4FQZA

Crystal structure of a protease-resistant mutant form of human galectin-8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
291
Chain Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 61
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fqzA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fqzA02
3AP6A 2GMMA 3I4IA 4YW4A 1WCSA 2JE9A 4CRQA 1X50A 4Q8LA 3SISA 1QF3A 2CL2A 1A3KA 1IKPA 4YZ5A 1LOAA 3VUOA 3ILFA 3WG1A 3VKFC 2P34A 1SCSA 2ARBA 3AZWA 4FPKA 1QDOA 2I2SA 3WHUA 4FPGA 4Q26A 3SITA 2YY1A 1FV2A 1JUIA 3B69A 4ZKTB 1W6OA 1DQ1A 3B9CA 1MZ6A 5JLVA 4PF5A 4ASMB 3OY8B 1A78A 2G4IA 2ZA9A 3FLTA 3M3CA 1CN1A 1DYKA 1LHOA 1LOFC 1W0PA 3INAA 4GA9A 4LBMA 3SH5A 1CR7A 1S0EA 4Y22A 5JMCA 4XTPA 4AWDA 5KXEA 3IPVB 1ULCA 2UU8A 3ILNA 1S1AA 1ZM1A 2R1DA 3PVNA 1QNYA 4M3CB 4ATEA 1JYIA 5EXOA 2KM2A 3WDWA 5CNAA 1BKZA 1VAMA 2OW4A 1C4RA 3OBTA 4K21A 3SH3A 2EXIA 1WUVA 5GLWA 2D6OX 2GMEA 2E7QA 2H0BA 4IQPA 1ULFA 3ASIA 4AGGA 4YZ1A 3V65A 2R49A 3A4UA 1S0JA 1LU1A 4UW4A 1SBFA 3T2TA 5EWSA 3IN9A 3WDTA 1VALA 5L73A 4OZXA 1W6MA 2BQPA 1URXA 2PHFA 1AXKA 2YZ4A 1SLTA 1UPSA 1GANA 4XYXA 4AVTA 1PZ8A 3AZXA 1CVNA 1G9AA 5H9PA 2P3KA 4Y26A 1LESA 2ZHMA 1N1YA 1RIRA 4FQZA 4YM1A 4CTEA 3HMYA 2ZABA 1QOOA 4XE9A 1KDKA 1NXD1 3IKWA 1LHUA 5DXDA 3PMEA 1HLCA 4M01A 5GLVA 1DYPA 2EAKA 3M2MA 3WUDA 3W59A 4PBPA 4P9WA 2ZZJA 1FYUA 1SLCA 5GM0A 4W65A 1N3OA 2DU0A 4BQ1A 5JOXA 2LTNA 1YI7A 4JRAA 3WG2A 3A0KA 5DG2A 3BODA 4H55A 1YIFA 3IM0A 2A5ZA 1G9DA 1GSLA 1SACA 4U2AA 1YO8A 1S0BA 1OFSA 1N1VA 3NV3A 1DBNA 4LBLA 4XBQA 4XJ9A 3ZXFA 4BMBA 4TZDA 5GZGA 1IS4A 2ZGOA 1H9WA 4YZ4A 1I3HA 2ZHNA 4YW3A 1RINA 1DLLA 2P3IA 2VW2A 1SLLA 2DVFA 5GLTA 4XBNA 4HL0A 2NM1A 1JW6A 2WQZC 1S0FA 3R05A 4FOYA 4K1ZA 2P3JA 2WJSA 4Q1PA 3OYWA 2A3WA 3AYDA 1IS3A 1V6NA 2PELA 1GNHA 3PVEA 2ZBJA 2W08A 1GYKA 3FLPA 1FNZA 4WVWA 4YGBA 4NOTA 2YV8A 1GKBA 1W6QB 3Q9OA 4P14A 4XJUA 5T50A 3V0AB 1N1TA 3VKNA 2JKBA 4XDQA 2A6WA 1LULA 1JHNA 3AP5A 5F9TA 1MS3A 3WV6A 5DZEA 4FPCA 1LEMA 5T5PA 1HDKA 2FMDA 2NMNA 2ES3A 3CNAA 3BTAA 1DQ2A 4AGVA 1WLDA 2VXRA 5BYNA 1I1EA 2DVAA 1IS5A 2A6XA 3N7LA 1N47A 5DG1A 2ZGTA 3OJBA 5GZCA 3MEPA 4KBBA 1CIWA 1W0OA 1VIWB 2HYKA 1BJQA 3FBYA 5E8AA 3PVOA 5H9QA 2WSVA 5IUQA 1DQ4A 5DZFA 2VW1A 2ZHLA 1UKGA 1LEDA 3D4KA 4JC1A 4UW3A 4Y1UA 4K1YA 5HCBA 1DGLA 3SLIA 1C57A 5FREA 2UWCA 1V6MA 3AYCA 2OVUA 4ATFA 3AX4A 4GALA 3ENRA 3FLRA 2E7TA 4P9YA 2DUQA 1LOBA 5T5JA 2ARXA 1S0GA 5CAZA 4Y20B 4NO4A 5CBLA 2V5YA 1UZZA 3WCRA 3WUCA 3ATGA 4XJAA 4C1WA 1JOJA 4Q2FA 1WBFA 1J1TA 3WDVA 2D43A 2WSUA 1WLCA 2AGSA 1SBDA 2OUJA 3AYEA 3NV2A 2ZHKA 3GNEA 3LCPA 4Q27A 2UURA 4YM2A 5JVVA 1LJ7A 1W6PA 1ENSA 1JXNA 5DZGA 1ULDA 3N7KA 1S0IA 2JDZA 4ZXKA 1V6OA 1UL9A 3A0NA 2D6LX 2EXHA 2GDFA 4BMEA 1CESA 2CY6A 3M3EA 4GKYA 4AVVA 5JOYA 2D6MA 1JN2P 2DV9A 2W39A 4YZ3A 4WVVA 1C1FA 1B09A 1DZQA 4XBLA 3KQRA 4LBQB 3LSEA 4Y24A 2AREA 2CWMA 3POSA 4FPOB 3L2YA 1D0HA 4DRVA 2P2KA 3VKMA 3HR9A 4GWMA 3POYA 4BLIA 3ZYPA 1LGBA 3V0BA 5GALA 4AYUA 1GZ9A 1WD3A 1W6NB 2E51A 4XJWA 3WDUA 3O0WA 1VAVA 3USUA 1LENA 2D3SA 4YGEA 3MPPG 5EYYA 1QGLA 1GZWA 3ZXLA 1GLHA 4FOQA 1LHWA 1LOFA 3RQ0A 5T54A 1BYHA 1R1ZA 2D3PA 1BXHA 2R1BA 2FHRA 2VH9A 4GWNA 3ZPYA 1WLWA 2D44A 5E89A 3ZSKA 4YG0A 1Q8SA 4XMIA 1D2SA 1FV3A 2C5DA 5JOZA 1F9KA 2WT1A 1ZA4A 2A6ZA 2SBAA 5LK5A 3D6EA 2EIGA 1UZYA 2A3XA 1O4ZA 1ENRA 4XZPA 3WOGA 3T1MA 3ZXKA 1FNYA 4R9BA 3QLQA 1JBCA 1SLIA 1Q8OA 4XHBA 2A6YA 1QOTA 3VKLA 5FRAA 4C1XA 1V00A 1O4YA 2JJ6A 1HQLA 1LGNA 1HQWA 1AVBA 1AX1A 3AP7A 3R4UA 2YROA 3RMXA 1Q8VA 2OUHA 1QNWA 2ZMKA 1WBLA 2UWAA 1EPWA 4JCKA 1Y7BA 3FFZA 2JECA 3AJYA 4YFWA 3IMNA 1KRIA 4XILA 1GICA 2A71A 2DURA 4F83A 1S0DA 1KQRA 1CJPA 4FPEA 2R0HA 4GXLA 5DUWA 5EYXA 2AYHA 2NYYA 1W6OB 4K20A 3OPZA 3AJZA 2ERFA 2DVDA 3AP9A 2GN7A 2ZMLA 2VY0A 3OY8A 5DUVA 3RSJA 3QCWA 1DQ5A 5GLZA 3N35A 2Q5TA 2YMZA 2ZKNA 1KJRA 2ZMNA 2EXKA 1LHVA 1LTEA 1S0CA 4UW6A 2DVBA 4Y22B 2A75A 3AFKA 3IPVA 1F31A 2R0FA 3RS6A 4M3CA 2GALA 2ZGNA 3O5SA 4FPHA 5T52A 1CONA 1DFQA 3LSDA 1GBGA 2DUPA 1QMJA 1SBEA 2E53A 5H9SA 4RA0A 4Z8BA 4YG3A 1MS0A 4DFSA 2JE7A 5JOWA 4Q8KA 2PHUA 3RG0A 1DQ0A 4BPZA 1AXYA 1U0AA 2GNMA 2NMOA 1LU2A 1F5FA 2ZGLA 4FPJA 4Y1ZA 4AVSA 1V6LA 4CZSA 1WW5A 2EALA 2A70A 4ISQA 2XG3A 4Y1YA 1LOCA 4M00A 1LOGA 2GNDA 1W6MB 2RHPA 4LBKA 3FUQA 4LBNA 4UW5A 3M1HA 5E88A 3T1LA 5GLUA 3UL2A 1C1LA 4YM3A 1LGCA 1PZ9A 3ZYRA 1PZ7A 3VV1A 1LHNA 1GV9A 3ZVXA 3H0OA 1HKDA 5HCFA 2UWBA 2JD4A 4BM8A 4XXPA 2SLIA 4FPFA 4XJ8A 1AXZA 2EXJA 3N7MA 2R16A 1Q8PA 1V6JA 3WHTA 4AGRA 1N1SA 2DU1A 4I30A 2ZGUA 4XXAA 3SNMA 3MW3A 2Z42A 3KM5A 4TYSA 4YM0A 2WKKA 4XHXA 5GZFA 1MS4A 5CB7A 1G9BA 3UJOA 3M3OA 5IK4A 1Z78A 1KITA 2XB6C 5IT6A 5IK8A 3GALA 5GJ6A 1G9CA 4WZFA 1H30A 3TB0A 4D69A 3FUOA 1AF9A 3AK0A 3O12A 2C9AA 2D6PA 1G8WA 3MW2A 4DS0A 1WW6A 3N3HA 1CQ9A 4YZ2A 2WNEA 1KJLA 2CYFA 2W68A 2DWRA 3NV4A 1LCLA 2TEPA 3VKOA 3I8TA 4M3CF 2AENA 2ZGPA 2A7AA 2DTYA 2PHXA 4HANA 4MYEA 3OYWB 1ENQA 1WD4A 3V64A 2W52A 1YYNA 3NV1A 1G7YA 1KDMA 3AP4A 1AJKA 3POWA 4GKXA 1G86A 1CPNA 3N7JA 1W6QA 3SH4A 4YG6A 3V0AA 1N3PA 1IOAA 3ZSLA 3WZ1A 4L8QA 3MW4A 4U36A 3PJQA 4XIKA 4BOWA 3B3QE 3NWKA 2WLQA 1DHKB 