4FQZA

Crystal structure of a protease-resistant mutant form of human galectin-8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
291
Chain Sequence
b'MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
molecule tags Sugar binding protein
source organism Homo sapiens
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
total genus 61
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fqzA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fqzA02
2B7YA 1G7YA 3M2MA 5JVVA 1W6OB 1HDKA 3MW4A 2ZMLA 2R1DA 3OPZA 5EWSA 3KM5A 1ENSA 4XMIA 2D6MA 4UW5A 2JE7A 3AXEA 2PHXA 3IMNA 2ZGSA 3USUA 1FAYA 4XTPA 4AWDA 1GZWB 1BYHA 2P34A 4ASMB 1LULA 4D69A 4FOYA 5T5JA 2GN3A 3WDWA 1LOBA 4XMAA 2HYKA 4M3CB 1ENQA 1R1ZA 1LHOA 1N3OA 2A71A 2JECA 4XHXA 5F9TA 1HQLA 1AXKA 3AYDA 2UWCA 2A6YA 3IN9A 5DZFA 2GMEA 1G9FA 4WZFA 2DTYA 4P9XA 1ULDA 2JJ6A 3M1HA 2UU8A 4FQ4A 1Q8OA 4L8QA 1WLWA 5T5PA 1GSLA 4GKXA 2JDZA 4DRVA 2A3XA 3BODA 4YG0A 3AP4A 3IM0A 4FPHA 2ZAAA 4YZ1A 1GZCA 1JHNA 5T55A 3WDTA 3AP9A 4YM2A 1W6PA 1LENA 1H30A 4LBOA 4AGGA 1AX0A 3NV4A 1MZ6A 2P37A 2WSVA 2WNEA 3C2UA 5T5LA 3RG0A 3T2TA 1QDCA 1C57A 4Y26A 1VAVA 3FLRA 4GWNA 3AZYA 4K1YA 1MS3A 3A0NA 3DUIA 3JU9A 1N1YA 2A6XA 2CWMA 4AYUA 3QCWA 5IK7A 3ZSMA 1Q8QA 1MVEA 1GLHA 2GNMA 3IPVA 2I2SA 3LSEA 4YFWA 4XTMA 3GNEA 2NMNA 3OJBA 3VKMA 3WUDA 1V6LA 1CPMA 2VW1A 4Y1VA 1IS4A 2AH2A 1UMZA 2D6KA 3GALA 1YYNA 5E88A 2D43A 2DU0A 2DWRA 3WLUA 3ZSLA 4GXLA 1LOCA 3BOPA 1SACA 4K1ZA 3VKOA 2OUJA 2V5YA 2H0BA 1ULCA 1Q56A 5E8AA 1UKGA 4DRRA 2VU9A 3O0VA 3B00A 2P2KA 1CQ9A 1WUVA 2W52A 4YW2A 1LOGA 5CBLA 1S0IA 2WLQA 1LCLA 3D4KA 4YFZA 5DUVA 2YMZA 3ZXJA 4Y20A 3AP6A 1DQ5A 2OVUA 2DVAA 2GNBA 3HMYA 1XQNA 2D3PA 1IS5A 1ULEA 3OBRA 3OGGA 4Q8LA 3N35A 3SITA 2EXHA 4PF5A 4U2AA 3RSJA 1YI7A 5F5QA 2E51A 3PMEA 1V6JA 1AVBA 4YM3A 3A0KA 3MW3A 4K20A 1OFSA 1C1LA 1UZZA 4ZXKA 1QF3A 1MZ5A 3BIWE 2JD4A 2A75A 2CWSA 2DUOA 5IK5A 2VXRA 5GALA 1G9BA 2ARBA 3AFKA 3AZVA 1S0EA 1SLAA 2A3YA 3CNAA 4FOVA 4TYSA 4YG6A 3ZSJA 1QNWA 2E7QA 3AXDA 4WV8A 1CESA 2R0FA 1SCRA 3AX4A 2WT0A 4FOWA 5JLVA 1GANA 3OYWB 4PCRA 2NMOA 3R05A 3APBA 2ZGQA 4Q1RA 4XIOA 1BXHA 1MS4A 2BQPA 4Q26A 1OQ1A 4XJ8A 3WCRA 5GLUA 1QOTA 1VALA 1GBGA 3MEPA 1FNYA 4NOTA 4TZDA 4XZPA 1RINA 2R0HA 5BYNA 1W6MA 2P3JA 4FPCA 4K21A 4CRQA 4R9DA 1W6OA 1LU1A 3ZXEA 5L73A 4XHBA 4FP2A 2E7TA 4RL7A 4IQPA 5T5OA 4FPFA 4FPJA 4P9YA 1BQPA 1B09A 4P9WA 1MS0A 3RQ0A 3W59A 3RMYA 1S0CA 4GALA 3WG2A 3MPPG 1YIFA 3RS6A 4YW4A 2JKBA 3AYAA 3N3HA 2A6VA 3WV6A 1DQ6A 1QOOA 1BZWA 5LK5A 1PZ9A 3WCSA 4BLIA 4LBJA 3POYA 2WT1A 4JC1A 3INAA 3FLTA 1CIWA 4F83A 2A6ZA 3WVJA 1IKPA 2ZGLA 2P3IA 1I1EA 5JMCA 1H9PA 1JUIA 1CPNA 4ATFA 1LGBA 4YGBA 2WJSA 5HCFA 1WLDA 1PZ8A 4DQAA 4FPLA 4P14A 3V64A 4YGCA 2AR6A 1BJQA 2ZHMA 2ZGNA 3LSDA 1KDMA 1NLSA 1C1FA 3OY8A 5JOYA 4Z8BA 1A3KA 4FOQA 4U36A 4Y24A 5IK4A 2VUAA 1LGCA 4DS0A 2DUQA 1DGLA 1X50A 1SFYA 1JOJA 3N7MA 2DV9A 4LBQB 2W08A 1WBFA 2PHFA 1LESA 1W6QB 2ZMNA 1A78A 1D0HA 4SLIA 3FBYA 4GKYA 4YLZA 1Y7BA 1JW6A 3ENRA 3VV1A 2ZA9A 2AUYA 2EXJA 3N7JA 2EAKA 1MR5A 1LTEA 1GZWA 2DVBA 3H0OA 1VIWB 2GN7A 3IPVB 2WT2A 1DZQA 4ISRA 1QOSA 1YO8A 2VW0A 5GZEA 3WUCA 3AJZA 4Y22A 5AVAA 2ZGMA 2PHUA 2YXSA 5DXDA 1N1VA 1DHKB 3N7LA 2ZZJA 4R9CA 1DYKA 5DG1A 3R4SA 4FP3A 1JBCA 4BQ1A 3I8TA 1DLLA 5KXEA 5JOWA 1UPSA 3ZXFA 1U0AA 1IS6A 1OKQA 1V6MA 1F31A 2YV8A 3HR9A 5CA6A 3N36A 1Q8VA 4LBKA 5GZCA 1CJPA 1WW6A 1O4YA 2EIGA 1AX1A 1MS1A 2ERFA 2UWBA 3D6EA 3O12A 4FPKA 4XILA 3USUB 3WDXA 2DVGA 4MYEA 1WLCA 4Y1ZA 1AJKA 2JE9A 2AYHA 3WHTA 2DYCA 1LOAA 2ZGTA 3FUQA 5GZGA 1NXD1 1IS3A 1W0OA 2ZACA 1N1SA 3NV2A 3SH5A 1VLNA 2FMDA 4UW4A 4AVTA 4M3CF 3UK9A 1AXZA 5GZDA 2ZHKA 3FUOA 4ITCA 2AENA 1SBFA 4Y1YA 1QKQA 5DUXA 2ZBJA 4AVSA 3V0AA 4YW3A 1G86A 1QNYA 2E53A 2EF6A 2GMMA 2D6NA 4M3CE 4YZ3A 1FV3A 2AGSA 2GDFA 1AXYA 1H9WA 5EYXA 5JOZA 1DQ0A 3M3EA 1S0JA 2YROA 1SLTA 2NP0A 1Q8SA 3RRDA 2A6WA 1LEMA 1ULGA 3LCPA 4YW5A 2ZGUA 3WDVA 4R9AA 4Q8KA 3I4IA 1IOAA 4XJWA 1C4RA 2D7FA 4JCKA 3ZXKA 4YZ5A 1RITA 3SH4A 1LODA 3PJQA 5FRAA 2VW2A 5T54A 5KXDA 2TEPA 2VH9A 1FX5A 3Q9OA 1W6MB 4XXAA 2D3RA 4BMEA 1UZYA 1QDOA 2A3WA 2G4IA 4BMBA 1GKBA 2UWAA 2WQZC 4W65A 4XJAA 2Z42A 1UL9A 3W58A 2NYYA 3M3CA 4OZXA 2ZABA 4XJ9A 4DFSA 1MS5A 4H55A 1BKZA 1TEIA 1WW5A 1GNHA 2YZ4A 1RIRA 4CTEA 1FV2A 4UW6A 3SH3A 4YGDA 2ENRA 3AP5A 4Q1PA 3SISA 1URXA 5KXCA 5E89A 1W6NA 4M3CA 5DUUA 2C9AA 1KITA 4YG3A 5IT6A 2PHWA 3M3OA 2R1BA 3B9CA 4I30A 3ZVXA 5GLVA 5H9PA 1N3QA 1LHWA 1Z0HA 1W6PB 5GLZA 1S0BA 1DQ1A 3V0BB 4FPOB 4BLJA 3AZXA 1AZDA 1G8WA 2W68A 3WNXA 3ZXLA 3ILNA 2PHRA 1MVQA 2ZGPA 3B69A 4FPGA 2GALA 2XG3A 3ILRA 3WOGA 2NM1A 2SBAA 2AREA 4GA9A 1CVNA 1GV9A 3PVEA 4LBNA 5T50A 1WCSA 1UAIA 3HN1A 1KQRA 2A7AA 3AYEA 4GWMA 3NWKA 2OUHA 2ZMKA 4XBLA 3T1MA 3O5SA 5DG2A 5GJ6A 3PVOA 2R16A 2XB6C 1SLCA 2EXKA 4HL0A 1FYUA 5EXOA 5KXBA 3NV1A 5H9RA 5HCBA 3UL2A 3A4UA 1V6OA 4YGEA 3BTAA 4M01A 5CB7A 3WDYA 1DBNA 1MACA 4Y1XA 1V6IA 3FLPA 2C5DA 1GZ9A 2ZHNA 5GZFA 1O4ZA 5DUWA 4FVVA 4XBNA 2ZHLA 1S0GA 5SV8A 3DGTA 1WD4A 5CNAA 2CL2A 3RMXA 1G9CA 2OW4A 2D3SA 3N7KA 1EPWA 1JXNA 4XDQA 3VKLA 1FNZA 1LOEA 1LGNA 4HANA 4RA0A 1AX2A 4PBOA 3PVNA 1V00A 3AP7A 