4FQZA

Crystal structure of a protease-resistant mutant form of human galectin-8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
291
Chain Sequence
b'MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
molecule keywords Galectin-8
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 61
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fqzA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fqzA02
5IUQA 4C1WA 2WQZC 5E89A 1MZ5A 3B3QE 3NV1A 1O4YA 2P2KA 3PVOA 1LHNA 5JOZA 3W58A 3OY8B 5EYYA 2E6VA 2ZGSA 3BODA 3USUA 4IQPA 1FYUA 2D7FA 1LOFA 4WZFA 1SLTA 2PHTA 4XHXA 3MW2A 3OGGA 2KM2A 1AJOA 3WDTA 1W6MA 2ZMLA 1W6NB 2H0BA 2DURA 2A75A 2ERFA 1IS6A 3BTAA 4F83A 4LBKA 3B01A 2EXKA 3ZSJA 4YZ2A 3IM0A 4YLZA 1Y7BA 2AENA 1PZ7A 3R4SA 4M00A 1BQPA 3AP6A 2JD4A 4YW4A 1ULDA 5T5LA 3ILFA 1YYNA 2YZ4A 3JU9A 2ZGRA 4Y26A 1C1FA 1AXZA 2VU9A 2JDZA 1MR5A 1WUVA 5FREA 1LHVA 2WKKA 3LSEA 4M3CE 3WDWA 1IS3A 1LECA 1CVNA 4P14A 1SCSA 1MACA 2I2SA 2ZGLA 3FLRA 3UK9A 1CJPA 1LGBA 2GALA 3D4KA 2HYKA 3OYWA 2ZGOA 4FPCA 4PBPA 4AGVA 3V0BB 4XJAA 5DG1A 2WT0A 3WG3A 2OUHA 3M3CA 3HN1A 3ATGA 1W6QA 2EALA 3B69A 1HKDA 5CB7A 4FVVA 1W0PA 3VUOA 2DV9A 5T54A 5IT6A 3CNAA 1IKPA 1SCRA 1DIWA 1V6NA 2GNMA 1QOTA 2DUQA 1DGLA 4AYUA 1W6OA 3WDUA 2PELA 3T2TA 3D6EA 1DHKB 2OVUA 1LCLA 3MEPA 3OPZA 4LBQB 4LBMA 3WG4A 1H9WA 1SLBA 3VKMA 1BKZA 4JCKA 4LBOA 2G4IA 1W6MB 4RL7A 4Y20A 5E8AA 4DRVA 2V73A 3JUUA 4LBQD 1YO8A 2ZBJA 1A3KA 1UKGA 1S1AA 1KDMA 1GANA 1H30A 2EXJA 3INAA 4CRQA 2YXSA 2A71A 4K1ZA 2FMDA 4P9XA 1JW6A 1QF3A 3NV3A 4BLIA 4HL0A 3OY8A 3U4XA 2WLQA 3ILRA 3VKFC 2NMNA 3AFKA 1SBFA 5T5JA 1AXKA 5DZEA 4GWMA 1GICA 4XJ8A 1TEIA 2R0FA 1V6IA 4CZSA 2VY0A 2RHPA 3LSDA 2WNEA 5JOWA 2P3JA 4Q1PA 1YI7A 1VAMA 1QDCA 1DYPA 1KRIA 5KXDA 1W6NA 1JOJA 4YG0A 1AVBA 1CONA 3HMYA 2P3KA 4GKXA 1KJRA 4YZ3A 1S0BA 4XIOA 1WW6A 1W6QB 4DPNA 3TAYA 1V6JA 1YIFA 4Z8BA 2WSVA 1UZYA 5L73A 4BPZA 1HLCA 1WCSA 4AVTA 4P9WA 4D69A 3AJZA 1ENSA 1Q56A 2ZHMA 3M3QA 1OFSA 5EXOA 3VKLA 1FNYA 4R9DA 4YW3A 1URXA 3IKWA 1ENQA 1LOBA 2NN8A 2AUYA 2LTNA 1GNZA 3VV1A 1YXWA 4AWDA 1UPSA 3ZSLA 5JOYA 1VLNA 2JE7A 1LTEA 1VIWB 4R9AA 4Y1UA 2NMOA 1DQ5A 2ZMNA 3PMEA 4YFWA 5GZEA 4YGDA 5T55A 3WG1A 2VW2A 2A7AA 3M3EA 1WD3A 4Y20B 4XYXA 2VW0A 1DYKA 1LEMA 4M3CA 5DXDA 3WVJA 3ZXJA 3AYEA 5DG2A 3V0BA 1LENA 2ZA9A 1SBDA 2XG3A 3N7LA 1FNZA 2PHXA 1YRZA 4XJWA 1A78A 1H9PA 2A3XA 4YGBA 1DLLA 1Z0HA 4XMAA 2V5YA 3FLPA 2EAKA 2AYHA 1MS1A 1I3HA 2VW1A 2YROA 5JDBA 4YW1A 1G9AA 2ZAAA 1HQWA 1GZWA 1IS5A 1GV9A 5DUUA 2D3RA 2EXHA 4YW5A 1CQ9A 1N47A 2ZACA 3AZXA 1MS0A 1S0IA 1KJLA 2A3WA 2A70A 2ARBA 2PHFA 4FPFA 1QMJA 4SLIA 4LBQA 4Y1ZA 1AX1A 2A5ZA 3POSA 4AVVA 1LU2A 1V6OA 3SNMA 1W6PB 5F5QA 1W0OA 1X50A 4DQAA 1ULFA 2ZHKA 2OW4A 3FLTA 1DQ0A 3ZXKA 2DVAA 2JKBA 4Q27A 2E53A 5AVAA 3ZXEA 1DQ1A 1CR7A 3WUCA 1Q8QA 2A6YA 4ISRA 2ZGNA 1SLCA 1GZ9A 1UN1A 1ONAA 2ZZJA 3RQ0A 5T5PA 4XDQA 2C9AA 4XMIA 1QOOA 4NOTA 5EWSA 1LODA 2EXIA 1A8DA 2P37A 2PHUA 1WW5A 3ASIA 2AH2A 2AR6A 3WZ1A 4GA9A 4RA0A 1ZA4A 1V6LA 1GSLA 3HR9A 4AGGA 2YV8A 4FPJA 3T1LA 1ULEA 1Q8SA 1WD4A 4M3CB 4PF5A 3ZYRA 4XE9A 3B9CA 1LHOA 3VKNA 1FV2A 1DZQA 2DVFA 1BYHA 1VAVA 2UWCA 1SACA 1LULA 5JLVA 1SLAA 5KXCA 3POYA 4ITCA 2ZGKA 3N35A 1F9KA 1MVQA 4BOWA 3AP7A 3AZYA 3SISA 5H9RA 1GZWB 1QU0A 2ZGMA 1CESA 1GZCA 1S0JA 2R16A 3WV6A 2GMEA 3AP4A 1FATA 1MS9A 1UL9A 3R05A 4WV8A 4BMEA 4YZ1A 1V00A 4ATEA 2P3IA 2XB6C 4GKYA 4AVSA 3PVNA 1OKQA 1LHWA 2R0HA 4XXAA 2ZGTA 2A6ZA 3O0VA 2DVDA 3V64A 2LALA 2PHRA 2CY6A 1J1TA 3UJOA 4XTMA 2GDFA 3N7KA 5E88A 2YY1A 1SFYA 4HANA 4TZDA 1F5FA 3NV4A 2A3YA 4ZKTB 3SITA 1LESA 1G86A 1G7YA 1V6KA 2ZMKA 3MW3A 2CTVA 1XQNA 2AREA 1MVEA 2Z42A 3IMNA 5JVVA 1RINA 4Q2FA 4Q26A 3WDVA 2D3SA 4FP3A 2GNBA 5CA6A 1LU1A 3OJBA 1JXNA 5FRAA 1U0AA 1CIWA 3A0NA 3PJQA 5GLTA 2EIGA 3R4UA 1MS3A 2NM1A 4PBOA 2UWAA 2ZHNA 3IN9A 1W6PA 3BIWE 4NO4A 1BZWA 1QGLA 1S0GA 1QKQA 3AXDA 4U2AA 2UU8A 2GMPA 1N1YA 1JYCA 1LOGA 4FOWA 1MS4A 4W65A 5DUWA 5F9TA 2GNDA 1WBLA 4PCRA 4Q8LA 2ZABA 3DGTA 4YZ5A 4XHBA 1UAIA 3AZWA 2OUJA 2C5DA 2A6WA 1KQRA 2AGSA 3NWKA 3ENRA 2R1DA 1UMZA 2GMMA 3ZXLA 2DVGA 2W52A 1NXD1 2YMZA 4I30A 5H9SA 2SBAA 1LOAA 3KM5A 1QNYA 5DZFA 1LGNA 2ARXA 3ZSMA 2P34A 4WVWA 1G8WA 3WHUA 4Q8KA 3QLQA 4FOYA 5LK5A 4R9BA 3RMXA 2D6MA 3N7JA 2D3PA 1C4RA 3A0KA 3AP9A 4BM8A 2ZGQA 2DUPA 3GNEA 4XTPA 3SH5A 1LEDA 1S0EA 1DFQA 2R1BA 5GLUA 2D6KA 3M2MA 3WDXA 1O4ZA 3OBTA 3WNXA 1DBNA 2WT2A 5T52A 4ASMB 1LOFC 1G9BA 1AJKA 2GN3A 3PVEA 1GKBA 2D43A 2JE9A 4FQZA 4XBQA 2NYYA 3WCSA 1AF9A 5SV8A 3D5OA 2DTWA 1SLLA 4YG3A 2CYFA 5GZGA 1IKQA 1FAYA 4JC1A 1S0CA 2Q5TA 5GM0A 2TEPA 1AXYA 1JN2P 1F31A 2ZGPA 1RITA 3I8TA 3KQRA 1MZ6A 4XOGA 3ZYPA 4XJUA 1D2SA 1GBGA 4GALA 5H9QA 4XJ9A 3N7MA 1AX2A 2NZ9A 3AP5A 3MPPG 1KDKA 1QNWA 1WLCA 2D6OX 4ISQA 1N3QA 1IS4A 4AGRA 3WOGA 2D6LX 2ENRA 3O5SA 3WLUA 