3R4SA 4PBOA 4PQ9A 1IKQA 5T55A 2ZAAA 3UJQA 4DPNA 3WLUA 2D6NA 1DIWA 4YFZA 2NP0A 2DVGA 4Y1XA 3ZSMA 3BOPA 3WCSA 4XIOA 4DRRA 1V6KA 3WVJA 4RL7A 4PCRA 5T5OA 4Q1RA 1MZ5A 1ULEA 2NN8A 2ZGQA 3ZSJA 1YRZA 3M3QA 1AX0A 2D6KA 1WW7A 4ITCA 1OQ1A 2V73A 4LBJA 3ZXEA 1MR5A 4Y1VA 2A3YA 3C2UA 4ISRA 5DUUA 1FATA 4FOWA 1UN1A 1FX5A 2B7YA 5SV8A 2AR6A 1UMZA 2WT0A 5KXDA 2CWSA 2ZGSA 4LBQD 5GZDA 4Y20A 1SLAA 1Q56A 3JU9A 3RRDA 3WNXA 4YGDA 1IS6A 4FPLA 4YLZA 1MACA 2CNAA 5IK5A 1ULGA 1GZCA 1MS8A 1QKQA 2ENRA 2VU9A 2VUAA 3AXDA 1UAIA 3DGTA 1AZDA 4YW5A 2D7FA 5DUXA 3N36A 4YW1A 1OKQA 1A8DA 1W6PB 1QU0A 2P37A 2CTVA 1H9PA 2GNBA 4FQ4A 2GMPA 2PHWA 1MVQA 3O0XA 2GNTA 1MVEA 1QDCA 1VLNA 3HN1A 3AZVA 4P9XA 1TEIA 3BIWE 4DQAA 2GN3A 2DYCA 2NZ9A 1UX6A 3ILRA 4R9DA 2PHTA 1SCRA 3D5OA 4LBQA 4FOVA 4FPYA 3WG3A 3TAYA 2DUOA 2A6VA 4XMAA 1Q8QA 1RITA 3WG4A 2D3RA 4M3CE 5GZEA 1CPMA 2EF6A 1LODA 1SLBA 3UK9A 3OGGA 2AUYA 3WDYA 3ZXJA 5CA6A 2LALA 2WT2A 3OBRA 5JDBA 3V0BB 1W6NA 4LBOA 5AVAA 1DQ6A 1NLSA 1Z0HA 5HCAA 3AZYA 4FP3A 2VW0A 4XTMA 3USUB 1GZWB 1JYCA 1SFYA 1WW4A 5KXBA 4WV8A 5IK7A 4XJZA 1FAYA 2YXSA 1AJOA 1YXWA 3RMYA 4BLJA 3WDXA 5KXCA 4FVVA 2ZGKA 1LOEA 5H9RA 1APNA 3U4XA 1LECA 1V6IA 5T5LA 2ZGRA 4SLIA 1QOSA 1MS1A 2AH2A 1MS9A 3JUUA 3W58A 2E6VA 4R9CA 3B01A 1G9FA 3AXEA 1AX2A 3AYAA 3DUIA 2DTWA 4YW2A 1XQNA 3AZZA 1ONAA 3O0VA 4FP2A 1GNZA 2ZACA 2ZGMA 5F5QA 3APBA 2PHRA 4R9AA 1BZWA 1N3QA 3B00A 4YGCA 1MS5A 1BQPA 4XOGA
chains in the Genus database with same CATH superfamily
1CAXA 3I4IA 1SQ4A 2VPVA 4IEQA 3PIJA 1Y3TA 2GC0A 2CL2A 2K0GA 2FZ2A 4CCCA 1NZCA 4ASKA 5FZBA 1AL0G 1LOAA 3M7AA 4YZ5A 4JVAA 3D8CA 1RGSA 2IXCA 3IMMA 4FPKA 3OPTA 4KNCA 5FLIA 2HYXA 2RJ2A 5AFEA 5F8PA 2W87A 1K12A 1AYN1 3IAQA 1JUIA 2LUWA 4HSJA 1W6OA 1DQ1A 3MLKA 4JV4A 2QQNA 2XUEA 4PF5A 4E4SA 1VRH3 4GH4A 4MGSA 4ES8A 2JG8C 3K51A 5KWRA 2Y6HA 2G4IA 2HWE3 3FLTA 4QPIA 4D0QA 1DYKA 1W0PA 4MV2A 1DYOA 3INAA 5IVBA 3JBG2 5C5UA 3ZXAC 1CR7A 2PQSA 1XNAA 3SKVA 1S1AA 3PVNA 4ATEA 2WZR3 4DXZA 3T0AA 2KM2A 5CNAA 1VAMA 1YCIA 3U78A 1WMDA 4LHSA 4LT5A 2ZEXA 1C4RA 3SH3A 2DBNA 5GLWA 3H8OA 5A7OA 4IQPA 1ULFA 1VBD3 2HWD3 5DMYA 4YZ1A 2IUWA 3CHXA 4LKFA 1AR63 1VBB3 4V1PA 3T0BA 4PDWB 3V65A 1SBFA 3KCCA 2X5IB 3TN91 5A1AA 2YGLA 1QQP3 3NW4A 5EWSA 2RR11 4MHUA 5FZ3A 1VALA 3I2KA 4OZXA 2WO2A 2VMIA 1W6MA 3I49A 5BNNB 1AXKA 2VMEA 2YZ4A 4UWDA 3VD5A 3OGSA 1GANA 1AHSA 5BXXA 3LEKA 3RYKA 1NY72 4AVTA 5AC93 5FZ7A 3JB8A 1PNGA 1JYNA 5H9PA 1DP0A 4CTEA 1LESA 1ND3A 1C5HA 1N1YA 1FPN3 1US2A 2D5FA 2ZEZA 5F2WA 5KC6A 4HZFA 3DF0A 2WUHA 3C7EA 2I74A 5DXDA 3PMEA 5GLVA 2GC1A 1DYPA 1YQ2A 3QBQA 5CIRA 3W59A 4PBPA 1DF0A 5A1FA 4P9WA 2ZZJA 3T09A 3M8LA 4M0NA 4JGZB 1FYUA 4FI9A 1Z7S2 1BK0A 3MLLA 3LFMA 3WINE 1GMMA 2JB8A 2KXLA 1O4TA 3MV11 1OUSA 3TNPB 3A0KA 4IV1C 4H55A 3CL1A 4CCMA 3IM0A 1XE0A 1SACA 4U2AA 4UAPA 1UMIA 1YO8A 1S0BA 1UYYA 3IIAA 4PHZA 1N1VA 4TSVA 1LKNA 1DBNA 4LBLA 4XBQA 4AFAA 3O1SA 1AYM3 1UF2C 1RXFA 1G6NA 4LKSA 1IS4A 3WP5A 3A22A 5FYSA 4H7LA 1HX6A 1RINA 3OG2A 4XFCA 2OIIA 1JZ3A 4CDWA 1ZRDA 3NKTA 2BBAA 5L9VA 5GLTA 1JMUB 1K5JA 4JHTA 1GNYA 4RGKA 1K42A 2NM1A 2WQZC 3I2GA 3HEIA 4YWAA 4Y3OA 4K1ZA 2J7MA 4IEOA 5FP7A 4LO5B 4QPGB 4OHZA 1IS3A 5BNOB 1OKOA 1EAH2 1GNHA 4AI2A 4IW3A 1VBE3 3WX5A 2YPDA 5C8CB 1HB4A 5L9RA 1U5ZA 4YGBA 4CPBA 3JZVA 1VBC3 5I0SA 4A44A 5T50A 2FD8A 1N1TA 4XF3A 5JIUA 2JKBA 3ZPOA 3JQXA 2A6WA 3T4HB 5G04L 5T3NA 3OPWA 2JD9A 2RM21 3JB4C 5T5PA 1OOPC 1VE0A 4BQWA 3CNAA 4LORA 1HN0A 1WLDA 4OVEA 2CV6A 2DVAA 1IS5A 4QXKA 2XVKA 4MXWA 1N47A 3VDDC 1XNTA 3HQUA 3OJBA 4K6BA 5GZCA 3MEPA 3O1RA 2HYKA 1DGRN 3FBYA 1BJQA 5FKBA 3UNPA 2HWC2 5DZFA 1PGSA 4CXXA 2VW1A 4CUCA 4QQOA 3SLIA 1Y9GA 4CEYC 3ETPA 3POJA 4K1YA 2BERA 2VL4A 4GMP0 3BTXA 3T30A 2VVEA 5DAXA 5FTTC 4LO7A 2FDKA 2W5FA 2OQ6A 3WQ1A 4P9YA 4C91A 2YU2A 2DUQA 3NKGA 1I5ZA 1S0GA 3GBGA 5F39A 4Y20B 5CAZA 5JPNB 5CBLA 2D98A 5EHDA 2ZEYA 3OUHA 3WUCA 1F8VA 1AR61 3I2FA 4K40A 1CAVA 4L99A 1ZVFA 4Q2FA 3VBUC 3WDVA 5LWBA 2D43A 3FHIB 3S30A 4UFJA 3DL3A 5FZCA 4ZXEA 2Y6KA 2OUJA 5FZGA 3AYEA 5C4WC 4YM2A 4OLLA 3NSTA 4GB32 1LJ7A 1JXNA 2VOWA 4L0PA 3HBZA 5DZGA 5FY0A 4KGGA 5AC91 3N7KA 2BW8A 5FK7A 3ZFGC 1NE6A 2VUJA 1OF4A 2ET1A 1M06G 2CY6A 1UZ0A 1SFPA 1ZBA2 2D93A 4E9KA 1UZVA 1UOFA 1PK6B 4YZ3A 3ACFA 3WF4A 2XL7A 4W4ZA 4XBLA 1DG6A 4RGAA 3KQRA 2BJSA 1W2NA 4WVMA 2WAOA 1QXJA 3GCWA 3MIGA 1TZOA 4HKOA 1RHI3 3T4VA 4XF9A 3VBOB 3GBWA 3UGHA 3MICA 2X29A 1DZRA 2D97A 3HR9A 4BLIA 4I0WB 1LGBA 4QX8A 5DDJ2 3LDBA 2BVBA 5CFDA 5LA0A 2VXJA 3J7LA 3VZNA 3OTFA 1SEFA 4X6QB 5A7NA 3O0WA 3NNJA 4LA3A 2Q8DA 3LGRA 3WDUA 4PJYA 2IFRA 3BVCA 2D3SA 4YGEA 5EYYA 4KG8A 3KV5A 5IVYA 4UFHA 3ZXLA 1LAJA 3ZSEA 1LOFA 3IB3A 3RQ0A 2O0OA 1BYHA 1R1ZA 2D3PA 3PUAA 2R1BA 3ZPYA 4V2WA 1WLWA 1W2UA 2VAUA 4YG0A 3ZSKA 1RUC2 5JCTA 2Y6GA 1YHFA 1FV3A 3ZMNA 1MPXA 3BU7A 2QQVA 2Q8OA 3SC7X 1IG3A 3IAPA 3ALQA 4E2SA 1O4ZA 4NN0A 1D0GA 2WINB 1FNYA 2R042 4QXHA 2JDYA 1K5MB 2UYBA 1JBCA 3KHBA 1OT5A 2HWB1 2R063 1QOTA 3QLQA 1PIV1 5FRAA 5FY7A 2OX0A 2JDUA 5I8TA 1U5YA 1OLMA 1VB2A 1XYOA 4WM8C 2KA3A 2J1TA 3ETQA 1TME3 2BGPA 5IFTA 1HQWA 1D2QA 3OGJA 5JSRA 1NCRA 3VDAA 1D4M1 1ZBE1 2UY8A 2WFF3 