4FQSA

Crystal structure of mycobacterium tuberculosis thya in complex with ump and pemetrexed
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of binary and ternary complexes of thymidylate synthase (ThyA) from Mycobacterium tuberculosis: insights into the selectivity and mode of inhibition
rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase/transferase inhibitor
source organism Mycobacterium tuberculosis
total genus 85
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4fqsA00
1F4CA 4E5OA 5FCTA 1JU6A 4TMSA 1TJSA 4EINA 3N5EA 1ZPRA 3NRRA 4ISKA 4FOAA 1EV5A 1BSFA 1SYNA 3BHLA 3JSUA 2KCEA 4FOGA 1EVGA 1J3KC 3UWLB 3B5BA 3BNZA 3CLBA 4DPHA 1BIDA 1F28A 4KNZA 2RD8A 1J3IC 2G8DA 3IRMA 3B9HA 3DGAC 4Q0DA 1TSNA 5HS3A 3UM8A 2VETA 1HW4A 1VZEA 2G8AA 1JTUA 4G2OX 1BP6A 3EJLA 1BO7A 3OB7A 1F4FA 1JMGA 1B49A 1VZDA 1LCEA 3DL6A 4KPWA 4O1XA 2TSRA 3BYXA 3EGYX 4GEVA 5H39A 4GD7A 1KCEA 3EAWX 4O1UA 4EZ8A 4PSGA 1TSLA 1KZIA 4ISWA 5H38A 4O7UA 2VF0A 1BPJA 1F4EA 1JMHA 3CL9A 3EHIX 4E28A 1TSWA 4GYHA 4JEFA 4H0RA 4UP1A 1F4BA 3IHIA 4IQQA 4FOXA 4ECKA 3GH0A 1BQ1A 1BSPA 1B02A 3I3RA 5BY6A 1TLSA 1DNAA 4Q0EA 1BO8A 3EBUA 4FQSA 3HB8A 3IJZA 1TSYA 1YPVA 1THYA 3UM5A 3EF9A 1LCBA 1EVFA 3N5GA 3KJSA 2G8XA 3IK1A 1HZWA 1JTQA 3IX6A 4IQBA 4FGTA 1JUJA 1AXWA 1NJEA 3BFIA 1TVUA 1BDUA 2TDMA 1DDUA 4XSCA 4G6WX 1B5DA 3C06A 1HVYA 3IK0A 1JG0A 5J7WA 3N5EB 3UWLA 3HBBA 2G89A 2OIPA 1TISA 1SEJA 3BZ0A 3ED7A 1NJDA 1AJMA 2TDDA 2RD8B 3IRNA 1F4GA 1JMFA 1FWMA 1VZAA 2FTQA 1TSXA 2H2QA 1TRGA 5H3AA 1TYSA 1TVVA 1QZFA 1NJBA 2TSCA 4XSEA 1TSZA 4IRRA 1TSDA 3C0AA 1CI7A 4LRRA 4DQ1A 4XSDA 2FTOX 4H1IA 5WRNA 3BGXA 3EDWX 1BJGA 1VZBA 4EB4A 1BKOA 1TVWA 3QGTA 4KY8A 1TSMA 1KZJA 1LCAA 1NJAA 1TDCA 3GH2X 2ONBA 1TDUA 2RDAA 2FTNA 3DL5A 3KGBA 2A9WA 3GG5A 1J3JC 4O1XD 3INVA 4DP3A 1AOBA 4KYAA 3BHRA 3IROA 4EILA 3V8HA 2G86A 3QJ7A 1HW3A 1FFLA 1EV8A 1BP0A 3UM6A 1RTSA 1AIQA 4KY4A 1B5EA 1TDBA 1VZCA 1AN5A 3QG2A 1BKPA 3DG8C 1QQQA 3K2HA 1TLCA 1BQ2A 1I00A 1NCEA 1F4DA 3HJ3A 3TMSA 1TSVA 4DPDA 1NJCA 4F2VA 2AAZA 3H9KA 3KJRA 1JUTA 1TDAA 4H0UA 1JMIA 2BBQA