3B00A 3GALA 1N3PA 2UWBA 3QCWA 1FX5A 3AX4A 2W39A 1S0DA 1N1VA 2DYCA 2W68A 3O12A 4YG6A 5GLZA 1ZM1A 4GWNA 3SH3A 1N1SA 3H0OA 3RG0A 1PZ9A 2D44A 4XBNA 4YGEA 3DUIA 1DQ6A 1C57A 1QDOA 2ES3A 1GLHA 4FPEA 5H9PA 1KITA 3AYCA 2D6PA 5GALA 1AZDA 1FV3A 1JUIA 4K1YA 1JYIA 1SLIA 3MW4A 5KXEA 1BJQA 3V0AA 4DRRA 1G9DA 5KXBA 1NLSA 1DQ4A 2WSUA 3AZZA 3N3HA 3UL2A 1WLDA 2E7QA 1N1TA 3M3OA 1HDKA 3O0XA 3SLIA 2E51A 5GZCA 4K20A 1G9CA 2NP0A 3IPVA 2WJSA 4FPOB 3FBYA 4ATFA 4C1XA 5IK5A 2JJ6A 4BLJA 2DTYA 4YM3A 1Q8VA 3AZVA 5T5OA 4DS0A 4MYEA 4XJZA 4Y22B 1N3OA 2ZHLA 1LJ7A 2DWRA 4YGCA 2D6NA 5CBLA 3BOPA 1Z78A 3WUDA 2SLIA 1AX0A 4XBLA 4BQ1A 1WBFA 1BXHA 1WW4A 1LHUA 3I4IA 4PQ9A 4KBBA 3ZPYA 4OZXA 2ZGUA 2VXRA 4XILA 4Q1RA 2W08A 2GNTA 3ZSKA 5DUXA 3T1MA 1C1LA 4GXLA 3RMYA 2DUOA 4UW4A 1V6MA 3FUOA 3TB0A 5IK8A 3ILNA 4FPGA 3USUB 5GZDA 1GYKA 5CAZA 3AYAA 4LBJA 4M3CF 3WHTA 4FPHA 2FHRA 3RSJA 5HCAA 3POWA 3FUQA 4YZ4A 2R49A 1WLWA 2DU1A 2UURA 3A4UA 5DZGA 5BYNA 4Y1XA 1DQ2A 2A6VA 1ENRA 1CPMA 1SBEA 1JBCA 3UJQA 2DVBA 3AYDA 4FQ4A 4UW6A 2CWMA 1WW7A 3AJYA 4YW2A 4FPKA 3ZVXA 4YFZA 1I1EA 3LCPA 3WDYA 1G9FA 1R1ZA 2B7YA 1GNHA 4XIKA 3L2YA 3V0AB 1APNA 1Q8OA 3WCRA 4P9YA 4ZXKA 1ULCA 2A6XA 1HQLA 4YM0A 1D0HA 1IOAA 5GLWA 3IPVB 2BQPA 2VH9A 4WVVA 2CL2A 4K21A 4BMBA 1LGCA 3VKOA 4H55A 3ZXFA 4YM2A 3NV2A 5IK7A 4M01A 3OYWB 1QOSA 3AK0A 2JECA 4FPLA 4TYSA 3SH4A 4UW5A 1MS5A 4XXPA 2ZKNA 4LBLA 4LBNA 4U36A 1JHNA 4L8QA 4R9CA 2E7TA 3RRDA 4FP2A 4XZPA 4FOQA 1Q8PA 1LOCA 4YM1A 4Y1VA 3APBA 5EYXA 3WG2A 5HCFA 2EF6A 2PHWA 1UX6A 4JRAA 3RS6A 1W6OB 2CNAA 3V65A 1OQ1A 5JMCA 5T50A 3C2UA 5GLVA 4Y1YA 3O0WA 2DU0A 4FOVA 1CN1A 4Y22A 4Y24A 1S0FA 5HCBA 1RIRA 1LOEA 1UZZA 2VUAA 3FFZA 5GJ6A 5JOXA 5DUVA 1B09A 1PZ8A 4UW3A 1EPWA 1CPNA 4FPYA 3Q9OA 2CWSA 1VALA 3M1HA 3N36A 3AXEA 5GZFA 5IK4A 4CTEA 2WT1A 1ULGA 4DFSA 1MS8A 2GN7A 5CNAA 3W59A 3OBRA
chains in the Genus database with same CATH superfamily
4XURA 5E89A 4BJ0A 1MZ5A 4Z07A 5A6ZA 1O4YA 3OUHA 4JQRA 4WM7B 3W58A 3VD7A 3OY8B 3WSOA 4IE5A 3PIJA 2JXAA 4MH0E 4IQPA 2D7FA 1YUDA 4META 1SLTA 5JIAA 1OBNA 1OF3A 4P9IA 1F8VA 2I45A 1POQA 1GWMA 5A3WA 3CIHA 4HN1A 1CAUA 5F5CA 5FMOS 3WX5A 2VMCA 1JZ8A 1HRI1 5FMOL 1UYPA 2B8MA 2X5IB 3BTAA 2R061 3RDIA 4MSVA 1XE0A 4LBKA 5CFCB 3GXUA 1MEC1 5FZGA 1H4HA 1XC6A 5C4WA 3ZMOA 1L7RA 1CX1A 4QKBA 3NNJA 1BQPA 3FX3A 3A21A 5IATA 5EV7A 4QKNA 1OXCA 4V2VA 1QWRA 1OFNA 1YYNA 1CAWB 1I5PA 4O9EA 2ZGRA 2HWD1 3BTXA 5FP4A 1H8TA 2VU9A 2VJXA 4FFIA 4QXCA 2DFBA 3FZ3A 4CPBD 1BVP1 1R091 4HSLA 4NHXA 4A45A 1F4AA 4WM8B 2GC3A 1GOGA 1Y9MA 1OA2A 4LO6B 5J3UA 5DDJ1 3AVRA 1VR3A 3OYWA 5A7PA 2ZGOA 3H1WA 4W50A 3V0BB 1VBA2 1XYPA 2WT0A 4DUXA 3MBWA 4EN7B 1PMIA 3POGA 3WF4A 4CEYC 2WFPA 2ORXA 1SFPA 1VBD3 1IKPA 4RS5C 3WW4A 3ZMNA 4K9SA 1SEFA 2GNMA 1QOTA 1AR72 2VOXA 2XOMA 3OEAA 1W6OA 3T2TA 1GWLA 4J1WA 4Q0VA 4Q4W2 5J36A 2CDOA 2JB8A 1H9WA 1BKZA 1HX6A 2BFUS 4Q0PA 1TME3 1W6MB 3MO4A 4Y20A 1IPJA 1WMXA 4DUWA 2BFUL 5CG8A 2JG9C 3E97A 4E9KA 1A3KA 1NLQA 5I8YA 1VRH1 4QX1A 4LE4A 5FPLA 1H30A 3AKTA 3R0RA 2XUEA 4P5HA 1K42A 2JX9A 4K1ZA 2X05A 4QQHA 5C8CB 5B2GB 2VVEA 3NV3A 4NMIA 4WM7A 5F32A 4HL0A 3OY8A 3U4XA 4FTSA 2NMNA 3K51A 2W94A 5T5JA 5A3TA 1AXKA 5DZEA 2RS51 3S5AA 4PDWB 2R0FA 2B5HA 2P4EA 4JDNA 4W6YA 5HPOA 4LHLA 5F39A 1VRBA 4XAAA 1W39A 2W47A 1KRIA 1L7QA 1JS9A 1EAH2 4XCAA 1HB2A 1SZBA 2P3KA 2E33A 5FZ8A 1KJRA 5CISA 2X5IA 3LEGA 3G6JB 4QPGB 5FZFA 4XIOA 1MPXA 2GP5A 2QDRA 1W6QB 3KHBA 5JWPA 2FCVA 2XUMA 1IPSA 1H8VA 4QQ2A 2W1WA 3RNSA 4OUMA 4NHYA 4O7XA 1W03A 3CO2A 4K8RB 4D69A 1CAWA 4JGYA 1IZ3A 1KXGA 5CIRA 1URXA 3IKWA 1LOBA 1UOBA 1XNCA 2VZ3A 4AWDA 3VD9A 4Z1VA 4FFGA 4S2GA 4KU8A 1O91A 1C8M2 1VLNA 4WM8A 3TWIA 4Y1UA 1PMHX 1W90A 3PDQA 2NMOA 1DQ5A 2ZMNA 3WG1A 2H0VA 3A23A 1PM7A 2VW2A 2IUWA 4MXVA 3SKJE 1WD3A 1W8OA 1BEV2 1DYKA 2RMU1 4NN0A 3OUJA 2Q8CA 1ND3B 3AYEA 3V0BA 3N7LA 4GWIA 1ZBA1 2PHXA 4AHWA 4ZU7A 1A78A 1H9PA 1NUKA 4DNYA 2EAKA 3CJXA 2G9GA 1VPHA 4RHV2 5C3OA 2VW1A 1G9AA 2HWD2 1GZWA 3H3LA 3A7QA 2R073 4TXWA 2Z69A 1GV9A 1OURA 1R092 1CQ9A 1SFNA 2JKXA 3AZXA 3UGFA 1FPN3 1KJLA 2WDBA 1QMJA 4HKOA 1AX1A 2G1MA 2JDAA 4URTA 5A6QA 3GHNA 4FBFA 2J1TA 3SNMA 1W6PB 4D6QA 4XFHA 1L7LA 4H7LA 1AL22 1ZYBA 4E4HA 2WZEA 2ZEWA 1AYN3 5K0UA 3OPWA 4IEUA 4MADA 4AE2A 4Q27A 2VNGA 3ZXEA 1DQ1A 3ZFFB 4GH4C 4Y5TA 3WUCA 4ISRA 1SLCA 1GZ9A 3AMPA 1ONAA 4CUAA 5K7PA 4LXLA 3O1OA 3ZFGA 4GULA 1ZRDA 2PA7A 1AR83 1QOOA 3BALA 3EBRA 2P37A 3IAQA 1S4CA 3DYPA 3MUZ1 3ZN4A 4AFMA 5CKNA 5KR7A 1WW5A 1YLLA 3ASIA 2AH2A 2BWAA 4QM8A 3WZ1A 3FJSA 2WNUC 2GZWA 4GA9A 4RA0A 3JD72 3GBWA 1YQ8A 1RL3A 3AFGA 3ORJA 4KU7A 3KGZA 3LKJA 5CKMA 4QPYA 4AVBA 5A7WB 2VQAA 2XXZA 1QJY3 4D6SA 1UOJA 3H7JA 4PF5A 3WW2A 5IFPA 1E5IA 3KD4A 4KNCA 4Q4V2 1XPWA 2DDUA 2WFF3 2UWCA 3NAPB 2O8OA 4CUGA 3KF5A 5JSOA 4HXCA 1SLAA 2WA3A 4AFBA 3M8LA 3N35A 2CGOA 