4RS5A 4GQ7A 1ZZ8A 2BPA2 2QQKA 1Y7BA 5F6LB 2X8KA 4ET7A 1RUD2 3CJIA 3NAPC 3AMHA 4OHVA 1GICA 2R071 1S0DA 3WF0A 1AL23 3GZUC 1KQRA 4UFLA 5LBCA 5E1RA 1ZRCA 1OQEA 2ATFA 2VZUA 4GXLA 3N9OA 2AYHA 2NYYA 2VZOA 5DUWA 4AQTA 4LEJA 2ERFA 2JE8A 3RSJA 2P5BA 4Q0SA 5GKAC 2Z5WA 2YMZA 1ZZBA 4EZHA 5FZKA 1QJX1 3GDBA 4UW6A 3PURA 4Y22B 1MQTC 3HNYM 3AVRA 2A75A 4R4ZA 4JTOA 3CU7A 4IDZA 1HJFA 4E2GA 2WNUB 2GALA 5FZ9A 4D7YA 4OQ8A 1QMJA 3PDQA 5ACA1 3KB5A 1MS0A 1VBA1 4NRPA 4EN6B 3PJYA 2AEYA 2EIEA 3KV9A 1JZ2A 5HCHA 2PHUA 2PQQA 2DCKA 2ADDA 3ZXGA 2W94A 4BPZA 4XUQA 1RC6A 4XQ4A 4LK6A 4FPJA 4XPVA 1UOGA 1NCQA 2GZWA 4B4PA 1XPWA 4Q5OA 4CA9A 1NX9A 2BUKA 1UX7A 4M00A 1CAWA 5FP3A 1PMIA 3BALA 3H7JA 5GLUA 4YM3A 1C1LA 4D7SA 4BIOA 2BOIA 3H50A 1H4GA 4PF1A 3ZVXA 2JD4A 3MHZA 4N90A 5K9YA 3VDCA 1AXZA 1EV11 3N4MA 2GC3A 3PUQA 1W39A 4BCUA 1C3HA 5A7WA 4A42A 2DBIA 1U5XA 4O61A 3MW3A 2Z42A 3KM5A 1A6CA 3ZOIA 2WKKA 4QPWA 2DCTA 1MS4A 1H0BA 3CLPA 1YFYA 4OHWA 4GH4C 5CB7A 3UJOA 2QCSB 1Z78A 4DEVA 2BWCA 2XB6C 4QPIC 1NA1A 1IGOA 4S2DA 3PUSA 1W28A 3TB0A 1H30A 5D2AA 1AF9A 3AK0A 1FOD3 5LASA 1QHDA 2D6PA 1HRV3 5I91A 2WZEA 3ZN4A 1WW6A 3AKSA 3N3HA 3SQOA 2VMFA 3DYMA 4YZ2A 1H8TA 3D0SA 4Q4V1 1BEV1 3DV8A 4Z2WA 2W1QA 3NV4A 4XDPA 1LCLA 4BIFA 4HFSA 1TME1 1IPJA 1XU1A 4H14A 3WP4A 1QJFA 1W9FA 3W5MA 1VBE2 2F6BA 2OA2A 1UMHA 2TBVA 3NV1A 1KDMA 4GKXA 1AJKA 4UYBA 4HLTA 2G9GA 1TVGA 4XZUG 5DPNA 2Q8EA 1V9U2 2BU9A 1W6QA 4YG6A 2XHNA 3VDBA 1AL21 1IPKA 1QH6A 3WZ1A 3VLBB 2W46A 3GCXA 1ND3C 2VZRA 3I7DA 4L8QA 3PJQA 4XIKA 4IEVA 5A3NA 3NWKA 2JIJA 1DHKB 4PBOA 4PQ9A 5FZLA 2F17A 4DPNA 5LBFA 2YPJA 3TOJA 1R1A3 4XIOA 4URTA 1PO13 4GMP3 5BNQA 5J48A 4RHV2 3NVCA 4CP2A 1JZ7A 4RL7A 4A7KA 5A3UA 2QFEA 2QQWA 4Q1RA 1ULEA 4CDXB 4CP9A 1ZYBA 2IXLA 3UYJA 3VHOA 1HXS3 3FFQA 4LBJA 2ZS6B 4GJZA 5E16A 3RNSA 2Y64A 4HBNA 2RS52 3C2UA 3HPNA 1JS9A 1UN1A 4KH9A 1W8TA 1XNDA 1JTZX 4IXLA 4XURA 3WY6A 1W8HA 1X9PA 3EQEA 3PU3A 2XUMA 3R0RA 3RI9A 3VL9A 1HRI1 1J1LA 3TBDA 1GP5A 4XFAA 3U4SA 4CCOA 2DF7A 4CDWC 2H0VA 4FPLA 4YLZA 5LW9A 1GZCA 2PHDA 1QKQA 2VU9A 3AXDA 3DGTA 3PIGA 4COVA 4YW5A 3T08A 3WEZA 4GAZA 4KG0A 4Q4Y2 1ODNA 4YW1A 1ACCA 4IETA 2HBTA 3RWNA 1H9PA 3BB6A 5JMOA 5FY8A 1MVQA 2K46A 3AKRA 4G4FA 3WQ7A 4O65A 1QDCA 1VLNA 2C6SA 3J8F2 4LUKA 1W8NA 3NJZA 3MBWA 1BVP1 3I2DA 1ZRFA 3BIWE 4DQAA 2GN3A 2X10A 1AR92 1UX6A 1VMFA 3ILRA 3JBG3 3OGRA 4HSLA 2VULA 4DY3A 4LBQA 5FCCA 4A41A 1X7NA 3C7GA 3H7YA 4IL7A 3TAYA 3WG4A 2QQUA 1UWWA 2QDNA 4N43C 5GZEA 1LODA 3OGGA 3HOBA 4FFGA 1JZ6A 4YPJA 1X9TA 1SPPB 1I9RA 2VO5A 4Z07A 2BFUS 3OBRA 3URFA 5JDBA 3IDEA 3NNGA 1FOD1 2C4XA 5A6ZA 1BMV2 2BYVE 2XWJB 1NLSA 5HCAA 3USUB 2JG8B 2W92A 4LULA 4XTMA 4MUVA 5LATA 1C8M2 3RYRA 5C8WA 1O59A 4JKLA 1PGW1 2W95A 4XJZA 4QKBA 3H1YA 1AJOA 2EAAA 5FPZA 5KXCA 1AR72 4FVVA 4QHOA 1H1IA 1LOEA 4X8PA 3U4XA 4DO0A 2ZJCA 1LECA 1V6IA 2RS12 2ZEWA 4EJRA 2BOJA 2ZGRA 1KGYA 1HB1A 5LA2A 2XJPA 1C8NA 1POQA 2AH2A 1MS9A 3POBA 2BTVC 3B01A 4R9CA 2QQMA 3AYAA 4I0AA 3SCFA 4LTAA 4INDA 4BISA 4C0HA 1XQNA 3AZZA 3B7MA 1MZFA 2FMYA 4FP2A 1GNZA 4NE9A 2ZGMA 1J59A 3D3AA 5IAXA 3JD71 4R9AA 1Z7S3 4RFRB 5FK8A 2V09A 1ALYA 2PAKA 2KD7A 4YGCA 5A3PA 4YW4A 2GMMA 1WCUA 1WCSA 2XWBB 3WNNA 1DLCA 1SDWA 3KV6A 4NHXA 4GMP1 3SXWA 1IKPA 1RUJ2 2EA7A 5ABJA 1STMA 3PHMA 4QAWA 4RFT0 2P34A 3JXSA 1F15A 3VKFC 4AAXA 4KGQA 3AZWA 3JCIA 3VBSA 3WHUA 3C7HA 4FPGA 4RR3A 4IV3A 4HG6B 3FN9A 2VNOA 3I54A 5JWPA 5CFDC 3O1TA 4AL9A 2VBBA 3B69A 1TE1B 3B9CA 4LOTA 3I3EA 3TYJA 2RDRA 1TMF1 4NPRA 1HIXA 4ASMB 1EAH3 3IZOA 4IV1B 4GZ9A 5FP9A 1LOFC 1Q5OA 4AFBA 1OHFA 4Q4W2 3O7OA 2CU5A 4Y33A 5BY5A 3K3OA 3DXUA 3VD4A 2X05A 1BBT2 1REDA 1ZM1A 3ILNA 3SKJE 5L36A 4M3CB 1VR3A 3VBHA 3GZTB 1BKZA 2WO3A 2XPJA 5A7PA 3FX3A 3OBTA 4L92A 2O14A 1WUVA 5DABA 4JGYA 2H0BA 2XLAA 4AFDA 3K4AA 1UY4A 3ASIA 3LA3A 1S0JA 1EUUA 1QXRA 2HWC3 1XBFA 3T2TA 3OCPA 3FWEA 3ABZA 4DNYA 2BQPA 1RYYA 4O9GA 1NCRC 2YUEA 1UPSA 3GJAA 4RS5C 1FI2A 1D7PM 4N7IA 3LEIA 1G9AA 1H2LA 4LE3A 2O8QA 4BQ3A 4BXFA 3CJIC 3FHQA 4QWNA 1OOPB 1JYXA 1RVF2 3C3VA 1YJLA 3O1VA 3KT1A 5C9AA 1NXD1 5FY5A 3VDDB 1LHUA 4G9SB 3SHRA 3W21A 2VTXJ 5CEHA 4AFCA 1E5HA 3M2MA 3WUDA 4CEWA 3KQ4B 1TNRA 4TWTA 4ZHNA 2QZ2A 3MYXA 3ZFFA 5FZ6A 1YFWA 3SEPA 4W65A 2DU0A 4CEYB 1HB2A 2LTNA 4NIGA 5ISLA 5CZKA 3H42B 5DG2A 4CPBD 4NIHA 4NIDA 5BNPC 1OFSA 5LRSA 1OH4A 1ZBA3 2ET7A 2XBO2 1L7QA 2JB4A 3LAGA 4XJ9A 3ZXFA 4BMBA 5GZGA 2W2IA 3KD4A 1RUE1 1H9WA 2ZHNA 1KFUL 3FJSA 1WZXA 2RV9A 1QJY2 2VW2A 3VBUB 2P3YA 4FAHA 2DVFA 5FO8B 5C4WB 3R05A 4FOYA 4P00B 4K3UA 4Q1PA 2A3WA 3CDZB 1ZZ7A 1GUIA 1RUF2 2PELA 2VCCA 2ZBJA 3PVEA 1NCQC 5DDJ3 2W08A 5AVPA 3USSA 1GYKA 3ZFGB 3R4DB 2VCMA 2EIDA 2YV8A 1GKBA 4P14A 2C26A 3IWZA 4QX3A 4NR1A 4XJUA 1GZTA 5C3RA 1R091 2XJSA 4IE0A 5F9TA 3AP5A 4URAA 3PLQA 4DZGA 1EPZA 3AMMA 4MLOA 5DZEA 1J83A 2HWF1 3ZM8A 1Q3EA 2BGCA 5JSOA 2QBXA 3DCQA 3BTAA 2ES3A 3N9LA 4R52A 3HT1A 5BYNA 2VXRA 1RUC3 3AKQA 1W04A 4Q4X2 2VG9A 2AEZA 3VZMA 4XCAA 5DG1A 3D0JA 1PX4A 2VQTA 3E1F1 1YIPA 1CIWA 1W0OA 1Y4WA 5E8AA 2WSVA 1H4HA 1DQ4A 4UFMA 2VJXA 2XL9A 4XVHA 4QQHA 4Y1UA 5CU1A 4UW3A 2R043 1C57A 4I01A 1NA1C 4AG4A 2UWCA 1V6MA 4QDRA 1JZ8A 3ZDVA 