3VKFC 1D2SA 1SLIA 2DU1A 1LOFC 1FATA 5JDBA 3ZPYA 2SLIA 4YZ2A 1W0PA 1SBEA 4XXPA 3U4XA 1DQ2A 3ASIA 3ZSKA 1SLLA 4LBQD 4XBQA 2CTVA 4BPZA 4WVWA 1Z78A 2W39A 4Q2FA 1GICA 3NV3A 1V6KA 2D44A 4WVVA 5DZGA 2GNDA 5T52A 1CN1A 4XJUA 3UJOA 3WDUA 1F9KA 1S0FA 3POWA 1WW4A 2ZGRA 2DTWA 2YY1A 1V6NA 4JRAA 2ZKNA 3MW2A 1KJLA 3AZZA 4Y20B 1CR7A 1YXWA 4C1WA 2ARXA 4LBQA 5GLWA 2R49A 4YM0A 2ZGKA 2CNAA 5JOXA 1LJ7A 2E6VA 3ILFA 1DFQA 4BOWA 1N3PA 1AF9A 1LU2A 1A8DA 2WKKA 3VKNA 1SLBA 2LTNA 3OBTA 4YM1A 3WG1A 3AZWA 2DVDA 1G9DA 3IKWA 4XYXA 2FHRA 3R4UA 1KDKA 4Q27A 2Q5TA 3QLQA 4BM8A 1QU0A 1APNA 1ONAA 1YRZA 4YZ4A 3WG4A 1AJOA 4FQZA 1SCSA 1LHUA 4ATEA 1N47A 1ZM1A 3ZYPA 4FPEA 2A5ZA 3VUOA 3L2YA 5FREA 3WHUA 1CONA 3JUUA 2PHTA 5H9SA 5CAZA 1GNZA 1LHVA 1MS8A 3OYWA 4PBPA 1N1TA 1LHNA 4R9BA 1WD3A 3AYCA 3B01A 5GM0A 1J1TA 1ULFA 1W6NB 1VAMA 3WZ1A 3O0WA 4CZSA 2RHPA 3B3QE 1UN1A 2V73A 3SNMA 1G9AA 2EALA 3AJYA 4XIKA 1F5FA 4LBLA 1GYKA 4NO4A 4UW3A 3SLIA 3TB0A 3WG3A 1S0DA 1W6QA 1DIWA 1HLCA 1LEDA 2WSUA 3O0XA 4DPNA 2ES3A 2D6LX 3OY8B 3V0BA 1LOFA 5DZEA 1JYCA 4XOGA 1SBDA 1ENRA 2PELA 5EYYA 1KJRA 2CYFA 1MS9A 1PZ7A 4ZKTB 4XJZA 3FFZA 4XE9A 3TAYA 2LALA 1HQWA 5IK8A 1UX6A 1IKQA 3T1LA 4M00A 1HKDA 3AK0A 2A70A 4YW1A 2P3KA 1Q8PA 1QMJA 2DURA 2DVFA 2GNTA 1DYPA 2ZGOA 5GLTA 4AGVA 4PQ9A 1JN2P 1JYIA 4FPYA 2EXIA 2D6OX 4KBBA 3POSA 4LBMA 1ZA4A 2KM2A 3V65A 4C1XA 2VY0A 3KQRA 5IUQA 1QGLA 3ATGA 5H9QA 2NN8A 3V0AB 4AVVA 2CY6A 2GMPA 3M3QA 2D6PA 4Y22B 1WBLA 1WW7A 2UURA 3UJQA 1I3HA 1DQ4A 1LECA 1KRIA 3D5OA 5HCAA 4Y1UA 3ZYRA 4AGRA 1S1AA 4ISQA 2NZ9A 2DUPA
chains in the Genus database with same CATH superfamily
1ST8A 1I6XA 3J7NA 4L99A 1JU4A 2W3JA 3ZYBA 1JZ3A 5F5AA 1W06A 4QWNA 2D6MA 2XGXA 4UW5A 4IGQA 1GOHA 2XMLA 4LOSA 3BTXA 1FAYA 4XTPA 3SQOA 4AWDA 1BYHA 1RUJ3 3VBFA 4Q0VA 4P9LA 5G04L 4C91A 3S5QA 1I5PA 2HYKA 1ZZCA 4XHXA 3OEAA 2R062 3WNKA 4Z1VA 1RUI3 1VBB3 2Y34A 3U1XA 2RM21 4H3WA 1ZX5A 4IE0A 3Q8CA 1G9FA 5C7GA 4P9XA 1ULDA 3M1HA 2UU8A 4B4PA 3POFA 2J1SA 2VQUA 2RDQA 2P17A 1IQDC 1GSLA 4GH4C 1ZBA1 1ND2B 3AP4A 2ZZQA 4CDWA 5F6KA 4CP1A 3IM0A 3JBG2 4BQ4A 2ZAAA 3CLPA 3IT8A 3NAPA 1JHNA 1NE4A 1T6BX 2EVXA 4B3NA 3WDTA 1OQEA 2VZVA 4YM2A 1ZZ9A 3GHMA 4CDUA 3UKNA 4ZS3A 5IAXA 4N53A 3C2UA 1H8TB 2NLRA 4Q4Y3 1VAVA 2R073 3FLRA 4EE2A 3WX5A 2BZDA 4Y5SA 4Q29A 1H8VA 2CWMA 3LDKA 1QJEA 2HBUA 3TBDA 5FZ4A 1MVEA 1GLHA 4MGSA 3MF6A 1EV11 2ATFA 1XNAA 2YG0A 1MPXA 2HKXA 3VKMA 1GR3A 1V6LA 2ARAA 2UYBA 1ZRIA 3TEZA 1HX6A 1OMIA 3WW2A 3DEMA 4N9IA 3WLUA 3NSTA 3ZSLA 4QU1A 1LOCA 4LUMA 1SACA 2DCYA 2VD7A 3OPTA 3VKOA 1AR72 2H0BA 2PQSA 3SEPA 1ULCA 3SKVA 2ZPXA 5E8AA 4A4AA 3U4SA 1R083 5FBJA 2VJXA 5FP8A 5I93A 5T3NA 3RZMA 5B2GB 4RFT0 4PIZA 2JKXA 2JDPA 1X8MA 2WLQA 3HN3A 1LCLA 3D4KA 2VZ1A 1R082 1BCXA 3AP6A 4XW3A 2OVUA 2DVAA 2BRTA 3HMYA 3AMMA 4BQWA 3H1WA 5B4XA 4CP0A 4BJ0A 1W8HA 3N35A 2RDNA 4QPGC 4A6SA 4PF5A 3RSJA 1YI7A 1Q3EA 3BI3A 1OKOA 1AVBA 4CCJA 2GC0A 4LEJA 5DQ0A 3DPRC 4K20A 1ODNA 4ZXKA 1UZZA 5IVCA 1MZ5A 4RS5A 1UF2C 3BPZA 2JD4A 5LRRA 2CWSA 3GZTB 3I2HA 3ZFEA 5FPXA 5HV4A 4YARA 1G9BA 3AFKA 4TYSA 3KGZA 3W21A 3PU3A 1TQ5A 4QX5A 1NA1C 5FJKA 2B9VA 3I3QA 1W99A 4Q4V1 3UGGA 3E5UA 1O3SA 1VB2A 1SCRA 4MV2A 4NWVA 3N9PA 1W28A 3ZM8A 3AB0A 4BZ4A 3TNQA 4FOWA 2VZ3A 1O5LA 1HV1A 5FXZA 3ZN5A 4PCRA 5LBFA 3KD4A 3EXUA 4Q4Y1 5CKQA 2QFEA 2JDMA 1MS4A 2F4LA 4AVCA 3NNGA 1CAUA 1VMJA 1OQ1A 4QHZA 1W9YA 5GLUA 5J3UA 2WZR3 1ULOA 2J22A 4JGZA 4TZDA 5LEJA 5ABJB 5FMOL 2RMU3 4URTA 2VOKA 3HIFA 5F2SA 1HRV2 1W6MA 1HQNA 3L2HA 4AQTA 1NA1B 1W6OA 1R64A 2RR11 1G6NA 1H8TC 5L73A 1PMHX 2XWJB 4XHBA 4FP2A 1RUI2 1X8EA 4RL7A 3E6CC 4FPFA 3UV9A 4P9YA 5KHKA 1BQPA 4P9WA 3RQ0A 1MS0A 4BB3A 4QD2A 1WCQA 4QPIB 2WNUA 3HD8B 4GALA 1YIFA 3O1UA 5J7MA 4N43B 2JKBA 5A7WB 4DB5A 1DQ6A 2WZEA 3USSA 2JG8B 1RMU3 2WT1A 2XUEA 1OC1A 3GYDA 3POYA 4JC1A 3IAQA 1W8OA 1CIWA 5C5TA 5HXMA 1S55A 2ZX1A 2ZEYA 4QGNA 1I1EA 1H9PA 1JUIA 4LO4B 1LGBA 2G19A 1OD3A 4L9BA 4YGBA 2BYVE 4F8AA 1JYNA 1YQ2A 4GB32 1X82A 1VRBA 2JXAA 5FZAA 3DXTA 1C1FA 3OY8A 1UNBA 1A3KA 4Y24A 3WD5A 1ND2A 4DS0A 3AL5A 2FDIA 1X50A 1AR61 5EJ3A 4QU2A 1C28A 2IXIA 2O8QA 2W08A 1ZZ8A 1LESA 2PHFA 3BPSA 3BU0A 4CXXA 5LATA 1D0HA 2PQQA 2W9XA 5A3WA 4A44A 2Q8EA 1GZTA 4N90A 3ENRA 5BPXA 3RJ2X 3VV1A 5I0SA 1COV3 1BVP1 2WZR1 1RVF3 3EB7A 4LK6A 1QJY2 1P8JA 2GN7A 3KLSA 4K9SA 1U5ZA 2D5FA 2H0VA 1DZQA 2WT2A 3WP3A 4KWUA 1QOSA 1YO8A 3IDBB 3J8F3 4O65A 3THPA 3AJZA 1QIQA 1TME3 3WUCA 4A3XA 1CZVA 1OOPC 4ES9A 4XURA 1H6YA 3KV4A 3WT3A 3X29B 4DINB 2OXBA 3R4SA 4FP3A 1JBCA 1FOD3 1C5IA 1OH4A 2D5HA 1DLLA 5KXEA 5T55A 5JOWA 4B1MA 4OZOA 2RR13 1UPSA 1EUTA 3KV5A 5FZOA 3ZXFA 4CVUA 1BBT3 5JR2A 1OPMA 1RMU1 2N7GA 2VBDA 3HR9A 1PGSA 5GZCA 4KWKA 4P02B 2QQWA 3DN7A 3WW1A 4A3ZA 4OUSA 4D3WA 1AX1A 4EZ4A 5IHRA 4XILA 2AC1A 3USUB 3WDXA 2DVGA 1OF3A 1AJKA 1J1LA 5CISA 4GIQA 4FAHA 3WHTA 5GZGA 1LOAA 1YFUA 3FUQA 4JKKA 3J7MA 5F2WA 1M06G 4BQYA 4ZHNA 2FDFA 4NIGA 5DDJ3 3ZKUA 5FPAA 1COV2 4COWA 4AVTA 3KZ4C 4QKBA 5LK7B 3CHXA 2WAAA 2CV6A 3LB9A 2AENA 3OGSA 2DCTA 4YW7A 3K4ZA 5DUXA 2ZBJA 2BUKA 3S5AA 3O1MA 5FYBA 1JHJA 1G86A 4BHPA 2QQVA 2XJVA 5A7OA 1H2LA 4ZZ8A 2ZX0A 2QQPA 2GDFA 1UU6A 4E4SA 1V0AA 