1IGOA 4IETA 1Y3TA 4AOCA 4BOWA 4FAGA 3SISA 4DO0A 2R7EB 1XXNA 4K6BA 2RS52 1GZCA 5FQ0B 1F15A 1ZVFA 5FLHA 1QY4A 3I2GA 2GMEA 2XLAA 1WMDA 1GFF2 1UYYA 3RZHA 3ZLIA 2B9UA 1QQP1 4CDXB 1UMIA 2XB6C 2RJKA 4GKYA 4KGQA 4QB2A 4J25A 1R083 4CUCA 1W8UA 1FOD1 2R0HA 3PLQA 4XXAA 2Q8EA 2IVIB 1W06A 1XRUA 1ND3A 4F8AA 1CX4A 5KWRA 2DVDA 1W8NA 3V64A 5L7OB 4YWAA 3UJOA 1W8HA 1PK6C 3N7KA 1HRV2 4PQQA 5E88A 5I0SA 4IW3A 3FHAA 5IJRA 2XJUA 3AVSA 5G05L 4I0WB 4B1LA 1XNAA 4Y33A 3N9PA 3SITA 1J58A 1G7YA 3KVBA 4LA2A 3NJZA 1XQNA 3IMNA 5FMBA 5C7GA 1BMV2 4FP3A 2GNBA 5CA6A 3ROUA 4CXYA 4Z2AA 2HWC3 4FI9A 1PIV1 1U0AA 5FK7A 3PJQA 1EP0A 3WF0A 2BGCA 3VBFB 2NM1A 2RMU2 4PBOA 1W6PA 2VUJA 1QGLA 5CFCC 2K9ZA 2RR13 3DYMA 4Q0UA 3VD5A 2GMPA 4AR2A 5A70A 1RMU1 4UWDA 5DUWA 3JCIA 2GNDA 4QD2A 1WBLA 3ZFFA 4PCRA 5A7NA 2EVXA 4I02A 4D7TA 5D1IA 1KQRA 4W6WA 2AGSA 1RUE1 3FMGA 1V9U2 1YHFA 4WM8C 5F2SA 5H9SA 5A32B 3ZN6A 5F3IA 2E31A 1W2NA 4L9BA 2GC2A 1LGNA 3ZSMA 1RJ8A 2P34A 4HG6B 5A7WA 1ODNA 4E2QA 3QLQA 2QCSB 4FOYA 1X8EA 5A33B 1PO11 4HFSA 3AP9A 3HWJA 3USSA 4BM8A 4BXFA 3RYKA 4DINB 2ZX2A 3NAPA 1L3JA 4NIGA 5IAXA 3VBUB 2GC0A 3VHNA 1RUJ3 1DDLA 5E16A 2R1BA 1W8FA 3MUY1 5A3PA 3GZAA 4M4PA 3WDXA 2HWF3 4JQTA 4LQRA 1O4ZA 1DBNA 2EIEA 5BNQA 1QJU1 2JE9A 3LEIA 2C6SA 4FQZA 4C0HA 1ZZ6A 1RUF1 3WCSA 4OZOA 3D5OA 5LA1A 1B35B 1SLLA 4CDXA 2VULA 1RTVA 2JDYA 3L2HA 3O14A 5A6YA 3H42B 3ZR5A 1ZZCA 2OS2A 5GM0A 1AXYA 1RUOA 3MICA 5FO7B 1F31A 2QDNA 3KQRA 1RITA 3BKZA 3PL0A 1RUC1 3N9LA 5H9QA 3O1PA 1COV3 2OQ7A 1AX2A 2RG4A 4XQWA 1QNWA 3OGVA 1WLCA 4KMQA 2J42A 4XW3A 1DGRN 3ZOIA 5C8CC 2MNGA 3U37A 2OX0A 3WOGA 2WC2A 3T0DA 4JGZB 1GP5A 4ET7A 1JZ7A 4NIAA 4LNVA 1VBE3 4QGNA 5FYZA 3QCWA 2XJVA 3MF6A 2W39A 1YEWA 1OA4A 1OKOA 1X7NA 4PDWC 3DKWA 1YI9A 1UQXA 1YWKA 1Y9QA 2XHKA 3H0OA 4GWNA 3HOBA 2VZOA 1GZTA 1V0AA 1CZTA 5FZ1A 1DQ6A 5IVBA 3VBFA 5JZGC 4FPEA 4QPGC 4DY3A 2NPIA 5FYBA 1KITA 3AYCA 1JUIA 3RGBA 2VBDA 1JYIA 1SLIA 5BNNC 3P5BA 1BJQA 4TLGA 3H8RA 3GGLA 5FY0A 4RFT0 3W21A 1JYXA 1NLSA 2K46A 2KR2A 2WL1A 5FY4A 2WSUA 5BV6A 3M3OA 1N1TA 3VGIA 4K20A 5IVFA 1M4WA 4ATFA 4NIDA 3NNMA 1NA1B 4LUMA 4BLJA 3F2ZA 3I2FA 4DS0A 2XJQA 1N3OA 1LJ7A 1SHWB 4YGCA 5CFDB 2VOTA 4BQ2A 1SDDB 3OGJA 4Q4Y1 3AL5A 1Q43A 5A33A 4MGTA 4PQ9A 4G3YC 4B3NA 4OQ9A 4OZXA 2ZGUA 5F3EA 5AFEA 4XILA 3ECQA 2V4AA 1D4M1 1C1LA 2VE1A 1K5MA 4GXLA 3RMYA 3VBUA 1VBA3 2XWBB 3CBNA 4AEDB 4KWJA 4UW4A 4BHPA 4A4AA 3TB0A 3ZR6A 1QH6A 3USUB 3DL3A 5GZDA 3ZO0B 3VL9A 3AYAA 4LTAA 4N53C 3RJ2X 2RJ2A 2FHRA 4FPHA 1RXFA 5D8AC 3BU7A 3VHRA 2VECA 4OHYA 4I0AA 1NCQC 4YZ4A 4L2NA 3KCYA 5DZGA 3KT1A 1DQ2A 1WMEA 3IT8A 2WYSA 1CPMA 1PO12 1JBCA 4LK6A 1RUI1 4Q4W3 5FV3A 4BXSV 5KC5A 1UOFA 5FZMA 1NLRA 4YW2A 4CCOA 3K3OA 3K46A 4YFZA 2XBO1 1R1ZA 1WCUA 1UY2A 1GNHA 2AACA 4HN0A 2VTXA 3DCQA 2ID4A 4CDQB 4FTBA 5FFOC 1KD7A 4JGZA 4JDMA 1JZ4A 2RM21 1D0HA 3U75A 1JTZX 2VZ1A 3K4DA 4BMBA 1LGCA 3U14A 2FBEA 4UFJA 1AYM1 4H55A 3OBAA 3VBOC 5LK7B 1OSGA 3CU7A 1EY2A 4LA3A 4NHLA 3E5XA 3KVAA 4N43C 4WVZA 2IWGB 1PHMA 4OCTA 2ET7A 1AR92 1QOSA 4XF1A 2OXBA 4CDUC 1RUC2 5F2WA 4XXPA 4LBLA 4LBNA 5FZOA 1EAH3 4L8QA 3T4VA 2Y0OA 4AQSA 1Q8PA 4IEQA 3GZUC 4YM1A 3APBA 5HV4A 3FWEA 2GAUA 5EYXA 2EF6A 3WG2A 2W91A 3DPRC 3RS6A 2CNAA 3AB0A 5T50A 3T2OA 1NA1A 1UX7A 2DU0A 1FMD1 1WGPA 4TN7A 4Y24A 5HCBA 2P6HA 2LUWA 1UZZA 4NUBA 1PNGA 5EJ3A 2VUCA 4YVWB 1EPWA 4BDVB 4FPYA 5KHKA 3Q9OA 3M1HA 3SKVA 4WZCA 1C8M3 1X33A 2VL4A 3RVHA 4EYUA 5L7OC 3C7GA 2HWB1 3VD3A 2G19A 5DAWA 1T6GC 1ASJ1 3T3YA 4BA6A 5ABJB 2GN7A 1BEV3 5CNAA 2WZR1 5IUQA 4C1WA 1RUG1 2WQZC 3TNQA 2CGPA 1D4VB 4AEDA 2ZEZA 1LHNA 2LW8A 3KLSA 1PVC2 2ETEA 5EYYA 1AR62 3S0MA 3USUA 3LA3A 1NCRB 1QXRA 3ZIWA 1VE0A 4LE3A 4RHV3 1K45A 1ND2B 4WZFA 2UY8A 1WA6X 2ZX1A 4BK5A 2TUNA 4TSVA 3THCA 2HWD3 2YDEA 5J7MA 3OGGA 1Y43B 2XGXA 1AJOA 1MZFA 3WDTA 3NL1A 2EIBA 1R093 4Q4Y2 1VBB1 2H0BA 3GBGA 5FPXA 1SMVA 3GYDA 3O1MA 2PFWA 5T3NA 1SPPB 3B7MA 3J8F1 3LF7A 1IS6A 4F83A 2B4KA 5DDJ3 3EB7A 3IM0A 1YIPA 4YLZA 1PZ7A 2DFCA 2WS91 1JODA 2QE3A 3PU8A 4YW4A 2VMIA 4EN8B 2HJIA 1TMF1 4IE6A 2QZ2A 4J1XA 1ZBE1 2JDZA 5FREA 1WUVA 1H1AA 1H6XA 1LHVA 2YGMA 4HMZA 4M3CE 4NR1A 4DEVA 4PI2A 1IS3A 1BHGA 1XSRA 2J7MA 2Q4SA 1CVNA 3RFRA 1RVF2 1NKGA 3TRSB 5FYVA 3CQOA 3FLRA 3UK9A 5EJ1B 2GALA 3JD73 4UT5A 1OOPA 3BGAA 3WG3A 2WO3A 5FZ4A 2XBO2 3HN1A 2VCCA 3ZSEA 5FY7A 5CB7A 2OQ6A 3DKQA 1NT0A 4QX3A 3AMQA 3VBHC 3E1F1 5K8SA 1MQTB 5BNPB 1NY71 2VOVA 3DECA 3OG2A 4AYUA 2HWC2 4OHXA 1AYM2 4EROA 1LCLA 4GMP1 4LBQB 2GH2A 1B35C 3K4ZA 5J48A 2WLPA 1CAUB 1S2KA 1RXGA 2RS53 3I2IA 5SV5A 4LBOA 2X8KA 4XEZA 4XFGA 1YJKA 4I09A 2E63A 2XKOA 4EN0A 4LPLA 2ZBJA 3ZIXA 4IGPA 4HOOA 3CDZB 4RGKA 4Q5OA 1S1AA 1KDMA 5ACA2 2XHNA 2YPDA 5ABJA 5F7UA 4P02B 5C4WB 4ZZ5A 3KV9A 5FYYA 4JGZC 1C8NA 1JW6A 1HRV3 1ZZ9A 4MHRA 5FK8A 2A1XA 1W8ZA 4NRPA 5FXWA 3VKFC 1F4HA 