chains in the Genus database with same CATH superfamily
1F4CA 4E5OA 5FCTA 1JU6A 4TMSA 1TJSA 4EINA 3N5EA 1ZPRA 3NRRA 4ISKA 4FOAA 1EV5A 1BSFA 1SYNA 3BHLA 3JSUA 2KCEA 4FOGA 1EVGA 1J3KC 3UWLB 3B5BA 3BNZA 3CLBA 4DPHA 1BIDA 1F28A 4KNZA 2RD8A 1J3IC 2G8DA 3IRMA 3B9HA 3DGAC 4Q0DA 1TSNA 5HS3A 3UM8A 2VETA 1HW4A 1VZEA 2G8AA 1JTUA 4G2OX 1BP6A 3EJLA 1BO7A 3OB7A 1F4FA 1JMGA 1B49A 1VZDA 1LCEA 3DL6A 4KPWA 4O1XA 2TSRA 3BYXA 3EGYX 4GEVA 5H39A 4GD7A 1KCEA 3EAWX 4O1UA 4EZ8A 4PSGA 1TSLA 1KZIA 4ISWA 5H38A 4O7UA 2VF0A 1BPJA 1F4EA 1JMHA 3CL9A 3EHIX 4E28A 1TSWA 4GYHA 4JEFA 4H0RA 4UP1A 1F4BA 3IHIA 4IQQA 4FOXA 4ECKA 3GH0A 1BQ1A 1BSPA 1B02A 3I3RA 5BY6A 1TLSA 1DNAA 4Q0EA 1BO8A 3EBUA 4FQSA 3HB8A 3IJZA 1TSYA 1YPVA 1THYA 3UM5A 3EF9A 1LCBA 1EVFA 3N5GA 3KJSA 2G8XA 3IK1A 1HZWA 1JTQA 3IX6A 4IQBA 4FGTA 1JUJA 1AXWA 1NJEA 3BFIA 1TVUA 1BDUA 2TDMA 1DDUA 4XSCA 4G6WX 1B5DA 3C06A 1HVYA 3IK0A 1JG0A 5J7WA 3N5EB 3UWLA 3HBBA 2G89A 2OIPA 1TISA 1SEJA 3BZ0A 3ED7A 1NJDA 1AJMA 2TDDA 2RD8B 3IRNA 1F4GA 1JMFA 1FWMA 1VZAA 2FTQA 1TSXA 2H2QA 1TRGA 5H3AA 1TYSA 1TVVA 1QZFA 1NJBA 2TSCA 4XSEA 1TSZA 4IRRA 1TSDA 3C0AA 1CI7A 4LRRA 4DQ1A 4XSDA 2FTOX 4H1IA 5WRNA 3BGXA 3EDWX 1BJGA 1VZBA 4EB4A 1BKOA 1TVWA 3QGTA 4KY8A 1TSMA 1KZJA 1LCAA 1NJAA 1TDCA 3GH2X 2ONBA 1TDUA 2RDAA 2FTNA 3DL5A 3KGBA 2A9WA 3GG5A 1J3JC 4O1XD 3INVA 4DP3A 1AOBA 4KYAA 3BHRA 3IROA 4EILA 3V8HA 2G86A 3QJ7A 1HW3A 1FFLA 1EV8A 1BP0A 3UM6A 1RTSA 1AIQA 4KY4A 1B5EA 1TDBA 1VZCA 1AN5A 3QG2A 1BKPA 3DG8C 1QQQA 3K2HA 1TLCA 1BQ2A 1I00A 1NCEA 1F4DA 3HJ3A 3TMSA 1TSVA 4DPDA 1NJCA 4F2VA 2AAZA 3H9KA 3KJRA 1JUTA 1TDAA 4H0UA 1JMIA 2BBQA
chains in the Genus database with same CATH topology
1F4CA 4E5OA 5FCTA 1JU6A 4TMSA 1TJSA 4EINA 3N5EA 1ZPRA 3NRRA 4ISKA 4FOAA 1EV5A 1BSFA 1SYNA 3BHLA 3JSUA 2KCEA 4FOGA 1EVGA 1J3KC 3UWLB 3B5BA 3BNZA 3CLBA 4DPHA 1BIDA 1F28A 4KNZA 2RD8A 1J3IC 2G8DA 3IRMA 3B9HA 3DGAC 4Q0DA 1TSNA 5HS3A 3UM8A 2VETA 1HW4A 1VZEA 2G8AA 1JTUA 4G2OX 1BP6A 3EJLA 1BO7A 3OB7A 1F4FA 1JMGA 1B49A 1VZDA 1LCEA 3DL6A 4KPWA 4O1XA 2TSRA 3BYXA 3EGYX 4GEVA 5H39A 4GD7A 1KCEA 3EAWX 4O1UA 4EZ8A 4PSGA 