4KNCA 2Y64A 1LEMA 5D1IA 2BPA2 1A6CA 4P9GA 5F7UA 3AMQA 4HFSA 4IV1A 5FYHA 2VOWA 3GCWA 4X6QB 5LY1A 2VC9A 5CKNA 2B9UA 1FOD1 1FPN2 4A42A 5FK7A 1PVC1 1JOBA 1C4RA 4JCKA 5E6HA 3ZXKA 4NIDA 1ZBE2 2C4XA 4CU8A 4OLLA 5FRAA 3HQUA 1RUE1 2Y6HA 2TEPA 2VH9A 4ZZ5A 1W6MB 4XXAA 4S2FA 4BMBA 2WQZC 4QX3A 3POIA 1V9U1 5FO9B 1OLQA 1UL9A 2E31A 3A22A 1WA6X 3LA3A 1O7FA 1O3TA 1E5IA 3T2QA 4XUTA 2TNFA 1DYOA 5FP3A 3HQXA 1VRH2 4AEDB 5FY0A 4EN8B 1W6NA 4MSVA 4EYUA 2B4KA 1WCUA 5DUUA 4GH4B 2O1QA 1UPIA 2XHNA 3M3OA 3O1TA 4OMCA 1D4M3 3OSDA 5FCCA 3DPRB 1FT9A 4I30A 3CEWA 4M0NA 2W0XA 3E5XA 2PHDA 2HLEA 5C5UA 4FFHA 4JDNA 1W9SA 5GLZA 2AEYA 2QQJA 4PT6A 5BNOA 1JOPA 1REFA 3AZXA 4LTAA 1J83A 1G8WA 3CU7A 3ZXLA 3G6JB 2VZPA 4IEZA 3B69A 1UD1A 1H1MA 2GALA 1B35B 2X8KA 3KF5A 1ZYBA 2NM1A 2SBAA 4UBGA 4EN9B 5BNPB 5EIYB 1J59A 3WQBA 1WCSA 1UAIA 1ND3C 3TRSB 2A7AA 4MGQA 1KXGA 1UZVA 3NWKA 2OUHA 2ZMKA 3VZMA 1PO21 2B45X 4L11A 1SLCA 2WN3A 4G9SB 3RJRA 2EAAA 1WMXA 1JYWA 5HCBA 2JG9A 3A4UA 2HWE2 1V6OA 4YGEA 1V9U3 1H2NA 3WF4A 4ZPIA 4LHKA 4M4RA 1Q5OA 2XQRA 2JDAA 4WVZA 4EN0A 1MACA 3WP5A 4Y1XA 5D8AC 1Z7S1 2RS33 2YBKA 1PM4A 3FLPA 2X29A 1UCXA 4AAPA 1O4ZA 1LNSA 1PGW2 1RYYA 4JGYB 3CDZB 4A6OA 3T4HB 4TLFA 3RWKX 1ZA7A 1S0GA 3IZOA 1K45A 1T2XA 4YPJA 2CL2A 1VR3A 1AL21 4HK8A 1PK6B 3ZYJB 4AQ2A 4CDWC 2J1UA 2VBPA 4GMP3 4Q0UA 2OW4A 2D3SA 3K4AA 1EPWA 2D93A 4I0AA 1FNZA 1SPPA 1FI2A 1LGNA 3N9LA 4CDUC 4TTGA 4HANA 1AX2A 4PBOA 4CDXA 3ZMOA 2VCAA 2IXKA 3VKFC 3W9AA 1YQ8A 2FDJA 1UOBA 1HXS2 5FFOC 3ZPYA 1RJ8A 1S2EA 3QD6A 3POGA 3RYPA 3GDBA 4XXPA 2B5HA 1SLLA 1JYTA 2YGMA 1Z78A 4N8MA 4Q2FA 3ECQA 3NV3A 4WVVA 2D44A 5I8SA 5K0UA 3WDYA 3MV01 1PNFA 2WO2A 2ZGRA 4UFHA 3BIEA 4OMDA 4JRAA 2X05A 4IXLA 1KJLA 2BOJA 4BIOA 1CR7A 1XE0A 5FK8A 2HWB2 5FP9A 5GLWA 3TOJA 1C3HA 3VBUA 1N3PA 2VBBA 1H4HA 3ZFGB 3VDDA 1SLBA 2XWBB 1C8M1 2Q8DA 1AR81 1XNCA 2OIIA 4HPKA 1SFPA 1HN1A 3WF1A 3IKWA 3OTFA 4QPIC 3T3YA 3THDA 4CU9A 2FHRA 2WWSA 3MLJA 4Q27A 5IJRA 1ONAA 3THCA 2JG8A 1YRZA 3D82A 1TME1 3RYRA 3JXSA 3VDCA 2WUHA 1H2KA 5JI7A 2A73B 5FWJA 3VUOA 1VBB1 2VQAA 3L2YA 4PIXA 4RD7A 4QXCA 2QQLA 5EJ1B 1XYPA 2R071 4RR3B 1GNZA 3OYWA 2RS51 4UYBA 2VMFA 1CAWA 3B01A 5GM0A 2QQIA 1OBNA 3MUZ1 1REDA 1W6NB 4UFLA 3S6PA 4MXVA 1J84A 4IERA 1J3QA 5JSRA 5FPBA 3AJYA 5FPZA 4WZCA 1DLCA 4RSUA 1F5FA 2WYFA 2ZTNA 3AL6A 4UW3A 3TB0A 3BCWA 1W6QA 1W9FA 1HLCA 1OT5A 1UZWA 2P4EA 2WSUA 3NQHA 3O0XA 4OHVA 2OYZA 5J09A 2D6LX 1NOVA 4C90A 1LOFA 2P3YA 2JIGA 4Q4W3 1JYCA 3J7HA 1I9RA 4XFAA 3PDQA 2I45A 3VBHB 1EV12 3BN6A 3ZR6A 4CYDA 4Q0PA 2PELA 5EJZB 2CYFA 1MS9A 3LKJA 2ZS6B 4JGZC 4BIFA 4M0HA 1RUOA 2WZ8A 1EV13 4MG2A 1UX6A 1UY3A 2EIEA 4HK9A 4IEYA 4M00A 2Y6FA 1QMJA 2DURA 5GLTA 2ZGOA 3GBGA 3IBMA 3LGRA 1JYIA 4FPYA 1YJKA 1QJY3 1OA2A 1XC6A 3B94A 3M70A 2KM2A 4IE7A 3IDCB 4LBMA 4KMQA 3LPGA 3V65A 4AR2A 4QXKA 1B35C 2JG9B 4Q4X3 3ATGA 4XDOA 1MEC2 3V0AB 3PVBB 3ZYIB 1ZBA2 3CO2A 3M3QA 3FL7A 4AI3A 2DCJA 3UJQA 2UURA 3VBHC 2BNNA 1C8NA 4DUWA 5F1RA 5AC91 1KRIA 5HCAA 3NJZA 5DPNA 4YVSB 5LA2A 2IZWA 5C33A 2NZ9A 4E4HA 2DUPA 4COUA 1ZRFA 1G7YA 5JVVA 1DZRA 2GC2A 2R061 1HDKA 1K5MC 1XNTA 2W92A 4HT1T 3E6BA 4A2UA 4QM8A 4AFCA 3KM5A 3TYJA 2ZEWA 1NXMA 5CIRA 4XMIA 2BDRA 2F17A 4LIVA 3ST7A 2VUDA 1IPSA 3NNLA 4LKFA 3R6SA 3AMHA 3M8LA 4QX1A 1LULA 3ON7A 5T5JA 1BEV3 4MXWB 4AI2A 3WDWA 2QZ2A 2B39A 5L7OA 4HZFA 4M3CB 4AZZA 2C24A 5JIAA 2JECA 1K12A 4OI4A 2A71A 1UY1A 4IGPA 4LKDA 3T2OA 4CPBD 1BEV2 1HQLA 2OPWA 2XONA 2WC2A 3MUY1 3SCFA 4AOCA 2JICA 3IN9A 4P9IA 3NAPC 2VMDA 1RL3A 5FZCA 4XFIA 1J3RA 5F5CA 4MADA 5K0UB 4YVWA 1GP5A 1RHI3 2XLAA 5T5PA 4G4FA 3N9OA 3ZR5A 2A3XA 3HT1A 4DRVA 4FFIA 2E33A 1A34A 3J26N 3VN4A 2DCZA 1RHI2 1HB1A 5FMOS 3RZGA 3LQCA 3PHMA 4PJYA 1GOFA 4JZRA 4RFRB 1H30A 3PLQA 5L9VA 4B4QA 4QDRA 2ZX3A 1TNFA 2WFF3 2XVKA 1C57A 2FMYA 5GKAC 3ROUA 2R043 3AZYA 3GZEA 5K8SA 2VVDA 4QX7A 1GFF2 3RZHA 1D4M1 1EP0A 3PL0A 1N1YA 1AR92 2A6XA 4S2DA 4LA2A 5IK7A 1X9PA 2QNKA 4P9JA 1O6UA 1Z7S2 2GNMA 2I2SA 4MGZE 4N43C 4YFWA 1RUG2 1OFNA 3I59A 2VW1A 1WMEA 4AEJA 1IS4A 3OBZA 5IYYA 1HRI1 1YYNA 1PK6C 2DU0A 1GU3A 2DWRA 2RV9A 5E88A 3SKJE 3T09A 3WNLA 5JMOA 2QQKA 4GXLA 4NRQA 4DUXA 2WYSA 4K1ZA 1F4HA 5FY7A 2FD8A 3VL9A 3VZOA 1UKGA 2PAKA 2VU9A 2YBPA 5FZDA 4DRRA 3B00A 2P2KA 1CQ9A 1POV1 1D4M2 4IW3A 1WZXA 4AVAA 4MH0E 4OCTA 5CZKA 1AL0G 1ASJ3 1S0IA 2MNGA 5FY9A 3KHBA 4P08A 4Y20A 4FTEA 2HWD2 2Y26A 3I2JA 4XF4A 4NIIA 2BW8A 4CP9A 4ET7A 3OBRA 3OGGA 4Q8LA 4OQ9A 5LW9A 1JMUB 4U2AA 1RHI1 1EY2A 4V2WA 3LPFA 1HXS1 3J7LA 5F5QA 2BNMA 2E51A 3VBOB 2HJIA 2BNOA 2ZCWA 4CUGA 1JZ2A 4YM3A 4HBNA 5FLHA 1DGRN 1OFSA 1QF3A 2Z79A 2DUOA 5IK5A 4QKDA 5GALA 2RR12 2ARBA 2BTVC 4YG6A 1S0EA 2A3YA 1PIV3 4FOVA 3VB9A 3ZSJA 5A33B 4AFMA 1WCDJ 2J42A 1AYM1 4AHXA 2G9FA 1BEV1 2R0FA 4A41A 4WM8C 3AX4A 5KHHA 3P1IA 1CJDA 5CADA 1VBA3 2WT0A 1NLQA 4RS5C 3VD7A 1W9TA 5JLVA 4ONUA 4Q0SA 1GANA 3OYWB 4HKWA 2VTXA 2NMOA 2Y6JA 3R05A 3APBA 4B8EA 4CP2A 4QHOA 4F7ZA 3WW4A 1BXHA 2BERA 4KQ7A 2RS13 4PDWC 4AHWA 4HLTA 5I0DA 3RVHA 1DDLA 4WM8B 4XJ8A 1W04A 5FZ6A 2R30A 2GAUA 2R042 1GBGA 2HWE1 4MGYE 3OG2A 4NOTA 4CCOA 3IWZA 2XH6A 5I0RA 5IVBA 4OQ8A 4Q4V2 3H42B 2Q0AA 2P3JA 5FYYA 5KHIA 3RFRA 