2QNKA 2Y6HA 1H8TB 5IVJA 5E6HA 1GMMA 1V6IA 2R042 2RHPA 3LSDA 3VZLA 3BPZA 5JOWA 4JHTA 1VAMA 1DYPA 1JOJA 1DG6A 2CSGA 2ZCWA 3LDBA 2RS12 4UXAA 5FZAA 1CJDA 4GKXA 4HK9A 1SPPA 2ZPXA 4QMAA 4YZ3A 4BISA 2D93A 2IFWA 1ASJ2 1S55A 1WW6A 2W1SA 3ETPA 1OPOA 2RMU3 5EJZB 5FZ9A 3TAYA 1NAEA 3IDBB 1UZYA 2JG8B 2YBPA 3LZZA 3OTFA 4HBNA 4HK8A 1ZBA3 4LR4A 5FXVA 4YSFA 2JDKA 3AJZA 1ENSA 1Q56A 4PLMA 3M3QA 3I3DA 1NZCA 1ENQA 1RGSA 2NN8A 4EQVA 1GNZA 2Q0AA 3FHIB 1DLCA 3OD4A 3ES4A 4AQ2A 4FAHA 5CFDC 1LTEA 2BWCA 4FSJA 4YFWA 2IXJA 1G6NA 2XQXA 2ORZA 4HONA 4Y20B 2BOJA 4M3CA 5F8PA 2W5FA 5DG2A 3S7EA 2ZA9A 1SBDA 2B39A 3OUIA 2DCYA 4CP1A 1FNZA 3U0ZA 1Z7S2 2A3XA 3AMNA 4YGBA 1JZ2A 1DLLA 1Z0HA 5FY9A 3FLPA 3FC0A 1DGWX 1MS1A 1I3HA 3HT1A 3S6PA 2YROA 4ARXA 4KG8A 3WNOA 2JD9A 2BBVA 1MQTA 1J3QA 2ZAHA 5BNPA 3WNMA 4LOSA 4X8NA 2G9ZA 4OHWA 3S57A 5FUNA 1MS0A 1S0IA 2A3WA 2A70A 2PHFA 3I54A 2OT7A 4LBQA 4YVSC 3SQOA 5JCTA 2HEYF 3D3AA 1LU2A 1HN0A 1NZIA 3ACIA 4S2DA 4UFLA 1O4TA 1W0OA 3RZMA 5IAVA 1ULFA 3K77A 4ASLA 2ZHKA 2OW4A 4LO4B 4Z92B 5FPBA 3PUQA 2NLRA 4BQ5A 3PUHA 1VBC1 5FP3A 2E53A 2WZ8A 1T2XA 1I5ZA 1Q8QA 2A6YA 4CDQC 5C71A 3T09A 1RB8G 4P9LA 4XDQA 1JYVA 2C9AA 1BVVA 4JGYB 2R32A 5IVCA 3DN7A 1WCQA 2AR6A 1OVPA 2JDPA 4A7KA 5CKQA 4S2FA 5F6KA 3H8XA 2XJRA 1ZA4A 1JZ5A 1GSLA 1UU6A 5F5AA 4CCEA 2YV8A 5J98B 1GU3A 1Q8SA 4LULA 3ZYRA 1WKYA 3WP6A 3B9CA 3VKNA 4E8DA 4QX7A 3R4DB 4NE9A 1FOD3 5M0TA 4JTNA 5JLVA 5KXCA 2JG8A 4IV3A 4ITCA 4Y4RA 1PGL1 1MVQA 3AP7A 4CEWA 3POEA 4LHKA 3SCFA 5FYUA 1GZWB 1QU0A 1VB4A 4Y5SA 1CESA 1HV1A 4I3PA 3K4AA 2PN5A 5JMOA 4BQWA 2X29A 1FATA 1UL9A 4CU6A 1PGW1 2ARCA 3R05A 4ATEA 4HZFA 2RV9A 4AXOA 2P3IA 4O9GA 4YVWC 3VZJA 1OD5A 4AVSA 5C5TA 4L11A 3PVNA 4INDA 4JVAA 4QU1A 1LHWA 2D40A 3LE0A 4HPKA 2DCJA 2HEVF 1PX3A 4GWJA 2KXLA 5K0UB 1SFYA 1O3QA 4URAA 3THDA 2A3YA 1UZVA 1LESA 1G86A 3T0BA 1OVSA 5DAPA 3ZFGB 3ZM8A 1NCRC 3Q8CA 2BJSA 3BCWA 2AREA 1K3IA 5JVVA 1ND2C 3WDVA 4Z2WA 3ZYJB 3NJVA 1J3PA 1LU1A 4IEOA 4XPVA 2W2IA 4TTGA 3IZOA 1U5IA 3A0NA 1W8TA 5J09A 3RYPA 2MPFA 4DZGA 3I97A 1X82A 4R8HA 2WAAA 1CIYA 3I7DA 2JB4A 1JYWA 2C24A 3K48A 3UESA 3VBRC 1PO13 1UO9A 5F9TA 4COVA 2XLGA 2L9LA 3HQUA 5FTTC 4Q8LA 2ZABA 3DGTA 5LATA 1EV11 4MGIE 2J1SA 2A6WA 4COUA 3P1IA 2G9FA 3ENRA 2R1DA 3PU3A 1UMZA 2VCMA 2P1BA 2Q1MA 2GMMA 3ZFEA 3RPQA 3PTRB 1I9RA 4IEZA 4RQPC 1LOAA 1QJU3 3KM5A 5FZCA 1H2LA 1XE8A 2YUEA 4RGAA 4WVWA 5D2AA 1G8WA 2WN3A 1HRI2 5LK5A 4R9BA 4N7UA 2CAUA 2D6MA 3N7JA 2R062 1OUXA 3A0KA 4AW7A 3HIFA 3J7NA 2XWJB 4XTPA 3NKGA 4XCBA 1MEC2 1LEDA 1TNRA 1W9TA 1S0EA 1AR93 4JKMA 1RUC3 1DFQA 1GOHA 4QPIB 2N7GA 1MQTC 2VUDA 3I2DA 2D6KA 4P5YA 3S7IA 2WAOA 5FBZA 5BNOB 2WT2A 1G9BA 2FDHA 3ZPOA 1O6UA 1GKBA 1QHDA 4QX0A 4AFAA 2W9XA 5CZKA 3BYWA 5SV8A 4UYBA 1BLZA 1ST8A 3D82A 2Y6JA 5DDJ2 1UU5A 4AI2A 2WABA 2XPJA 2JDMA 1QEXA 4E4DX 1QIQA 4JC1A 3PVBB 3WT3A 2TEPA 3KT4A 4UFMA 1OLQA 2ZGPA 3I8TA 3ZYPA 2HH9A 4N9IA 4XOGA 4MGYE 5C4WC 2BNOA 2RS31 3DF0A 3WINE 1HB4A 4AI3A 4COWA 4AHXA 3O5SA 3MIDA 2BGOA 3PJYA 1N3PA 4JV4A 1FX5A 1H8TC 2WIIB 3AX4A 1S0DA 2ZEYA 2B45X 2DYCA 3O12A 3SH3A 1AHSA 3POIA 1N1SA 1PVC3 1PZ9A 5L9BA 1AR63 3RJRA 3ZN6B 2D44A 4YGEA 1YQ2A 2WNVB 2HWE1 3DUIA 1REDA 1X8MA 5JI7A 4B7EA 3SHRA 1REFA 5C9AB 2XJPA 4GB31 1LR5A 1S2BA 4XABA 4QDQA 1QXJA 5GALA 4N8MA 2F17A 3RZJA 2B42B 5C8WA 1UNBA 1VRH2 2BEOA 3HBKA 3MW4A 4Q4Y3 2FDKA 2Y38A 4C0BA 2JG8C 3NKTA 4R52A 3VBSA 3V0AA 2YC2A 1G9DA 3QH7A 1X9PA 4HKLA 1DQ4A 2E26A 3AZZA 1LKNA 1ZREA 3P6BA 1WLDA 2NP0A 1D4M3 4OLLA 3OPTA 3IPVA 2WJSA 4FPOB 5E1RA 5FZEA 3U11A 1OLRA 2JJ6A 3B5LB 5KHIA 2VZSA 1Q8VA 2QQKA 4CSWA 3MHZA 1UZWA 4SBVA 3RZZA 2NQYA 2ET1A 3L9JT 2VVDA 1UY3A 3U07A 5CBLA 1WLTA 2QQWA 3BOPA 4IE4A 5B4XA 2SLIA 4QXKA 2Q8DA 3WUDA 4AFCA 3HBZA 4BWOA 1LHUA 3AMMA 4A3XA 2O0OA 1RVF3 5FZ7A 4I3GA 3MLJA 2VXRA 3CF6E 4KL1A 4NHMA 1DU3D 2EAAA 4Q29A 5LA9A 4A2UA 4B4PA 4OQ8A 2W08A 2GNTA 3K3NA 3ZSKA 2CAVA 3T1MA 3I59B 2C0ZA 5FZIA 1EV12 3WF3A 1CAVB 4QPIA 2PHDA 1V6MA 2XBO3 4QU2A 3TBDA 5A3LA 2LRPA 4WM7C 1WMFA 1E57A 2VR4A 3ILNA 3LFIA 2OPKA 5CAZA 3WHTA 5BNOA 1ZRCA 5JIUA 3GHMA 5HCAA 4DEQA 1Y9GA 3HEIA 3POWA 3I2OA 4AF9A 2RM23 4YNIA 3FUQA 1WLWA 4QPWA 3LOBA 1OQDA 1C5IA 4QT6A 4FCAA 5FUIA 4YW7A 3WP5A 4CDWA 1AYM3 3J7MA 4PJYA 4AL9A 4D7YA 1VBD1 2DVBA 4RGGA 2CGNA 4CCDA 2X5IC 2PYTA 2YBSA 1RUH1 2CWMA 3AJYA 3KCCA 4NAMA 2YGLA 4FPKA 4OFGA 1GUIA 2WO1A 1ZBA2 3U78A 3IDAA 3M70A 4XFIA 3WDYA 1G9FA 2B7YA 5I0RA 3CZUA 3MIHA 1Q8OA 3ITQA 4ZXKA 1J83A 1HQNA 2VOKA 4CP9A 4P9GA 1BK0A 2A6XA 4JGYC 5ACA3 1STMA 4YM0A 4B7KA 1ENXA 4PLOA 5IWFA 1IOAA 5GLWA 3RWKX 2BQPA 4XUPA 4WVVA 3VKOA 2D5FA 4LITA 4DMIA 5FZLA 4JKLA 2WBKA 3VN4A 5F6LB 2BNNA 1AL0G 2WNVA 3SCGA 2JWPA 3VZOA 5C9AA 2R043 2E32A 5F1RA 4FPLA 2IC1A 4TYSA 4DOUA 4UW5A 1JOBA 2ZEXA 2IFRA 4NPMA 1O5UA 1XNKA 2J1VA 2RS13 2E7TA 3KV6A 5F3GA 