1TSLA 1KZIA 4ISWA 5H38A 4O7UA 2VF0A 1BPJA 1F4EA 1JMHA 3CL9A 3EHIX 4E28A 1TSWA 4GYHA 4JEFA 4H0RA 4UP1A 1F4BA 3IHIA 4IQQA 4FOXA 4ECKA 3GH0A 1BQ1A 1BSPA 1B02A 3I3RA 5BY6A 1TLSA 1DNAA 4Q0EA 1BO8A 3EBUA 4FQSA 3HB8A 3IJZA 1TSYA 1YPVA 1THYA 3UM5A 3EF9A 1LCBA 1EVFA 3N5GA 3KJSA 2G8XA 3IK1A 1HZWA 1JTQA 3IX6A 4IQBA 4FGTA 1JUJA 1AXWA 1NJEA 3BFIA 1TVUA 1BDUA 2TDMA 1DDUA 4XSCA 4G6WX 1B5DA 3C06A 1HVYA 3IK0A 1JG0A 5J7WA 3N5EB 3UWLA 3HBBA 2G89A 2OIPA 1TISA 1SEJA 3BZ0A 3ED7A 1NJDA 1AJMA 2TDDA 2RD8B 3IRNA 1F4GA 1JMFA 1FWMA 1VZAA 2FTQA 1TSXA 2H2QA 1TRGA 5H3AA 1TYSA 1TVVA 1QZFA 1NJBA 2TSCA 4XSEA 1TSZA 4IRRA 1TSDA 3C0AA 1CI7A 4LRRA 4DQ1A 4XSDA 2FTOX 4H1IA 5WRNA 3BGXA 3EDWX 1BJGA 1VZBA 4EB4A 1BKOA 1TVWA 3QGTA 4KY8A 1TSMA 1KZJA 1LCAA 1NJAA 1TDCA 3GH2X 2ONBA 1TDUA 2RDAA 2FTNA 3DL5A 3KGBA 2A9WA 3GG5A 1J3JC 4O1XD 3INVA 4DP3A 1AOBA 4KYAA 3BHRA 3IROA 4EILA 3V8HA 2G86A 3QJ7A 1HW3A 1FFLA 1EV8A 1BP0A 3UM6A 1RTSA 1AIQA 4KY4A 1B5EA 1TDBA 1VZCA 1AN5A 3QG2A 1BKPA 3DG8C 1QQQA 3K2HA 1TLCA 1BQ2A 1I00A 1NCEA 1F4DA 3HJ3A 3TMSA 1TSVA 4DPDA 1NJCA 4F2VA 2AAZA 3H9KA 3KJRA 1JUTA 1TDAA 4H0UA 1JMIA 2BBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4C A;  4E5O A;  5FCT A;  1JU6 A;  4TMS A;  1TJS A;  4EIN A;  3N5E A;  1ZPR A;  3NRR A;  4ISK A;  4FOA A;  1EV5 A;  1BSF A;  1SYN A;  3BHL A;  3JSU A;  2KCE A;  4FOG A;  1EVG A;  1J3K C;  3UWL B;  3B5B A;  3BNZ A;  3CLB A;  4DPH A;  1BID A;  1F28 A;  4KNZ A;  2RD8 A;  1J3I C;  2G8D A;  3IRM A;  3B9H A;  3DGA C;  4Q0D A;  1TSN A;  5HS3 A;  3UM8 A;  2VET A;  1HW4 A;  1VZE A;  2G8A A;  1JTU A;  4G2O X;  1BP6 A;  3EJL A;  1BO7 A;  3OB7 A;  1F4F A;  1JMG A;  1B49 A;  1VZD A;  1LCE A;  3DL6 A;  4KPW A;  4O1X A;  2TSR A;  3BYX A;  3EGY X;  4GEV A;  5H39 A;  4GD7 A;  1KCE A;  3EAW X;  4O1U A;  4EZ8 A;  4PSG A;  1TSL A;  1KZI A;  4ISW A;  5H38 A;  4O7U A;  2VF0 A;  1BPJ A;  1F4E A;  1JMH A;  3CL9 A;  3EHI X;  4E28 A;  1TSW A;  4GYH A;  4JEF A;  4H0R A;  4UP1 A;  1F4B A;  3IHI A;  4IQQ A;  4FOX A;  4ECK A;  3GH0 A;  1BQ1 A;  1BSP A;  1B02 A;  3I3R A;  5BY6 A;  