4BH9A 3PIGA 1PO22 2RE9A 1LU1A 5BNOC 1JZ8A 3NJVA 4FTSA 2FDKA 3JBG1 2DDUA 3DV8A 1YQCA 2VNOA 3ZX7A 4UXAA 3WY6A 5A1FA 1B09A 3OGRA 2VO5A 1YFWA 2WQ4A 3MHZA 5FZFA 3RMYA 4PI2A 5FZ8A 3RS6A 1XNKA 3AMNA 3N3HA 2XL9A 3ES1A 3E97A 2Y60A 1PZ9A 2RM22 3UGFA 4I2OA 1HXS3 2OT7A 5ACA1 3CKHA 3Q8FA 1JZ4A 3INAA 3IIIA 1IKPA 2Z69A 2P3IA 4XUNA 1CPNA 4WM7C 3E5QA 1K42A 4LKEA 2RJLA 4YGCA 2HWF3 4BQ2A 1SEFA 1LB2A 5FLIA 3JD71 1KDMA 5JOYA 2OX0A 3MI8A 5FYIA 3VDDB 4Z8BA 2JX9A 4U36A 1VBE3 3OD4A 5IK4A 5LA1A 1GOGA 2VUAA 3WNOA 1YFYA 1US2A 4DXSA 2DUQA 4RGKA 3CBNA 3RWNA 1SFYA 3BALA 1JOJA 1OUSA 2DV9A 2JDNA 5LBBA 5CVRA 4LR4A 3FN9A 1O3RA 5A6QA 2JDYA 1AYM3 4QB1A 4BQXA 2VUCA 4N53B 4GZ9A 5FZLA 5ANNA 1U5YA 2ZA9A 3WINE 2EXJA 2HWE3 1NZCA 1RJ7A 3Q8EA 2HH9A 2EAKA 3ZN6B 4EJRA 1GZWA 2DVBA 1QXRA 5FYZA 5L36A 5F6LB 2LROA 4CDQA 1ASJ2 5FYSA 3H8OA 5GZEA 1O4TA 4JQTA 4QGMA 4D6RA 1FOD2 1FPN1 4Y22A 1JZ7A 2ZGMA 4CCNA 2JWPA 1N1VA 4HETA 4EV0A 1X33A 4R9CA 4LORA 4QHBA 5DG1A 2WFPA 5JZGB 1RUG3 1U0AA 1H4GA 5EZWA 3VBUB 1IS6A 1OKQA 1V6MA 4Q5OA 5ACA3 5C9AB 5CA6A 5K7PA 1AR82 3N36A 3KHCA 1L7QA 2CDOA 3VBHA 1F15A 2QQMA 1C5HA 2UWBA 3D6EA 4IETA 2R32A 1L7RA 3DCQA 2EIBA 1WLCA 1EAH3 3JQWA 2ZJCA 5HPOA 3JBG3 2HWF1 1UW8A 2BVVA 4YSFA 2Q8OA 1IS3A 2ZACA 3NV2A 4GAZA 2WR9A 1VLNA 4J1XA 2YHJA 2CU5A 1X7NA 3LF7A 3K4DA 5ANQA 2RS12 3OD0A 4LNVA 2OZJA 5A32B 1SBFA 4OHXA 4Y1YA 4CU7A 2ZXQA 2C1FA 2IXJA 5CFDC 4NPRA 2WO7A 4IV1C 2BVBA 3AVSA 2R063 4YW3A 4RHV1 5A33A 5FMCA 1DGWA 2C6SA 4YZ3A 1R093 1FV3A 2JDHA 2PHLA 3SMHA 4CA9A 1RUNA 4UF0B 1YI9A 3M3EA 5LBEA 4QGLA 4DXTA 3K77A 5JSPA 1NT0A 2BBAA 1ULGA 2JG9C 3S7IA 2XJRA 2BWAA 5F8PA 2K46A 1XU1A 1W3VA 1EYBA 4GULA 4XF3A 4LIUA 3DF0A 3I4IA 2P1BA 1TVGA 2ZEXA 5F3CA 3I49A 3VL8A 3HVDA 3I2KA 4LITA 5DN2A 4CU6A 1UU4A 2D7FA 2PN5A 2OS2A 1VBE1 1UO9A 2VZQA 1D2QA 3OGJA 4Z2AA 2Q1MA 1KD7A 3J9SA 2G1MA 4YWAA 4L2NA 4CXWA 3RZLA 2VZOA 1QDOA 2A3WA 2G4IA 4OUEA 5LB6A 2UWAA 1XB9A 4Q4Y2 5A3TA 5C71A 2Z42A 3UETA 4URAA 4K40A 3M3CA 5JPMB 1NYWA 2RMU2 1BKZA 1IPKA 1RIRA 4N43A 5A7WA 5EFUA 4UW6A 3V56A 5CFCC 3AP5A 4DXRA 3SISA 4QB2A 5E89A 1S2KA 1UY0A 1OXCA 2BWCA 2C9AA 5LY2A 4YG3A 2Y6KA 2ZEZA 2VQ0A 5IT6A 2R1BA 1VP6A 1EPZA 2FZ1A 4YVSA 5FOJB 4LUKA 4GJYA 2DCKA 5J36A 5JXHA 1ACCA 1R1A3 1SDDB 2W1UA 1S0BA 3VBRC 4QQ2A 1RUD3 4XETA 3MIDA 1DU3D 1H8TA 2X09A 4FPOB 2PTMA 4ARXA 1AZDA 2VECA 3WNXA 4BYYA 3C7FA 4CDWB 1QQP1 4META 2ZX2A 2ZGPA 4W4ZA 1OVPA 2I74A 4FPGA 1REEA 2ADEA 3ILRA 3WOGA 2PA7A 1POV3 3VD5A 5C6CA 1CVNA 4LBNA 4OHZA 1GWMA 4NHYA 4ES8A 1D4VB 5IWFA 4GWMA 2XBO2 1QJFA 3T1MA 3O5SA 2LW8A 1VBA1 5BNNA 5GJ6A 5C3RA 3ACIA 1KS5A 2XB6C 3PVOA 4UFMA 4A45A 3VD9A 1FYUA 1TMF3 3NV1A 2ID4A 1YJLA 3LAGA 1VJ2A 2VNGA 3UL2A 4KH9A 2WNVA 1ENXA 3VZJA 5JI9A 3OGVA 4NN0A 4N7IA 4R4XA 4I3PA 5LA9A 3AKSA 1RUC1 5HV0A 2BU9A 2C5DA 2JENA 3DECA 4GWJA 1VBC1 2UY8A 5FZHA 4COVA 4E2SA 4TN7A 3NL1A 4C8DA 2L9LA 2ZX4A 5L9RA 5E1RA 2HWC3 3AMPA 4JKLA 4S2GA 5SV8A 3DGTA 4NROA 4B7EA 4I0BA 5FQ0A 1NUKA 4PLNA 3EO6A 1W2NA 4LMFA 4NVPA 5FXVA 2P5BA 4LPLA 2BBVA 4XDQA 3VKLA 1YNAA 5K0UC 4E9KA 3B02A 2E63A 1UMIA 3U07A 1HJGA 3ZN4A 1W8UA 3EMRA 1D2SA 5FPVA 2PFWA 1LOFC 4QXBA 4YZ2A 5FUNA 3U4XA 1DQ2A 3HWJA 3ASIA 2TBVA 1NAEA 3VZKA 5A70A 2OZ6A 4ORFA 3ZFEB 1AL23 2JB8A 4NRMA 3LA2A 2YGLA 4FI9A 4CE8A 5T52A 4NIHA 3UJOA 2W47A 4XJUA 5FV3A 1QJZA 1UU5A 1S0FA 1ZZBA 3WDUA 5D8AB 1OURA 2YY1A 3HBZA 1UYXA 4JV4A 2VM9A 4QX2A 1OA3A 3MW2A 3URFA 4OI2A 5IFTA 4Y20B 3RI9A 5FIXA 2K2SA 1PMJX 3B9IA 2EICA 5CFDB 1RXFA 3H50A 2E6VA 1DGWX 1UXXX 4BOWA 2ET7A 1AF9A 3NJXA 2KD7A 3OBTA 3K3NA 1BBT2 1TMF1 1DG6A 2BV4A 3AZWA 3C8XA 4Q4W2 1G9DA 4CEYB 1AR83 3I3BA 5IVEA 2WNUC 3R0RA 2WL1A 1ALYA 3BTZA 5BNPC 1W05A 4UFKA 5ABJA 3QLQA 3NJYA 1JZ5A 4YZ4A 1FPN3 1ND3B 4FQZA 5J48A 5CEHA 1ZREA 2VG9A 2W95A 1MZEA 1N47A 1XPWA 4ATEA 4D7YA 1QJX3 2A5ZA 4CCDA 1VBC3 3ZKYA 1GQGA 3WHUA 5DDJ2 3KVBA 1QQP3 2PHTA 4W8JA 1YEWA 2CSGA 4PBPA 1N1TA 1RUF1 3AYCA 1DZTA 1UXZA 4FO9A 3LEIA 4NJ4A 4DNYA 5AC93 1O3QA 1VE0A 1TNRA 2VMEA 1VAMA 3WZ1A 3S30A 1W9WA 3B3QE 4WM8A 3SNMA 4E8CA 1YIPA 3ZDVA 4XUOA 4I0WB 4CSWA 3KMHA 4JQRA 2HWF2 1S0DA 4AHYA 4BE3A 1CAXA 1DIWA 3FHIB 4H7LA 1NZIA 5A7PA 4WVMB 3ITQA 4K6BA 2J1RA 1ZZ6A 2VNVA 3UESA 1ENRA 5FYUA 1RUG1 4BQ5A 2P6HA 4COZA 2H6BA 2PLV3 4HN1A 1PNGA 4ZKTB 3ZXAC 3MFAA 5BNQA 3B5LB 1UY4A 1B35A 4XE9A 3TAYA 4E2QA 4C0HA 3R4DB 4XQ4A 1HQWA 1IKQA 2EIDA 3T1LA 4D6QA 2RJ2A 1HKDA 1O5UA 2DVFA 1Q8PA 2HEVF 3TNPB 1OOPB 1SZBA 4Q0QA 1JN2P 2GU9A 3TEWA 2EXIA 2D6OX 2YU2A 4HMZA 1HIXA 1LR5A 4KBBA 4FBFA 5FTTC 4C1XA 2VY0A 4UFIA 4D94A 3KQRA 1Y4WA 5IUQA 4S2HA 1QGLA 3IIAA 4TSVA 2XJTA 1K5MB 2CY6A 2GMPA 4QX0A 2Q1FA 3ZOIA 1PGL2 3KV9A 5A6XA 4YRDA 1I3HA 1XRUA 1VAKA 1LECA 1WMDA 2D40A 3LEKA 3D5OA 2IFRA 3FHAA 2WWUA 1D0GA 3PIJA 4Y1UA 5APAA 1XYOA 1H6XA 4AGRA 4BISA 2PXJA 1PO23 1TMF2 4ISQA 4Q4W1 4GD4A 5F37A 2J7MA 4RHV2 2YYOA 1ULPA 4N7UA 4QAWA 3RZJA 4NAOA 1YLLA 5C9AC 3KF3A 4JAAA 5L7OC 3MW4A 4KI5M 1JYXA 2ZMLA 2R1DA 4DMIA 1ENSA 4EWAA 4JRLA 5FYMA 1AHSA 2JE7A 3AXEA 3PUIA 4AAXA 2PHXA 4EWDA 1GUIA 2UYAA 3WEZA 1GZWB 1XSRA 2P34A 4K7JA 5J37A 2TUNA 4D69A 5LCWL 1LOBA 4XMAA 4NIAA 1ENQA 1LHOA 1S2BA 5F9TA 1IQAA 3UKVA 