 4E0RB 1TMCB 3ILQC 4P9ML 4O00A 4ZUVA 1H3PL 3SE3A 1YC8A 1FPTL 5I1EL 4JRXE 2F9BT 1T6VN 4KVNH 5C86A 3MV9E 3UZVB 2UV3A 3DUUA 2DIBA 4H25B 3KPRD 2GIYA 2JJVA 3MV8B 1I1FB 4I3RL 3S4SG 4LCYA 4TQEH 2BVUA 4YJZL 2AV1A 5SWSE 4YNYA 1D5XB 2IBGA 2CLVB 4XNZC 5FGSA 1VKXB 1FFPB 1HI6A 1E6JL 4ESKA 5JPNB 3ABZA 1A5FL 3L5WB 1FG2A 1NAML 5FYLD 5HY9B 4G6ML 1EXUA 3I9GL 3IDGB 3QO1A 3QDJA 4PJFF 3LSOB 1FVDA 1OSPH 4MNGE 1JHLL 4U1IB 3MGTB 4E42A 1B0RB 4PJXB 3UYOD 1W0VB 4K2UL 2JJWA 5A3ID 1VACA 2X44D 3PJSB 5E00B 4L4VB 1K9TA 4K3DH 5L8JB 2CRZA 4KHTH 4QGYA 1M6OA 2NZ9D 2VXQH 3CC5B 3AS2A 1A6WH 5FF6B 1CIDA 3O8XC 1DANT 4ELME 2B2XL 1WWCA 2BSED 5C0BD 1FL3B 1HXMA 1RUAH 3QAZC 4HZLA 3B6SA 3QUZD 4M8VA 1KV3A 1BFOA 3KPOB 2BXYA 2D2OA 2O5YH 4MYWB 15C8H 1AO7B 2HFFA 2X89A 2ZPKH 1I9JL 1G6RL 3O8XA 1JWSB 5CGMA 1CL7L 2HKHL 5I2IB 3ROOA 4DCQA 4HS8H 1KGCE 1MCFA 2DWDA 3MLTB 3MRQA 2AJVH 1JN6A 4BA8A 4ODWB 1IAIL 5FOBA 4WENB 1ZAGA 3MRPA 4ZS7H 3RTQB 4M1DL 5DWUL 4Z76A 4LCIL 3G5YA 4WFHD 4X4XB 3QQ4A 2DLIA 4GAFB 5FM8A 3MXVL 4KTDL 4V1DE 1SJEA 2V9QA 2QQKL 1OY3B 4Y2DD 3MJ8A 1HHGA 2SEBA 2XTJC 43C9B 3QCTH 3VD5A 1MCNA 3WIFB 5F9OH 1KLUA 1N4XL 2HT4C 3UJJL 4WGVB 1R3IH 4OZ4A 1YN6B 3GSWA 3GB7A 3LKQA 5BOZG 2A0LD 2O5XL 4WTZA 1BX2A 1CYGA 4K23H 3MR9B 1A2YB 5DFVC 5I30L 5JHLH 1YC7A 4KAQH 5JO5B 3THMH 1LE5A 3G5VB 3D25A 5D2NE 5F96L 4LARH 1H3WM 3BZEA 1X7QB 4HMDA 1ZGLA 1OTSD 1UEYA 5ESVB 2A9ML 1VERA 3IU4H 1P7KB 2EE2A 4O9HL 1CBVH 1T66C 4L3EA 1RURL 2YA1A 5D5MA 2ZG1A 1PX3A 5D72L 1LK2B 2UWEA 4OD1L 5ITBL 4UV4L 1RZJH 3MGOB 4M6OL 2ICEB 4Q7DA 1AH1A 1AC6A 4Y19A 2XQBH 1TJGH 4JPWH 1Z5LA 2IFGA 3QUML 1P1ZB 3V8CA 2R4SH 1U8LA 5I8CA 4TUJB 5F7FA 2CRIA 1T1XB 5J3HC 2WIIB 1WZLA 3QULA 4TNVF 3MRKA 1JWUB 2R0WH 1WC7A 4JPKL 2ESVB 1A3LH 3V5DB 5I1KH 3JWOH 5GRXG 4XB7A 3IFOA 3BVNB 2Y6SD 3ULVD 1U91B 3MJ9H 5GRUH 1NC2B 4G8IB 3TZVD 2NTFB 2YK1L 3FZUD 3VWKD 3KLAA 4HKXB 3FRUA 3T3PE 2H8PB 4PUBL 2ZZUT 3WHXA 4AEEA 1T7ZA 2YD6A 1BFVL 4TUKL 3BYYA 2XOTA 4DGYH 5KN5B 3WSQL 3V4PL 2E27H 1FNGB 4A2MA 2EO9A 1P2CA 1I3GL 1MHHA 1WCQA 3FO0H 3STLA 1OARH 3NA9L 4HBQA 1UXSA 3BJLA 4GRLC 3D48R 4LPVA 3BP7A 5EO0B 4LIQL 5LCVL 3GIZH 4P2QD 5DVKA 5GRWA 4N9GB 5IVOA 1EGJA 3Q1SL 1U0QA 2CKBH 4C4KO 1KYOK 1ZMYA 4AQOA 4E41D 2ARWA 3D0VB 3BGMB 4MNQB 4QRUA 2DQUH 4DQOL 1RY7B 3IDJB 4KMTH 4YAQA 3DETC 3RJQB 3WIHH 1ZEAL 5I1DA 4D3CH 1WBXA 1S9WB 3BESR 5DEZA 32C2B 4Q9QH 4YBQD 3VFSB 1ES0B 1I7RB 3O4OB 1N3NB 2WAHA 5D2LE 4OV5A 1M71A 1BBDL 1FGNH 1JHKL 3CXDH 4HC1L 2K7PA 3EIFA 4PBXA 3KPRE 1RZJC 5HHQA 2ZUXA 2H26A 1RZ7L 2YKLH 4ZTPH 3WLWC 1ROWA 1IQWH 4NUGH 1AD9B 3GUTA 5DRZA 4N8CL 3HZVB 1QBMH 2FSEB 3CAFA 2NY4D 2DQCH 5IB4A 1A6TA 1IILE 2XRAL 3O2DL 5CEZD 4ZPVA 4HAFA 4GG8A 1P7QD 1Q9KA 3H3PH 4K3EH 2XA8L 2VLRA 1FE8L 3OGCA 5IROC 2AK4D 4NKOB 4MCZA 3MLPA 1L0XA 4CBPA 2R0LH 4XGZA 2YPVL 1KULA 4WHTA 1MIEH 5C0GB 2VZVA 5IROA 3S5LA 2GTZB 3BUTA 1F6AB 4OFYA 4LSRL 4PJHA 2I9LA 3O11A 2VXUH 3DI3B 1J11A 2R1WB 1ZHBA 1YJDH 4MVBD 3LEXB 4HS6A 2V7HA 4ODXA 2NPLX 1N6VA 3NACH 1X3DA 4LRNL 1ZLVH 5A1AA 4LLYA 1SYVA 3QQ3B 3MRFB 3L6FB 5CIPH 4KZDL 1QLRA 2NY6C 2IAMB 3HA0A 3BPLC 3W5MA 1IAOB 1OW0C 4GW4B 1WT5C 3CFJB 3TT3H 4RMQA 2NLJA 3OSKA 4X7TB 3WS3A 1ZA3A 2CDFA 3CMOL 3M1BA 4HH9A 5I1CL 3QA3B 4ZDHB 2FX7L 1R5IA 1OW0A 5F8QC 1WT5A 3R1GH 2C3XA 4ERSH 3LH2H 2GJZB 2YPLA 1AKJA 1K5NA 2ZKHH 5T1LA 4KI5C 4Z8FH 4RMRA 1NCDH 4HDIB 4HBCH 4I9WD 3HNVH 2PXYC 1U8MA 3MA9L 4PGBB 4RDQG 2OYPA 1FC1A 3S6CA 2WBJD 3LDBB 1D6EB 4Z7VA 1SJXA 2VNCA 1NGQH 2V5YA 3AMKA 3UZEA 1CLYH 2GUOA 1J12A 4OUUB 4EUPG 3KS0H 1A6ZA 2PXYA 2B4CL 3DVNB 1K6QH 1XGRA 4YZFE 2AS5M 5C70A 1LNUB 2EE6A 1HKLH 5D1ZD 5C8JA 2YD8A 2DTML 4HWUA 2Y36H 3BE1H 4XVJL 4JZJB 5IFJA 1ZANH 3PXJA 4KU1A 4P2CG 3BP6B 1MWAB 5I1IL 5EZIH 4CRPA 4YEFA 2JCCE 3P9LB 3H3KA 4M3JA 3T09A 2JB6B 2HH0H 3T0WA 4Y88A 1GGIH 1GC1L 4B7IA 3ILPA 3Q5OA 1FH5L 3OKNB 2NY2C 3PGCA 3VXMD 3ZDZE 4A6YH 3MRGA 1ZLVK 4RMVA 4Y5YC 5AYUL 2Z8SA 4WEBH 4DVBB 3RNQA 2VMFA 5ISZB 3CMGA 5TGBA 2O5ZL 4K9EH 1PSKL 3EOTH 3ULUF 3RUGE 2LTQB 2A83A 4KK6D 4PJBB 4LSQL 4Y5YA 1QSEE 5EU5B 1A1MA 4S1SL 4OZFH 5EBMA 1XFPA 5DC9B 4KZEH 1EFXD 3CFCL 1QOKA 3BKJL 1FVEB 4K94C 4I8DA 4OLUH 3JZ7A 5INDB 5EU7C 2DICA 3OAYH 1LDPH 5H2BB 2PKDA 1OHQA 5JDSB 5E9DB 2IH3B 4YIQB 4C4KT 1A6AA 3WNKA 4G6FB 1S7RA 1DJSA 1TVBB 5DUPH 3B9DA 3P73A 3ARRA 4TN9A 3DHMA 4O2CB 4RMUA 3RVWC 1PY9A 2ITDB 5E2UH 4OCXL 1CE1L 1TVHB 5TH2B 1FNEA 4I3RH 5T1MB 2EC8A 2KZ1B 4P2QE 1NLDH 3HI1B 4FQQB 4R26H 1J0IA 5KVDL 5ACZB 3NGBC 4O2FA 1CGSH 