2HWB3 2VC9A 4XZPA 4XQDA 1K5MB 1LOCA 1W9SA 1GNYA 4DXRA 2VO5A 3WW1A 1ASJ3 3A22A 5GKAC 5FMCA 3KMHA 2C4XA 4Y1YA 3WNPA 3WNLA 2QQPA 1CN1A 2WA4A 1S0FA 4CCMA 1ZRFA 1ZNPA 2VM9A 2AZ5A 4K3UA 4XF3A 5AFBA 5GJ6A 5JOXA 3HPNA 5DUVA 1C3HA 4C8DA 3R6SA 2W1UA 3N9OA 2VNOA 3N36A 1VALA 5GZFA 5IK4A 1UWWA 2WYFA 4FXKB 1VBB3 3J7HA 5K0UC 4DFSA 2Y33A 3OOXA 5FJKA 2B9VA 3HVDA 3I59A 4LEJA 3F95A 3B3QE 1H1MA 3LDRA 3NO8A 4XC9A 1CAVA 4C91A 2TNFA 2P2KA 3ZFGC 5FCCA 3BTZA 1Z7S3 2E6VA 2ZGSA 3BODA 3JQWA 3JXSA 4YRDA 5FWEA 1FYUA 1LOFA 2E9QA 4I01A 1DZRA 4QAWA 4XHXA 3MW2A 4A6SA 1EPZA 2X10A 5LASA 2Q30A 2ZZQA 1QQP2 1ZBE3 1W6NB 1JMUB 2YFUA 1ZZBA 4AQ6A 1FOD2 4HSJA 5JPMB 5AC91 4UAPA 1R1A1 1ULOA 4NROA 4BB3A 4BE3A 2Z2SB 2XJSA 1YFYA 2EXKA 4MO3M 3ZSJA 3ST7A 5FPUA 3WR0A 3WXPA 1JYNA 5C3PA 4UI9L 5FZOB 4EWEA 2AENA 5F5IA 1BBT1 3R4SA 4HT1T 2OZJA 4M00A 4AK3A 4BQYA 2AEZA 3AP6A 1ULDA 4MHUA 4CXXA 5EIYB 2YZ4A 5LY2A 2P3YA 3JU9A 3U1XA 3W5NA 1Y4WA 4Y26A 1C1FA 4A3ZA 4OUSA 3CJIB 1UY0A 2WKKA 3LSEA 3EHKA 4Y5Z0 2QQNA 5A3NA 1LECA 3EJKA 3M3IA 4P14A 1PIV2 4X6RB 3VDCA 4AHYA 1MACA 4F3JA 2ZGLA 1VMHA 1AYN1 5C33A 2QTWB 5A3MA 2RVAA 3MV01 4IXLA 3NW4A 1RUH2 2HYKA 1ND3C 3OF1A 4FPCA 3T4HB 4AGVA 5DG1A 3H3UA 3M3CA 3VDDB 3QD6A 3VZNA 2ZKLA 3O1UA 1CGPA 2HYXA 3I2HA 2ADEA 3B69A 5AVPA 4FXGB 1RMU2 1AR81 4FVVA 4IE7A 3G7DA 3VUOA 2DV9A 4QPIC 5FYSA 3CNAA 3MLLA 1YC61 3GCXA 5IT6A 1DIWA 2KD7A 1YQ6A 3UKNA 2WO7A 4R4ZA 1H2KA 5L36A 5EFUA 2UYAA 4AAPA 2DBIA 1RUE2 3D6EA 4NVPA 3WY6A 1DHKB 1E5SA 2OVUA 2HEWF 4RR3A 4OI4A 5ERLA 4ZY9A 5BPXA 3OPZA 4QGLA 3WG4A 1QJFA 3CHXA 5JPNB 2WFF1 3KB5A 4EE2A 2G4IA 2XKPA 5E8AA 3ZYBA 1YQCA 3HN3A 2V73A 3CL1A 3IBMA 3JUUA 3QBQA 4LBQD 2YB7A 4QQOA 3RI9A 4E2GA 4N7IA 3P3PA 1UKGA 4I0BA 3CMGA 5IHRA 3INAA 3ZFFC 2YXSA 2FMDA 3IIAA 4P9XA 1ZRRA 5FLJA 3BI3A 4V2WA 3ILRA 3LQCA 3AFKA 4A7ZA 5A6XA 1QJU2 4J6GA 1F35A 3ZKUA 5L9RA 3NQHA 2FCTA 3VHPA 1GICA 1R081 4XJ8A 1TEIA 2QKDA 1RUF2 1RHI1 1XE7A 1PVXA 2WNVC 2WWJA 3T0AA 3ZDSA 2P3JA 1OUSA 1YI7A 3MYXA 1QDCA 4H2AA 1W6NA 5KHGA 4YG0A 1AVBA 1CONA 4D7SA 1CAXB 2FQPA 2I07B 5FXZA 4HETA 2GSYA 1OOPB 4KGGA 3SXWA 1O8SA 3JBG1 2JIGA 4XUQA 3NAPC 2GP3A 3POBA 1QJZA 1X9TA 1KGYA 3NJXA 1V6JA 1YIFA 3RYRA 4BCUA 4Z8BA 3H9AA 1W9WA 1PO21 2BOIA 2VOWA 3HT2A 4BPZA 1HLCA 1US2A 1WCSA 4AVTA 4G9SB 3N4MA 3VKLA 1FNYA 4OI1A 1HXS1 3CJIA 2P5BA 1ZA7A 2LTNA 3LOIA 4LMFA 1YXWA 3VV1A 1UPSA 3QACA 5IFTA 2FDGA 3ZSLA 4MOAA 5JOYA 2JE7A 5I8TA 1VIWB 4CDXC 2RR11 3I2JA 3O1RA 2RDNA 3PMEA 4M0NA 5T55A 5A7SA 2MEV1 5KHHA 1J3RA 1LEMA 3WVJA 5AC92 3ZXJA 3TN91 3O1SA 3GZTB 4XAEA 2CV6A 1A6CA 2RDQA 4ZPIA 3VDDA 3ACGA 3D0JA 4XJWA 5FP7A 2QZ3A 3H50A 4CEYB 5LCWL 3FL7A 1HRI3 5A3OA 3ME2A 4XMAA 3H8UA 4BQ4A 2V5YA 2AYHA 2R063 4RS5B 1ALYA 5I0DA 5JDBA 4YW1A 2YG0A 1HQWA 4OI0A 1MEC3 2XL9A 5F3CA 1IS5A 2D3RA 4G4FA 5ANQA 1H0BA 5I8SA 1N47A 2ZACA 4XUTA 4D8MA 1VJ2A 2ARBA 4Y4YA 4SLIA 3AKSA 1W05A 3E6CC 1EUTA 2A5ZA 3POSA 4GQ7A 5HXVA 1OPMA 2XONA 3PUIA 4JTOA 1TG7A 3GCWA 3VBFC 1V6OA 5ISLA 5F5QA 3T2QA 3HAGA 4XF9A 2XQRA 3ELNA 1XB9A 5FDBA 1RUJ1 3Q8FA 4PIYA 4EV0A 3RZLA 1DQ0A 2OPWA 2RE9A 2DVAA 1HW5A 2HWF1 1W3VA 2IXLA 3NMBA 3ZXKA 5FO9B 1O3SA 1D4M2 4CCCA 2BVVA 2BU9A 1UN1A 2ZGNA 2ZZJA 1OI6A 2F4LA 1POV1 3CEWA 3RQ0A 5T5PA 5BY5A 2WQ8A 5EWSA 1LODA 2EXIA 1A8DA 2PHUA 3GJBA 3LPFA 3UKTA 3DEMA 4NPLA 4IGOA 1GWKA 2YHJA 1ZZ8A 5FPZA 3VB9A 4ZHNA 2BDRA 2XVGA 1ULEA 3WNNA 2PTMA 1COV1 2RJLA 5J1XA 5LW9A 1XBFA 4K40A 1RUI2 1WD4A 4NAOA 4M3CB 4QB1A 1CAXA 2ADDA 4XE9A 5TSWA 4LO5B 2V4VA 3WF2A 1FV2A 3ES1A 1DZQA 1BYHA 2PQQA 1SACA 1VBE1 1K5MC 3HQRA 3VBUC 3POYA 4DUVA 4HVQA 4E4SA 1VRH3 3AZYA 5H9RA 5JR7B 1KS5A 2RM22 1IG0A 4QKFA 2IXKA 3IIIA 4TLFA 4AI0A 4XUOA 3AP4A 4AI9A 1MS9A 4B4RA 5A7QA 1W99A 4AI8A 4QX5A 5LBBA 2A6ZA 4K7JA 2FDJA 2ZS6B 2PHRA 1J1TA 1JU3A 2VZRA 3N9NA 4XTMA 5FZ0A 3Q8EA 4CXWA 2V09A 4CEYA 3SCHA 2P17A 4HANA 2R6QA 1V70A 4ASKA 2XJTA 1W8WA 3C8XA 1US3A 1VP6A 4RS5A 4GIQA 4KH9A 2GC1A 3MW3A 2CTVA 2VMFA 3TEXA 2BRTA 4Q2FA 1EV13 2VPVA 2D3SA 4XVHA 2F6BA 2C1FA 2JE8A 1FMD2 3D8CA 2LM3A 1JXNA 2CU5A 1GOFA 3DXTA 5FRAA 1U5ZA 1CIWA 2H6CA 3BPSA 2EIGA 3R4UA 4E4ZA 3BIWE 4NO4A 3UETA 2JG9A 1VBA1 2HWB2 3POFA 1JHJA 1QKQA 3AXDA 4U2AA 2UU8A 2W0XA 4CYDA 4LLOA 4QDRA 1LOGA 4W65A 4ZZ8A 2IXIA 3P3NA 1U5YA 2WZR2 2XMLA 4IE0A 1RUG2 2DCKA 4MGKE 2Y6GA 4IV3B 4XHBA 1UAIA 4DXTA 3AZWA 2QVSB 2C5DA 3BVCA 3NRUA 4CEWB 1AR71 1UD1A 4JRLA 3LGRA 4PI0A 1NA1C 4D6RA 5JXHA 1UKRA 2ZTNA 2DVGA 2W52A 4X6QB 2C9KA 2WNUB 1GP4A 2YMZA 4I30A 4BYYA 5FOBB 4Q4W1 2SBAA 4NWVA 1F2NA 1UY1A 4DIQA 2YYOA 1QNYA 1D0GA 1VBB2 3WHUA 1W28A 4L97A 3BUCA 2V72A 3J8F2 1LNSA 4HPKB 3WP4A 3MV11 1A8MA 3WQ1A 2YBKA 1D2QA 2DUPA 2ZGQA 3ABZA 3E5UA 1OH4A 3LIGA 4LLFA 4OMCA 5FPVA 4OHZA 1POV0 1E5RA 2WS92 4XF4A 5FMDA 3M7AA 3U4SA 3WQ0A 4AEDC 5KBFA 5GLUA 3T08A 4XACA 1TMF2 3TEWA 4DXZA 3UKVA 