4JRLA 3MDPA 4ATFA 3ENRA 1XJAA 3FLRA 1JZ5A 1WA4A 4YRDA 4P9LA 4A6SA 1LOBA 2ZKLA 4CDQA 2ARXA 2WNVA 4RGGA 4NO4A 3B93A 5JPMB 2VQUA 2V4AA 2V5YA 1H8TC 3HVDA 3RJ2X 3POIA 1YC61 4C1WA 4EYUA 1JOJA 1L3JA 1RUD3 4MGQA 1WLCA 1XU2A 4META 2AGSA 3F95A 4I09A 3NV2A 4QHBA 3LCPA 3P1IA 3GZEA 3RPQA 2UURA 4NVPA 5FZOA 4AI8A 5LBBA 5JVVA 2WS92 4YARA 1W6PA 4E4DX 2G1MA 3GJBA 5A3TA 3A0NA 1WCDJ 4HKLA 1RUI1 4AK3A 4S2FA 1CESA 1VAKA 4WM8B 1FMD2 4GKYA 2ARCA 1RUOA 3CJXA 2PA7A 4AVVA 5JOYA 1JN2P 2W39A 3HNMA 4ZS3A 3FE5A 1C1FA 1B09A 3P3NA 5F32A 1Y9QA 5A3OA 5HBAA 4YVSA 3NAPB 3PNAA 1OH3A 5FZ8A 2ORZA 3J4UH 4Y24A 2AREA 4GB31 2CWMA 5F3IA 4FPOB 4DUVA 1OPOA 2YGMA 3LOBA 5FUPA 1HQNA 5FMOS 3I97A 4A7ZA 3ZKYA 1CX4A 1HV1A 4AYUA 1WD3A 3TEXA 3ZO0B 1W6NB 4KU7A 3B9IA 5B4NA 2GH2A 1WKYA 5DQ0A 4CVUA 5B2GB 1VAVA 4N9IA 2IZWA 1VJ2A 1LENA 2PLV2 5LZ6A 3MPPG 4XFGA 1GZWA 3ZDSA 4LO4B 4FOQA 1LHWA 5A1LA 2IXJA 1UCXA 2ZZQA 1MQTB 3E6CC 5J98B 1MEC2 4GWNA 3ZFEA 2VH9A 1PO22 2BVVA 5KHKA 4FFFA 1VMJA 1D2SA 2C5DA 5C33A 1UD1A 1F9KA 3EMRA 4Y5Z0 2OPKA 3FC0A 3D6EA 5LK5A 1RMU2 2A3XA 1OA4A 3RZZA 4IE5A 5AFBA 3WP6A 4FFHA 4XHBA 5I0UA 1V00A 4HPKA 1O4YA 1XB9A 3DECA 1PVC2 1R082 4XAEA 3I59B 4AI0A 2JJ6A 4ZPIA 3H8XA 2Q1ZB 1CAXB 1OLME 2R7EB 4XF4A 2UY9A 4MADA 4DUWA 2YFZA 1WBLA 2UWAA 2YHJA 4JCKA 3FFZA 1COV1 2NPIA 2JECA 3K4DA 1RL3A 1S4CA 1W3XA 2J1SA 4XILA 2E7AA 2OKXA 2CDPA 3SCHA 3RZLA 1NG0A 4F83A 4AEDC 3EB7A 1CJPA 3AVSA 4FPEA 1PGL1 1QJU2 1W6OB 3OPZA 1UOBA 3OY8A 4GH4B 2GN7A 4XQDA 4CCDA 5EP9A 3QCWA 4QPIB 1H6XA 5GLZA 3N35A 4LQRA 2EXKA 2ZX4A 1H8VA 4MHRA 1V9U3 2VTFA 3RYPA 4UBGA 3THPA 3IPVA 1F31A 4RN5A 4TLFA 4WBBA 4TLGA 3WF1A 2WYFA 1DFQA 3Q8FA 2DUPA 5LRRA 4MGZE 4CU8A 4Z8BA 4O9EA 3VBRA 1RUG2 1VRH1 4N43A 3K48A 2JE7A 4P9IA 4XF1A 2P4EA 3Q8CA 2HWE1 2WBKA 4Q8KA 5C6CA 2G9FA 1DQ0A 2YC0A 3VBFC 5FP4A 1NE4A 2GNMA 4BU2A 4RHV3 1LU2A 1F5FA 1ZX5A 2WWUA 3OGVA 4J1WA 2WZR1 2A70A 2XG3A 3PMSA 4MX3A 2J22A 1W6MB 2MEV2 3FUQA 1JU3A 2IFWA 4AOCA 4F3JA 3LF7A 3U37A 2RS53 3UL2A 3KLSA 1LGCA 4QPYA 3ZYRA 5JUVA 1ZRRA 5FYIA 2BNMA 4EN9B 1ND3B 2VECA 5ABJC 3H0OA 1VBD1 5HCFA 4DXTA 1J84A 1VP6A 2HWD1 5F5AA 3SMHA 3VBSC 1VBB1 4BDVB 1JODA 3I3DA 5F6KA 4BQYA 2W9XA 2R16A 1Q8PA 4RR3C 1QQP1 1CIYA 4IEWA 3R6SA 4IV3C 2YB7A 2JXAA 2ZGUA 3KS7A 4B29A 5FZFA 1X36A 1X8EA 2JKXA 4Z92B 3HN3A 1W0NA 5GZFA 5IVJA 4Q4Y3 4LE4A 3I2IA 1G9BA 5IK4A 1D4VB 1AYN2 5FXZA 5F3CA 1KITA 2GH8A 2E9QA 1FPN1 1ZZCA 5L7OA 3GALA 1O3SA 3NJVA 4D69A 2AZ5A 4B1LA 3J8F3 2VVDA 2DCJA 3GM8A 5IJRA 2FDGA 2JG9A 4HK9A 2BWAA 1RUNA 3ORJA 1CQ9A 3GBFA 2C1FA 3NNMA 4IGOA 3IIIA 4QD2A 4WVZA 1AR93 1H2MA 1KJLA 4N8MA 3U10A 4CDWB 1OF3A 4D94A 2IC1A 3WNLA 2ZGPA 3CZUA 1UY2A 4JGYC 4AQSA 2JICA 1WD4A 5FZ0A 3V64A 4LK7A 1GWLA 5DAVA 4JTNA 1YYNA 4XEZA 1G7YA 3T2OA 1M4WA 1AYM1 3AP4A 3KGZA 3POWA 3Q8AA 1G86A 1T2XA 1GR3A 1REEA 3U75A 3EHKA 1C8M3 5FFOC 1W8OA 1IOAA 3TN92 3UGFA 2RR12 3V0AA 3G7DA 2QQPA 1E5RA 1RJ7A 1GU3A 4NAMA 4A7YA 3KF5A 1F35A 1W99A 2QJVA 1WLTA 4ARXA 1AR73 2EIBA 3B3QE 4QKNA 3R4SA 1UU4A 4MOAA 5JIAA 3WLUA 4YFZA 5BPXA 2DVGA 2RS13 4MXWB 1VBE1 3NNFA 4Y1XA 3ZSMA 3BOPA 4XUNA 5LB6A 4BQ4A 4D7TA 5J37A 3NJXA 5FZMA 4CEWC 1NKGA 3HBKA 1VBC1 2XMLA 4YYOA 3WVJA 3ZSJA 4LITA 3ZFFC 4JKKA 2NN8A 2ZGQA 4HT1T 4PLMA 4AZZA 4I3PA 1AX0A 2AC1A 2D6KA 4ITCA 4QDQA 2Q8CA 1C5IA 2ETEA 2V73A 5KHGA 1H2KA 2RE9A 1UY1A 3OSDA 3OOXA 4QXCA 2A3YA 5IW0A 1FATA 2PTMA 1BCXA 1HB3A 3N9MA 2B7YA 1FX5A 4R8HA 5SV8A 2AR6A 4N53A 1W8UA 5KXDA 4XFFA 5I0RA 4FXKB 1NOVA 4LBQD 1DDLA 2HLEA 2F4PA 4QQLA 3WQBA 4LA2A 4AI9A 3RZMA 1ZNPA 3S7EA 1RUJ3 2ARAA 2Q0AA 3HNBM 5CVRA 1CAVB 1W2TA 5LA1A 1ULGA 1MS8A 1X82A 1YWKA 2ENRA 4UF0A 2VUAA 4L97A 4CCJA 4FCAA 2ZXQA 4Y4RA 5DUXA 4KWJA 1XYPA 3GHNA 1QU0A 1UPIA 2GNBA 5HV0A 2XJTA 3J7NA 2VOVA 2PHWA 2A1XA 5FZDA 1RUH2 5FDBA 2YU1A 4Z2AA 3HN1A 4OYUA 4P9XA 2B39A 2VD7A 4Q4W3 3BCWA 3VGIA 1ST8A 3A21A 3ZXDA 2PHTA 1SCRA 3D5OA 1EYBA 4FPYA 1BBT3 2DUOA 1GQHA 2A6VA 2C9KA 1Q8QA 4WVMB 4XMAA 4A3XA 4M3CE 2RM22 1CPMA 2EF6A 3OUIA 3WDYA 4KWLA 4A3ZA 4IERA 3BIEA 2OYZA 5JXHA 4B4RA 4Q29A 3WW2A 5CFDB 5HV4A 2N7GA 4XUPA 4ARYA 4LBOA 5AVAA 1PNFA 5FY1A 4FTSA 2Q30A 5FOBB 4AF9A 2VW0A 3A7QA 4A4AA 1SHWB 1JYCA 1U5IA 1W8FA 3WQ0A 4AE2A 4WV8A 5IK7A 1FAYA 2YXSA 1RHI1 2PHLA 2XJQA 4P08A 1IG0A 1ND2A 3EBRA 1KXGA 3M4FA 3WD5A 3WDXA 2VVFA 2WNVC 4CDQC 5BNPA 2I07B 2LS6A 2CGPA 5SV5A 5J36A 4OUMA 4NMIA 4M4RA 2BV4A 5FJHA 1PHMA 1RVF3 2HBUA 4GULA 3JUUA 4RYDA 4A2UA 5F1RA 2PAEA 1JUHA 3DUIA 4C90A 3MZHA 2H6CA 4QB2A 1T6BX 4PLOA 4YVWA 5D8AA 1W9WA 2ZACA 2BFUL 5FPUA 2PHRA 1CWPA 4AXOA 3WW4A 1MS5A 3LFIA 4PT6A 5LEJA 1BQPA 5A32A 2GP5A 4XOGA 3O1PA 1NCRB 4CRQA 1X50A 1OMIA 3SISA 1QF3A 4RS5B 4OI1A 4C8DA 2J42A 1W03A 1O3QA 1E57A 5LBEA 5FP8A 2XBO3 4NRQA 4YVSC 3CJIB 3ILFA 2V72A 1SCSA 4CXYA 4CU9A 2KR2A 2R061 3J7HA 4Q26A 3QOPA 1QJY3 5K0UA 3ST7A 3SITA 2YY1A 1K3IA 1CAUA 1FV2A 3LB9A 4QT6A 1A34A 1SG3A 4AVCA 4PI2A 2WFF1 3PL0A 4AEMA 5JLVA 2B45X 4AAPA 1A78A 1RUF3 1MZEA 1XRUA 2JEMA 3BI3A 3M3CA 1AR83 4QHZA 4LBMA 4QB6A 2JDAA 4XETA 1NT0A 2Y0OA 4OI2A 3SH5A 5JI9A 2WZPP 1S0EA 3LPFA 5JMCA 2B4KA 4XTPA 5EQUA 3ZFEC 4OULA 2UU8A 2R1DA 3UKVA 1JYIA 4AVAA 