1TLS A;  1DNA A;  4Q0E A;  1BO8 A;  3EBU A;  4FQS A;  3HB8 A;  3IJZ A;  1TSY A;  1YPV A;  1THY A;  3UM5 A;  3EF9 A;  1LCB A;  1EVF A;  3N5G A;  3KJS A;  2G8X A;  3IK1 A;  1HZW A;  1JTQ A;  3IX6 A;  4IQB A;  4FGT A;  1JUJ A;  1AXW A;  1NJE A;  3BFI A;  1TVU A;  1BDU A;  2TDM A;  1DDU A;  4XSC A;  4G6W X;  1B5D A;  3C06 A;  1HVY A;  3IK0 A;  1JG0 A;  5J7W A;  3N5E B;  3UWL A;  3HBB A;  2G89 A;  2OIP A;  1TIS A;  1SEJ A;  3BZ0 A;  3ED7 A;  1NJD A;  1AJM A;  2TDD A;  2RD8 B;  3IRN A;  1F4G A;  1JMF A;  1FWM A;  1VZA A;  2FTQ A;  1TSX A;  2H2Q A;  1TRG A;  5H3A A;  1TYS A;  1TVV A;  1QZF A;  1NJB A;  2TSC A;  4XSE A;  1TSZ A;  4IRR A;  1TSD A;  3C0A A;  1CI7 A;  4LRR A;  4DQ1 A;  4XSD A;  2FTO X;  4H1I A;  5WRN A;  3BGX A;  3EDW X;  1BJG A;  1VZB A;  4EB4 A;  1BKO A;  1TVW A;  3QGT A;  4KY8 A;  1TSM A;  1KZJ A;  1LCA A;  1NJA A;  1TDC A;  3GH2 X;  2ONB A;  1TDU A;  2RDA A;  2FTN A;  3DL5 A;  3KGB A;  2A9W A;  3GG5 A;  1J3J C;  4O1X D;  3INV A;  4DP3 A;  1AOB A;  4KYA A;  3BHR A;  3IRO A;  4EIL A;  3V8H A;  2G86 A;  3QJ7 A;  1HW3 A;  1FFL A;  1EV8 A;  1BP0 A;  3UM6 A;  1RTS A;  1AIQ A;  4KY4 A;  1B5E A;  1TDB A;  1VZC A;  1AN5 A;  3QG2 A;  1BKP A;  3DG8 C;  1QQQ A;  3K2H A;  1TLC A;  1BQ2 A;  1I00 A;  1NCE A;  1F4D A;  3HJ3 A;  3TMS A;  1TSV A;  4DPD A;  1NJC A;  4F2V A;  2AAZ A;  3H9K A;  3KJR A;  1JUT A;  1TDA A;  4H0U A;  1JMI A;  2BBQ A; 
#chains in the Genus database with same CATH topology
 1F4C A;  4E5O A;  5FCT A;  1JU6 A;  4TMS A;  1TJS A;  4EIN A;  3N5E A;  1ZPR A;  3NRR A;  4ISK A;  4FOA A;  1EV5 A;  1BSF A;  1SYN A;  3BHL A;  3JSU A;  2KCE A;  4FOG A;  1EVG A;  1J3K C;  3UWL B;  3B5B A;  3BNZ A;  3CLB A;  4DPH A;  1BID A;  1F28 A;  4KNZ A;  2RD8 A;  1J3I C;  2G8D A;  3IRM A;  3B9H A;  3DGA C;  4Q0D A;  1TSN A;  5HS3 A;  3UM8 A;  2VET A;  1HW4 A;  1VZE A;  2G8A A;  1JTU A;  4G2O X;  1BP6 A;  3EJL A;  1BO7 A;  3OB7 A;  1F4F A;  1JMG A;  1B49 A;  1VZD A;  1LCE A;  3DL6 A;  4KPW A;  4O1X A;  2TSR A;  3BYX A;  3EGY X;  4GEV A;  5H39 A;  4GD7 A;  1KCE A;  