1WCDJ 4MXWA 4IERA 1ZBE2 4ASMB 3PVEA 2GN3A 4ARYA 2D43A 1UXXX 3AL6A 2QQUA 2NYYA 4RD7A 4MGQA 4O61A 5B4NA 2RDRA 1QJX1 4LOTA 3DXUA 2WWUA 1EAH1 1S0CA 4PHZA 1LAJA 1NOVA 3KZ4C 3LDKA 3W20A 1F5JA 1MZ6A 1PK6B 1D2SA 1GBGA 1JZ3A 4XJ9A 5DABA 3N7MA 2NZ9A 1NXMA 3MPPG 4IEWA 2VCBA 2VQ0A 1NYWA 4AEMA 2D6LX 2ENRA 2VZQA 3WLUA 1NY72 3ZYFA 3FN9A 3GALA 2UWBA 1O3TA 4GMP0 1N1VA 2W68A 5GLZA 1IQAA 4YG6A 3ZFEB 2PAEA 2QUOA 4ZU5A 4EZHA 1C8M1 4JZRA 4XBNA 1YFWA 3GF6A 1XU2A 4MZUA 1QDOA 3THTA 2ES3A 3KWVA 3KS7A 3WD5A 2O8QA 1BEV1 1GLHA 3ALQA 5LZ6A 1OOPC 5HCHA 4CVUA 1QQP3 2VTFA 2Y64A 1OT5A 2CDPA 2V5DA 4K1YA 1IPKA 4L99A 3UGGA 1UU4A 4P00B 2PLV1 4NJ4A 2WNOA 3NNLA 2Y60A 4GH4A 5JSRA 2JENA 4RHV1 2XDVA 3IMMA 5EQUA 2K2SA 4LK7A 5JXJA 4HVOA 1HDKA 3O0XA 3ZXGA 2E51A 4CUBA 2BUKA 5GZCA 3MZHA 4C1XA 5A1LA 2DTYA 4CP2A 2VAUA 4QKDA 2PQSA 4XJZA 4QGMA 4CU7A 2WNUA 4YW6A 1W2UA 4Y22B 2UYBA 2ZHLA 4Q0QA 4A7YA 5CYYA 2LROA 3GDBA 3LB9A 1EUUA 1AX0A 1IG3A 4BZ4A 1WW4A 1ZZ7A 4LO7A 4X8PA 4E2SA 1ZX5A 2VZVA 5L9VA 1PIV3 4NIHA 4Y3OA 1AL21 2ATFA 2VNRA 4Q1RA 2QQIA 3T30A 5ABJC 5JAXA 5DUXA 3HJRA 1J59A 1W0NA 1WCKA 1RUH3 4NWWA 3V56A 2DUOA 4M4RA 2FZ2A 5IW0A 5A1AA 3FUOA 3GJAA 3MIEA 1RMU3 4FPGA 4M0HA 3VHOA 3H8OA 4MGZE 2QQJA 2WN2A 1TE1B 2Y34A 3JD71 4EN6B 2VMGA 2Y6FA 2R49A 2UURA 2DU1A 1RUE3 5BYNA 3AC0A 4Y1XA 3HNBM 4LJHA 4IV1B 4EZ4A 1H1IA 1ENRA 2A6VA 2QBXA 1YFXA 3EYPA 3UJQA 4FQ4A 5FZHA 4D0QA 4Q4V1 1I1EA 1PX4A 3LCPA 1PK6A 1QXPA 1IHMA 5FPAA 3WP3A 4XIKA 4L92A 3VBSB 4Q4X1 3V0AB 1RYYA 4UOJA 3WCRA 4P9YA 1PMJX 1ULCA 1UMHA 3VDAA 3IPVB 3S5QA 1E5HA 5JR2A 5K9YA 2VH9A 2CL2A 4K21A 2IZWA 3JQXA 2Q1FA 1QJX2 3KV4A 4COYA 5JI9A 4OUEA 3NV2A 2W3JA 3MIFA 3OD0A 5IK7A 2VTXJ 4XF0A 5JZGB 5EPAA 1RUNA 1RUF3 5J96B 5CFCA 2E7AA 1DP0A 3SH4A 4ORFA 1MS5A 1HRV1 2BV4A 2ZKNA 4QQLA 1VBC2 5BNNB 5LWBA 1JHNA 5J37A 5FUPA 1RUD1 4BIOA 1HV0A 1OHFA 4A41A 5BNPC 2EA7A 3V65A 1ULPA 3E6BA 4C90A 3C2UA 3EO6A 1BMV1 3O0WA 4AEKA 4FOVA 2W1QA 5ANNA 4Y22A 5FR3A 1RIRA 1LOEA 3C3VA 2VUAA 4XFAA 5HI0A 5IK8A 1B09A 3RI8A 3ACLA 4UW3A 4OYUA 5LA2A 5LBEA 4CDWB 2CWSA 1R64A 3GM8A 3AXEA 2D98A 5LRSA 1NG0A 3ACFA 2GU9A 1TVGA 1ULGA 2B46X 2BPA2 3OCPA 1JUHA 1MS8A 2PLV2 5FZKA 5AC93 1R1A3 3W59A 3OBRA 5DN2A 1OA3A 1BK1A 3QH6A 1PGL2 3KGLA 3NV1A 4H3WA 4YYOA 3PVOA 4XFBA 3U10A 3LA2A 1J84A 4OMDA 4A6OA 5JOZA 1XU1A 2WINB 1BBT3 1C5HA 1UIJA 3N9QA 3KSCA 1T6BX 1UIKA 4N53B 1XOYA 1V9U1 4NIIA 3NNFA 3EQEA 2PHTA 5D8AB 1HB1A 1XNDA 5FJHA 4EN9B 1NCQB 1PGW2 1OC1A 2KM2A 4A42A 1O7FA 1X36A 2XVKA 4KBZA 1W6MA 2ZMLA 4IV1A 5FZ6A 5BXXA 5FKCA 5HXMA 2DURA 2A75A 2ERFA 3JZVA 3LD8A 3HQXA 3KF3A 3B01A 4JAAA 4DY5A 4YZ2A 5I91A 2WUHA 1NX9A 3LEMA 1Y7BA 2YU2A 3IDCB 2Y6KA 4IV3C 4AQTA 1C28A 2IVJA 2JD4A 5T5LA 4QM9A 3ILFA 5C8CA 4CEWC 4NPRA 5I93A 4QHZA 5FZ3A 1AXZA 1DGRA 2PAMA 5DPNA 5HBAA 1MR5A 4PDWA 4BQ3A 3VBOB 3WDWA 2QQOA 4CE8A 2FMYA 2OA2A 4N43B 3BN6A 1SCSA 4IGQA 2I2SA 4AI1A 3QOPA 1CJPA 4WBBA 1LGBA 3D4KA 2VMEA 4PBPA 5JZGA 1UPIA 4R4XA 4QPGA 1NQJA 4XJAA 3ZDVA 3CZJA 4CDUB 2OUHA 3FE5A 3ATGA 1W6QA 2D5HA 2EALA 2VGDA 1HKDA 2UY9A 1W0PA 5BNNA 3BB6A 4Q4X2 1RUI3 2OKXA 3IWZA 4QQPA 5T54A 1SCRA 3MFAA 4LT5A 2TBVA 3BU0A 1V6NA 2VZTA 4BK4A 5IVYA 3UNPA 4AFDA 4GAZA 4CCNA 2PHLA 2DUQA 3DPRB 1DGLA 1OMIA 2OIIA 4LIVA 5FY1A 2PELA 3WDUA 2QQMA 3IB3A 2MHFA 2WO2A 2O14A 3MEPA 3PIGA 2Y8KA 4LBMA 1SLBA 1IQDC 3MIBA 3VKMA 5JSPA 5EHDA 4JCKA 3CKHA 3MFCA 4FFFA 2ZX0A 4GZ9A 4DRVA 4RL7A 5KC6A 1AUYA 2Q8OA 1RHI3 4E27A 1YO8A 3UGHA 3IAPA 2QJVA 3SC7X 3TOJA 3LA7A 1LB2A 1GANA 5C6CA 1Q5OA 2EXJA 5CVRA 1XYOA 1RUD2 4CRQA 2A71A 3JBG3 4PIZA 1UZ0A 1QF3A 4BLIA 2KA3A 4ES8A 2WLQA 4BQXA 2W46A 1PO23 1SBFA 4A44A 4QXHA 4N53A 3HNMA 3ZFEC 1PNFA 4GWMA 5FZBA 1TME1 2BBAA 2YC4A 4KWLA 5D8AA 5A3UA 4CZSA 2VY0A 1NCQA 1HXS3 5LRRA 2WNEA 3FFQA 4Q1PA 1W2AX 5I0TA 3PHMA 4UBHA 5KXDA 5FY5A 4LKFA 4IEYA 1FMD3 2BP6A 3HMYA 2VG9A 1QJEA 4JKKA 1BCXA 4YARA 5FZDA 1S0BA 1REEA 2MEV3 4DPNA 3OBZA 3TN93 2RS32 3LIHA 2WSVA 2J1UA 2O1QA 5L73A 4P9WA 4CPBA 2YPJA 1VB2A 5EXOA 2ZHMA 5FYMA 1OFSA 4R9DA 3MI8A 4YW3A 2WZR3 1RUG3 1HB3A 3MIGA 2AUYA 4MV2A 4B29A 4RR3B 1ACCA 2XH6A 3VBOA 2ZX3A 3ETQA 4R9AA 4AAXA 2K0GA 2DF7A 4IEXA 4N43A 2HWE2 5GZEA 4YGDA 4LUKA 2A7AA 2Z79A 3M3EA 4XYXA 3FBMA 2VW0A 4AZZA 4GB32 4HLTA 5C3QA 1KFUL 5DAVA 3DYOA 4S2HA 5DXDA 3AKRA 1LENA 4CDUA 2XG3A 4QX8A 5C3RA 5LEKA 1K12A 1YRZA 3WQBA 1HN1A 2P6CA 5C5UA 4WVMB 3SMHA 2FDFA 3K75B 4B4QA 3J8F3 1UXZA 2OZ6A 4MGSA 5EZWA 4AHZA 1UYZA 3LAGA 3VBHB 5DMYA 2ZAAA 5FP8A 3KQ4B 3DPRA 3ZYHA 2ZXQA 2WS93 2D97A 3NNGA 5DUUA 5FQ0A 1O3RA 2EXHA 4YW5A 1POV3 3LFMA 4FPFA 1TMF3 2LS6A 3AKQA 4Y1ZA 2EIDA 1XNBA 4AVVA 2FDIA 4IV1C 5I0UA 3WW3A 5IVEA 4IEPA 4I2OA 1X50A 4DQAA 1AR91 3LPGA 2Y6LA 1HJFA 4LIUA 3THPA 5L7OA 3TEYA 3AM2A 4KI5M 1OD3A 1TZOA 3T2PA 2J1EA 3FLTA 1JYTA 1JOPA 2JKBA 4PF1A 3VBSC 4HKWA 4NRMA 