1PQZB 4TRPL 4N0CC 2PW1A 3EO1B 1DBJL 1CFTB 4E41E 4YFDB 1BECA 4U1GC 2H1PH 2BY3A 2CDGA 2CIIA 3C08L 1J05A 4L9LC 1ZGLM 4OCNC 4Y5XC 1GOHA 3FB8B 1S9XB 5F9WC 4MZ2A 5IBTH 2F53A 1GHFL 4TSBH 3HE6C 2OS7A 3QEQD 4P23D 4U49A 3S34L 4Y5XA 1KTLA 2VN4A 1FLRL 5ADOH 3GO1L 4I48B 1FLTX 5ICZA 2I5YH 2FJGA 1K4CB 1KG0B 4S0TD 1DBMH 5TF0A 3CNKA 4YDKL 3D1MC 4LMQE 5DUML 4P4KB 1C8PA 1KFAL 1QRNA 5ILTL 4LGRB 5ANMB 1G6VK 2CO7B 4M1CD 4XMLH 5K9KA 4BM7A 4BQ8A 4WDIB 1I1CA 4RRPG 4H8WL 3MRNB 3PNWB 4EIZC 5F7DB 3ZDXF 4X80L 4JFDD 1R24B 4P2YA 2AK4E 4K9EC 3OAYK 2PW2A 5DD5L 4BKLA 2BHUA 2ITCB 1MRDH 3DHJA 1BBJB 1EEQA 3ARBB 3DX6B 3LEVL 3K2UL 1VGEL 5F3BA 1T0PB 4QXTB 4FXKB 1RUQL 2NMSA 4ZQKB 2LU7A 2AJXH 5EN2A 3MQIA 4BZ2L 3O3EA 3MXVH 1VFBA 3R0NA 5A40E 3HUJF 1B0WA 4YXHH 3HB3C 3MNVB 2VR5A 1Z2KA 3AAZA 5DMGD 4KROC 5FGBC 2KQNA 4PJ9D 5FB8B 1S3KH 2X9WA 3T8XA 4DJMA 3I85A 3QZWA 4OCRH 1MNUL 4HHAB 3HC4H 1F3JA 1GZQA 1EJ6A 3O3BB 1OB1B 5IQ7H 2P24B 3VFWB 4DVRL 1G7JA 2BNQE 5HI4C 1NAKL 2G2RA 1TPXB 3N1MC 3RPIA 2O5XH 5FGBA 1QPPA 1JVKA 3HE7D 3TBSA 4KPHH 4D0CB 1NDGA 3X11A 4P2OC 3E2HB 1G7PA 4J1UB 4QTHB 4H1LB 1X5YA 3VI3F 4IRJD 2IQ9L 3BT2L 4GOSA 4R6UA 5BW7C 1N26A 4FFVD 1MJ8L 5ERWA 4O9HH 3HLAB 1S7SA 3GSVA 3VXRE 5JXED 1KCRH 2EIDA 1BVKB 3C6LC 3G5XA 2JJSC 3ZO0A 1MFDH 1XGUB 3ZYIA 3WKNA 1K8DB 5BW7A 1NCWL 1ZT1B 3P40A 3V0AC 1AQKH 1L0YA 4WHYH 2B1HL 4I9WE 3TA3D 4JDZA 3C6LA 4D0BB 3QHZL 1URLA 4YC2B 2XKUA 2XACC 2JJSA 3CDGA 3ZTJH 1BVLB 3ZLQC 3WUWB 4LGSB 5A16B 5MI0C 3KPLA 1IBGH 2YN5A 5HI3D 2Q76A 3B83A 4PJCB 3TO4D 2DQIH 1LEIA 1A6UL 4JKWA 2EDHA 5FUOL 2HVKA 1HH9A 4X8JB 1S5IL 1UCBH 4PJDB 3I6KA 5DC4B 3P3YA 4NQVA 5CBEB 3EYUL 5FYJL 5L6YH 2JK5B 5IJVA 1JRHL 4YHKH 4OF8A 4OKVA 3H9SA 1IGTA 1BF2A 4WW2B 3RI5F 5I1AA 4NSKB 5DRXA 5CGTA 1NUGA 2AJUL 4WFED 3MBED 1FZKB 1TJHH 3AXLA 3P4MB 4S1RL 4UQ3A 2Q3AA 4Z7OE 5GGUA 4HLJA 4CU6A 1G6RA 2HJFA 2DL2A 1F4WH 2CLRB 5C0IB 5DUBA 3S37X 5DMKA 1B2WH 2HJKB 1Y18A 4JR9H 1OP3H 2GW5A 4GRWE 4LIQH 5LCVH 3CH8A 5INCB 1L7IH 1C08A 1MCBA 1KT2B 1QR4A 2V6HA 2DD8H 5DD6A 3MCKB 4Y5VC 4N90D 2WUBH 4AQ1B 2F54B 5I75B 4QT5B 3BZDA 4WY7L 1MCOL 3S4SB 4KK9D 4PRHB 5EFIA 1OAUH 1XF4B 3TYGL 1E4WL 3PGFH 2YUVA 4M7LH 1KB5B 4Y5VA 4RCAA 2XPGA 3FQWB 1T1YB 5C0RL 1JHKH 3NA4A 4JQXC 5IF0B 4H20L 3T08A 3FRPA 4AK1A 5IESH 3FFDA 2J1KA 3CDYA 3RY4A 3ZT5A 2VYRE 2MQ3A 3EYQC 2ARJB 3BZ4A 5GSRA 2NY3D 5DD1L 4OZHE 4UDTB 5E2TL 4JQXA 4PRIA 2OP4L 5D71H 4WU7A 3QEHA 3O2DH 2ADFL 4EI5B 3P4LA 3NCYS 4DKFL 3QWOA 4NOBA 4WO4C 4UQ2B 4U6TA 2ADGB 4MJ5A 2R1YB 1T2QL 2DQFA 4C56E 4M48H 1NH6A 3WFDL 1KLGB 5EUKA 3CX5J 5DFTA 5F9AC 1BLNA 4WO4A 1KN4H 3GMMB 4EJ1C 4JQVC 5FO8B 4MJ6A 4FXLA 1A0QL 5IOPB 1R5WB 3STBA 4MD0B 4KRPB 1OP3K 2P5EB 2P49B 4JQVA 1AR1D 1UJ3C 5BCAA 4UIKH 5D1XB 2XIDA 3MRIB 5E5RB 4LBEA 4U33A 5AUMB 2DLTA 3BN3B 1QTYT 3O6LL 1C5DB 1SMOA 3F7YB 4E5XB 4XXDA 3DO7A 3U4EA 4ZFOA 2FCBA 4JFDE 1NBZA 2OR9L 1CVSC 4KJQC 1UJ3A 1W2KT 1LP9F 4NQCD 4S1DD 1R5VB 2A6IA 3UTTB 1KNOB 3RDTB 2FD6L 3HZMA 2F5AL 4L5FH 4LLUA 4F15B 2NW3A 3LRSA 2CGRH 3WFHB 4BK5A 4X5XA 2UZIL 5E03A 1QZ1A 4FS0A 2N1KA 5FKPB 4PBVC 4NZDA 5JQ6H 1REIA 4V1DB 5ID0A 5KBNC 1CR9H 1PDKA 5JIHA 3QHFH 2CDEA 3EJZC 4KFZC 1T5WB 5L8KB 4NYLB 5LWYH 4Y4FC 1KCLA 4IOFC 2C1OB 3B4NA 1XIWD 4NO3B 4JN2B 4NC1E 3RZCD 1Q8MA 3KPSD 3GBNL 1N8ZB 5FXCH 3P11H 5F6IC 4OZGE 1WVZA 1BQHG 3QPQD 4Y4FA 5JIIA 1HILB 1F4HA 4FZ8H 4NKDA 3SQBA 5DVLA 1XF5B 3RWFA 5L2KD 2Z0BA 2FEEL 5FA3A 4Y4KC 1T0MB 4XPAL 4HC1A 4JAMB 3GRWL 3BFOA 1E4KC 4MQXD 5CZXC 1EEZB 4MCYA 1W8NA 4H88L 5JTWA 3AROA 3BWAA 4JY4A 4I3GA 3BRFA 1MWAL 4Y4KA 2HJLA 4HFWB 1QFWM 2I27N 3CPLB 1BVZA 2FEDD 3O2DA 1E4KA 4H0HB 4GKZA 2CRYA 4O2EA 5CKAA 1ZS8B 4ZXBB 4PJ5A 1NCAH 2W9EH 1ZVSB 1AIFB 5SWZA 4FNLL 4PV8A 3DV6B 3QDGD 3CFDB 3L3KA 1YY8B 3KHOA 3KS0J 3P77A 3Q6FA 2Q20A 3RPKA 3E6HB 4WWKD 2UVEA 4F8TA 3K3QA 4RFNC 3QFJD 1TNNA 1J10A 5EOCL 3B2UD 1CTNA 3N9GL 3TWCH 3W0WB 4QHNA 2PUQT 2O61B 4NNXA 2ZNWA 4MLIA 1NGXA 1JHTB 3C2AH 4M5YH 5CP7A 3A6CL 1MJJA 2VISB 3HI5L 2FATL 4OD2B 5B21A 5IVXE 5FFLA 1G7QB 2EYSA 1Z9SA 1AI1L 4QXUL 4LRIC 2ICWB 2W60A 4LEXL 5KAQF 1IC4H 4OJFH 4IOSD 4PJIB 1CICD 3SJVD 4OT1L 2CJUH 3OB0H 4Z6AT 1UQSA 3CJJA 3DXAA 1X44A 5J11B 4PRPD 3EZJB 4APQD 1KJ3L 1FAIH 3U6RB 1U8NA 1GGCL 2X4SA 3H0TA 1OAXH 3C09B 4YHYC 2X4UB 1DQDL 3VE0A 3ZKMD 3KR3L 3VCLA 4QTIL 3G6JF 5E1AB 2Z91B 1A22B 4NO0B 1CE1H 1EO8L 3UTSB 2WWMC 5KVDH 3C5JA 2GJ6B 4X6DA 4ZFZA 1J7VR 2VAAB 4X7CC 3VFMB 2FJHA 2J88L 2YD5A 3WXVL 1RFDH 4BSWA 5C0EB 5DQJA 4HJJL 3WO4C 5JZ7D 