4CCMA 2VMHA 3EJKA 3AYDA 1AXKA 4DY3A 2BOIA 3H8RA 3I3EA 1M4WA 1L7LA 2QDNA 4WZFA 1YUDA 4IV1B 5CFCA 1ZZ7A 2YC2A 1NCRA 2J1AA 4L8QA 4AE2A 3ZO0B 1JUHA 5C8CB 4GKXA 1NY72 2JDZA 3BODA 2JIJA 3CJIA 4Y5Z0 1XE7A 5F3GA 3AKTA 5M0TA 4INDA 1BK1A 4YZ1A 1GZCA 5DAVA 3VHRA 5HI0A 3LE0A 1CWPA 1NE6A 1W0NA 5DDJ1 3WXPA 2BFUS 3F2ZA 1W6PA 4LBOA 3VBRA 2W2IA 2W87A 1AX0A 4AGGA 1MZ6A 1R081 2WWJA 3J8F1 3RG0A 4CCEA 2OQ6A 5BXXA 4JX0A 4Y26A 4XFCA 4GWNA 4K1YA 3ES4A 1MS3A 3LFIA 3OUIA 4XAAA 3JU9A 3NRUA 4XPVA 4AI0A 3CJXA 2Q30A 3KWVA 5A32A 3K46A 1COV1 3ZSMA 4ZY9A 3IPVA 1IHMA 1IGOA 4XTMA 3LDRA 2J1VA 1BBT1 5C8CC 3MDPA 2AH2A 4Y1VA 1RUH3 2D6KA 5FUIA 4BA6A 2D43A 5JWPA 5KC6A 3LFMA 2Z2SB 3BOPA 4OULA 1OHFA 5FDBA 3KQ4B 2OUJA 2V5YA 2YB7A 3A7QA 3GZAA 4G3YC 4XFGA 3S0MA 3ZYFA 1YC61 4QPGB 1Q56A 3JD73 5A7NA 2VTXJ 2CAVA 1WUVA 2YPJA 4YW2A 2JDKA 5CG9A 1LOGA 3OBAA 4FXKB 3JCIA 2J1TA 3EQEA 2MPFA 3T4VA 3ZXJA 2RS52 4PQQA 1DQ5A 1QQP2 5F5IA 2Z5WA 4E8DA 1XQNA 1U5IA 4LLOA 1ULEA 3AC0A 2HWD1 4Q4V3 2EXHA 5G05L 2RS53 2WLPA 4PIYA 4MZUA 3DYMA 4BWOA 4DZGA 3UT0A 4OUMA 3B7MA 3OB8A 3A0KA 4HXCA 3JQXA 1NY71 4HOOA 3MW3A 4RYDA 2CGPA 1JZ6A 1C1LA 4N9HA 1OLRA 4GQ7A 1PVC3 2A75A 4XUPA 3Q8AA 2VXRA 5D21A 1AR73 3AZVA 4NHLA 1SLAA 3CNAA 1C8M2 3ZDSA 1QNWA 3MGUA 4CUBA 4IEVA 2E7QA 1PM7A 2RJKA 3VBSC 1JODA 2K9ZA 3H8XA 2QVSB 3CL1A 4EZHA 4WM7B 4JGYC 1JU3A 3H7JA 4CCKA 1R091 4NUBA 4CDQC 1O59A 3HAGA 5A3NA 4XIOA 1RUC2 3N9NA 1RUE3 5FOBB 1A8MA 1AYN1 4Q26A 4GB31 3VBOC 1XNDA 1CZTA 4I09A 4ASKA 3WCRA 3BYWA 5BUVA 3GJBA 5LBCA 1F4AA 2VUJA 4HSLA 2GC1A 5HCHA 1NCQC 1RINA 3E1F1 5BYNA 4V1PA 3MIHA 3POJA 4CRQA 4CDXC 2H6CA 3K2OA 3VGIA 3ZXEA 3AFGA 1W03A 4IUGA 2E7TA 5T5OA 4H7MA 4X8PA 4FPJA 1PK6A 2FQPA 3IAPA 5BNNB 3W59A 3MZHA 2XKOA 3W5MA 1W2OA 1S0CA 4KL1A 4YYOA 3MPPG 3U11A 4IE6A 4YW4A 3AYAA 2A6VA 3WV6A 3WCSA 1KS4A 5A80A 2OKXA 3SEEA 4BLIA 4AI8A 4WBBA 5L7OB 3H9AA 4B4RA 4HG6B 3FLTA 1MQTB 4F83A 4CEWA 2A6ZA 4D7SA 4XDPA 5CKMA 2ZGLA 3HOBA 5C3SA 4ATFA 2NQYA 5HCFA 1WLDA 3MLLA 1PZ8A 4DQAA 5CFDA 4P14A 5IVYA 5IAVA 1PGW1 3V64A 4D7TA 1JYVA 3DXUA 2RDRA 2ZHMA 3LSDA 4YVWB 1NCRB 1QHDA 1K5MA 1PO12 1NLSA 1R092 2WRAA 4P5YA 3GHNA 5FQ0B 3GJAA 3ZIWA 4LK7A 3DYPA 3KCYA 3CJIB 1W2TA 3MV11 1Z7S3 1DGLA 3LA7A 1F8VA 2XOMA 5D2AA 3PTYA 2DFBA 4LBQB 5I0UA 4FXGB 2HYXA 5FWEA 3NNJA 2JG8C 2XBO3 4MVTA 1A78A 4MGIE 1CZSA 3FBYA 2WO3A 4GKYA 4YLZA 3ZFGA 2D97A 1JW6A 3MIBA 4LHLA 3RGBA 5DAQA 4GJZA 3N7JA 3JB4C 4RR3A 1MR5A 5FYTA 5FZ9A 1LTEA 3IPVB 1AYN3 4ISRA 3CQOA 2VW0A 1UZ0A 1QJX2 3HEIA 2HBTA 3BB6A 2PHUA 4BXFA 5A3PA 3KB5A 2VTFA 4LXLA 5FP4A 4IV3A 5F3IA 3NNFA 3I8TA 3IB3A 5FZBA 2VCBA 4UWDA 5LRSA 1ZRDA 2ZOEB 1RUD1 3I7DA 1IZ3A 4DOUA 1F31A 1RUH2 1AR71 2JB4A 2VCMA 3H1MA 1Q8VA 3H3UA 1STMA 4PHZA 3WNMA 5DABA 4DEQA 1CJPA 1WW6A 1O4YA 2EIGA 3O12A 4FPKA 4CUCA 3KGLA 4DXZA 5AFEA 4AG4A 5FZ0A 4CEYA 5HBAA 4CUAA 1TZOA 2MHFA 2DFCA 2WABA 4MYEA 4RGAA 3S7EA 5I8YA 3NMBA 5JZGC 4CP9B 2PAMA 2W94A 1ZNPA 2DYCA 2MEV2 2ILMA 1NXD1 5C4WB 2JE8A 1W0OA 2VVFA 1XNBA 3SH5A 2MEV3 5KHGA 1J58A 2V4AA 5GZDA 2ZHKA 5A7QA 1RUE2 1W39A 2DBNA 1QKQA 5FY1A 4OHYA 3BTYA 1FXZA 4AVSA 3V0AA 4AEDC 2WO1A 2GMMA 2D6NA 5B4NA 1S4CA 1VBB2 1EAH1 4D0QA 4XF1A 4EN7B 2AGSA 2ZAHA 4LJHA 5JOZA 3CMGA 1CGPA 1S0JA 2YROA 3NAPB 5K9YA 1WA4A 5FXXA 4AXOA 4KWLA 1C8M3 2A6WA 3LCPA 4IEPA 3C7GA 3GZUC 2WBKA 3WF2A 1OUXA 4AVBA 3TEXA 3WQ7A 2ZGUA 1Y9MA 2F4PA 2XLGA 4Q8KA 4IEWA 4WVMA 4RQPC 5J96B 1IOAA 2GH8A 1FMD2 1ASJ1 1OLME 3LWCA 1UYYA 4YZ5A 1RITA 3SH4A 1LODA 2R041 3PJQA 5T54A 1Y43B 4W50A 3VZLA 4CDUB 1FX5A 3Q9OA 4MOAA 3ZYHA 1F35A 4BMEA 4J6GA 5CFCB 4MGTA 5FAXA 3BGAA 1JI6A 5EPAA 1H2MA 4ASLA 3W58A 2GP3A 1VPHA 5F39A 4PI0A 2V09A 4XJ9A 4YVSC 1PO13 1MS5A 2WS93 1TEIA 1WW5A 5FPLA 3OF1A 4YGDA 2ENRA 3SH3A 2XDVA 1PIV1 1URXA 1WGPA 2O0OA 3WQ1A 1QH7A 3O1RA 2IVIB 5C8CA 4M3CA 1KITA 3LEMA 2PHWA 4AFAA 2B46X 3B9CA 3POEA 3TWIA 4MUVA 3GGLA 2WIIB 4NR1A 3ZVXA 4KU7A 4EROA 2KR2A 3ACHA 5GLVA 2QKDA 4I01A 1DP0A 1UY2A 3MLKA 4AF9A 1X36A 2XJQA 2DBIA 3V0BB 4BLJA 4SBVA 2G9ZA 4MGKE 1H1AA 1UOGA 2E7AA 4LE4A 4P00B 4YNIA 5JIUA 2YBSA 3ILNA 3BVCA 2PHRA 1MVQA 4LA3A 5FP7A 1QJY1 2XG3A 5AVPA 4W6WA 4MO3M 2IUWA 4RN5A 2VZSA 1Y9QA 4XQWA 4GA9A 2AREA 2WNVC 2Y38A 4FT8A 3AKRA 5FO8B 1J3PA 1KQRA 4OVEA 1GWLA 3AYEA 5I0TA 2QUOA 3WR0A 5DG2A 3ALQA 5FZ7A 1W8WA 4XUQA 1BMV2 2EXKA 5KXBA 2Y8KA 4RS5B 3ZLIA 1AR62 5ABJC 2P6CA 1VBD2 5BV6A 3BTAA 4CDQB 1YCIA 4M01A 5A6ZA 1ZBE3 4Q4X1 5CB7A 3I2OA 5LWBA 1GP4A 1V6IA 3T08A 4CEWB 4XVHA 4LO6B 5FKCA 3TN92 1GZ9A 1SQ4A 4LOTA 4Y4YA 5GZFA 4FAGA 5BNNC 3I3MA 4O9EA 4FVVA 4IV3B 1O8PA 2RS31 3KT1A 1E5RA 4XBNA 4DUVA 2WFF1 2IXLA 4QKFA 5IVFA 1TE1B 5CNAA 3MIFA 5DAPA 2IVJA 4MHUA 1K5JA 3VBOA 1G9CA 1OH3A 3WQ0A 1YQ5A 1IG0A 3N7KA 3M3IA 2QBXA 1JXNA 1LOEA 1IPJA 1UYPA 3FZ3A 3VD3A 3O1VA 1V00A 3N9MA 3U14A 3CZUA 2DU1A 1BHGA 4PF1A 5JDBA 3UYJA 4JHTA 1W0PA 4QX8A 1JS9A 3RNSA 1HRV1 3PMSA 4DEVA 3FBMA 5JCTA 1H1IA 1VRH1 4GMP1 4LBQD 4XBQA 2CTVA 4BU2A 5IATA 5FXWA 2W39A 3HNBM 4B1LA 1YWKA 3KVAA 1CN1A 4PDWA 1WMFA 1F9KA 1PVXA 4J25A 5FR3A 5IFPA 2OQ7A 2HWC1 2YPDA 1V6NA 3FHQA 2QQOA 4UT5A 2XHKA 3VD4A 3LIGA 3PUQA 1KEXA 3K3OA 4ARYA 1YXWA 2ARXA 3QBQA 1OI6A 