1A8MA 5DAWA 1OD3A 2E32A 1ULPA 2W1SA 4L9BA 2OW4A 5A7QA 2JIGA 4BA6A 4K21A 2ZPXA 3K4ZA 2Y8KA 4Q4X3 2D6OX 2BDRA 5JZGA 2E7QA 3KT7A 4W6YA 4AGGA 4Q4W1 3A4UA 1YQ6A 1LU1A 1NCQB 3LZZA 4UW4A 4XW3A 3POGA 3H8UA 5J96B 5FOJB 3K46A 2O1QA 1EUTA 1CAWB 1URXA 2HWB2 3THCA 4JDOA 1PIV2 1UXZA 4QKDA 2JDNA 5FZEA 3AKPA 1KS5A 5FO7B 4MG2A 3AZXA 1CVNA 1S2EA 4CP0A 4Y26A 1X8MA 4YM1A 3WSOA 2Z2SB 1D4M2 1ZBE2 4GIQA 4QGMA 3ZN6A 2VZ3A 3HMYA 1IZ3A 3W9AA 3ZR6A 2ZX1A 2JDMA 3NL1A 4BYYA 5CG8A 3CO2A 3MIHA 4JDMA 3IKWA 2IVJA 4M01A 5FPAA 5A7WB 3FBMA 2EAKA 3LPGA 1OVSA 2R072 3BTYA 1F5JA 1NAEA 1B35A 2DCZA 2Y6FA 3H9AA 4NIAA 1N3OA 2WS93 1UIJA 3P5BA 4BK4A 3T0DA 4JRAA 4XQWA 2ORXA 1W05A 3GZAA 1NA1B 1YIFA 3RWKX 2A5ZA 1G9DA 3DPRA 3POEA 4YW7A 1RVF1 1FMD3 5FLJA 4TZDA 4Y5TA 3L2HA 4LMFA 2D5HA 3THTA 1F4AA 1QJX2 2ZGOA 4YZ4A 1LB2A 1I3HA 1H8TB 4LXLA 4YW3A 4XABA 3RZGA 3U11A 2Y34A 3THDA 1OFNA 4HVRA 2MNGA 1SLLA 3VBRC 1PX3A 1S2KA 3Q8BA 2Y33A 3H3LA 1JW6A 3ZYBA 1S0FA 4RQPA 2P3JA 2WJSA 4AEDA 1UIKA 3OYWA 5EJ1B 5ACA2 3RJRA 3AYDA 3LOIA 1PMJX 2W1UA 1VBA2 1V6NA 5IWFA 3ZYFA 1IQAA 1HRV1 1FNZA 4WVWA 4NOTA 3ZKUA 1W6QB 2PLV3 2EVXA 3E5QA 4B4QA 3VKNA 1LULA 1JHNA 1OA3A 4NROA 1DU3D 4WM7A 4FPCA 1MEC3 1LEMA 1PO23 2RS32 2YC2A 4DUXA 1HDKA 1DQ2A 2ZX0A 4E8CA 1I1EA 4AQ6A 3VHPA 1OBNA 2A6XA 3N7LA 3KZ4C 1VRBA 3IBMA 5FY9A 2ZGTA 2DFBA 2OXBA 2RJLA 3MFCA 2WO1A 2X09A 4B8EA 5H9QA 1VIWB 4AI3A 1RMU3 1EV12 2E33A 3VBFA 4CP9B 5HCBA 2ZHLA 1UKGA 4JC1A 1HN1A 1RTVA 4KU8A 5L7OC 4CDUA 3AYCA 2BRTA 5A6YA 2OVUA 1PVC3 1R083 2FZ1A 3AX4A 2XVGA 4IEXA 5HI0A 4GALA 2HEYF 1YI9A 4NHLA 1R1A1 2JG9C 2WR9A 1PO11 1QY4A 2NLRA 3VB9A 1CGPA 3S0MA 3U0ZA 4BWOA 1UZZA 3ATGA 1J3PA 1GOHA 5CKQA 3K77A 1J1TA 4LHLA 2WSUA 1HXS1 2ZX3A 5FBJA 5HXVA 2J1VA 4BH9A 3MO4A 2ZHKA 3GNEA 4Q4V2 1BEV2 1OA2A 4MO3M 5IYYA 3VD3A 1UYXA 5EV7A 5FQ0A 1W8ZA 1ENSA 1FXZA 1UZWA 5JAXA 5HXMA 4ZXKA 1QJU3 2D6LX 3AC0A 3VHNA 2GDFA 2HEVF 2K2SA 4OUSA 1C28A 3GGLA 5FZIA 4QX0A 2Y0IA 5LA9A 3ES4A 4QX1A 2D40A 2RMU2 4NWWA 5FZAA 3ES1A 3P3PA 2P17A 1XNKA 4X8NA 2VC9A 4LBQB 1ASJ2 5A33A 4COZA 1PVXA 1XOYA 3KHCA 1D0HA 4DRVA 5FYVA 4EN8B 2P2KA 3K3NA 2ZOEB 4GWMA 3POYA 4AEDB 3ZYJB 4L2NA 4KQ7A 1RUG3 4IEUA 4AW7A 5A6QA 5BUVA 5GALA 3V0BA 1GZ9A 3ZLIA 5FYCA 3O1UA 2E51A 2FDJA 3MGUA 3JBG1 4NWVA 3HAGA 4OCTA 1W06A 4PLNA 4ES9A 5D1IA 1SMVA 1E5IA 1UO9A 4CUBA 5T54A 2MEV3 4N53C 2FHRA 3ME2A 3ZIXA 3WF3A 2D44A 5C7GA 1WMEA 1Q8SA 4XMIA 1OVPA 3RZKA 1POV0 4LHKA 3MI8A 2WT1A 2A6ZA 1HRI2 1W8WA 1YJKA 2P1BA 4LPLA 1AUYA 4IE6A 4E4HA 1UZYA 2JDHA 1I6XA 4XZPA 3RI8A 3VBFB 3ZXKA 5FMOL 3OD0A 4R9BA 2VZPA 4TN7A 5FYYA 4YSFA 1Q8OA 4AHZA 5KHIA 5IATA 4MXVA 2VMHA 1NY71 4P5HA 1JHJA 1HQLA 1AYN3 1LGNA 1UYZA 1H1MA 4UBHA 1W3VA 1AVBA 1AX1A 2HJIA 3AP7A 2JDKA 3AMPA 3R4UA 3RMXA 3PVBB 1Q8VA 3LEMA 5I8SA 1QNWA 1EPWA 2Z4FA 2G9ZA 5ABJB 1W90A 4CCLA 5BV6A 5FBZA 3IMNA 3G6JB 1KRIA 1BLZA 3VBSB 4QGLA 1UYPA 3RDIA 4CXWA 1VPHA 2DURA 4HN0A 3QH7A 4P02B 4RR3B 1Z7S1 4IV3B 5C70A 2QTWB 3HD8B 4EZ4A 2XOMA 1ENXA 2VOXA 3FZ3A 2R0HA 2C0ZA 3MF6A 4I0BA 4K20A 5EZWA 2K9ZA 3E5UA 3AJZA 4G3YC 3VZOA 1SDDB 2DVDA 4R4XA 2ZMLA 1AR82 4DIQA 1DQ5A 2Z79A 2Q5TA 2ZKNA 3F2ZA 5EIYB 1KJRA 4XUTA 2ZMNA 1LHVA 1LTEA 1S0CA 4LO8A 2YFUA 5IVVA 4FXGB 2YBPA 3S7IA 2VBPA 3AFKA 3MF9A 1ND2C 2R0FA 3GXUA 3TN93 4ZU7A 1PGW2 3VD7A 2RR13 3CZJA 3VBHB 1OLQA 1OQDA 5T52A 3I3MA 3IDCB 3T2QA 4HN1A 2VCAA 1SBEA 5FY4A 4RA0A 4YG3A 1GP6A 1YNAA 4Q0PA 2AACA 1EAH1 4AR2A 5JOWA 4QQPA 4JGYB 3RG0A 1AXYA 4Z1VA 5A3WA 4LNVA 5A7SA 3BKZA 2BP6A 4YVWC 1BK1A 1DZTA 3C7OA 5D8AC 2HEWF 3ZMOA 4Y1ZA 2ZGLA 2RG4A 4D6QA 4PDWA 4CUAA 4AVSA 1V6LA 2X5IA 4CZSA 1WW5A 3WNMA 1JYTA 1KS4A 4Y1YA 3C7FA 5IAVA 2GNDA 2GU9A 2QUOA 2RHPA 4LBKA 4LBNA 5BNNA 3M1HA 3T1LA 1DGWA 1TG7A 2CHHA 3IDBB 2VNVA 3I3BA 1PZ9A 3JD72 4N9HA 1ZREA 2OPWA 3VV1A 3T3YA 2BBVA 4KL1A 1HKDA 4QU1A 4COUA 1O8SA 2UWBA 2WN2A 3KMHA 4BM8A 5I93A 4XXPA 2SLIA 4FPFA 4EWDA 4XJ8A 5C9AB 2EXJA 3N7MA 2HWC1 3VZLA 5K0UC 1ZA7A 4S2GA 3N9PA 3QD6A 1L7LA 2DU1A 1YEWA 4I30A 2UYAA 4XXAA 3SNMA 4TYSA 1UW8A 4CEWB 5A3LA 5IVFA 2XJVA 4F8AA 3VHRA 4JGZA 4XHXA 3ZFFB 4IEPA 4AFMA 3CEWA 4B7KA 1JZ4A 3M3OA 4BZ4A 3Q8EA 5A80A 2Y60A 2B8MA 3P6BA 5IT6A 4BQ2A 3X29B 2CAVA 3CBNA 1UNBA 1RUH3 3DYOA 3FL7A 4J6GA 4K8FA 1TMF2 3SCGA 2WL1A 4MGYE 3O12A 4HONA 5JI7A 2DDUA 3MV01 3MIDA 4W50A 3UT0A 4B7EA 3UESA 4BJ0A 2WNEA 4PI0A 2CYFA 2W68A 5ANQA 2DWRA 1K45A 2L9LA 3PU8A 4LIVA 3WNPA 3MLJA 3VKOA 4OUEA 5ERLA 3LD8A 2AENA 3QH6A 5JZGC 4MVTA 2RM23 2PHXA 5C5TA 2CAUA 4MYEA 1ENQA 2BEOA 4QPGA 1SFNA 2FCUA 2XONA 5BNOA 4HVQA 4D6RA 1ZBA1 3VD9A 2QZ3A 2QQJA 4GWIA 1GWMA 4ZONA 5C8CA 2EICA 1L7RA 1ZZ9A 1UU5A 4NRMA 4CYDA 1JOBA 3N7JA 5KC5A 3SH4A 3WR0A 4CU6A 3WNOA 4AHWA 5LY2A 1N3PA 2J1AA 3ITQA 3A23A 3J26N 4LOSA 4AHYA 3FHAA 2QQOA 5FYBA 4UXAA 2Y38A 3MW4A 3WG2A 2WLQA 4CCKA 2ZAAA 1EP0A 5DDJ1 2D6NA 3LQCA 3ZR5A 4EE2A 1RJ8A 2PYTA 2VZTA 4UOJA 3H3ZA 4DRRA 2RDSA 3ZYHA 3NO8A 2WIIB 3LWCA 1GFF2 1UY0A 1MZ5A 2B46X 3LA2A 1B35C 4MGIE 1YRZA 3M3QA 5F2SA 1O3TA 1YLLA 4HKWA 4OI0A 4IEYA 3ZXEA 1MR5A 3VBHC 4Y1VA 3OD4A 3O1MA 3PUHA 3DPRC 2FDIA 5L9BA 1YFUA 1R64A 2PFWA 4DOUA 1RUC1 2NQYA 1F2NA 2B9VA 1UMZA 4JZRA 