3EAW X;  4O1U A;  4EZ8 A;  4PSG A;  1TSL A;  1KZI A;  4ISW A;  5H38 A;  4O7U A;  2VF0 A;  1BPJ A;  1F4E A;  1JMH A;  3CL9 A;  3EHI X;  4E28 A;  1TSW A;  4GYH A;  4JEF A;  4H0R A;  4UP1 A;  1F4B A;  3IHI A;  4IQQ A;  4FOX A;  4ECK A;  3GH0 A;  1BQ1 A;  1BSP A;  1B02 A;  3I3R A;  5BY6 A;  1TLS A;  1DNA A;  4Q0E A;  1BO8 A;  3EBU A;  4FQS A;  3HB8 A;  3IJZ A;  1TSY A;  1YPV A;  1THY A;  3UM5 A;  3EF9 A;  1LCB A;  1EVF A;  3N5G A;  3KJS A;  2G8X A;  3IK1 A;  1HZW A;  1JTQ A;  3IX6 A;  4IQB A;  4FGT A;  1JUJ A;  1AXW A;  1NJE A;  3BFI A;  1TVU A;  1BDU A;  2TDM A;  1DDU A;  4XSC A;  4G6W X;  1B5D A;  3C06 A;  1HVY A;  3IK0 A;  1JG0 A;  5J7W A;  3N5E B;  3UWL A;  3HBB A;  2G89 A;  2OIP A;  1TIS A;  1SEJ A;  3BZ0 A;  3ED7 A;  1NJD A;  1AJM A;  2TDD A;  2RD8 B;  3IRN A;  1F4G A;  1JMF A;  1FWM A;  1VZA A;  2FTQ A;  1TSX A;  2H2Q A;  1TRG A;  5H3A A;  1TYS A;  1TVV A;  1QZF A;  1NJB A;  2TSC A;  4XSE A;  1TSZ A;  4IRR A;  1TSD A;  3C0A A;  1CI7 A;  4LRR A;  4DQ1 A;  4XSD A;  2FTO X;  4H1I A;  5WRN A;  3BGX A;  3EDW X;  1BJG A;  1VZB A;  4EB4 A;  1BKO A;  1TVW A;  3QGT A;  4KY8 A;  1TSM A;  1KZJ A;  1LCA A;  1NJA A;  1TDC A;  3GH2 X;  2ONB A;  1TDU A;  2RDA A;  2FTN A;  3DL5 A;  3KGB A;  2A9W A;  3GG5 A;  1J3J C;  4O1X D;  3INV A;  4DP3 A;  1AOB A;  4KYA A;  3BHR A;  3IRO A;  4EIL A;  3V8H A;  2G86 A;  3QJ7 A;  1HW3 A;  1FFL A;  1EV8 A;  1BP0 A;  3UM6 A;  1RTS A;  1AIQ A;  4KY4 A;  1B5E A;  1TDB A;  1VZC A;  1AN5 A;  3QG2 A;  1BKP A;  3DG8 C;  1QQQ A;  3K2H A;  1TLC A;  1BQ2 A;  1I00 A;  1NCE A;  1F4D A;  3HJ3 A;  3TMS A;  1TSV A;  4DPD A;  1NJC A;  4F2V A;  2AAZ A;  3H9K A;  3KJR A;  1JUT A;  1TDA A;  4H0U A;  1JMI A;  2BBQ A; 
#chains in the Genus database with same CATH homology