1T83C 1T5XB 3PF2A 4N90E 4YGVB 4J2XA 2BNUA 4RGOH 5ALBH 5I8KL 5C2UB 1NBVL 1SY6H 4QO1A 1B90A 2IPUK 2VC2H 2JLLA 2KKQA 5F21B 1MJUH 1G7IB 1IGCH 4YXLL 2GKIA 1T83A 5ESAA 5E8NB 3SGEH 3U82B 2J5LB 4PYHA 1N5YL 3O6KH 1BZ9B 1BM3H 1SJHA 4KUZH 4NO5A 5J9PB 4D0DA 4R4FH 2PR4H 5F1IB 3W9EB 3QCUL 4B7LA 4KDTC 4ONOA 1H15A 5B39B 5F7KC 2HN7B 4DN4L 4NKMA 3BGAA 4OSUL 2P8MB 2AI0L 1NSNL 5IUSA 3N06B 1GC1C 4HLZG 2QQQA 1H3GA 4DW2L 3DRTA 4KDTA 3GGWB 2RGSA 1D6VL 3VFUA 5ID1A 2BK8A 3QSKB 3LS5L 4Q97A 4NHCH 3RBGA 7CGTA 3QIUD 4R3SA 5IMMB 5KSAC 2FB4H 4QOKE 4OCWH 4W6WB 1HH6A 1H0DA 4JRWA 2BSTA 2KH2B 3O45B 5DJ6A 3KPPA 1JTTA 2W92A 1RUQH 3RIFF 1MF2L 4XPFL 5KSAA 1I7TB 3U46B 3F12A 4AL8H 5GJSH 2EE3A 3BQUC 1J8HD 4Q9RL 1J1OL 5E94A 3O41A 4I0PC 3U0PB 1RUPL 3PWNA 5IBUG 1MCWM 3BO8A 3WLBB 3QEUA 5C0BB 5ICYA 4P3DB 3C8KB 2A1WL 1CK0H 4X98B 3HR5B 4N0FA 1MFAH 3EYOB 3BQUA 3KXFD 2E5EA 4MDIA 2VXVL 4QWWD 3WYRA 4I0PA 4F7CB 4L4JA 1IAIM 5BZWA 4JKMA 5IM7B 3GBMH 3KPMB 4E0RA 4LU5L 4PJ7F 3E3QE 3MREB 2AQ1A 4MA1B 3TV3L 5LAXB 1A14H 1D9KD 3O6ML 3ALPA 1XH3B 2ZCKL 1CN4A 1H3VA 1FFNB 4AM0B 3S37H 2AEPL 4H25A 5KVEL 4Y2DB 5DO2C 2R4RH 2BP3A 4UNTA 3MV8A 3H9ZA 1I1FA 4XNYH 4PJFE 4EQ3A 3BWUC 1MRCH 1T4KB 1OD9A 4EUPB 4KKCC 1QUNA 1D5XA 1ZE3C 2CLVA 1VKXA 1FFPA 3GI8L 5IP4A 5FV2A 2R56H 4BZYA 1HQRA 4N1EA 4GG6E 1INDH 3HG1D 3L5WA 5D7JC 5DRNB 4QRRB 2VJXA 5HHPB 4YR6B 5HY9A 3MRLA 3IDGA 1T03L 4PJGF 2WANA 3LSOA 4S11A 1QKZL 1UWEH 2XWTB 1L0QA 3MACL 5D7IF 4W81A 2XICA 5KVFH 4HUXA 1JFQH 1INEL 3QXAA 1IKNC 5D7JA 2HKFH 1B0RA 3LHPH 4PJXA 1S7XA 1HHHA 3ARFC 3DOSA 3MXWH 4DZBB 1J0KA 2JCCB 3PJSA 4H8WC 4L4VA 4WTXA 2AGJH 2NW2A 3DX9A 1MAMH 4YHOH 4MXWL 3HNSL 1IKNA 5CHNA 3CC5A 3ARFA 4JPVH 5FF6A 1G7LA 4UV7L 1V5JA 4P46D 2G5RA 4ODTL 5T1DL 1KCSL 2I60L 1FL3A 1QACA 3V79C 5DA4A 5DMIH 1BJ1H 2AJUH 2MCG1 3QDGE 4H0GA 5EA0L 4YXKL 5LGHL 3KPOA 4S1RH 3RUGB 1AO7A 3VXSD 1A7OH 5IB5A 3GSQB 1RZKH 2DQTL 2QR0B 3ZE0E 3RTQC 5MP6L 2A73B 3QFJE 1JWSA 3T0DA 4PY7B 3U30B 4XVSL 1BQUA 3FB6B 3MLTA 3VXUD 4G8GD 3P2TA 4ODWA 1F3RB 5CINL 4LLWB 3TZVB 2P47B 3VWKB 2EH8H 3RTQA 3ZYZA 4G7YH 5GRZA 4XPHH 4X4XA 1TIUA 4ZOAA 5GRVK 1FIGL 4JHWL 4KGLA 4WY7H 3LKOB 4CGTA 4GFTB 5DQDL 3SJVE 1ZTXL 1FCCA 1B4JL 3WIFA 1OOAA 1P9MC 1UZ8A 2FHBA 2CKNA 1T20B 1YN6A 4RGNE 5MEND 1PG7W 1KB5L 3TCXA 3GHEL 2R1XB 3MBXH 1A2YA 4H20H 3WFCL 5JO5A 2OSLB 3G5VA 5DK0B 1P9MA 5HDQH 4XP5L 1TCRB 3L1OL 5LVEA 1X7QA 3IDXL 4PS4L 5JMOC 4E41B 4XHJD 1I4FA 2NR6D 3GFUA 1P7KA 3MFFB 3CX2A 3RU8L 3MLVL 3VGGA 3VFGH 3U79A 4UT9L 4RFEB 5C1MB 1LK2A 3IS1X 3ULSB 3MGOA 2ICEA 1HN1A 4RMWA 4XWOD 4QRSB 3SDXF 3ULUD 4JREC 2F5BH 4PLJC 5GGRB 3NH7L 1EV2E 3NPSB 4OI8A 5ECJE 2QLVB 1P1ZA 3O4LB 2DQEH 3ECBA 3VG9B 5EOQL 4TUJA 1U8JB 1UB5B 3L3GB 3K8KA 2WIIA 1OM3H 3ARVA 5GZND 4CU7A 1XGQB 1DBKH 2D03H 3P0VH 1NEZA 3V5DA 1P7QB 2JIXD 1LK3H 5GPRA 4RGMB 2XWJB 1UM5L 3BVNA 3RVUD 3ZYJA 4JFXB 1U91A 1KEGL 2VLLB 3I3DA 4NRZB 1NC2A 3VD4A 3ARUA 4HKXA 1RZKC 3NIDF 2H8PA 2OR9H 3DNKA 4FFWD 2ZWLT 4HQQH 1CGVA 4NQDD 5T3ZL 2H9GB 5KN5A 4Y8AA 1LE9B 1E4XL 1FNGA 5JXAL 4QHUB 3BH8B 5E8PB 1JGEB 3G5ZB 3EJYC 5F3HB 4JO3L 2RAMA 2WBWB 3X12A 4NGHL 1J8HE 4K8RD 3RKDD 2NY5H 3SOBH 4GJTB 4M5ZL 2WLZA 4N9GA 1L6XA 2IH1B 3ARSA 2X4PA 2BMKB 5IQ9B 3ZMRA 3O4OC 5K9QI 1S7WB 3KXFE 7FABL 4J8RA 3X17A 3BGMA 4MNQA 4R4ND 2E8YA 3VG0L 3IDJA 3QIWD 4KGJA 3HC3H 1CG9B 1RPQA 1S9WA 4ZSOE 4TUOB 1ES0A 1I7RA 3HPJB 1N3NA 2Y4SA 4XPTH 3TLRA 2ZUTA 4BQ9A 4M6NL 1KPVA 1BOGA 3MLUL 2MCPL 4PRDB 4TNWF 5C0FA 1T6WA 2CUMA 2WUCH 5MHSD 1IM3B 1I1AC 5DJ0B 5FO7B 1AD9A 1AP2B 2XZAH 3BXNB 5TQ2H 5GXBB 2VDQL 4IRSD 1XCTB 2FSEA 3FN3A 3OJ2C 1G1CA 2WBJB 4XC3H 3I50L 5F8RC 4S2SB 1I1AA 3HG1E 3RWEB 1EVTC 1TJIH 5GRJL 2B1AL 3U7YL 5I15H 4QRQB 3D0LB 4JKPH 4NKOA 3PV6B 1IJ9A 2HG5A 1UT9A 4HIIB 1DUZB 5D1ZB 3MO1B 2OZ4H 4NQSB 2GITB 5DS8B 1CXLA 4ZTOH 1RUKL 1EBAA 5CFHA 4ISVB 1SBSL 5C0GA 1F45A 1MAKA 4JHZA 2GTZA 5CMAB 2V9TA 1F6AA 2BFVH 5DF0A 1X5AA 2R1WA 4OTXH 4Z7QF 3FO9B 2GJJA 1MI5D 2ORBL 4JFQB 3REVB 3VXMB 3LEXA 1MPAH 2D0HA 2IAMC 4HCRL 2OL3B 3PWJB 3OMZA 2APXA 2NXZB 5LBSL 3OJMB 2FLRT 4ZUSB 2W1NA 3FFCB 3FN0H 1ZOXA 3GZKA 2YMXL 3QQ3A 3MRFA 1KJ3H 3L6FA 3VXSE 3ARZA 1IGMH 3GNMH 4Y16D 2IAMA 1KTKE 2DBLL 3GMPA 1CFSB 3NCCB 3MV7A 4L4TE 1IAOA 2DLFL 4GW4A 4POZD 1EFXB 4NBYB 3VXUE 4F37K 4G8GE 4GXUN 1Q0YH 3H9HB 1TQCB 1SEQL 4PY8I 1JYNA 4X7TA 1X6NA 2VR4A 5DEGA 3PQYD 2QSCH 4XP4H 3LDBC 5DK3A 5FUZH 2X4RA 2GJZA 2DQJL 4LVOB 4FQ1L 5E99L 1OLZA 1S9VA 1INQB 3BPNC 1J1XL 4HDIA 4YXLH 5E8DH 5DT1L 