2WDBA 2R49A 4YM0A 3ZXDA 4RGGA 2FCVA 2CNAA 4JHZA 5JOXA 1YFXA 1ZBE1 3ILFA 1XSQA 2V72A 5C3OA 4I3GA 5EV7A 1A8DA 1FMD1 2WKKA 2ETEA 5FJHA 4XFFA 5C8WA 1BMV1 4YM1A 2YFZA 3WW3A 2XQXA 3IMMA 3LZZA 5JPNB 4E4DX 4LT5A 1QXPA 1WWYA 1KDKA 3SCHA 4BM8A 3M4FA 1W8NA 1QU0A 1APNA 3RI8A 4Y4RA 4OI1A 2F6BA 1SCSA 3SCGA 5DAWA 1JH5A 1SG3A 1ZM1A 2QCSB 4FPEA 4YW6A 2QJVA 1RC6A 2GC3A 1LRHA 5J98B 2X5IA 4NRPA 4WM7A 2CHHA 2CAUA 3HQRA 4L97A 5H9SA 3VHNA 1MS8A 1NCQB 2VE1A 3GM8A 1WD3A 2B8MA 2V4VA 1DGRA 2D98A 1ULFA 4E4ZA 3RZKA 3W5NA 4CZSA 4JVAA 4BCUA 2RHPA 4NPLA 1VRH3 3VBSA 5JXGA 2EALA 4IEXA 4NHXA 5IVJA 1G9AA 1HRV3 2VPVA 2VULA 1NQDA 4MHRA 4NO4A 1GYKA 3SLIA 2O14A 1XJAA 1LEDA 5FZOB 4UFJA 1NCRC 2C0ZA 1LAJA 3MO4A 3OY8B 3ZSEA 4DY5A 3WNNA 3V0BA 3MPBA 5KBFA 2RDSA 3T0DA 3J4UH 4HN0A 1RMU2 4HSJA 3G7DA 1RUD2 4XACA 2BEOA 5A7SA 1FMD3 1PX3A 5C70A 3FJSA 1U12A 3FE5A 3P6BA 5IK8A 2Y6GA 2AACA 3A23A 4HVOA 4N53C 1R1A1 2A70A 2P3KA 3VHOA 3I3DA 4AHZA 4L0PA 1OD5A 3J8F2 1HB2A 4AGVA 4FFGA 3HNMA 2J1EA 3POSA 1RUJ2 1W2UA 1ZA4A 3MYXA 5FMBA 5IW0A 3UKTA 3Q8BA 1HW5A 5H9QA 2NN8A 4AVVA 5C9AA 3LIHA 5K4LA 4IESA 3MF9A 4PLOA 4Y22B 1CAUB 3CF6E 4NE9A 2XJUA 5IVVA 1AR63 1BLZA 4COYA 1S1AA 1EAH2 4K3UA 3WG1A 3H3LA 2CGNA 4IE4A 3IDEA 5KR7A 2B7YA 3M2MA 2WA4A 1W6OB 2VQTA 3OPZA 2HEYF 4OHWA 5KC5A 5EWSA 3KT7A 4HONA 4LO5B 3I2FA 4LQRA 2UY9A 1PO11 3IMNA 2ZGSA 5FY5A 3USUA 4ASMB 3NVCA 4FOYA 4JTNA 1SMVA 1ZRRA 2GN3A 1SHWB 1R1ZA 1N3OA 1F2NA 2JD9A 2VCCA 3C3VA 4GH4A 3CJIC 4UF0A 1POV0 2I07B 2UWCA 2A6YA 3DPRA 3PUAA 5FY8A 4RR3C 5DZFA 5J1XA 4XCBA 2GMEA 2EA7A 2DTYA 3ELNA 5DMYA 3HNYM 2JJ6A 3P3NA 4FQ4A 3O1PA 1Q8OA 3I2GA 4PDWB 1WLWA 4D6SA 3ZYGA 3QOPA 2GP5A 3KV6A 5A1LA 2WS91 4YG0A 2WQ8A 1W90A 3BKZA 5C3PA 4FPHA 4HKOA 1CD3G 1QJU2 2FCUA 1RVF2 3AKQA 3C7EA 3AP9A 3KCXA 3OOXA 3PURA 1AL22 5FZ1A 1LENA 3ZIXA 4GB33 3NV4A 5T5LA 2P37A 3WG4A 2WSVA 1DF0A 2WNEA 3T2TA 3ZFFA 3T30A 1MZFA 1QDCA 5BNOB 1RB8G 4Y33A 4A7YA 1MEC3 3A0NA 3DUIA 4A7ZA 1E5HA 4JKMA 4BDVB 4AYUA 3QCWA 1EUUA 5F3EA 5A3MA 3DL3A 1Q8QA 2V5DA 1O8SA 4IE5A 3LSEA 3GNEA 2QDRA 2NMNA 3OJBA 3WUDA 1ND3A 1CPMA 3W20A 4Y3OA 5JR7B 4CCCA 1UMZA 3GALA 5I8TA 2WNOA 4Y5TA 1W3XA 3O1SA 2Z4FA 4NAMA 4LHNA 2Y33A 3SC7X 4K8RB 2YFUA 3U78A 4AW7A 4AEDA 3SHRA 3KCCA 3O0VA 2YC0A 1AR91 2IFWA 2W52A 3WNPA 4LHSA 4CEWC 5CBLA 4AFDA 3VBSB 3T0AA 2WN2A 4HVRA 4AQSA 1RUF2 4YFZA 3FX3A 5DUVA 1QJU3 2YMZA 5A3LA 1SPPB 3MICA 1CIYA 1XXNA 2GNBA 3VBFC 2D3PA 1IS5A 5FYVA 1CAXB 2X10A 3SITA 3C7OA 4XC9A 2PAEA 3PMEA 1QH6A 1V6JA 2ET1A 2IXCA 4ZU5A 3QH7A 4R8HA 3WP6A 1YHFA 3BIWE 1LKNA 1RUI1 1E57A 3I2IA 2WNVB 4I02A 2PMWB 2Y0IA 3C7HA 2A1XA 5FUPA 2FBEA 5FZGA 4QB6A 3AXDA 4WV8A 1CESA 4KG8A 4UAPA 1UMHA 2Q8CA 1W8FA 5BY5A 2WFF2 1XE8A 1OQDA 4LO7A 1RXGA 1W8TA 1AYN2 1NCQA 4GMP0 3H1YA 1U5XA 2ZGQA 2Q4SA 4Q1RA 3LOBA 2BQPA 3E6DA 3NO8A 4QQHA 1H0BA 1KGYA 4QXHA 4W6XA 1HB4A 1QOTA 1VALA 1GQPA 1FNYA 1HV0A 1VBD1 2O8OA 3MEPA 4X8NA 4JGYA 4XZPA 1PVC2 4OI0A 4Z82A 2R0HA 1ZVFA 2QTWB 3DKQA 4FPCA 4K21A 4EWEA 5LASA 2W46A 4R9DA 4AFBA 4BXSV 5C4WC 2CDPA 3DYOA 2C26A 4H14A 1MQTC 3VDDC 5AC92 4IQPA 3AKPA 4QQOA 3WG2A 3EBRA 1MEC1 4K8FA 1UIJA 4IEOA 4FTBA 3BUCA 1Y3TA 1QOOA 1BZWA 5LK5A 4J1WA 4LBJA 3HJRA 5A3OA 3A21A 1OPOA 4ZONA 5FZEA 1KFXL 4HVQA 3WVJA 1PHMA 4QPYA 1XBFA 2VAUA 1R1A2 2VVEA 5JMCA 2WJSA 4AI9A 4DO0A 2QQUA 3NNMA 3WF3A 4AI1A 5AFBA 3I97A 1UOJA 4NWWA 4FPLA 3B93A 1HN0A 4L92A 2BGPA 2K0GA 1BJQA 2AR6A 2XVLA 2ZGNA 3K48A 3VDAA 5CG8A 4X6RB 2BFUL 4FOQA 3ZFGC 4RQPB 2R7EB 4O9GA 5D8AA 1PIV2 5FYCA 1LGCA 4B7KA 2VZRA 1WKYA 3MBWA 3N7MA 1AYM2 3ZFEC 3FC0A 5BNPA 1WBFA 1W6QB 5FY4A 2Q1ZB 2XXZA 3FWEA 2ZMNA 2XBO1 3VDBA 4SLIA 5L19A 3IDAA 1OOPA 4NHKA 1Y7BA 2E9QA 1JTZX 2QQNA 2AUYA 2X5IB 1OVSA 1VBD3 4OYUA 4HPKB 3H3ZA 5FO7B 1HB3A 3H0OA 1OF4A 1VIWB 5JXJA 4QQLA 2RG4A 3RYKA 4W6YA 4IDZA 3BU7A 4JDOA 3ABZA 4OFGA 2BGCA 5AVAA 2YXSA 5DXDA 1DHKB 3N7LA 2LUWA 2ZZJA 1DYKA 2XUMA 5FMDA 1UX7A 1T6GC 3OPWA 4CEYC 3D3AA 1KFUL 1TME2 2LM3A 4LULA 4BQ1A 5FLJA 1Q43A 2XJSA 2AEZA 2YV8A 1UWWA 4R52A 4LBKA 3ZXGA 1SFNA 5HXVA 2VZTA 3SXWA 3ETQA 3U0ZA 1E5SA 1MS1A 2ERFA 1NLRA 4H2AA 4ZU7A 4Y1ZA 3AM2A 1CX4A 2JE9A 4RHV3 1US3A 2AYHA 2C9KA 2ZGTA 4CDXB 2W1WA 4B29A 2IC1A 3EYPA 1N1SA 1VMHA 2DF7A 2FMDA 4UW4A 3JB8A 4M3CF 3UK9A 2XL7A 2MEV1 1AXZA 3FUOA 4ITCA 5E16A 2XKPA 2CGOA 4LE3A 2KA3A 1TG7A 2OPKA 2XR4A 4Z92B 4MXWA 2JDUA 1QNYA 2E53A 2EF6A 3MFCA 4M3CE 2GZWA 1AXYA 1H9WA 1ND2C 5EYXA 1DQ0A 4E27A 3UGHA 1HJFA 3VHPA 4CCLA 1SLTA 4P5HA 2NP0A 1HRI3 1Q8SA 1PGL1 3N4MA 3RRDA 2BGOA 2NPIA 4R4ZA 2BJSA 4QMAA 1K3IA 1L3JA 3RDIA 4YW5A 2Y6LA 4XCAA 4YVWC 3ACGA 3WDVA 4R9AA 3FFQA 3WP4A 1V70A 4AQ6A 3GBWA 1GWKA 4FCAA 4XJWA 4LO8A 1GNYA 5A6YA 3PTRB 2VZUA 5KXDA 2VW2A 2RS11 4Z2WA 1RGSA 5A3UA 2D3RA 2RS32 1UZYA 2HWB3 3WF0A 2RVAA 3I59B 1GKBA 1WCKA 3P3PA 4W65A 4XJAA 3TN91 2WINB 5F32A 2NYYA 4OZXA 2ZABA 4AEKA 4DFSA 1ZBA3 4H55A 2PLV1 3OCPA 2YZ4A 1GNHA 4UI9L 3OUJA 1GQHA 4KU8A 4CTEA 1CAWB 1FV2A 2GSYA 3ME2A 4O61A 4Q1PA 5SV5A 1CAVB 5KXCA 2W5FA 3U75A 5C3QA 2HEWF 2YUEA 2VOTA 3PUHA 5EQUA 3NKTA 5CYYA 4F3JA 2G9GA 2W1QA 1QEXA 5EP9A 1NX9A 3PU8A 2YU1A 5FZKA 5H9PA 3AVRA 1N3QA 1LHWA 1Z0HA 2QZ3A 4NMIA 1W6PB 