5FV3A 2WT0A 2ZGSA 5DAPA 4CDQB 2WNVB 5GZDA 4Y20A 1SLAA 3JU9A 2DFCA 3RRDA 1IS6A 4V2VA 5G05L 5FZ4A 3MUY1 1ODMA 1MACA 2CNAA 2R30A 4AI1A 5IK5A 1RUE2 2R041 1SZBA 3RVHA 3AMQA 4GWJA 4NHYA 4RQPC 5EJ3A 2FCTA 5FZOB 2HKXA 3OB8A 3N36A 3WW3A 1JYWA 4E4ZA 1W6PB 2P37A 2CTVA 4RSUA 4XFIA 2TNFA 3CMGA 4FQ4A 4IGPA 1UKRA 3U07A 3TRSB 4D3WA 1JH5A 1MVEA 3UGGA 3ZYGA 2E31A 3AZVA 4CSWA 1NLQA 1RUD1 1TEIA 2MPFA 1PK6A 4JQRA 4A45A 1W9YA 5CFCC 2NZ9A 4WM7C 5KHHA 3WF2A 4FOVA 1U12A 2H6BA 4P9JA 4YVSB 1R092 3WG3A 4B1MA 1RITA 1UY3A 5C3SA 5CG9A 5K8SA 2D3RA 4I3GA 1CZVA 5TSWA 1SLBA 2HWF2 4OHXA 3VBOA 5CA6A 2WNOA 3ZXJA 3V56A 2WQ8A 2LALA 2VNGA 3OEBA 1RUH1 4LKEA 1H2NA 5A3MA 2BZDA 4ASLA 2QQIA 4D8MA 3DEMA 1DGWX 3AM2A 1GWKA 2E63A 4EN7B 1DQ6A 5I0DA 2XLFA 3E5XA 4FP3A 4W6WA 2FCVA 4Q0UA 1BVVA 1GZWB 2VOTA 3ACLA 4CDUC 4CCEA 2XJUA 1POV3 2CDOA 1XSRA 1YFXA 1YXWA 2ZTNA 1J3QA 1KEXA 2HWB3 1W2AX 5FYUA 1PIV3 4Q0VA 2DCYA 3RMYA 1PMHX 3ZFEB 4AVBA 4BLJA 5H9RA 4XFBA 2FDFA 4LLFA 5LY1A 1UQXA 2WA3A 5T5LA 1D4M3 1QOSA 1REFA 1MS1A 1ZBE3 1TQ5A 3O1OA 2XQRA 4EN0A 4XAAA 4MGKE 3W58A 2E6VA 4ZZ8A 1G9FA 1S2BA 4YW2A 1WMXA 2VMGA 4FTEA 1ONAA 1K5MA 5F5QA 2R073 3RZHA 3APBA 4BHPA 4HPKB 3TNQA 1N3QA 1US3A 4IEZA 1CJDA 1XSQA 2J1EA 3LE0A 4COWA 1WCKA 5F37A 4NUBA 3AP6A 4OMDA 5F7UA 4NHMA 2JE9A 1RUI2 1YQ8A 4K7JA 2WDBA 4Q8LA 2Y26A 5FIXA 1A3KA 2XXZA 4NIIA 3PUIA 5FPXA 4QDSA 3VUOA 3WG1A 4CE8A 4H2AA 2ARBA 1QJX3 4E2QA 1QDOA 4PIXA 2I2SA 5IHRA 3N9QA 5C3QA 3EO6A 2VR4A 2F4LA 5C3PA 2PAMA 1J3RA 1NLRA 1NYWA 1XNBA 1XNCA 3CF6E 3UKNA 5KR7A 4ZKTB 2PXJA 4O7XA 1MZ6A 4IGQA 5ACA3 1JYVA 2WYSA 3OY8B 3WXPA 1VBA3 4QKFA 2ZA9A 2VQ0A 3BTZA 4M4PA 3UV9A 1CN1A 2HH9A 1LHOA 4FFIA 4GA9A 3C8XA 4YNIA 4Y22A 2GP3A 3LA7A 4AWDA 1VMHA 5KXEA 1S55A 3IPVB 1ULCA 1QNYA 4CP1A 2WNUA 1QWRA 5FZ1A 5EXOA 3WDWA 3B5LB 1IHMA 2RJKA 2RS33 2XR4A 4OFGA 3VBRB 2EXIA 4Z82A 4N43B 5CADA 4DINB 2GMEA 3TEWA 5EJZB 5C3OA 1V9U1 2R49A 1J58A 1EV13 5FZHA 2XKPA 3B94A 3IN9A 3OBAA 5F5CA 5FMBA 3BN6A 3NJYA 4KWKA 5L73A 3WDTA 2PHFA 2ADEA 4GD4A 1SLTA 2QVSB 2QNKA 4XYXA 4JDNA 1PZ8A 4L11A 1JU4A 1QXPA 1GQGA 2P3KA 2ZHMA 1RIRA 4FQZA 2ZABA 5LK7B 1F4HA 4OI4A 1W2OA 1Y43B 1W9TA 1QOOA 4RHV1 2JENA 4XE9A 1KDKA 2IXIA 1COV2 1DCSA 1HLCA 1NZIA 2B42B 2VZVA 3KF3A 5FLHA 1POV1 3MIEA 3NRUA 4KMQA 4Q4V3 1BEV3 2RS51 1SLCA 4WZCA 5GM0A 4BQ1A 4DB5A 5JOXA 2BGOA 1YI7A 3BODA 1QH7A 3GF6A 5FO9B 5L7OB 1PGL2 1WA6X 5FPBA 4ZY9A 1GSLA 4UT5A 5K7PA 2G19A 3LEGA 5FYMA 4HOOA 3NV3A 1HV0A 3WNKA 2JG9B 2FQPA 2RMU3 2V4VA 2VMDA 3GYDA 2LROA 5J1XA 4AQ2A 3AB0A 1DLLA 2P3IA 5ANNA 3TEYA 4EQVA 4UFKA 1ASJ3 4Q4Y1 5CYYA 4NJ4A 4XBNA 4HL0A 4DMIA 4S2HA 1OURA 4FAGA 2VUDA 2YDEA 5FUNA 1UOJA 1Q43A 4J1XA 5KBFA 3LDKA 2VZQA 3KT4A 1VRH2 3EJKA 5J3UA 2IVIB 2ID4A 3J8F1 3MPBA 2HWE2 4PDWC 2PN5A 2QQLA 2X5IC 5C71A 3FLPA 1ZZ6A 4CU7A 1QJZA 1XE8A 1AR91 4D6SA 2R6QA 1BHGA 4HXCA 4Y4YA 5BNNC 3Q9OA 4NHKA 2FDHA 1CZTA 1P8JA 3V0AB 2WZR2 2VZ1A 3J9SA 4XDQA 4E27A 1MS3A 3WV6A 1YQ5A 1GOGA 2OS2A 4OMCA 5K4LA 2FMDA 2NMNA 4AGVA 3ZN5A 1BMV1 4DXRA 2BNOA 1VBD2 2J1UA 3B02A 1HRI3 1XXNA 1QIQA 2HWD2 4KBBA 3HJRA 3WP3A 3AFGA 1O6UA 1VBB2 2LW8A 3PVOA 1AR62 5IUQA 4CDXA 2XDVA 1C8M1 2VUCA 3KSCA 1QQP2 3N9NA 1CZSA 4JGZC 1LEDA 3D4KA 2MHFA 1DGLA 1HJGA 4IE7A 2YYOA 4COYA 1H1AA 4I02A 4LLOA 5FREA 1AR71 4DY5A 3AKTA 5AC92 2RS31 3RFRA 4UI9L 5EPAA 2WWSA 4QB1A 2RS11 4N53B 5FKCA 2E7TA 1FPN2 1LNSA 5T5JA 4LO6B 5FYHA 4XDOA 3I3QA 1HW5A 3ELNA 3WCRA 2XH6A 2CGOA 3KCXA 3QACA 4M0HA 4P5YA 4XJAA 3U1XA 1WBFA 5B4XA 2X53S 4UF0B 2C24A 5M0TA 1SBDA 4Q27A 4QX7A 4QPGC 1QEXA 2CGNA 3DXTA 5BNOC 4N7UA 1ULDA 5LEKA 1S0IA 2JDZA 3E6BA 1V6OA 1UL9A 3POFA 5FYTA 3S5QA 5C8CC 2EXHA 4BMEA 4LJHA 4LKDA 5FR3A 4QMAA 5DAQA 3M3EA 1WWYA 2VTXA 1RUJ1 1AYM2 1OD5A 2D6MA 3VZKA 2XGXA 2DV9A 1E5SA 4WVVA 5CISA 1DZQA 2VNRA 2YC4A 3S57A 2QKDA 4NAOA 3OUJA 4MH0E 3LSEA 5JSPA 3EXUA 4H7MA 2OZ6A 3POSA 1NUKA 3L2YA 3VKMA 2W1WA 1SPPA 4FT8A 5FMDA 3ZYPA 4JX0A 2QDRA 3JQWA 3HIFA 3MUZ1 4XF0A 2CSGA 2VBDA 4EV0A 5A70A 4XJWA 2RMU1 2VQAA 4PIZA 1KFXL 1VBC2 3USUA 4DEQA 2JG8A 1I5PA 1QGLA 1ZRIA 1BBT1 1GLHA 2W91A 3W5NA 1ASJ1 4ZU5A 4IESA 3KCYA 3ZYIB 5IVEA 4ORFA 3H1MA 1BXHA 1NQDA 1ND2B 2WABA 2E26A 5BNPB 3JD73 2GSYA 4NPMA 5E89A 4ZS2A 1O3RA 2XKOA 3I2HA 4BXSV 5JOZA 3HWJA 2IXHA 1ZA4A 4CCNA 4QXBA 2SBAA 4IUGA 5IVCA 5JR7B 4PIYA 2EIGA 1ENRA 3WOGA 1O5UA 4W8JA 2ZAHA 3K2OA 3NNLA 4JQTA 3T1MA 4B3NA 1OXCA 3RGBA 4W6XA 4YVWB 1T6GC 1SLIA 5D8AB 4C1XA 2A6YA 3VKLA 3IT8A 4XCBA 4ZU4A 5D21A 3RZJA 5A32B 1CX1A 3EYPA 4YW6A 2YROA 1PK6C 2OUHA 3ZIWA 2FBEA 2WRAA 1OLRA 3DN7A 1TMF3 2ZMKA 3O14A 3MFAA 5I0TA 3OEAA 4HETA 3AJYA 3OBZA 4PQQA 4YFWA 4QX5A 4TTGA 2B9UA 5A6XA 1PM4A 2A71A 2VM9A 3VBOC 3BPSA 4HMZA 4FO9A 5K0UB 1EY2A 1NXMA 2LRPA 3D82A 1CAUB 2ZCWA 4OZOA 5F3GA 5HPOA 2GAUA 2Z69A 5EYXA 2WAAA 3LIHA 3AP9A 3NQHA 2VY0A 5DUVA 2ILMA 3BPZA 2XBO1 4IV1A 3M70A 3BU0A 4MGTA 2LM3A 4QM9A 2DVBA 3H8RA 2WO7A 3DKQA 4QGNA 1DGRA 1LR5A 5J7MA 1QJY1 3RS6A 4UFIA 4JHZA 2RDQA 4M3CA 5CFCA 2ZGNA 3O5SA 3HQRA 4FPHA 1V0AA 1RHI2 2WZ8A 1CONA 1OPMA 4BQXA 3LSDA 1GBGA 2OZJA 5E6HA 2E53A 4KWUA 5H9SA 5FXVA 3NMBA 4DFSA 1PM7A 1RUF1 2BNNA 2JX9A 1O5LA 5I8YA 