3M8OL 5DLML 4AMKL 4HJ0C 4PGBA 4MQTB 1D6EA 2VLJB 3EO0B 4DKEH 4U6VL 4JZJC 4LLMB 4BH7A 4OUUA 5IBLD 5TF1H 3D6GA 3NCEB 3QCUH 4OZHB 4Y0GA 4JRYD 3DVNA 3BP4B 2VL5B 2YC1B 3GRWA 2AI0H 1LNUA 4QHKI 5FUCC 5C08E 4NRXB 1R3JB 4JZJA 4YX2H 1BQLL 2V17H 4NT6B 3JWDL 3BP6A 4JVUA 1HZHL 5FYLL 1MWAA 3VI4F 4HPOH 5FM5O 2M8XA 3C2SA 3P9LA 4YPJA 3ULUE 4LP4A 5ENWB 1NCUA 3ELAT 5GGQH 5TE6L 3I3BA 2JB6A 5KTEL 3N0PB 3QEQB 4P23B 2JJTC 3ETBF 2LTQC 4AZ8A 5L7XL 3FHAA 4JVPA 4LLQA 2XFXB 5GIRB 3CU1A 4N1CA 3DMMC 5CGYD 2OZ4A 5D7LD 3I2CH 2JJTA 2YEZB 5L88L 2D9QB 2PO6B 1AGEA 3ZE2E 1J1OH 5HHVL 8FABA 1TZGH 3NIFE 5EU5A 4JJ5B 4KK5D 4HUMB 2V2WB 4DTGL 2CMRL 5E8EB 1NCNA 3DMMA 1M7XA 1FVEA 4JFDB 4M7ZB 4RAUB 1MH5A 3OG4B 3HN3A 4OCSH 2QADD 3CSPA 1VHPA 5INDA 2VXVH 5A2JH 2B0SL 5HHOB 4NQED 1S78D 2B20A 3TFKD 5H2BA 3GMRB 3QG7L 1UZ6E 5JDSA 5E9DA 2IH3A 5M7QA 4YIQA 1TVBA 4U3CA 1BZQK 3PV7A 3TV3H 3WUZA 3FQXB 4O2CA 2ITDA 3V7AE 1A4KB 4PJBF 1TVHA 5I8OH 5TH2A 3KYOB 4PJ9B 1T7YA 2CXKA 3HI1A 4FQQA 5ACZA 3IFLL 4Z7VF 2IANB 4MS8C 3H42L 4OD3H 4DAGL 1PQZA 3EO1A 1JWMB 1CFTA 3GI8H 3UDWC 4OZGB 3B2VH 1G84A 1QO3B 3AC0A 3V7AG 2Y25A 3HE7B 1NFDB 3Q3GB 3TPUB 5I8EA 4ZYKB 4F9PC 1MFNA 3ARGD 4IRJB 3FB8A 3UDWA 5HI5C 1KACB 3MACH 5D70H 3MLXL 4P4KC 4Y89A 1AHWC 4NCC2 1INEH 2WQRA 4KJWC 4FQCL 4OB5L 4HKBA 2BVTA 3PHQB 4F9PA 2W9DH 5IT2L 2AXJA 4I48A 2HTKC 3GKZA 4HIXL 1JGUH 4PLKC 1K4CA 1KG0A 5MHSE 1A4JB 2R29L 3W11C 1PW3A 4JJHA 4P4KA 1AHWA 3LEYH 5KS9B 5DYOA 5IW1B 2HTLD 4X8XA 1N5AB 4B0MM 4M7KH 5TDOB 2RCSH 3MGAA 3ARBC 5GQBA 5HGHB 3PNWA 1UYWL 4YXKH 4XCNB 1R24A 1J1PH 1IARB 5IHZB 4XBEL 3TO4B 1FYTA 2DQTH 3HUJE 1BBJA 3ARBA 2X70B 3DX6A 4RA3A 2FH6A 2G5BB 4U4BA 3IU3B 4KRMB 4QXTA 4FXKA 3UCRA 5B8CB 1MELA 5KSUB 3FOLA 4PLOB 5FM4A 3ULVL 5GS0H 2DQDL 3TH4T 1NMAH 2J8UF 1MCQA 1IGIH 2ZUSA 1H8SA 1MI5E 4TVPD 3DLQR 1IM9D 3MNVA 4JHWH 1TPXC 3T77B 2Y06H 1ZTXH 5KVGL 4OCMC 3VI3E 1BJ1J 3MBEB 4TULH 1C16B 2XA3A 1MFCH 4HHAA 3E2HC 5L8LB 2P24A 3VFWA 1FL5B 2Q7YB 4Y4HD 2BRRL 2R9HD 4Z7WB 1KB5H 1YY9D 1WGOA 4WUKL 4GQ9L 4M6AA 4KXZI 3RWIA 3JTTB 3WFCH 3OAUL 3CFIC 4D0CA 4CN4A 3IKCB 1JZ8A 4XCCL 4J1UA 4QTHA 4XP5H 4H1LA 2D7MA 2P48B 2P44B 1C5CL 3MNZB 2A9NL 3HLAA 2EH7H 1JPGB 4NWTH 5JPMA 3MLYL 4MAUL 1TQBB 4G9DB 4OCYL 2DLEA 4YC2C 3IJSA 2V9RA 1XGUA 4DEPB 1K8DA 5FAAA 1ZT1A 1A7QL 1LD9B 5ICXA 3S98A 3IXAB 5I1JL 2A6DB 1GGTA 2HT3D 1EHXA 4D0BA 4NNPL 3C60D 4DUVA 1AXTH 2MSPA 5IW6A 3INUH 1J88A 3WUWA 2FWOA 1YPZF 5EOQH 2NY3B 5D7KD 3UTPD 4BFEA 4G5ZL 1QVOB 4XNMA 1QBAA 2BVQB 1NMBH 3DPBA 1GGUA 2NTSP 3X3GL 2A74B 3FO1B 4U3XA 5CEZL 1MRFL 3T0ED 4X8JA 1LO4H 4WW2C 4HFUH 1UM5H 1KEGH 1GIGH 4Q0XL 3RGVD 4KKLC 1C12A 2R8SH 3N1QC 5TQ0L 2MOVA 3NIGF 5I73B 4WW2A 5EC1A 1WAAF 3C6SB 1NGPL 3TT1H 3QQ9D 1CLOL 3NFSL 3EGSB 2BX5A 1IL1B 3D69B 1FZKA 2ERJC 3P4MA 4LSVH 3MUY1 3D9AH 2CLRA 4NWUL 2HJKA 5HHXL 3TYFB 1YZZA 5EBLB 2VKXA 5F7NC 5I75C 2KQMA 3FTGB 1NCBL 2BSRB 3BKCL 5INCA 5IV2B 3RVXC 5T33H 1KT2A 4NBXB 3QYCA 4GW5B 3U0WH 5AZEL 4L8DB 2XNAB 3DARA 4D9LL 1AR2A 4Y1AA 4NQCB 5CD3B 1MHEB 4RMTA 2F54A 5DC0A 4PRHA 2ILLA 1C5BL 3VU2A 1XF4A 4LF3B 2VZ3A 2V2XB 1U8QB 5E6ID 4UBDD 1CZ8L 3CZJA 1KB5A 3K0WA 1P4IL 1HDMB 3FQWA 1T1YA 2YA2A 3SDAB 3MOBH 4TOYL 4UI2A 5IF0A 4PJFB 4D9RE 1VFMA 1BIHA 4WU5B 4EI5C 4MWFB 1KIRB 2BJML 3V5HB 1XIWB 2ARJA 4MHHI 4LSTL 4JPIB 1ZLSH 5C3TA 1YECH 3RZCB 3ZT6A 1QBBA 2VDQH 4UDTA 3KPSB 4GG6B 4JY6A 4P99A 4RWYL 3SY0B 4TPRH 1V3MA 1ZGLP 4MA7L 3G6DL 4OBSA 2HFGH 1MLBB 4UQ2A 3WFEL 5I71B 4CJ1A 1TDQA 5L2KB 1N6QH 3B9KD 1UEMA 2ADGA 4V2BA 2EDEA 4NKIL 4QRPD 1KLGA 4P4RB 2LV4A 4G8FB 4EBQL 5E56A 2VDRH 4KRPC 2X5PA 5KZCD 4ZMAT 3GMMA 4ACPA 5FO8A 4DN3H 3UYRL 2NZIA 5IOPA 1WBZB 5K93A 1R5WA 3MRCA 4I18B 2DB8A 2AABH 3E8UL 4KUCF 1F2XK 4MD0A 2P5EA 5B4MC 1FNFA 1YEGL 2PTTB 3MRIA 2DI9A 2OL3L 3WS6C 5C7XL 3FAWA 2PYEA 3QDGB 4EOWL 2Z8VC 4FQXD 4UTAH 4R90L 4F15C 4KKAD 4MAYD 5TDPB 4UDUA 4E5XA 4WWKB 1VFOA 1A21A 3QFJB 3WN5B 5J13B 1DDHB 2QQNH 4FZEH 4QHLB 3D85D 3TIDB 5C09D 1BD2E 2WP3O 1ZVYA 3PP3H 2HMID 3WS6A 1R5VA 3UTTA 3LV3B 5IMLB 4PGJA 4LNRB 5FK9B 2DLFH 3WNPA 3UXFA 5GRYA 2J3SA 1T7VA 3WFHA 5FHAH 5FKPA 5IHLB 1GXEA 3IAGC 4TVPE 5ITFB 1BAFH 1CICB 3SJVB 2AJ3A 4J3XA 5J1TC 1WITA 4ELMF 1T5WA 1N7ML 1U95A 3NCFB 1DCLA 1A6VL 2QKIA 2VH5L 3VD9A 4HIEB 4PRPB 4APQB 1I7ZB 4NO3A 2DQJH 3BDXA 4JZOB 1JK8B 3OKMB 2R2EB 4QCIA 5F7MC 1CGTA 4HT1L 3OR6B 4HZAA 2IG2L 1JPTH 5HYJE 1FVCB 1HILA 3TVMB 3QWRA 4IM8A 3V5KB 4ELKB 4QRTB 3ROLA 1XF5A 3IDMB 1P84J 1MIML 3UJTH 3C5SB 1I8KB 3LKPA 