2VMCA 4TXWA 2B42B 1D7PM 3KS7A 1DQ1A 3UNPA 3VZNA 3ZFFB 4HKLA 3LD8A 3I54A 4QT6A 1RUJ1 5TSWA 4D8MA 2W68A 1O91A 1QJU1 5FBZA 4NHMA 4MLOA 4CXYA 3VBFB 1UOFA 1ODMA 1AR93 4XZUG 5T50A 4QDQA 1GV9A 3PVEA 2LRPA 3ZMNA 3PJYA 4IEQA 3VBRB 4GWIA 3HN1A 4BK4A 2QE3A 2ZKLA 1OSGA 3LDBA 4XBLA 3RPQA 1IG3A 3OEBA 2FCTA 5EHDA 4ZU4A 5LA0A 4KWJA 2R16A 2XVGA 4HL0A 5EXOA 2BP6A 3GCXA 4QPIA 5KHJA 1OLMA 5H9RA 3N9QA 2VGDA 3S57A 1VMFA 1W2AX 3TN93 2FZ2A 2VMGA 1UIKA 1DBNA 1VBA2 4M4PA 3JD72 3EHKA 1V9U2 3THTA 2ZHNA 2ORXA 2X5IC 5DUWA 2R6QA 1UQXA 1RUC3 1VB4A 5LEKA 4TLGA 4O7XA 3F95A 2ZHLA 5JXIA 4QPGA 1F5JA 3ZPOA 1WD4A 3ETPA 3HT2A 5ERLA 3RMXA 4IEUA 4BQ3A 3ACFA 2Y0OA 5ACA2 4QQPA 5JSOA 3FMGA 1WLTA 4JGZB 3O1OA 3LEGA 2XPJA 4RA0A 2ORZA 3PVNA 2VL4A 3AP7A 1NA1A 3MIEA 5C4WA 1SLIA 4BK5A 1MQTA 1FATA 2SLIA 3LOIA 3PNAA 1UYZA 1SBEA 4XEZA 3HBKA 2GH2A 4IV3C 1QWRA 3DKWA 3O14A 3ZSKA 1ZRCA 2FDGA 3TEYA 4BPZA 4WVWA 4UOJA 1GICA 3ORJA 1V6KA 3HPNA 5DZGA 2GNDA 4LLFA 2RMU1 5KWRA 2HWB1 3POWA 1WW4A 3U37A 2DTWA 1VBC2 2ZKNA 1DCSA 2VNRA 3AZZA 4XF9A 3WSOA 4C1WA 4LBQA 5L9BA 1GP6A 4QPWA 2ZGKA 2VMIA 1Y9GA 3L9JT 1LJ7A 3GF6A 3T2PA 1VBE2 2W91A 3U10A 1DFQA 2VR4A 1LU2A 3PUSA 3VKNA 3T0BA 4PLMA 2LTNA 1CX1A 3KSCA 5FZMA 2DVDA 4MX3A 1RUH1 5DAXA 4JDMA 4XYXA 2W1SA 5FKBA 3R4UA 4A7KA 3POBA 2Q5TA 2WA3A 3KT4A 4JTOA 3VBUC 4XF0A 1AJOA 1QY4A 3CZJA 3I2DA 1LHUA 4KGQA 5LZ6A 3ZYPA 4AK3A 2RM23 2JEMA 2E32A 1PX4A 2R072 1UKRA 1CONA 1PMIA 3JUUA 2YC4A 1QJX1 4QKNA 5FREA 4KBZA 2IWGB 5CAZA 1LHVA 4R9BA 1LHNA 1NG0A 4XFHA 4FSJA 4DIQA 2HWD3 4NPMA 2WZPP 1J1TA 1NQJA 1GMMA 4E2GA 2WZR2 2X53S 3OUHA 1RUF3 2IXHA 3GBFA 3O0WA 4KGGA 4RQPA 4UBHA 1UN1A 2V73A 1AUYA 3QH6A 1XOYA 4XIKA 2OA2A 5FZIA 3RZZA 2KXLA 3M7AA 4LKSA 3VLBB 3BOWA 4LBLA 3WG3A 3CIHA 4Q4X2 2E26A 4ZS2A 4DPNA 2XLFA 2ES3A 3JZVA 4XABA 4AL9A 1HRI2 4EN6B 2PYTA 2VOVA 1XYNA 2PLV2 5FPUA 5DZEA 2AZ5A 3NKGA 4XOGA 1SBDA 3K51A 5CU1A 1NKGA 1OA4A 4TWTA 5ISLA 1RTVA 3GXUA 1KJRA 5EYYA 1PZ7A 2WNUB 2LS6A 4XJZA 3FFZA 5JUVA 3QACA 2HWC2 4AEMA 4EQVA 2LALA 3O7OA 4XQDA 3D8CA 4CPBA 4FFFA 4V2VA 5I91A 1XU2A 3AK0A 3ZFFC 1POQA 4YW1A 4C0BA 2GNTA 2ARCA 1W8ZA 1DYPA 2VXJA 4QM9A 1SDWA 4XAEA 4PQ9A 5FZ3A 3H7YA 1QXJA 4IGOA 3H8UA 4QDSA 3NW4A 1RVF1 1BVVA 3ZN6A 1YQ6A 4KG0A 4IL7A 4ZXEA 4XFBA 2WS92 1CAVA 3ACLA 3P5BA 2D6PA 2YDEA 1WBLA 1WW7A 5JAXA 3D0JA 2FDHA 2WAOA 1DQ4A 3K75B 3MIGA 1X9TA 3D0SA 4Z07A 3ZYRA 2XJPA 1BK0A 5A1AA 2VOXA 2ADDA 5JZGA 1I5ZA
chains in the Genus database with same CATH topology
1I6XA 4L99A 2D6MA 2XGXA 4UW5A 1FAYA 4XTPA 4AWDA 1BYHA 1RUJ3 3VBFA 4Q0VA 4P9LA 4C91A 2HYKA 1ZZCA 4XHXA 2R062 4Z1VA 1RUI3 1VBB3 2RM21 4H3WA 1ZX5A 1G9FA 4P9XA 1ULDA 3M1HA 2UU8A 4B4PA 2P17A 1GSLA 4GH4C 1ZBA1 1ND2B 3AP4A 2ZZQA 4CDWA 5F6KA 4CP1A 3IM0A 3JBG2 2ZAAA 3CLPA 3IT8A 3NAPA 1JHNA 1NE4A 2EVXA 4B3NA 3WDTA 1OQEA 4CDUA 4YM2A 1ZZ9A 3GHMA 3UKNA 4N53A 3C2UA 1H8TB 2NLRA 4Q4Y3 1VAVA 2R073 3FLRA 3WX5A 4Q29A 1H8VA 2CWMA 3TBDA 1MVEA 1GLHA 3MF6A 1EV11 2ATFA 2HKXA 3VKMA 1GR3A 1V6LA 2UYBA 1HX6A 1OMIA 3WW2A 4N9IA 3WLUA 3NSTA 3ZSLA 1LOCA 4LUMA 1SACA 2DCYA 3VKOA 1AR72 2H0BA 1ULCA 2ZPXA 5E8AA 1R083 5I93A 5T3NA 5B2GB 4RFT0 4PIZA 1X8MA 2WLQA 1LCLA 3D4KA 1R082 1BCXA 3AP6A 4XW3A 2OVUA 2DVAA 3HMYA 3AMMA 3H1WA 4CP0A 3N35A 4QPGC 4PF5A 3RSJA 1YI7A 1Q3EA 1AVBA 2GC0A 4LEJA 3DPRC 4K20A 4ZXKA 1UZZA 1MZ5A 4RS5A 1UF2C 3BPZA 2JD4A 5LRRA 2CWSA 3GZTB 3ZFEA 5FPXA 4YARA 1G9BA 3AFKA 4TYSA 3KGZA 1TQ5A 4QX5A 1NA1C 4Q4V1 1O3SA 3E5UA 1VB2A 1SCRA 4MV2A 4NWVA 3AB0A 4BZ4A 3TNQA 4FOWA 1O5LA 1HV1A 3ZN5A 4PCRA 3KD4A 3EXUA 4Q4Y1 2QFEA 1MS4A 4AVCA 1CAUA 1OQ1A 5GLUA 5J3UA 2WZR3 4JGZA 4TZDA 5LEJA 5ABJB 5FMOL 2RMU3 4URTA 2VOKA 3HIFA 1HRV2 1W6MA 1HQNA 3L2HA 4AQTA 1NA1B 1W6OA 2RR11 1G6NA 1H8TC 5L73A 2XWJB 4XHBA 4FP2A 1RUI2 1X8EA 4RL7A 3E6CC 4FPFA 3UV9A 4P9YA 5KHKA 1BQPA 4P9WA 3RQ0A 1MS0A 4QD2A 4QPIB 2WNUA 3HD8B 4GALA 1YIFA 5J7MA 4N43B 2JKBA 4DB5A 1DQ6A 3USSA 2JG8B 1RMU3 2WT1A 3GYDA 3POYA 4JC1A 1CIWA 1S55A 2ZX1A 1I1EA 1H9PA 1JUIA 4LO4B 1LGBA 4YGBA 4L9BA 4F8AA 2BYVE 4GB32 1X82A 2JXAA 1C1FA 3OY8A 1A3KA 4Y24A 3WD5A 1ND2A 4DS0A 1X50A 1AR61 5EJ3A 4QU2A 1C28A 2IXIA 2O8QA 2W08A 1ZZ8A 1LESA 2PHFA 1D0HA 2PQQA 4N90A 3ENRA 5BPXA 3RJ2X 3VV1A 5I0SA 1COV3 1BVP1 2WZR1 1RVF3 1QJY2 2GN7A 3KLSA 4K9SA 1U5ZA 2D5FA 2H0VA 1DZQA 2WT2A 3WP3A 1QOSA 1YO8A 3IDBB 3J8F3 3THPA 3WUCA 3AJZA 4A3XA 1TME3 1OOPC 4ES9A 3WT3A 3X29B 4DINB 3R4SA 4FP3A 1JBCA 1FOD3 1C5IA 2D5HA 1DLLA 5KXEA 5JOWA 2RR13 1UPSA 3ZXFA 1BBT3 1OPMA 1RMU1 2N7GA 3HR9A 1PGSA 5GZCA 4KWKA 3DN7A 3WW1A 4D3WA 4OUSA 1AX1A 4XILA 3USUB 3WDXA 2DVGA 1AJKA 1J1LA 4GIQA 4FAHA 3WHTA 5GZGA 1LOAA 1YFUA 3FUQA 1M06G 5DDJ3 1COV2 4COWA 4AVTA 3KZ4C 5LK7B 2CV6A 3LB9A 2AENA 2DCTA 5DUXA 2ZBJA 2BUKA 1G86A 4BHPA 2XJVA 1H2LA 2ZX0A 2QQPA 2GDFA 1UU6A 4E4SA 4KNCA 1LEMA 5D1IA 2BPA2 1A6CA 4P9GA 3AMQA 4HFSA 4IV1A 2VOWA 4X6QB 2B9UA 1FOD1 1FPN2 1PVC1 1C4RA 4JCKA 3ZXKA 1ZBE2 4OLLA 5FRAA 1RUE1 2TEPA 2VH9A 1W6MB 4XXAA 4S2FA 4BMBA 2WQZC 5FO9B 1V9U1 1OLQA 1UL9A 3LA3A 1O7FA 1O3TA 2TNFA 4AEDB 4EN8B 3HQXA 1VRH2 1W6NA 4MSVA 5DUUA 4GH4B 2O1QA 1UPIA 3M3OA 1D4M3 5FCCA 3DPRB 1FT9A 4I30A 3CEWA 4M0NA 2W0XA 3E5XA 