4CUGA 5JZGB 2WLPA 3BUCA 3E6DA 1AR81 3CIHA 4X6RB 4A6OA 1U0AA 4BQ5A 4QX2A 1K5MC 2NMOA 3DYPA 1ULOA 5FJKA 4ISQA 2EALA 4IE4A 1LOCA 4P9GA 1LOGA 4UW5A 1OC1A 5DN2A 5E88A 5FYZA 1PZ7A 4FSJA 1LHNA 4Q4X1 5FXWA 4FBFA 1GV9A 3ZN6B 3LKJA 1OOPA 4ONUA 3BGAA 3T2PA 2IXKA 2TUNA 4QQ2A 2XJRA 3HQXA 2VCBA 4QM8A 1V6JA 3VDDA 3WHTA 4AGRA 4BK5A 3VL8A 1N1SA 4MSVA 3GHMA 4XC9A 3BYWA 1RUE3 1XYNA 2GC2A 5FPLA 2R062 4YM0A 3CKHA 1UU6A 1B35B 4LUMA 5FXXA 2B5HA 4CEYA 2OQ7A 4FTBA 1TME2 3WW1A 5IK8A 1XE7A 3DPRB 2WFF2 5GJ6A 1G9CA 1V70A 4WZFA 1JOPA 2OT7A 5C9AC 3FUOA 3ECQA 2WWJA 3TWIA 2C9AA 4TXWA 3E97A 1G8WA 3MW2A 4DS0A 2J1RA 2XVLA 2WNUC 3OF1A 2PMWB 4OHYA 3I2JA 3VN4A 1AL22 2XHKA 3VBUA 1R093 2WS91 2TEPA 3I8TA 4M3CF 4JAAA 5LCWL 4RQPB 2A7AA 2DTYA 2P6HA 4HANA 2HWF3 3ACIA 3H1WA 5C4WA 3OYWB 4EWAA 2WN3A 3S6PA 3BOWA 3W20A 1FMD1 2W52A 5CKMA 3AL6A 5EFUA 1JI6A 3WT3A 3ZFGA 5J09A 3KGLA 1Y9MA 1CPNA 5IFPA 1GOFA 1CD3G 4H3WA 5KHJA 3S5AA 3ZSLA 5CFCB 4WM7B 3UKTA 5FUIA 4LIUA 3TEZA 2W0XA 4U36A 4Y5SA 4QU2A 4BOWA 3PTYA 5T55A 3UJQA 1IKQA 4EROA 2NP0A 1DIWA 5FPVA 4AHXA 1H6YA 3WCSA 2Y6LA 2I45A 2Q1FA 1OSGA 1V6KA 5JXIA 2VE1A 3H3UA 4K9SA 2PLV1 4PCRA 4XACA 2QE3A 1W9SA 5T5OA 4F7ZA 1RB8G 2Q4SA 1WW7A 1OQ1A 1TNFA 5FMCA 1WCQA 5APAA 3SEEA 1MEC1 1PO21 4SBVA 2RDNA 4CDUB 5DUUA 1FT9A 3ACGA 2P6CA 4ISRA 4Q0QA 2WQ4A 1LRHA 4FOWA 1QJEA 3PTRB 3I2OA 3DKWA 2WC2A 4C0BA 2CWSA 2YBKA 1IPSA 3ROUA 1RUI3 3J7MA 3WNXA 1Q56A 1RMU1 4YGDA 1GQPA 2W3JA 1RXGA 4KI5M 3ON7A 5CKNA 2XLGA 4LR4A 2YBSA 2WA4A 4EWEA 1UAIA 4J25A 4I2OA 3MIFA 1AZDA 3LDRA 2D7FA 2O8OA 1OKQA 1PVC1 1A8DA 1R081 5FQ0B 3LIGA 3M3IA 2ZX2A 3AMNA 4GB33 1IQDC 4RD7A 1X33A 2GMPA 4HK8A 2VMCA 2RVAA 3O0XA 4AEJA 2VGDA 3U14A 2GNTA 4WM8A 1FOD2 3ZX7A 4JKMA 3FMGA 1HRV2 5FWEA 4OQ9A 4E8DA 4AEKA 2DYCA 3KWVA 4R9DA 5FWJA 1XC6A 4KBZA 1VB4A 5A33B 4HVOA 3NAPA 1OUXA 5JR2A 4NPLA 1O91A 2WFPA 1QJU1 2AUYA 3UK9A 5L19A 2WT2A 3V0BB 2R32A 4CDXC 1W6NA 2Q1MA 1O8PA 1UXXX 4DXSA 1O7FA 1WGPA 1Z0HA 3MIBA 4BB3A 3AZYA 1SFYA 4ZZ5A 1WW4A 5KXBA 4XUOA 1OI6A 4K8RB 4LHNA 5JXGA 1MQTA 4XFHA 2VZSA 3KVAA 3HT2A 5F3EA 5JXJA 2ZGKA 1APNA 1RUG1 3AL5A 1R1A2 3KVBA 2Y6JA 4SLIA 3IDAA 1PO12 1NQJA 2IWGB 1KD7A 1YUDA 2W47A 1YQCA 3AXEA 1AX2A 5F5IA 2VOKA 2JDPA 4MZUA 1COV3 5FAXA 2DTWA 3CQOA 1HXS2 3O0VA 1WMFA 2JWPA 3UETA 3VZJA 2MEV1 3ACHA 1GP4A 3KV4A 3L9JT 1BZWA 4BE3A 2XQXA 3I59A 3B00A 2A73B 2YG0A 3K75B 4GJYA 2V5DA
chains in the Genus database with same CATH topology
1CAXA 3I4IA 1SQ4A 2VPVA 4IEQA 1Y3TA 2GC0A 2CL2A 2K0GA 2FZ2A 1NZCA 1AL0G 1LOAA 3M7AA 4YZ5A 4JVAA 3D8CA 1RGSA 2IXCA 4FPKA 4KNCA 5FLIA 5AFEA 1AYN1 1JUIA 2LUWA 4HSJA 1W6OA 1DQ1A 3MLKA 4JV4A 4E4SA 4PF5A 1VRH3 4GH4A 4ES8A 2JG8C 3K51A 5KWRA 2G4IA 2HWE3 3FLTA 4QPIA 1DYKA 1W0PA 4MV2A 3INAA 3JBG2 3ZXAC 1CR7A 1S1AA 3PVNA 4ATEA 2WZR3 4DXZA 2KM2A 5CNAA 1VAMA 1YCIA 4LT5A 1WMDA 1C4RA 3SH3A 5GLWA 4IQPA 1ULFA 1VBD3 2HWD3 4YZ1A 4V1PA 3V65A 1AR63 1VBB3 4PDWB 1SBFA 3KCCA 2X5IB 3TN91 2YGLA 1QQP3 3NW4A 5EWSA 2RR11 1VALA 4OZXA 2VMIA 1W6MA 5BNNB 1AXKA 2YZ4A 1GANA 1AHSA 5BXXA 3RYKA 4AVTA 1NY72 5AC93 3JB8A 1PNGA 5H9PA 4CTEA 1LESA 1ND3A 1C5HA 1N1YA 1FPN3 2D5FA 5KC6A 4HZFA 3DF0A 2I74A 5DXDA 3PMEA 5GLVA 2GC1A 1DYPA 3QBQA 5CIRA 3W59A 4PBPA 1DF0A 4P9WA 2ZZJA 3M8LA 4M0NA 4JGZB 1FYUA 1Z7S2 3MLLA 3WINE 2KXLA 1O4TA 3TNPB 3A0KA 4IV1C 4H55A 3CL1A 3IM0A 1SACA 4U2AA 3IIAA 1YO8A 1S0BA 1N1VA 4TSVA 1LKNA 1DBNA 4LBLA 4XBQA 4AFAA 1AYM3 1UF2C 1G6NA 1IS4A 3WP5A 4H7LA 1HX6A 1RINA 4XFCA 1ZRDA 2OIIA 4CDWA 3NKTA 5GLTA 2NM1A 2WQZC 4K1ZA 4IEOA 4LO5B 4QPGB 4OHZA 1IS3A 5BNOB 4AI2A 1EAH2 1GNHA 1VBE3 3WX5A 5C8CB 1U5ZA 4YGBA 3JZVA 1VBC3 5I0SA 5T50A 1N1TA 4XF3A 5JIUA 2JKBA 3JQXA 2A6WA 5T3NA 2RM21 3JB4C 5T5PA 1OOPC 3CNAA 1WLDA 4OVEA 2CV6A 2DVAA 1IS5A 4QXKA 2XVKA 4MXWA 1N47A 3VDDC 4K6BA 3OJBA 5GZCA 3MEPA 2HYKA 1DGRN 3FBYA 1BJQA 2HWC2 5DZFA 1PGSA 2VW1A 4QQOA 3SLIA 4CEYC 4K1YA 4GMP0 2VVEA 5FTTC 4LO7A 3WQ1A 4C91A 4P9YA 2DUQA 3NKGA 1I5ZA 1S0GA 3GBGA 5CAZA 4Y20B 5JPNB 5CBLA 2D98A 3WUCA 1F8VA 1AR61 4K40A 1CAVA 4L99A 1ZVFA 4Q2FA 3VBUC 3WDVA 2D43A 3FHIB 3S30A 3DL3A 2OUJA 3AYEA 5C4WC 4YM2A 4OLLA 3NSTA 4GB32 1LJ7A 1JXNA 2VOWA 5AC91 3HBZA 5DZGA 4KGGA 3N7KA 2BW8A 3ZFGC 1NE6A 2VUJA 2ET1A 1M06G 2CY6A 1ZBA2 2D93A 4E9KA 1PK6B 4YZ3A 2XL7A 4XBLA 1DG6A 4RGAA 3KQRA 4WVMA 1QXJA 3MIGA 4HKOA 1RHI3 4XF9A 3VBOB 3GBWA 3MICA 2X29A 1DZRA 2D97A 3HR9A 4BLIA 4I0WB 1LGBA 5DDJ2 2BVBA 5CFDA 3VZNA 3OTFA 1SEFA 4X6QB 3WDUA 3O0WA 4LA3A 3LGRA 4PJYA 2IFRA 2D3SA 4YGEA 5EYYA 4KG8A 3ZXLA 3ZSEA 1LOFA 3RQ0A 2O0OA 1BYHA 1R1ZA 2D3PA 2R1BA 3ZPYA 1WLWA 1W2UA 3ZSKA 4YG0A 1RUC2 5JCTA 1YHFA 1FV3A 3ZMNA 3BU7A 2Q8OA 3ALQA 4E2SA 1O4ZA 4NN0A 1D0GA 2WINB 1FNYA 2R042 4TWTA 2UYBA 1K5MB 1JBCA 3QLQA 2HWB1 2R063 1QOTA 1PIV1 5FRAA 5I8TA 1U5YA 1VB2A 1XYOA 4WM8C 2KA3A 3ETQA 1TME3 5JSRA 1HQWA 1D2QA 3OGJA 1NCRA 1D4M1 1ZBE1 2UY8A 2WFF3 4RS5A 4GQ7A 1ZZ8A 2BPA2 1Y7BA 5F6LB 2X8KA 1RUD2 3CJIA 3NAPC 3AMHA 4OHVA 1GICA 2R071 1S0DA 1AL23 3GZUC 1KQRA 5E1RA 1ZRCA 1OQEA 2ATFA 4GXLA 5DUWA 2AYHA 2NYYA 4AQTA 4LEJA 2ERFA 3RSJA 5GKAC 4Q0SA 2Z5WA 2YMZA 1ZZBA 1QJX1 4UW6A 4Y22B 1MQTC 2A75A 4R4ZA 4JTOA 