3PDOB 1T0MA 3UX9B 5HBBA 4JAMA 5DZNA 2CK0H 2BZDA 4NKQB 4ZXBC 5H8DA 1FBIH 3S88L 5IW3A 1EEZA 3K4ZA 3JWDH 5FYLH 1GYAA 2DMKA 4WFGD 4HFWA 3HS0B 3CPLA 2FYYA 1YEFL 4NNYB 1ZS8A 1CU4L 4JLRA 4P5TC 5EPMB 5GZOC 2E7HA 3BOVA 4JEGB 1ZVSA 1AIFA 3LVEA 5BS0B 3CFDA 1F3DH 5C07D 3JV6B 3KYKH 3A6BH 2P8LB 3E6HA 5D7KE 3UTPE 4P5TA 1WFNA 4HK3N 2O61A 3W0WA 3LMJL 2IPTH 3KPQB 3T0EE 2VDOH 3GK8L 2R2BA 4OD2A 3ZL4H 5BO1L 5IB2A 4WI5A 1G7QA 2MPAH 3NZ8A 3QIUB 5KAQG 2ICWA 4EKXA 2DYPD 5J11C 5CD5C 3L7FB 5ESQB 4LSSL 3G6JE 4HCRA 4PJIA 3IRPX 4YHML 1OCWH 3C09C 4PV9A 3QG7H 3N85L 4UMGA 1T3FB 2IMMA 3QDJD 3UBXB 4GH7B 3U6RA 1J8HB 4MD5B 4NRYB 2ENSA 2X4UA 4HWEL 1MCKA 4CW1B 5E1AA 3OL2A 1CD0A 3UTSA 2GJ6A 2VAAA 3KXFB 4DAGH 5C0EA 3Q48A 1RIUL 3T3PF 3VRLF 4LDLB 1T5XA 4LCWD 4YGVA 2J5LC 1U8HA 4AIXA 4ZSOB 3V0VB 3MUJA 1GPOL 4P3CL 3REWB 5J7CC 1EIBA 5J4MA 1IAKB 1YEKL 1D9KB 1G7IA 1MFBH 1WQVT 3RY5A 3OHXB 1NLBL 3T1FB 5E8NA 5JR1H 3HRZB 4ODUA 3K1KC 1BZ9A 1QLEL 3O8XD 5J9PA 4AG4L 3JWDC 1H3UA 3W9EA 12E8H 4KJYA 3MLSL 3HHRB 5DA0B 5B39A 2ZP0T 4UOW0 3D39E 2MKLC 2HN7A 3P4OB 2YWYA 2VXSL 4L3CB 3ZZ1A 1RULH 5CWSB 1TCMA 3HG1B 3KJ4B 2B8OT 2D7TL 3F7PC 3GGWA 5A3IC 4R4BA 5TPWL 2G9HA 3KWWB 3QNZB 1ZKAA 4HK0B 5D2LF 2VXTL 3U9PH 4F58L 5IMMA 4D8PA 5HVHB 1HXYB 3SDYH 1AJ7L 4QXGH 3VH8G 5MEOB 2NZ9C 2Y72A 2AP2A 1PEWA 3NCBB 1TTUA 2PTVA 3GDBA 3O45A 2DQHL 1OAQH 2XTJD 2VQTA 1LO5B 2HT4D 5EUOE 1I7TA 2VR9A 3U46A 5HHNB 3ULVH 3LKNB 3AMLA 1B6DA 1F8TH 3X14A 2HRPH 4LDOB 4Z7UA 3MRJB 5DFVD 3U0PA 4P46B 1LHZA 35C8L 3WLBA 1QD0A 2BRQA 4XAKD 3U4BL 5C0BA 2FR4B 4L3ED 4OLWH 4P3DA 4PJ7E 5CUSL 3DECA 4YQXH 3C8KA 2APFA 4G6JL 3B5TA 3TBVB 3IDNB 4F33B 4Q74A 3HR5A 3EYOA 3LQZB 2C4FT 4U1NB 4HKJA 2FECI 3VXSB 3V7MA 5E0QA 4LCCC 4MA1C 4Y19D 4F7CA 4EIGB 4L8BB 2P45B 1QFWI 5C09E 5IM7A 3KPMA 3X3FH 3VXUB 4Y2DC 4AH2B 4G8GB 3U1SL 4UILH 4XPBH 5CEYB 4WTWA 1CXKA 3IXTB 4LCCA 4OLZL 4JO1L 1XH3A 1FFNA 5F9DC 2A9NH 4AM0A 1NANH 1DE4B 4G6AC 4Y2DA 2JJUA 4OCYH 4EUPA 2PCPB 1JNLL 3NVQA 2Y5EA 5D7IE 4NQXB 5MENB 2M1KA 4NUJB 1VADB 4HD9A 5T5FL 4UUJB 3D18A 5IFHL 3HFMH 1A7PL 1U93B 1WWWX 2YA0A 1P6FA 2HFEB 4WUUA 4QRRA 1K4DB 5HHPA 4YR6A 4N0YH 4EZMA 3MLZL 1B0GB 3M17B 1JGDB 2XWTA 4NN7C 4G5ZH 2Q6WA 1Q94A 1T21B 1NBYB 4Q2ZB 2HA1A 2EXYD 5CEZH 2FGZA 4BQ6A 3C87A 1OTTC 4DZBA 3WHE1 4MA3A 3ZKSD 4LVEA 3G6AB 4TSCH 4I2XE 4MQSB 2YUXA 4NFDA 4XBGB 4H5SB 5JHDB 2EIEA 3B5GA 4MB3A 2COQA 4JO4H 5C9JB 3QDMB 3MYJB 4XMPH 5TQ0H 3GMNB 3HC0B 3U30C 1G9ML 1SBBA 1ZT4B 4DZ8B 4F57L 1RUML 3KYAA 3ULVC 1CLZH 1GCFA 5T3XE 4HEPG 3GSQA 3FZUC 4YZFF 3TZVC 2QR0A 5BZDB 5J56B 1YEJL 2A73A 4CU8A 5TE4L 4PY7A 2X4OB 2JIXB 2VOTA 3FB6A 3VGEA 1IEHA 3BKCH 1F4XH 1NUDA 3MRMB 4LLWA 1F90L 3U2SB 3TZVA 2JELH 4JDVB 3LQAL 1EHAA 4R0LB 4LHQB 2DQGH 4UIMB 1UH4A 4NQDB 5DGRA 2M26A 3JV0A 4JM2F 3VRIB 3ZDZF 4FXGB 3LKOA 3UPAA 2X4QB 2PNDA 2YD4A 2XXCB 3SGDI 3BAEL 5T1KD 3X13A 1E6OH 4JY5L 3DYPA 1X4XA 5CLTA 5EO9B 1T20A 1F4YH 3RX5A 3QDJE 3WL9B 3TNNA 2HT2D 2XQYG 4TOYH 2R1XA 5L2JB 4YHLH 4U3HA 1LILA 5DK0A 4EI6B 1TCRA 5CIPB 4YBQC 4E41A 5KSBA 4HG4K 1GOFA 4BSVB 4CL7A 3MFFA 3QIWB 4HGKC 1IGFL 3V6FA 3SO3B 3NPSC 3VMNA 3ULSA 3WFEH 3EFFB 1KTRL 3VG9C 2UYLB 4QRSA 1U3HB 4JFOB 1N6UA 3TJHD 2IPKB 5GGRA 1CL7I 1DN2A 4EDXB 3VGFA 5FECB 4EVNA 4F7PB 4HJGB 8CGTA 4O58L 2VDKL 1YMMA 3F7VB 2A6JB 4UAOB 3O4LA 1IAII 1F58L 1UACL 2E6QA 1KEML 1UB5A 3L3GA 4RGMC 4IRSB 1XGQA 2AV7B 4MMXC 2NY6D 4QEGA 1ZA6B 1R3HB 1WSST 4L1HA 1P7QA 5FYKL 4JFED 1Q38A 2FHCA 2QQLL 3NZHH 2VUOA 2XWJA 3GMQB 3R4DA 4Y8DC 2NY1D 4EOWH 1UKQA 2CUIA 3QJHB 1CGYA 4JFXA 3HNTL 4UTBL 2RR3A 2YPLD 2VLLA 1AKJD 4NRZA 3SE9L 4UOW1 4KRLB 1KELL 4ZFGL 3HUJB 3TNMB 3CVHB 3O6FD 1AGBB 4MVBC 4XH2B 5F7EL 4ZO6A 3RX7A 2H9GA 4PGEB 4GRWH 1ADQH 1BHGA 1LE9A 3VFNB 4QHUA 2XTJE 3BH8A 5E8PA 4X5WB 5F1NB 4KI5D 3G5ZA 5F3HA 4N5EC 4KY1L 5GGTL 5JA9A 2ICWJ 2PXYD 4ZO9A 3QPXL 4JM4H 1JZ3A 3EYSL 3ALXA 3H2WA 3LRGA 4JCLA 3I6LD 3FMGL 1OAYH 4Z5RA 3VFOA 4NCDA 2WSKA 1A1OA 2HAZA 4XAKE 1PZUB 3QH3A 4L3EE 5D5ME 2IH1A 2BMKA 5IQ9A 1QFUH 5I6XB 3I84A 3GSNB 1S7WA 4PJEA 4OM1H 4Y19E 4OZFB 1Q72H 5EZLA 1DVFD 4LVHB 3T2PA 1CG9A 2F8OA 4YGAB 4OI9A 4TUOA 1DSFL 2CXGA 3HPJA 3WJLC 4P49A 4CDGC 5A2IH 5EWIH 3G04B 3LN4B 3MODL 5JW5B 2D0FA 3PQYB 1FZOB 4RISH 2VZSA 2NY2D 2XXMB 4PRDA 3IVKB 2WBJC 4PG2C 2Z31B 1JPSH 3WJLA 1IM3A 1VEPA 5DJ0A 3W2DL 4GMSH 1AP2A 3BXNA 4KVNL 1XCTA 1S7TB 2G60H 2AK1H 1CDCA 2WBJA 4PG2A 3UEZA 1CD8A 5D1ZC 4TQEL 4S2SA 4WHDA 1QLFB 3RWEA 3ZHKA 1QBLH 4JRYB 3DRQB 3D0LA 4Z7QE 1FNSH 5JOFB 