2PHDA 4JDNA 5GLZA 5BNOA 1REFA 3AZXA 4LTAA 1G8WA 3CU7A 3ZXLA 3G6JB 4IEZA 3B69A 1UD1A 1H1MA 2GALA 1B35B 2X8KA 4UBGA 1ZYBA 2NM1A 2SBAA 5BNPB 4EN9B 1J59A 1WCSA 1UAIA 1ND3C 3TRSB 2A7AA 1KXGA 3NWKA 3VZMA 2OUHA 2ZMKA 1PO21 2B45X 4L11A 1SLCA 4G9SB 3RJRA 2EAAA 5HCBA 2JG9A 3A4UA 2HWE2 1V6OA 4YGEA 1V9U3 1H2NA 4LHKA 1Q5OA 4WVZA 4EN0A 1MACA 3WP5A 4Y1XA 5D8AC 1Z7S1 2RS33 3FLPA 2X29A 1UCXA 1O4ZA 1PGW2 4JGYB 4TLFA 1S0GA 2CL2A 1VR3A 1AL21 4HK8A 1PK6B 3ZYJB 4AQ2A 4CDWC 4GMP3 4Q0UA 2OW4A 2D3SA 1EPWA 2D93A 4I0AA 1FNZA 1FI2A 1LGNA 4CDUC 4HANA 1AX2A 4PBOA 4CDXA 3ZMOA 2IXKA 3VKFC 1HXS2 5FFOC 3ZPYA 1RJ8A 3QD6A 3RYPA 4XXPA 2B5HA 1SLLA 2YGMA 1Z78A 4Q2FA 5K0UA 3ECQA 3NV3A 4WVVA 2D44A 5I8SA 3WDYA 5CFCB 1PNFA 2ZGRA 4JRAA 4IXLA 1KJLA 4BIOA 1CR7A 5GLWA 3TOJA 2HWB2 1C3HA 3VBUA 1N3PA 1H4HA 3ZFGB 3VDDA 1SLBA 2XWBB 1C8M1 1AR81 1XNCA 2OIIA 4HPKA 3IKWA 3OTFA 4QPIC 2FHRA 2WWSA 3MLJA 4Q27A 1ONAA 2JG8A 1YRZA 3D82A 1TME1 3RYRA 1H2KA 5JI7A 2A73B 3VUOA 1VBB1 2VQAA 3L2YA 4PIXA 4RD7A 1XYPA 2R071 4RR3B 1GNZA 3OYWA 2RS51 1CAWA 3B01A 5GM0A 1REDA 1W6NB 3S6PA 4MXVA 4IERA 1J3QA 5JSRA 3AJYA 5FPZA 4WZCA 4RSUA 1F5FA 2ZTNA 4UW3A 3TB0A 3BCWA 1W6QA 1HLCA 2WSUA 4OHVA 3O0XA 5J09A 2OYZA 2D6LX 1NOVA 4C90A 1LOFA 4Q4W3 4XFAA 3VBHB 1JYCA 3W9AA 1I9RA 4CYDA 2I45A 1EV12 4Q0PA 2PELA 2CYFA 1MS9A 3LKJA 2ZS6B 4JGZC 4BIFA 4M0HA 1RUOA 1EV13 1UX6A 4HK9A 4M00A 4IEYA 1QMJA 2DURA 5GLTA 2ZGOA 3GBGA 3IBMA 3LGRA 1JYIA 4FPYA 1YJKA 3B94A 1QJY3 1OA2A 3M70A 4LBMA 2KM2A 4QGNA 3IDCB 3V65A 4QXKA 1B35C 2JG9B 4Q4X3 3ATGA 1MEC2 3V0AB 3PVBB 3ZYIB 1ZBA2 3CO2A 3M3QA 4AI3A 2DCJA 3UJQA 2UURA 3VBHC 2BNNA 1C8NA 5F1RA 1KRIA 5AC91 5HCAA 3NJZA 4YVSB 2IZWA 5C33A 2NZ9A 2DUPA 4COUA 1ZRFA 1G7YA 5JVVA 1DZRA 2GC2A 2R061 1HDKA 1K5MC 4HT1T 4A2UA 3E6BA 4QM8A 4AFCA 3KM5A 3TYJA 1NXMA 5CIRA 4XMIA 3ST7A 3R6SA 3AMHA 3M8LA 1LULA 5T5JA 1BEV3 4MXWB 4AI2A 3WDWA 2QZ2A 2B39A 5L7OA 4HZFA 4M3CB 5JIAA 2JECA 4OI4A 2A71A 1BEV2 1HQLA 2WC2A 3SCFA 2JICA 3IN9A 4P9IA 3NAPC 1RL3A 4XFIA 1J3RA 5K0UB 4YVWA 1RHI3 2XLAA 5T5PA 4G4FA 4DRVA 2A3XA 3HT1A 3J26N 3VN4A 2DCZA 1RHI2 5FMOS 4PJYA 3PHMA 1H30A 3PLQA 4B4QA 2ZX3A 1TNFA 2WFF3 2XVKA 1C57A 2FMYA 5GKAC 3ROUA 2R043 3AZYA 5K8SA 2VVDA 1GFF2 1D4M1 1EP0A 1N1YA 1AR92 2A6XA 4S2DA 4LA2A 5IK7A 2QNKA 4P9JA 2GNMA 1Z7S2 4MGZE 2I2SA 4N43C 4YFWA 1RUG2 1OFNA 3I59A 2VW1A 1WMEA 4AEJA 1IS4A 1HRI1 1YYNA 1PK6C 2DU0A 2DWRA 5E88A 4GXLA 4K1ZA 3VL9A 3VZOA 1UKGA 2PAKA 2VU9A 4DRRA 3B00A 2P2KA 1CQ9A 1POV1 1D4M2 4AVAA 4MH0E 1AL0G 1ASJ3 1S0IA 2MNGA 4Y20A 4FTEA 2HWD2 2Y26A 4XF4A 2BW8A 3OBRA 3OGGA 4Q8LA 4U2AA 1RHI1 1EY2A 1HXS1 5F5QA 2BNMA 2E51A 3VBOB 2HJIA 2BNOA 2ZCWA 4YM3A 4HBNA 5FLHA 1DGRN 1OFSA 1QF3A 2Z79A 2DUOA 5IK5A 5GALA 2RR12 2ARBA 2BTVC 4YG6A 1S0EA 2A3YA 1PIV3 4FOVA 3ZSJA 5A33B 4AFMA 1WCDJ 1AYM1 4AHXA 2G9FA 1BEV1 2R0FA 4WM8C 3AX4A 5KHHA 5CADA 1CJDA 1VBA3 2WT0A 4RS5C 5JLVA 4ONUA 4Q0SA 1GANA 3OYWB 4HKWA 2NMOA 4B8EA 3R05A 3APBA 4CP2A 4F7ZA 3WW4A 1BXHA 4PDWC 4KQ7A 2RS13 4AHWA 4HLTA 1DDLA 4WM8B 4XJ8A 2R30A 2GAUA 2R042 1GBGA 2HWE1 4MGYE 4NOTA 3IWZA 2XH6A 5I0RA 4Q4V2 2Q0AA 2P3JA 5KHIA 4BH9A 1PO22 2RE9A 1LU1A 5BNOC 4FTSA 3JBG1 3DV8A 2VNOA 3ZX7A 4UXAA 3WY6A 1B09A 2WQ4A 1YFWA 3RMYA 3RS6A 1XNKA 3AMNA 3N3HA 2XL9A 3ES1A 3E97A 4FSJA 1PZ9A 2RM22 4I2OA 1HXS3 5ACA1 3INAA 1IKPA 2Z69A 2P3IA 1CPNA 4WM7C 3E5QA 2RJLA 4YGCA 2HWF3 1LB2A 1SEFA 5FLIA 3JD71 1KDMA 5JOYA 4Z8BA 3MI8A 3VDDB 2JX9A 4U36A 1VBE3 3OD4A 5IK4A 2VUAA 1YFYA 2DUQA 3RWNA 1SFYA 3BALA 1JOJA 2DV9A 5CVRA 4LR4A 1O3RA 1AYM3 4N53B 1U5YA 2ZA9A 3WINE 2EXJA 2HWE3 1NZCA 1RJ7A 3ZN6B 2EAKA 4EJRA 1GZWA 2DVBA 1QXRA 5L36A 5F6LB 4CDQA 1ASJ2 5GZEA 1O4TA 4QGMA 1FOD2 1FPN1 4Y22A 2ZGMA 1N1VA 4HETA 4EV0A 1X33A 4R9CA 4QHBA 5DG1A 2WFPA 5JZGB 1RUG3 1U0AA 1H4GA 5EZWA 3VBUB 1IS6A 1OKQA 1V6MA 5ACA3 5C9AB 5CA6A 5K7PA 1AR82 3N36A 3VBHA 3D6EA 4IETA 1C5HA 2UWBA 2R32A 1WLCA 1EAH3 3JQWA 2ZJCA 3JBG3 2HWF1 1UW8A 2BVVA 4YSFA 2Q8OA 1IS3A 2ZACA 3NV2A 1VLNA 4J1XA 2YHJA 1X7NA 2RS12 3OD0A 4LNVA 2OZJA 5A32B 1SBFA 4OHXA 4Y1YA 2C1FA 2IXJA 5CFDC 4NPRA 4IV1C 2BVBA 4YW3A 2R063 4RHV1 5A33A 1DGWA 4YZ3A 1R093 1FV3A 2PHLA 3SMHA 1RUNA 1YI9A 3M3EA 4QGLA 5JSPA 1ULGA 2JG9C 3S7IA 2XJRA 2BWAA 1XU1A 1EYBA 4GULA 4XF3A 3DF0A 3I4IA 3VL8A 1UU4A 2D7FA 2PN5A 1VBE1 1D2QA 3OGJA 2Q1MA 1KD7A 3J9SA 4L2NA 1QDOA 2A3WA 2G4IA 2UWAA 4Q4Y2 2Z42A 4K40A 3M3CA 5JPMB 1NYWA 2RMU2 1BKZA 1IPKA 1RIRA 4N43A 5EFUA 4UW6A 3V56A 5CFCC 3AP5A 3SISA 5E89A 1S2KA 2BWCA 2C9AA 4YG3A 5IT6A 2VQ0A 2R1BA 1VP6A 1EPZA 2FZ1A 4YVSA 5FOJB 4LUKA 5J36A 2DCKA 1R1A3 1S0BA 3VBRC 4QQ2A 1RUD3 4XETA 3MIDA 1DU3D 1H8TA 4FPOB 2PTMA 1AZDA 2VECA 3WNXA 4BYYA 4CDWB 1QQP1 4META 2ZX2A 2ZGPA 2I74A 4FPGA 1REEA 3ILRA 3WOGA 2PA7A 1POV3 5C6CA 1CVNA 4LBNA 4OHZA 4ES8A 1D4VB 4GWMA 2XBO2 3T1MA 3O5SA 1VBA1 5BNNA 5GJ6A 1KS5A 2XB6C 3PVOA 1FYUA 1TMF3 3NV1A 1YJLA 3LAGA 1VJ2A 2VNGA 3UL2A 4KH9A 2WNVA 1ENXA 3VZJA 5JI9A 4NN0A 4N7IA 4R4XA 4I3PA 3AKSA 1RUC1 2C5DA 2JENA 4COVA 1VBC1 2UY8A 4E2SA 3NL1A 2ZX4A 5E1RA 2HWC3 3AMPA 4S2GA 5SV8A 3DGTA 4B7EA 4I0BA 5FQ0A 4PLNA 3EO6A 4NVPA 2BBVA 4XDQA 3VKLA 1YNAA 5K0UC 4E9KA 3B02A 2E63A 3U07A