3CU7A 4E2GA 2WNUB 2GALA 4D7YA 1QMJA 5ACA1 3KB5A 1MS0A 1VBA1 4EN6B 3PJYA 2PHUA 2PQQA 2DCKA 3ZXGA 4BPZA 1RC6A 4XQ4A 4FPJA 4XPVA 1NCQA 2GZWA 4B4PA 2BUKA 4M00A 1CAWA 1PMIA 3BALA 3H7JA 5GLUA 4YM3A 1C1LA 4D7SA 4BIOA 3H50A 1H4GA 3ZVXA 2JD4A 5K9YA 4N90A 1AXZA 1EV11 3N4MA 2GC3A 1W39A 4BCUA 1C3HA 1U5XA 3MW3A 2Z42A 3KM5A 1A6CA 2WKKA 2DCTA 1MS4A 1H0BA 3CLPA 1YFYA 4OHWA 4GH4C 5CB7A 3UJOA 2QCSB 1Z78A 2BWCA 2XB6C 4QPIC 1NA1A 1IGOA 4S2DA 3TB0A 1H30A 1AF9A 3AK0A 1FOD3 1QHDA 2D6PA 1HRV3 5I91A 3ZN4A 1WW6A 3AKSA 3N3HA 4YZ2A 1H8TA 3D0SA 4Q4V1 1BEV1 3DV8A 4Z2WA 3NV4A 1LCLA 4BIFA 4HFSA 1TME1 1IPJA 1XU1A 4H14A 3WP4A 1VBE2 2F6BA 2OA2A 2TBVA 3NV1A 1KDMA 4GKXA 1AJKA 4HLTA 2G9GA 1V9U2 1W6QA 4YG6A 1AL21 1IPKA 1QH6A 3WZ1A 3VLBB 1ND3C 4L8QA 3I7DA 3PJQA 4XIKA 4IEVA 3NWKA 4PBOA 1DHKB 4PQ9A 4DPNA 2YPJA 3TOJA 1R1A3 4XIOA 4URTA 1PO13 4GMP3 5BNQA 5J48A 4RHV2 3NVCA 4CP2A 4RL7A 4A7KA 2QFEA 4Q1RA 4CDXB 1ULEA 1ZYBA 2IXLA 3VHOA 1HXS3 3FFQA 4LBJA 2ZS6B 5E16A 3RNSA 4HBNA 2RS52 3C2UA 1UN1A 4KH9A 1XNDA 4IXLA 1JTZX 3WY6A 3EQEA 3R0RA 2XUMA 3RI9A 3VL9A 1HRI1 1J1LA 3TBDA 4XFAA 2DF7A 4CDWC 2H0VA 4FPLA 4YLZA 2VU9A 1GZCA 1QKQA 2PHDA 3AXDA 3DGTA 4COVA 4YW5A 4Q4Y2 4KG0A 4YW1A 4IETA 3RWNA 1H9PA 3BB6A 1MVQA 3AKRA 4G4FA 3WQ7A 1QDCA 1VLNA 3J8F2 4LUKA 3NJZA 1BVP1 3I2DA 1ZRFA 3BIWE 4DQAA 2GN3A 3JBG3 1AR92 1UX6A 3ILRA 4HSLA 2VULA 4DY3A 4LBQA 5FCCA 1X7NA 3H7YA 4IL7A 3TAYA 3WG4A 2QDNA 4N43C 5GZEA 1LODA 3OGGA 1I9RA 4Z07A 2BFUS 3OBRA 3URFA 5JDBA 3IDEA 1FOD1 1BMV2 2BYVE 2XWJB 1NLSA 5HCAA 3USUB 2JG8B 4LULA 4XTMA 5C8WA 4MUVA 3RYRA 1C8M2 1PGW1 4XJZA 3H1YA 1AJOA 2EAAA 5FPZA 5KXCA 1AR72 4FVVA 1H1IA 1LOEA 4X8PA 3U4XA 2ZJCA 1LECA 1V6IA 2RS12 4EJRA 2ZGRA 2XJPA 1C8NA 2AH2A 1MS9A 2BTVC 3B01A 4R9CA 4I0AA 3AYAA 3SCFA 4LTAA 4INDA 4C0HA 1XQNA 3AZZA 3B7MA 1MZFA 2FMYA 4FP2A 1GNZA 1J59A 2ZGMA 3JD71 4R9AA 1Z7S3 2V09A 1ALYA 2PAKA 4YGCA 4YW4A 2GMMA 1WCSA 2XWBB 1SDWA 4GMP1 3SXWA 1IKPA 1RUJ2 2EA7A 5ABJA 3PHMA 4RFT0 3VKFC 2P34A 4KGQA 3AZWA 3JCIA 3VBSA 3WHUA 4FPGA 4RR3A 4IV3A 2VNOA 3I54A 5JWPA 5CFDC 3B69A 1TE1B 3B9CA 4ASMB 3TYJA 1TMF1 4NPRA 1HIXA 1EAH3 4IV1B 1LOFC 1Q5OA 4AFBA 1OHFA 4Q4W2 3O7OA 5BY5A 1BBT2 1REDA 1ZM1A 3ILNA 5L36A 4M3CB 1VR3A 3VBHA 3GZTB 1BKZA 2XPJA 3FX3A 3OBTA 4L92A 1WUVA 4JGYA 2H0BA 2XLAA 4AFDA 3ASIA 3LA3A 1S0JA 1QXRA 2HWC3 3T2TA 3OCPA 3FWEA 4DNYA 2BQPA 4O9GA 1NCRC 2YUEA 1UPSA 4RS5C 1FI2A 4N7IA 1G9AA 1H2LA 4LE3A 2O8QA 3CJIC 1OOPB 1RVF2 3C3VA 1YJLA 3KT1A 5C9AA 1NXD1 3VDDB 1LHUA 4G9SB 3SHRA 4AFCA 3M2MA 3WUDA 4CEWA 1TNRA 2QZ2A 3MYXA 3ZFFA 1YFWA 4W65A 2DU0A 4CEYB 2LTNA 5DG2A 1OFSA 5LRSA 1ZBA3 2ET7A 2XBO2 4XJ9A 3LAGA 3ZXFA 4BMBA 5GZGA 3KD4A 1RUE1 1H9WA 2ZHNA 1KFUL 3FJSA 1QJY2 2VW2A 3VBUB 4FAHA 2DVFA 5FO8B 5C4WB 3R05A 4FOYA 4K3UA 4Q1PA 2A3WA 1ZZ7A 1RUF2 2PELA 3PVEA 5DDJ3 2ZBJA 3USSA 1NCQC 2W08A 5AVPA 3ZFGB 1GYKA 3R4DB 2YV8A 1GKBA 4P14A 3IWZA 4XJUA 4NR1A 1R091 2XJSA 5F9TA 3AP5A 3PLQA 4DZGA 1EPZA 3AMMA 4MLOA 5DZEA 5JSOA 2HWF1 1Q3EA 2BGCA 3BTAA 2ES3A 4R52A 3HT1A 5BYNA 2VXRA 1RUC3 3AKQA 4Q4X2 2VG9A 3VZMA 5DG1A 3D0JA 1YIPA 1CIWA 1W0OA 5E8AA 2WSVA 1H4HA 1DQ4A 2XL9A 4QQHA 4Y1UA 5CU1A 4UW3A 2R043 1C57A 4I01A 1NA1C 4AG4A 2UWCA 1V6MA 4JRLA 3MDPA 4ATFA 3ENRA 3FLRA 1WA4A 4YRDA 4P9LA 4CDQA 1LOBA 2ZKLA 2ARXA 2WNVA 4RGGA 4NO4A 3B93A 5JPMB 2V5YA 1H8TC 3RJ2X 4C1WA 1JOJA 1L3JA 1RUD3 1WLCA 1XU2A 4META 2AGSA 4I09A 3NV2A 4QHBA 3LCPA 3RPQA 2UURA 4NVPA 4AI8A 5JVVA 2WS92 4YARA 1W6PA 4E4DX 3A0NA 1WCDJ 4HKLA 1RUI1 4AK3A 4S2FA 1CESA 1VAKA 4WM8B 1FMD2 4GKYA 1RUOA 3CJXA 2PA7A 4AVVA 5JOYA 1JN2P 2W39A 3FE5A 1C1FA 1B09A 3P3NA 1Y9QA 5HBAA 4YVSA 3NAPB 3PNAA 4Y24A 3J4UH 2AREA 4GB31 2CWMA 4FPOB 1OPOA 2YGMA 3LOBA 1HQNA 5FMOS 4A7ZA 1CX4A 1HV1A 4AYUA 1WD3A 3ZO0B 1W6NB 4KU7A 3B9IA 2GH2A 5B2GB 1VAVA 4N9IA 2IZWA 1VJ2A 1LENA 2PLV2 3MPPG 4XFGA 1GZWA 3ZDSA 4LO4B 4FOQA 1LHWA 2IXJA 1UCXA 2ZZQA 1MQTB 3E6CC 5J98B 1MEC2 4GWNA 3ZFEA 2VH9A 1PO22 2BVVA 5KHKA 1D2SA 2C5DA 5C33A 1UD1A 1F9KA 4Y5Z0 2OPKA 3FC0A 3D6EA 5LK5A 1RMU2 2A3XA 1OA4A 3RZZA 5AFBA 3WP6A 4XHBA 5I0UA 1V00A 4HPKA 1O4YA 1PVC2 1R082 3I59B 4AI0A 2JJ6A 2Q1ZB 1CAXB 4XF4A 2UY9A 1WBLA 2UWAA 2YHJA 4JCKA 3FFZA 1COV1 2NPIA 2JECA 1RL3A 4XILA 2E7AA 3SCHA 1NG0A 4F83A 4AEDC 1CJPA 4FPEA 1PGL1 1QJU2 1W6OB 3OPZA 3OY8A 4GH4B 2GN7A 4XQDA 3QCWA 4QPIB 5GLZA 3N35A 2EXKA 2ZX4A 1H8VA 1V9U3 3RYPA 4UBGA 3THPA 3IPVA 1F31A 4TLFA 4WBBA 1DFQA 2DUPA 5LRRA 4MGZE 4Z8BA 4O9EA 3VBRA 1RUG2 1VRH1 4N43A 3K48A 2JE7A 4P9IA 4XF1A 2HWE1 4Q8KA 5C6CA 2G9FA 1DQ0A 2YC0A 3VBFC 1NE4A 2GNMA 4RHV3 1LU2A 1F5FA 1ZX5A 4J1WA 2WZR1 2A70A 2XG3A 3PMSA 4MX3A 1W6MB 2MEV2 3FUQA 2IFWA 4F3JA 2RS53 3UL2A 3KLSA 1LGCA 4QPYA 3ZYRA 1ZRRA 2BNMA 4EN9B 1ND3B 2VECA 5ABJC 3H0OA 1VBD1 5HCFA 1VP6A 2HWD1 3SMHA 3VBSC 1VBB1 5F6KA 2R16A 1Q8PA 4RR3C 1QQP1 4IEWA 3R6SA 4IV3C 2JXAA 2ZGUA 3KS7A 4B29A 1X36A 1X8EA 4Z92B 5GZFA 4Q4Y3 4LE4A 1G9BA 5IK4A 1D4VB 1AYN2 1KITA 2GH8A 2E9QA 1FPN1 1ZZCA 5L7OA 3GALA 1O3SA 4D69A 2AZ5A 3J8F3 2VVDA 2DCJA 2JG9A 4HK9A 2BWAA 1RUNA 1CQ9A 3GBFA 2C1FA 4WVZA 4QD2A 3VBHC 1AR93 1H2MA 1KJLA 3U10A 4CDWB 4D94A 2IC1A 2ZGPA 4AQSA 4JGYC