3PV6A 3IDIA 1T2XA 5CCKH 4HIIA 1DUZA 4MHHG 3MO1A 5D1ZA 4NQSA 5BOPA 1RU9H 5DS8A 2JKXA 2YUZA 4Z18A 5C6TH 4ISVA 1L7TH 1P69B 5CMAA 3I6GB 2CK2A 2NXZC 4YDIH 4PD4K 1OSPL 3BMVA 2X7LB 2BCKB 3FQRB 2R2HB 4OLYH 1I3VA 3FO9A 2GCYB 3S8WA 3REVA 3O2WH 1Z6JT 1JNHB 1FNLA 3RVWD 3VXMA 2FZ3A 4KK6C 2BVPA 3U83A 2OL3A 3PWJA 4CVXA 1YDPB 2HP4A 1KJVA 2DF3A 3B8SA 2ZOKB 4K3DL 4UZGA 1F3DJ 4ZUSA 3P9MB 3FFCA 2C26A 4KHTL 4PRAB 4N0CD 5D7LB 4X6CA 2VXQL 5DHVB 1A6WL 2Q8BH 1TQCC 5GGSB 4F7MB 1CFSA 2F53D 3QQNA 1WBYB 3DGCR 1RUAL 5ALCH 4HWEH 1CXFA 1IC5H 4FQHB 4UU9B 5F88B 2O5YL 15C8L 4PGZA 4YPGB 2QADB 5DVOA 4LVOC 3DX7B 3T2NL 4NQEB 5C0DB 2BNRD 5FO9A 4HS8L 1CQYA 2HWZH 3SDDD 4JG1H 2AJVL 4NIKB 3BD5A 2OMNA 4XX1E 5EU3A 4ZS7L 4GAYB 1INQA 4RIRB 4Z7OF 2BC4B 4UB0H 3GI9H 3RL2A 1EHNA 2OTUB 3I75B 2YN3A 3LPGA 2VLJA 3EO0A 4GRWF 3QCTL 4LLMA 4XX1G 3VI4E 5F9OL 4CMHB 5IKCB 1NEUA 3T65A 1QR1B 1R3IL 4G42B 4OZHA 3BP4A 4OV6F 3T3MF 2YC1A 4PJHE 4OFVA 2WW8A 3LKRB 4K23L 4YO0B 4NRXA 1R3JA 5JHLL 4KAQL 4P23C 3THML 3T04D 6FABH 4NT6A 1YYMH 1AGCB 4LARL 4OUOA 1NGZB 1V7MH 3S5LG 3IU4L 2FO1A 1CBVL 2VZOA 3BIKB 1QNZH 5ENWA 3QEQA 4P23A 2WLYA 1K85A 1RZJL 2PO6C 3HB3D 4M1CC 5JORB 2WZPD 1S7QB 5EO1B 3EDJA 2P5WD 1LO2L 5GIRA 2XQBL 1MJ7H 1TJGL 2X4TA 2J6EH 2P1YA 4JPWL 4JCMA 1LP9B 5FDWB 3ARWA 4M7ZC 1MQKH 5HI4D 3VMOA 2PO6A 4RQQB 3RHWK 1KB9K 5KW9H 2R4SL 1FRGH 4JJ5A 1W0WB 3FB7A 2QHRH 3SO5A 1MFEH 3JUYA 1U58B 1CXHA 5E8EA 1MUJB 1U36A 5J6GA 1ND0A 1OTUD 2R0WL 4RAUA 2YPLE 2NX5D 5HHOA 1DZBA 3JWOL 5DJZB 4WI9A 3C6LD 3GMRA 4DWHA 5DMGC 4Z7VE 3MJ9L 1WEJH 4PJ9C 5GRUL 2I25N 5C0CD 2EEAA 3GSUB 5F1KC 4KI5E 4FOMA 5I66B 2MQCA 1Q0XH 3FQXA 1IM9B 4DGYL 2V5SA 2YD1A 1A4KA 2DLHA 2E27L 2L0DA 4PJ9A 3FO0L 3HE7C 1OARL 2IANA 1JTPA 4JRXD 3MV9D 4W4OC 4NP4H 4Y4HB 4IRJC 1JWMA 1T04A 1VFAB 1T2JA 1XZ0B 1QO3A 2UUDH 4IS6B 4FFVC 3GIZL 5EC2B 5JXEC 3H9SD 1T22B 3HE7A 5F6HJ 1NFDA 2CKBL 3TPUA 3S36X 4DUWA 3QUKB 3B9AA 1WIOA 4BSJA 4W4OA 4IRJA 4KUCD 3VXNB 3DYOA 2DQUL 1H5BB 3LKSB 3LS4L 4KMTL 5LXGH 4HMEA 5JXEA 3WIHL 4B41A 4D3CL 3PGDB 3NABH 4KKBD 3PHQA 4Q9QL 4XI5C 1RMFH 1TTGA 2OM5A 3RBSA 4GBXD 4XNXL 5EU6D 1FGNL 5KS9A 3CXDL 5IW1A 5IHBA 2DIJA 5C92A 1RI8A 1N5AA 1I8LC 3C60B 3TO4C 3S3JA 2NY7H 2YKLL 4ZTPL 5AZ2L 5HGHA 1R3KB 1UM6H 4AT6B 4NUGL 3CDFA 5B3JE 1QFPA 5B8CC 1QBML 2DQCL 4XCNA 1IGJB 3EO9L 5IHZA 4PPTA 1I8LA 3TO4A 4ZG1A 2P7TA 4K3EL 3H3PL 4RNRB 5EOTB 3E0GA 5EU7E 3T0EB 2X70A 4MA8H 1XR8B 4U0QB 2G5BA 1CFBA 1RIVL 3VGBA 3IU3A 1IKFH 5JLZB 1N0XH 3CCHA 3EOAB 5B8CA 2J6EA 5DD0H 5KSUA 2PN5A 3TP4A 2EO1A 4YHPB 4P3WA 1F90H 2R0LL 3MBEC 3RGVB 3G6JB 2VTFA 1MIEL 3SCMB 1ZHLB 2YOCA 3WFZA 2AVGA 3IF1B 1J86A 3BAEH 4XZUB 2EDQA 2VXUL 3MBEA 4P9HH 1C16A 5E70A 2DI8A 3CDCA 2EIZB 1YJDL 1FL5A 2Q7YA 3RL1B 4Z7WA 1XT5A 2XG5A 1I9IH 2AJZA 2F58H 3FT4B 3NACL 1J0JA 1IGYA 1HKFA 2F53E 3JTTA 4KK9C 4WO4D 3IKCA 1TQBC 5IVXF 1N59B 2BDNL 4HX1A 5DJAB 4FFZH 3STZB 1ZVHA 5DHYB 1NDMA 5HJ3B 2Q86B 3V4UH 1YEIL 3MNZA 1MEXL 1JUFA 3S97C 4U1LB 4BH8B 2BVOB 1SMAA 4G9DA 3V52H 3TT3L 3F62A 1FGVH 5E6IB 1QYGL 3MFGB 3EW3B 3RWHA 5HYSG 3IXAA 2NY3C 2A6DA 4U7MA 4ZPTB 3BH9B 1ZK9A 4C58B 2X6MA 3R1GL 4ERSL 4M7JH 2VDKH 3LH2L 4GS7B 1YEHH 3B5HA 1DQLL 1F58H 1ZSDB 2ZKHL 3K2MC 4QKXB 4R8WH 3CVIL 4LAQH 4Z8FL 1NCDL 4HBCL 3HNVL 2V5TA 3VWJD 2BVQA 3WEXB 3UC0L 1OGAA 1EHLH 5HVFB 1RZ8B 2A74A 4XTRD 1CLYL 5I73C 2UY7A 1G9MC 4PBWD 3B9KB 4X0KA 1K6QL 3NFPB 2QSVA 2J7LA 3S3PA 4M62H 3DTXB 4LSPH 4QRPB 1HKLL 5DR5H 1MCLA 4X6BA 4HK3J 3RAJH 4FABH 1C1EH 2Y36L 3BE1L 3BN9D 2E6PA 3NFNB 4AEFA 1ZANL 5KZCB 2FRGP 4X83A 5F7EH 3C6SA 4KV5F 4Y4FD 5EZIL 3EGSA 5HVGB 5A43C 1IL1A 1UVQB 4M7LT 3D69A 2ADIA 3QZWG 2WK2A 3LQAC 5SV3A 2HH0L 4U1MA 1GGIL 5GSVB 4YBHA 5J6HB 1RV6X 5DJYB 4A6YL 4LK4A 4FQPA 3K46A 3WJJC 2ZG2A 4PJ7B 3MRHA 3QHTC 5B3NA 4XVUC 5EBLA 4S1DC 2WBKA 4WEBL 1Q9OB 2GK0B 2BSRA 3FT2B 1O0VA 3VGAC 5IV2A 4FQXB 1HSAA 4BFIB 3GMOB 1HEZB 5LGJB 3F7QA 3NTCH 4MAYB 4P9HC 4K9EL 4GW5A 3EOTL 5DJ2A 3EHBD 4Y4KD 2IMNA 2XNAA 4L8DA 3WJJA 5JA8B 3D85B 3GSNL 5C09B 4NQCA 3RVTD 4BUGA 5M95B 3HMXL 3SDAC 3U4AA 3D2UD 4PJ5D 4KZEL 4LF3A 4YDJA 5SWZD 2V2XA 3DUHA 5CJOL 4HIJA 2FJFB 4OLUL 4PD4J 4R7DB 3CFKB 3G9AB 1LDPL 1HDMA 3RZCC 3PP4H 3SDAA 4DGVH 5C71A 2HVJA 1EAPB 4PJGB 4XWGL 5DURD 2IBBA 3QPQC 2DN7A 4MWFA 4WU5A 1AQDB 1D5MB 3CXHK 1JRHI 5I76B 1PG7X 5D7IB 3V5HA 5DUPL 3QJFB 3W2DH 4JPIA 5HYEA 3RZCA 2PETA 5GS1B 3KPSA 4YBLB 5E2UL 4KDVA 2V2TB 5KSVA 3SY0A 3KDMB 4MQXC 4R26L 1NLDL 5E6YA 3H9SE 4MB4A 1MLBA 2OI9B 1CGSL 4G9FD 