5AVAA 1CR7A 2R071 3KCXA 2VCAA 5BUVA 5FXXA 5LB6A 5CG9A 4ZS3A 1SDWA 1FXZA 2WR9A 3GZEA 1FPN1 3MPBA 4XMIA 3LWCA 4NOTA 5FLIA 5FP9A 3ZN5A 1OF4A 4JDOA 4XQ4A 4K8FA 4LKSA 4FTEA 1UW8A 2VZPA 3VL8A 1S2EA 4MX3A 3ZX7A 2DBNA 5FYHA 2XR4A 1YQ5A 1V6LA 1CD3G 3HR9A 1H4GA 4Q0SA 4AGGA 5FWJA 4FPJA 3T1LA 2VVFA 4W4ZA 4XUNA 3VZKA 1W3XA 3H3ZA 5IYYA 1VBD2 4GMP3 4BIFA 1LHOA 2H6BA 3E5QA 1RC6A 3E6DA 4CP0A 2DVFA 1VAVA 4IL7A 4LO8A 3OEBA 1LULA 4RFRB 1TNFA 4XETA 1EYBA 4JX0A 1DF0A 4D3WA 2ZGKA 1F9KA 4XDPA 2IXHA 1XYNA 1O8PA 1I6XA 1PVC1 1AR61 2ZGMA 1DGWA 4JHZA 4UF0B 1W04A 3J26N 5BNOC 1S0JA 4EJRA 1TME2 2R16A 5A32A 4XFCA 4ZXEA 3WV6A 4D94A 3MF9A 1DCSA 1QJY1 1YJLA 5LBCA 5C3SA 5FOJB 2Z4FA 2WZPP 2DCZA 4WV8A 3WNKA 4BMEA 1V00A 2XLFA 4YZ1A 5CADA 2FD8A 4LHNA 4CDWC 2OYZA 1GQPA 1OKQA 4GD4A 2ZGTA 3O0VA 1GR3A 3I3QA 1PM4A 2IXCA 3O7OA 2LALA 1O59A 2CY6A 3MDPA 4H7MA 4COZA 2GDFA 3PUSA 2R30A 1H2MA 2YY1A 4AEJA 1XJAA 3TNPB 1F5FA 3C7EA 4WVMA 4TZDA 4UFIA 3NV4A 4AVAA 4ZKTB 5LA0A 4MLOA 2JDUA 3SEPA 3VBHA 4CP9B 3I49A 1K5JA 1V6KA 2ZMKA 2XVLA 2ZJCA 3RRDA 2Z42A 1MVEA 3AMHA 4ZONA 1RINA 4Q26A 5IVVA 2F4PA 4GJZA 3FHQA 3VD4A 4CA9A 2ZOEB 1AR73 3OJBA 1KS4A 2Z5WA 3RZKA 1B35A 1RVF1 2ZX4A 4UFKA 4YVSB 5DAXA 3S30A 3M4FA 5A1FA 4FT8A 4MUVA 1Q3EA 1OH3A 5GLTA 3WQ7A 1MS3A 4DB5A 4CCLA 2UWAA 2ZHNA 3IN9A 2JEMA 1UCXA 3J7LA 5C9AC 2PAKA 1BZWA 5FAXA 3ZXAC 1ZRIA 3X29B 2WQ4A 1S0GA 2J1RA 2ILMA 1VMJA 1N1YA 1JYCA 4FOWA 4LKDA 1MS4A 4UBGA 1W9FA 5CU1A 2HBUA 3UT0A 3ZXDA 4ZU4A 5FIXA 3KV5A 4YZ5A 3TEZA 1UYXA 2OUJA 1W2OA 3I3MA 2BW8A 2HWC1 3NWKA 4QX2A 3OSDA 4HVRA 5FBJA 3SEEA 3ZXLA 4OVEA 1NXD1 3PURA 2X09A 4AVCA 1JU4A 3O1VA 1D7PM 5DZFA 3VLBB 3BIEA 2ARXA 2J22A 4AG4A 4Q8KA 2FCUA 3RMXA 4B8EA 1QH7A 2W95A 4YPJA 1QJX3 1R1A2 1YCIA 1C4RA 2D3PA 2Y26A 2CHHA 2HLEA 3PMSA 4B1MA 1DYOA 3GNEA 4H14A 3SH5A 5ACA1 3CLPA 2J1AA 2BYVE 2R072 5G04L 4ES9A 3BTYA 5APAA 1PGSA 3I3EA 1BBT2 1W2TA 4P08A 1HIXA 1KEXA 3ZYIB 1FPN2 3M2MA 3Q8AA 3PUAA 4RN5A 5L19A 1VBC3 2BGPA 2C26A 2QQVA 4KWUA 4ZS2A 3OBTA 3WNXA 1VAKA 1P8JA 4UF0A 5T52A 3NSTA 1LOFC 3PTYA 1AJKA 2W87A 4QHBA 3RWNA 3B93A 2BERA 4XBQA 1SG3A 3GBFA 2RDSA 2R041 1AF9A 2BVBA 5CFDA 2DTWA 4YG3A 2CYFA 1CWPA 1AYN2 5GZGA 1IKQA 5KHJA 1FAYA 4E8CA 2Q5TA 2VMHA 4O65A 2RS11 2XL7A 3W9AA 5JXIA 1JN2P 2JG9B 4ONUA 1NQDA 2JDNA 4XJUA 2HKXA 4GALA 1AR82 4W6XA 1WZXA 2AC1A 3AP5A 1OLME 1KDKA 1ODMA 2D6OX 2QFEA 4ISQA 1N3QA 1IS4A 4AGRA 4UFHA 2WWSA 5A80A 4EWAA 3B00A 2PLV3 4CCJA 1WA4A 3C7OA 4NRQA 3H1YA 1GP6A 1O5LA 1YFUA 4TWTA 1QJY2 3J4UH 4XDOA 1ZM1A 1DZTA 3JB8A 3RG0A 3ACHA 3EMRA 2VZUA 3I2KA 4QHOA 4YVSA 2WFF2 4OI2A 4QB6A 1C57A 1XSQA 3W5MA 1U12A 4MG2A 3NVCA 1HJGA 3IDEA 5H9PA 3KHCA 2D6PA 1AZDA 2BNMA 1FV3A 2Q1ZB 4XZUG 2VQUA 5KXEA 4FO9A 1Z7S1 3VBRB 3O1TA 3B9IA 4RYDA 1H2NA 2AEYA 4DRRA 5KXBA 1AL23 4CDQA 3J9SA 2YU1A 3N3HA 3UL2A 3SLIA 2E7QA 3D0SA 3EXUA 2QQLA 3H7YA 5LBFA 1G9CA 2VXJA 4OULA 3FBYA 3OGSA 5CEHA 4RR3C 3C7FA 4YM3A 4MXWB 5IK5A 4KWKA 3AZVA 3K2OA 5T5OA 4MYEA 1R082 2BZDA 2VQTA 4RSUA 4RQPB 1RHI2 1TQ5A 2DWRA 2D6NA 5D21A 3HD8B 1UF2C 1Z78A 3ON7A 1VMFA 4XBLA 4BQ1A 1WBFA 1BXHA 3I3BA 1JI6A 2GH8A 3I4IA 4FFHA 2X53S 1J1LA 1JH5A 4KBBA 3ZPYA 1XNTA 3JBG2 5FY8A 1A34A 2YFZA 5JXGA 2Y0IA 5C70A 1GQHA 1CZSA 5FO8B 2JIJA 4Q4V3 3C7HA 4PIXA 1PO22 4PLNA 1U5XA 1FI2A 2DCTA 4MVTA 5FKBA 4N9HA 4Q4X3 1GYKA 1HXS2 4LBJA 4M3CF 3POJA 4LHSA 3B94A 3RSJA 3OGRA 4F7ZA 4IDZA 3H1MA 1KFXL 1RJ7A 3MLKA 1FT9A 3A4UA 2RR12 3RZGA 1NE6A 2JICA 3KT7A 4YVWA 2PXJA 1W9YA 3HNYM 2MEV2 1SBEA 3MGUA 2VBPA 5EP9A 3AYDA 3TN92 3OB8A 3WF1A 3URFA 1WW7A 3AKPA 1LRHA 4CCKA 3ZVXA 1H6YA 2W92A 4LORA 3L2YA 1APNA 2HBTA 4OHVA 4GH4B 3VDBA 3VZMA 1OQEA 5K4LA 3ZKYA 1HQLA 2JDHA 1NCRA 1RUD3 3CJIC 1OLMA 4IEVA 1ND2A 4IESA 1WWYA 4LKEA 4W8JA 4QWNA 5A7OA 3ZYGA 3ZXFA 4EWDA 1UY4A 1JZ6A 2FZ1A 4YM2A 3N9MA 3WEZA 4M01A 3OYWB 4NHKA 4CU8A 2VBBA 2VNVA 2VD7A 1MZEA 3B02A 1RUJ2 1UOGA 3AK0A 2JECA 2PMWB 5FYCA 3UV9A 3VDDC 3UYJA 5FYTA 4L0PA 2HWF2 2YC0A 4PT6A 4U36A 4R9CA 3VBRA 5JUVA 4FP2A 3TYJA 4FOQA 4Y1VA 4DXSA 5HCFA 1NE4A 2PHWA 1UX6A 4JRAA 5JMCA 1W6OB 2RS33 1OQ1A 2VMDA 2WRAA 3NJYA 4GJYA 5DQ0A 2EICA 3PNAA 4N90A 5GLVA 5LEJA 1M06G 4QXBA 4BU2A 4RQPA 2BTVC 1GQGA 4CU9A 1YNAA 1V9U3 3FFZA 5F37A 1PZ8A 5HV0A 3BOWA 3DV8A 1COV2 1CPNA 4QDSA 5FYIA 5LY1A 4V1PA 4Z82A 4BH9A 1VBE2 4KQ7A 5DAQA 2ARAA 4P9JA 4CTEA 2I74A 4KG0A 3LEKA 2WT1A 3JB4C 2HWE3 4XFFA 1CZVA 1SQ4A 4IUGA 2A73B 4UW6A 4GB33 3Q8BA
chains in the Genus database with same CATH topology