 1F4C A;  4E5O A;  5FCT A;  1JU6 A;  4TMS A;  1TJS A;  4EIN A;  3N5E A;  1ZPR A;  3NRR A;  4ISK A;  4FOA A;  1EV5 A;  1BSF A;  1SYN A;  3BHL A;  3JSU A;  2KCE A;  4FOG A;  1EVG A;  1J3K C;  3UWL B;  3B5B A;  3BNZ A;  3CLB A;  4DPH A;  1BID A;  1F28 A;  4KNZ A;  2RD8 A;  1J3I C;  2G8D A;  3IRM A;  3B9H A;  3DGA C;  4Q0D A;  1TSN A;  5HS3 A;  3UM8 A;  2VET A;  1HW4 A;  1VZE A;  2G8A A;  1JTU A;  4G2O X;  1BP6 A;  3EJL A;  1BO7 A;  3OB7 A;  1F4F A;  1JMG A;  1B49 A;  1VZD A;  1LCE A;  3DL6 A;  4KPW A;  4O1X A;  2TSR A;  3BYX A;  3EGY X;  4GEV A;  5H39 A;  4GD7 A;  1KCE A;  3EAW X;  4O1U A;  4EZ8 A;  4PSG A;  1TSL A;  1KZI A;  4ISW A;  5H38 A;  4O7U A;  2VF0 A;  1BPJ A;  1F4E A;  1JMH A;  3CL9 A;  3EHI X;  4E28 A;  1TSW A;  4GYH A;  4JEF A;  4H0R A;  4UP1 A;  1F4B A;  3IHI A;  4IQQ A;  4FOX A;  4ECK A;  3GH0 A;  1BQ1 A;  1BSP A;  1B02 A;  3I3R A;  5BY6 A;  1TLS A;  1DNA A;  4Q0E A;  1BO8 A;  3EBU A;  4FQS A;  3HB8 A;  3IJZ A;  1TSY A;  1YPV A;  1THY A;  3UM5 A;  3EF9 A;  1LCB A;  1EVF A;  3N5G A;  3KJS A;  2G8X A;  3IK1 A;  1HZW A;  1JTQ A;  3IX6 A;  4IQB A;  4FGT A;  1JUJ A;  1AXW A;  1NJE A;  3BFI A;  1TVU A;  1BDU A;  2TDM A;  1DDU A;  4XSC A;  4G6W X;  1B5D A;  3C06 A;  1HVY A;  3IK0 A;  1JG0 A;  5J7W A;  3N5E B;  3UWL A;  3HBB A;  2G89 A;  2OIP A;  1TIS A;  1SEJ A;  3BZ0 A;  3ED7 A;  1NJD A;  1AJM A;  2TDD A;  2RD8 B;  3IRN A;  1F4G A;  1JMF A;  1FWM A;  1VZA A;  2FTQ A;  1TSX A;  2H2Q A;  1TRG A;  5H3A A;  1TYS A;  1TVV A;  1QZF A;  1NJB A;  2TSC A;  4XSE A;  1TSZ A;  4IRR A;  1TSD A;  3C0A A;  1CI7 A;  4LRR A;  4DQ1 A;  4XSD A;  2FTO X;  4H1I A;  5WRN A;  3BGX A;  3EDW X;  1BJG A;  1VZB A;  4EB4 A;  1BKO A;  1TVW A;  3QGT A;  4KY8 A;  1TSM A;  1KZJ A;  1LCA A;  1NJA A;  1TDC A;  3GH2 X;  2ONB A;  1TDU A;  2RDA A;  2FTN A;  3DL5 A;  3KGB A;  2A9W A;  3GG5 A;  1J3J C;  4O1X D;  3INV A;  4DP3 A;  1AOB A;  4KYA A;  3BHR A;  3IRO A;  4EIL A;  3V8H A;  2G86 A;  3QJ7 A;  1HW3 A;  1FFL A;  1EV8 A;  1BP0 A;  3UM6 A;  1RTS A;  1AIQ A;  4KY4 A;  1B5E A;  1TDB A;  1VZC A;  1AN5 A;  3QG2 A;  1BKP A;  3DG8 C;  1QQQ A;  3K2H A;  1TLC A;  1BQ2 A;  1I00 A;  1NCE A;  1F4D A;  3HJ3 A;  3TMS A;  1TSV A;  4DPD A;  1NJC A;  4F2V A;  2AAZ A;  3H9K A;  3KJR A;  1JUT A;  1TDA A;  4H0U A;  1JMI A;  2BBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...