5L2KA 5I9QB 4WW1B 1F11B 2DJUA 2H1PL 1V3JA 4P4RA 4G8FA 1V3LA 3UZQA 1FCGA 1AY1H 4XPGH 1BGXH 4QF1B 1G9NH 4I2XB 1YNKH 5IMOA 5D93B 3V6OC 2XZCL 1FNHA 3OXSB 1MHPH 5IBTL 5EU6E 4TSBL 1X5ZA 4WWKC 3QEGH 4IIQB 4WV1B 3WN5C 5J13C 2I07A 4EDWH 3B2UC 4GG6F 5DTFB 5ADOL 2BOBB 4W68A 3V6OA 2PTTA 2I5YL 3QXDB 5DK2B 1DBML 3QDGA 5C07B 2QSQA 2JTDA 3HR6A 5TDPA 4WWKA 5ACLA 3WN5A 4GMTH 1AC0A 4XMLL 3ZT7A 4QHLA 3TIDA 4J6RH 1PEZA 4Z7NE 2X1QA 1F6LL 3LV3A 4X4YB 5FK9A 2C1PB 4JVWA 5D1QD 5FOJA 4NCC1 2HYMA 1QSFA 5GGTA 3GIVB 2DYPB 3VFVA 1UM4H 1I3RB 1MRDL 3L5XH 3T2NH 3QNXB 5I16B 5ITFA 3SJVA 4PRIE 5HDOA 3TBTB 3ZKMC 2LVEA 3ZDYF 1FG2B 3KHQA 3FRPG 3TVMC 4TNVK 4HIEA 4PRPA 2AJXL 1MREH 3QDJB 2RBLA 1JK8A 3OKMA 4AENA 1FVDB 2R2EA 5DVMA 5FM5M 1LQSR 5CP3H 3ZE0F 4YXHL 3OR6A 5JZ7C 4Q6YA 1KB9J 2VN7A 1FVCA 1S3KL 4X9HA 3SDXB 3TVMA 4OCRL 2DDQH 1VACB 3V5KA 4ELKA 4QRTA 3HC4L 3HTLX 1O7VA 2ZCHL 5IQ7L 3IDMA 3PIQB 1HHJB 1CFQB 3JV4B 4UT6H 3C5SA 1I8KA 1NKOA 3PDOA 4OGYH 5E8OB 4LCWB 4G8EB 4KPHL 3ES6B 3HPLA 5E4EC 5HYFA 4OF3A 4HZLB 3B6SB 5J57B 3LIZH 1UFUA 3V6ZB 5GISH 1NGYB 4NNYA 1KCRL 4OAWB 5EPMA 4MGXA 4I0PD 4NDMA 1MFDL 1CVRA 3ROOB 1G9NC 5BS0A 2DWDB 3S36H 5AYQA 1LO2H 1JN6B 3JV6A 5KOVC 2P8LA 1AQKL 2ATPB 4JFPB 4TVSa 4PRNA 1FSKB 4NZTL 1EERB 3QIUC 4JM2D 1II4E 4OZIA 1AXIB 5IG7B 3KLDA 4P59H 3KPQA 2Z92B 3RA7H 5A2KH 4LIQE 1IBGL 1HHGB 2SEBB 1Y0LB 3QIUA 4NZUH 4OLXH 1KLUB 5CJQH 2EDDA 3L7FA 2DQIL 5SX5H 5ESQA 4K3HA 3GSWB 3GB7B 1DBBH 1QSED 4RA0C 1UCBL 1WJ3A 2XTJB 5L6YL 3ARDB 4X9FA 1IVLA 1K2DB 4KKCD 1LE5B 4YHKL 3D25B 1T3FA 1DBAH 2RB8A 3UBXA 1ZGLB 4KHXH 3VRLE 4ZFOL 2ZUVA 1J8HA 1Z3GH 3BYTA 4NRYA 4TTGA 4LASL 5JW3H 3A67L 1V7NH 4PGDB 4CW1A 4OGAD 3QCVH 5D7JD 5D5MB 4S1QH 2EEDA 4MXQD 1B6UA 3W82A 1RAMA 3VRJB 4LCUB 1C7SA 1TJHL 4OM0H 2IC2A 1WICA 2DWEA 2W07A 3B9VA 1F4WL 2Y9RT 1B2WL 4JR9L 1D9KC 3OR7A 2ADJB 1JTOA 4EXKA 1DN0B 1L7IL 3ARFD 3WXWH 3V0VA 4PJ5E 1XGPB 4GRLA 5SWZE 1IAKA 2DD8L 3RWJB 1PLGH 3NCJH 1D9KA 2YRLA 1PYWB 3RWCA 3OHXA 2WUBL 4M8QB 1RIHL 3T1FA 3LS4H 2BERA 4P2RA 4MQ7B 3HRZA 1U9KA 1OAUL 3K74B 1HYSD 5FGCB 1JZ2A 3CK0H 2GSGB 3PGFL 3GSRA 3KJ4C 1FC2D 3BKMH 4M7LL 5HGAB 3IDYB 4KQ3H 4YDVA 2DOCA 4XNXH 2OR8A 43CAB 4F7EB 3ULUH 3K81A 3P4OA 2Q1EA 2F8XC 2VAJA 1I75A 4L3CA 1FORH 5IESL 3HG1A 3V4VH 3D3VA 5FKAA 1YQVH 1H8NA 2VLMD 5AZ2H 4JDTL 5DZLA 5EU4A 3KWWA 4NJAH 3QNZA 4G9FE 5GGSY 4HK0A 1UXSB 5D71L 2V5MA 5SX5K 3EO9H 3K80A 3MV11 5K59E 2YR3A 4YDLC 5MEOA 3C8DA 2BVEA 1RIVH 1UA6H 4F80A 5C0JB 4ZD3H 1LO5A 1NC4D 4M48L 2KUTA 5E2VH 1WWAX 4X6DE 5JUEL 1CT8A 1CFVH 3EDKA 1KN4L 4ZAKC 3MRJA 3JWOC 4FG6D 2FR4A 4Z95H 2FIRT 3TBVA 4X4MA 4F33A 5F70A 4U1NA 3DVGB 3VXSA 2HLAA 3MNWA 4J12A 4YHIA 2VQ1B 1I9RH 4ZAKA 5C6WH 4L8BA 3WNNA 4N8VG 4UIKL 1CDBA 4BJLA 4NZRH 1DQQB 4K8RH 1OSZB 4M9OA 3MJ9A 5HTSA 1IT9H 4JN1H 4AH2A 5HHQB 3OAZH 4AEHH 5CEYA 2H26B 2BDNH 3IXTA 4CADB 2BNQD 2QTEA 1UGNA 3W39B 1PD6A 4LPWA 1YEIH 5CJ5A 1E28A 1MEXH 1FFRA 4L5FL 5BVPL 3TC9A 4I5BB 2CGRL 5T1KB 1X5XA 1HSBB 1W72B 2DKMA 1QYGH 4XC1L 3SKNB 3VJ6A 4NQXA 5JQ6L 5MENA 4KQ4H 4NUJA 1VADA 5DEFB 1UB6B 4XHJC 1CR9L 3CX5K 3VXRD 3QHFL 4UUJA 2NR6C 2X40A 5LQBH 5IVZB 4XGZB 5LWYL 1MY7A 1U93A 2CKBA 2HFEA 1K4DA 1X5FA 3TJEH 1DQLH 1U92B 3S5LB 3CVIH 1B0GA 3QIBD 4XWOC 1ED3A 3P11L 1T21A 1XGYH 3OB8A 3P9WB 3WIHA 2X2YA 3UC0H 3QFDB 5I17B 2D4DA 2GAZA 4FZ8L 1CCZA 1T0NB 2YHGA 3B3IB 3IFNH 1ODAA 1PG7H 3SDCC 1CQKA 5MEQA 4XBGA 4U6XB 4H5SA 5JHDA 5GZNC 1J0ZA 1J5OH 1T7XA 2MTPA 5C9JA 3QDMA 3MYJA 3CVHH 3GMNA 3HC0A 1ZT4A 1MCJA 2OQJA 1M05B 5FIEA 3SDCA 1SM3H 4DZ8A 4Z7UF 1D5ZB 3CXHJ 4OIBA 4QNPE 4Y7MA 3RVUC 3D5OF 1I8IB 1YNTB 5BZDA 1NCAL 3WV0A 3BPLB 5IEHB 2W9EL 2CDFB 2X4OA 3T2QA 2OR7A 2JIXA 4HH9B 5C2BH 4JFEB 3OAZK 3EYFB 2NY1B 3DYMA 2PF6A 3MV8E 3GMLB 2YPLB 3U2SA 1AKJB 3SGJC 1RZGB 4JDVA 1X4YA 1YJDC 4OQTH 3TWCL 3CSYB 3O6FB 5KANI 1KSRA 1U8MB 3GSNH 4NQDA 3C2AL 3IKKA 4M5YL 3HMXH 3C5ZC 3VRIA 4Z7VB 1RJLA 4KK8D 2X4QA 1ONQB 2YD7A 3L3JB 1I1AD 3HZKB 3L3DA 3SGJA 5CJOH 2GUOB 4NQUA 1MVUB 4PJ8B 4WCYH 1A6ZB 1IC4L 4OJFL 1FFOB 3WL9A 1TZIA 1XGRB 1NBQA 3C5ZA 3ZE2F 4R4NC 5C8JB 5L2JA 3QIWC 2CJUL 3NIFF 3SO3C 4XWGH 1KXQE 4PJXE 4EI6A 2R23A 3FQNB 3VXPB 1VPOH 2WIMA 1FAIL 5HSFA 5CIPA 4TSAL 1U3HC 1OAXL 4L4VE 2FX9H 4BSVA 1A3RH 3QIWA 3W9DA 4HXAH 5D7SH 1DVFB 3KYMB 5DI8B 1UZ6F 3U36A 4UAOC 3EFFA 4RFOH 2UYLA 1U3HA 2MJWA 4JFOA 1RFDL 3OKEB 2IPKA 4JFFB 4IRSC 1J18A 3OF6D 3A6OA 5EULV 1A7RH 1GSMA 5HHMD 3TH3T 1RHHB 4EDXA 5ABDE 4RGOL 4HJGA 2NY2B 1AO7E 3J7HA 5ALBL 3PL6C 2A83B 1SY6L 2D7QA 1LEGB 2A6JA 3F7VA 1ZHNB 4ODVH 3MV7D 4TTDC 2VC2L 1A1MB 4C56D 1MJUL 1IGCL 2XZCH 5MEPA 5I1GL 4IRSA 5DSCB 1L9MA 1Q1JH 1WCBA 2VDLH 3DURB 4Z0BH 2AV7A 3O6KL 1BM3L 4L9LA 3PL6A 2CRMA 4KUZL 1ZA6A 2VERN 1R3HA 4R4FL 5HXMA 1KIPB 2PR4L 3GMQA 4FQIL 2J8UB 4OLEA 2VLME 3PWPA 5DJ8B 2AXHA 3QJHA 4K7PH 3HE6A 1JNJA 3TNMA 3MJGX 3OKDA 5DHVH 4XH2A 2XN9D 4P5MA 1BIIA 3KVQA 2D4FA 3VFNA 2GT9B 2H6PB 4NHCL 1IZJA 3MA7B 2FB4L 1DFBH 4OCWL 3WFBL 4A6YA 4X6EA 1ACZA 5I6XC 2R69H 3KLHD 2VDPL 4OQ1A 5K9OA 2CIIB 1J05B 4LVHC 2LAAA 3NGBB 5I74B 4AL8L 5GJSL 3GSNA 3HMXA 1RZFH 4OZFA 4F2MB 5KSBF 3QBTB 1CK0L 4Z78B 1MFAL 2Z31C 4KDWA 5HYSB 2ZCHH 4PJAF 3LN4A 2C7UB 3RI5K 2NYYC 5JW5A 2BNRB 2MFNA 1FZOA 3PQYA 4LL9A 3UJIH 3BDBA 3GBML 1RJZB 3SDDB 1XF2A 1OD7A 1YPZB 3IVKA 5ELIA 2J12B 2Z31A 3DBXB 2D31B 2ZJSH 1JGLH 1ETZA 1A14L 5FYJE 3DMMD 3S37L 1S7TA 3EUUA 2R4RL 5GRVL 3VXTB 1E4XI 2WMPA 4XNYL 3FONB 1NEZG 1Q9WB 4P2OA 1MRCL 4JE4B 4U2YA 5BXFB 5HYQB 5F3BB 1QLFA 3ORJA 2JB5H 1I85C 5E9DD 4JRYA 4AEIH 3DRQA 5GS3A 4FN0A 5A2FA 1IRAY 2R56L 4ODHH 3GJEB 4NZTH 5EN2B 1G1YA 1INDL 1WZ1H 2R0KH 3L3HB 5F93C 1I85A 2MQ0A 1KBGH 3LY6A 3ZE1F 5IR1B 3I6GA 1UWEL 2VABB 1U8OB 2EKJA 3T8XB 4POUB 4U1HB 3QZWB 1BMGA 3FQRA 3MRRB 2R2HA 1JFQL 3SKMB 5KVFL 1F3JB 5CGYC 2GCYA 1PKQB 3DSNA 2P43B 2HKFL 3LHPL 1G7JB 1FDLH 1AD0A 5AAMA 3MXWL 4FTVA 1KTDA 2VITB 3RPIB 4MNQE 4ENED 1YDPA 2P5WB 4G43B 2AGJL 2ZOKA 1MAML 2GQHA 3BEWB 4YHOL 1F4AA 3P9MA 2H3NB 1G7PB 4PRAA 3LPWA 5D7LA 4XCFH 3P0YL 3Q6GH 4JPVL 2QADC 4MXVE 5GGSA 4F7MA 4LASH 4TVPH 3A67H 1DUYB 1S78C 1WBYA 4RAVB 3WNOA 4PJEF 2WINB 5DMIL 1IFHH 4YHNB 5DQ9B 4UU9A 5F88A 1A7OL 3MLWH 5HI5D 4XP9H 1RZKL 4YPGA 5IFAL 2NX5B 3DX7A 3QXTA 1IC7H 4OF0A 4NQEA 9CGTA 3O9WD 3OKKB 4C83B 4KJWD 4JDZB 2W91A 3C6LB 1MCHA 3I02B 3VDAA 4XP1H 1NAMB 4UINH 3JWNC 5IIEB 4PLKD 4GAYA 2BY1A 2EH8L 4MX7B 5C0CB 3T3ME 5BRZA 2ZCLH 3W11D 3KPLB 4RIRA 2BC4A 4G7YL 1M1SA 4XPHL 1SEBB 1RIHH 3I75A 2OTUA 2VSDA 2FDBP 1FYTD 1LEIB 3ZTNL 3CLFH 1QQDB 4URTB 5EZJB 1J87A 3T0XA 1QR1A 4JRXB 4UNVA 3MV9B 4PP2B 4KJPD 4M1GH 4U6YA 3MBXL 4AIZB 3LKRA 4YO0A 4K7FB 3H9SB 5SWSB 1IGTB 2FGWH 2YWZA 4L8CB 1KN2L 5HDQL 3EYVB 1NGZA 4JDTH 1CLCA 5F71A 3L7EB 3BIKA 4UQ3B 3VFGL 1G6RB 5HHME 4JHAH 2HTLC 1YYLH 4DKAA 2E7MA 4P0DA 1S7QA 3MV7E 1C08B 4MJ4A 4MNGB 2F5BL 1F02I 4GBXB 5EU6B 4QOKD 1DLFH 1LP9A 5FDWA 2P4AB 4C59B 4ALAH 5JUEH 3KNBB 4RQQA 3C9NB 1U3ZA 2DQEL 5AG9A 1W0WA 1U58A 4KI1A 5EFIB 1OM3L 1MUJA 3BW9A 1W0YT 2EYTB 1DBKL 2D03L 3P0VL 4ELMB 5FA4B 2XTLA 4HWBH 5DJZA 1LK3L 1VENA 2F74B 3DX8B 2XN9E 1ORQB 4P57B 2VLKA 1KXVC 3FQTA 3WIIH 5I18H 4HQQL 2OK0H 4Y4HC 2R9HC 1IM9A 5DJDA 4ZODA 5BVPH 4U1JB 5FYJU 3QWOB 2KPNA 2EDRA 4XRCA 1W72L 4XC1H 5E5MA 1FG9C 4Y4HA 1MCPH 3SEPA 1V05A 2I9TB 2DRUA 1XZ0A 4IS6A 3PXHA 1H5BC 2EDYA 3QUMB 2NY5L 5EC2A 5FUCE 3SOBL 5L0QC 3L9RB 4WO4B 5GJTH 5I19H 5IK3B 3MOAH 4MJ6B 1S7VB 3T4YB 5IB3B 1H5BA 2NY0C 3LKSA 1KPUB 4KKLD 2E7CA 1EJOH 3HC3L 3PGDA 4B53A 5D2NB 1O7SA 3WNMA 1FZJB 3OZ9H 3U0TA 4BYHA 3QO0B 4HXBH 3O3AB 4LBEB 4XPTL 4B50A 1YEDA 3U4EB 2GSIB 1NBZB 1A7NH 5JOPE 4XNUL 1KENH 4Y1AD 2WUCL 3NCYP 3WKMH 5F7YC 1R3KA 4AT6A 2XZAL 5TQ2L 4OIIH 2N7BA 3LRSB 5E9DE 3VFRB 4FQJH 3OBAA 3VWJB 1IGJA 4XC3L 3RGVC 4RNRA 2QJDA 5EOTA 4H26B 2NCMA 1XR8A 1TJIL 3BPOC 5JLZA 5I15L 3SCMC 2AXFB 5BVJB 4JKPL 5K9JH 1KJ2B 4ONFH 4GLRI 2D0GA 3VFTB 4PR5B 3IDUA 3QI9B 3RGVA 2I24N 3G08A 2OZ4L 5CZKA 5EDXA 4FFYH 4ZTOL 3KYNA 3GM0A 3P30L 3SCMA 1ZHLA 1H9VA 4Y4FB 4K71B 2BFVL 3KPNB 2Y7QB 2RFXB 1VSCA 1QP1A 4OTXL 2EIZA 3RWFB 4HWBA 3SKJH 4C55A 1RJYA 3DSFH 1MPAL 3P4NB 4LLVA 4MNHB 4YWGH 5F6IB 3EJJX 5DD3H 3MUHL 4FQ2H 2EKSA 4LRIA 4J4PC 1B9ZA 2VZTA 3FN0L 3MYZA 5JOEA 4JQIH 1N59A 2GTWB 2C3WA 4RGND 1JNNH 5DJAA 5SX4I 3STZA 5E6IC 5DHYA 4Y4KB 1IGML 3GNML 4TSAH 5HJ3A 4WGWB 2WWKT 3SPVA 3VXOA 4KTEH 3FOMA 5HGGS 1K3ZA 4U1LA 4KRPD 4J4PA 2BVOA 3D2UB 3RIFK 4PP1D 3MSPA 5SWZB 1Q0YL 5E6IA 2AQ3A 5CSZA 5ETUB 2PYED 3EBAA 4LVNB 2VQUA 2QSCL 4ZPTA 4ZS6C 3CFBB 5L9DH 3I3EA 4XP4L 5T3ZD 2JE8A 5FUZL 5I1HH 4NNXB 1FYTE 2YD2A 2IWGA 3L5HA 5D2LB 1ZSDA 4NJ9H 4PB0H 3QRFM 4NPYB 5E8DL 5AAWA 5I1GH 3B9KC 5H37G 3WEXA 2IGFH 3KPRB 2W65B 4PB9H 4X7FC 1RZ8A 4DKEL 1J0HA 4KV5E 2XZQH 5TF1L 1BPVA 1OVZA 4FQIH 4G9FB 3B9KA 3TO2B 1KC5L 5IEKB 3NFPA 3EFDH 4NC2B 2YZ1A 5J8OA 1EZVX 1A9BB 3DTXA 4DGIH 4QRPA 5T3XH 2X42A 5I1LB 3NFNA 2X4SB 4YX2L 2V17L 5D9SB 5A2LH 1RVFH 4LHUD 4LLDA 4HPOL 3TIEB 3IGAA 2IFFH 2ZUWA 5CILH 1UVQA 3TN0D 3VA6A 1AGFA 3FHQA 4G7VH 4KKAC 5GGQL