5E89A 1MZ5A 4Z07A 1O4YA 4WM7B 4JQRA 3W58A 3OY8B 2JXAA 4MH0E 4IQPA 2D7FA 1YUDA 4META 1SLTA 5JIAA 1F8VA 4P9IA 2I45A 4HN1A 1CAUA 5FMOS 3WX5A 1HRI1 5FMOL 2B8MA 2X5IB 3BTAA 2R061 3RDIA 4MSVA 4LBKA 5CFCB 1MEC1 1H4HA 5C4WA 3ZMOA 1BQPA 3FX3A 5EV7A 1QWRA 1OFNA 1YYNA 1CAWB 4O9EA 2ZGRA 2HWD1 1H8TA 2VU9A 2DFBA 3FZ3A 1BVP1 1R091 4HSLA 4WM8B 2GC3A 1OA2A 4LO6B 5J3UA 5DDJ1 1VR3A 3OYWA 2ZGOA 3H1WA 3V0BB 1VBA2 1XYPA 2WT0A 4EN7B 1PMIA 4CEYC 2WFPA 1VBD3 1IKPA 4RS5C 3WW4A 3ZMNA 4K9SA 1SEFA 2GNMA 1QOTA 1AR72 2VOXA 1W6OA 3T2TA 4J1WA 4Q0VA 4Q4W2 5J36A 1H9WA 1BKZA 1HX6A 2BFUS 4Q0PA 1TME3 1W6MB 4Y20A 1IPJA 5CG8A 2BFUL 2JG9C 3E97A 4E9KA 1A3KA 5I8YA 1VRH1 4LE4A 1H30A 3AKTA 3R0RA 4P5HA 2JX9A 4K1ZA 4QQHA 5C8CB 5B2GB 2VVEA 3NV3A 4WM7A 4FTSA 4HL0A 3OY8A 3U4XA 2NMNA 3K51A 5T5JA 1AXKA 5DZEA 2RS51 4PDWB 2R0FA 2B5HA 4W6YA 4JDNA 4LHLA 1W39A 1KRIA 1EAH2 2P3KA 1KJRA 2X5IA 4QPGB 3G6JB 4XIOA 2QDRA 5JWPA 1W6QB 2XUMA 1H8VA 4QQ2A 3RNSA 4OUMA 4D69A 3CO2A 1CAWA 4JGYA 1IZ3A 1KXGA 5CIRA 1URXA 3IKWA 1LOBA 1XNCA 4AWDA 4Z1VA 4S2GA 4KU8A 1O91A 1C8M2 1VLNA 4WM8A 3TWIA 4Y1UA 2NMOA 1DQ5A 2ZMNA 3WG1A 2H0VA 1PM7A 2VW2A 4MXVA 1WD3A 1BEV2 1DYKA 2RMU1 4NN0A 1ND3B 3AYEA 3V0BA 3N7LA 1ZBA1 2PHXA 4AHWA 4ZU7A 1A78A 1H9PA 4DNYA 2EAKA 3CJXA 2G9GA 4RHV2 2VW1A 1G9AA 2HWD2 1GZWA 2R073 2Z69A 1GV9A 1R092 1CQ9A 1SFNA 3AZXA 1FPN3 1KJLA 1QMJA 4HKOA 1AX1A 4URTA 3GHNA 4FBFA 3SNMA 1W6PB 4XFHA 4H7LA 1AL22 1ZYBA 1AYN3 5K0UA 4AE2A 4IEUA 4Q27A 2VNGA 3ZXEA 1DQ1A 3ZFFB 4GH4C 3WUCA 4ISRA 1SLCA 1GZ9A 3AMPA 1ONAA 5K7PA 3ZFGA 4GULA 1ZRDA 2PA7A 1AR83 1QOOA 3BALA 3EBRA 2P37A 4AFMA 3ZN4A 1WW5A 1YLLA 3ASIA 2AH2A 2BWAA 4QM8A 3WZ1A 3FJSA 2WNUC 2GZWA 4GA9A 4RA0A 3JD72 3GBWA 1RL3A 3AFGA 4KU7A 3KGZA 3LKJA 4AVBA 4QPYA 2VQAA 1QJY3 3H7JA 4PF5A 3WW2A 3KD4A 4KNCA 4Q4V2 2WFF3 2UWCA 3NAPB 2O8OA 5JSOA 1SLAA 2WA3A 4AFBA 3M8LA 3N35A 2CGOA 1IGOA 4IETA 1Y3TA 4BOWA 4FAGA 3SISA 1XXNA 4K6BA 2RS52 1GZCA 5FQ0B 5FLHA 1ZVFA 1QY4A 2GMEA 2XLAA 1WMDA 1GFF2 2B9UA 1QQP1 4CDXB 2XB6C 2RJKA 4GKYA 4KGQA 1R083 1FOD1 2R0HA 3PLQA 4XXAA 5KWRA 1XRUA 1ND3A 4F8AA 1CX4A 2DVDA 3V64A 5L7OB 3UJOA 1PK6C 3N7KA 1HRV2 5E88A 5I0SA 2XJUA 4I0WB 3SITA 1J58A 1G7YA 4LA2A 3NJZA 1XQNA 3IMNA 1BMV2 4FP3A 2GNBA 5CA6A 3ROUA 2HWC3 1PIV1 1U0AA 3PJQA 1EP0A 2BGCA 3VBFB 2NM1A 2RMU2 4PBOA 1W6PA 2VUJA 1QGLA 5CFCC 2K9ZA 2RR13 4Q0UA 2GMPA 1RMU1 5DUWA 3JCIA 2GNDA 4QD2A 1WBLA 3ZFFA 4PCRA 2EVXA 4I02A 4D7TA 5D1IA 1KQRA 4W6WA 2AGSA 1RUE1 3FMGA 1V9U2 1YHFA 4WM8C 5H9SA 5A32B 3ZN6A 4L9BA 2GC2A 1LGNA 3ZSMA 1RJ8A 2P34A 4E2QA 3QLQA 2QCSB 4FOYA 1X8EA 5A33B 1PO11 4HFSA 3AP9A 3HWJA 3USSA 4BM8A 3RYKA 4DINB 2ZX2A 3NAPA 1L3JA 3VBUB 2GC0A 3VHNA 1RUJ3 1DDLA 5E16A 2R1BA 3GZAA 3WDXA 2HWF3 1O4ZA 1DBNA 5BNQA 1QJU1 2JE9A 4FQZA 4C0HA 1ZZ6A 1RUF1 3WCSA 3D5OA 1B35B 1SLLA 4CDXA 2VULA 1RTVA 3L2HA 3O14A 1ZZCA 5GM0A 1AXYA 1RUOA 3MICA 5FO7B 2QDNA 1F31A 3KQRA 1RITA 1RUC1 5H9QA 1COV3 1AX2A 4XQWA 1QNWA 1WLCA 4XW3A 5C8CC 1DGRN 2MNGA 3WOGA 2WC2A 4JGZB 4LNVA 1VBE3 4QGNA 3QCWA 2XJVA 3MF6A 2W39A 1OA4A 1X7NA 4PDWC 3DKWA 1YI9A 2XHKA 1YWKA 1Y9QA 4GWNA 3H0OA 1DQ6A 3VBFA 5JZGC 4FPEA 4QPGC 4DY3A 2NPIA 1KITA 3AYCA 1JUIA 1JYIA 1SLIA 5BNNC 1BJQA 4RFT0 1NLSA 2WL1A 2WSUA 5BV6A 3M3OA 1N1TA 3VGIA 4K20A 1M4WA 4ATFA 1NA1B 4LUMA 4BLJA 4DS0A 2XJQA 1N3OA 1LJ7A 4YGCA 5CFDB 3OGJA 4Q4Y1 1Q43A 5A33A 4PQ9A 4G3YC 4B3NA 4OZXA 2ZGUA 5AFEA 4XILA 3ECQA 1D4M1 1C1LA 4GXLA 1K5MA 3RMYA 3VBUA 1VBA3 2XWBB 4AEDB 4BHPA 4KWJA 4UW4A 3TB0A 1QH6A 3USUB 3DL3A 5GZDA 3ZO0B 3VL9A 3AYAA 4LTAA 4N53C 3RJ2X 4FPHA 2FHRA 5D8AC 3BU7A 3VHRA 2VECA 4I0AA 1NCQC 4YZ4A 4L2NA 3KCYA 5DZGA 3KT1A 1DQ2A 1WMEA 3IT8A 1CPMA 1PO12 1JBCA 1RUI1 4Q4W3 5KC5A 1NLRA 4YW2A 4YFZA 2XBO1 1R1ZA 1GNHA 4HN0A 4CDQB 4FTBA 5FFOC 1KD7A 4JGZA 4JDMA 2RM21 1D0HA 1JTZX 4BMBA 1LGCA 2FBEA 3VBOC 1AYM1 4H55A 5LK7B 1OSGA 3CU7A 1EY2A 4LA3A 4NHLA 3E5XA 4N43C 4WVZA 2IWGB 1PHMA 2ET7A 1AR92 1QOSA 4XF1A 4CDUC 1RUC2 4XXPA 4LBLA 4LBNA 1EAH3 4L8QA 2Y0OA 4AQSA 1Q8PA 4IEQA 3GZUC 4YM1A 3APBA 3FWEA 2GAUA 5EYXA 2EF6A 3WG2A 3RS6A 3DPRC 2CNAA 3AB0A 5T50A 1NA1A 2DU0A 1FMD1 1WGPA 4Y24A 5HCBA 2LUWA 1UZZA 1PNGA 5EJ3A 4YVWB 1EPWA 5KHKA 4FPYA 3Q9OA 3M1HA 4WZCA 1C8M3 1X33A 5L7OC 2HWB1 1T6GC 1ASJ1 4BA6A 5ABJB 2GN7A 1BEV3 5CNAA 2WZR1 5IUQA 4C1WA 1RUG1 2WQZC 3TNQA 2CGPA 1D4VB 4AEDA 1LHNA 3KLSA 1PVC2 2ETEA 5EYYA 1AR62 3S0MA 3USUA 3LA3A 1NCRB 1QXRA 3ZIWA 4LE3A 4RHV3 1ND2B 4WZFA 2UY8A 2ZX1A 2TUNA 4TSVA 5J7MA 2HWD3 2YDEA 3OGGA 1Y43B 2XGXA 1AJOA 1MZFA 3WDTA 3NL1A 1R093 4Q4Y2 1VBB1 2H0BA 3GBGA 5FPXA 1SMVA 3GYDA 2PFWA 5T3NA 3B7MA 3J8F1 4F83A 1IS6A 5DDJ3 3IM0A 1YIPA 4YLZA 1PZ7A 2DFCA 2WS91 2QE3A 4YW4A 2VMIA 4EN8B 2HJIA 1TMF1 2QZ2A 4J1XA 1ZBE1 2JDZA 5FREA 1WUVA 1H1AA 2YGMA 1LHVA 4HMZA 4M3CE 4NR1A 4OHYA 1IS3A 2Q4SA 1CVNA 1RVF2 3TRSB 3FLRA 3UK9A 2GALA 3JD73 1OOPA 3WG3A 2XBO2 3HN1A 3ZSEA 5CB7A 3AMQA 3VBHC 5K8SA 1MQTB 5BNPB 1NY71 2VOVA 4AYUA 2HWC2 4OHXA 1AYM2 4EROA 1LCLA 4GMP1 4LBQB 2GH2A 1B35C 5J48A 2WLPA 1CAUB 1S2KA 2RS53 5SV5A 4LBOA 2X8KA 4XEZA 4XFGA 1YJKA 4I09A 2E63A 2XKOA 4EN0A 2ZBJA 3ZIXA 1S1AA 1KDMA 5ACA2 5ABJA 5C4WB 4JGZC 1C8NA 1JW6A 1HRV3 1ZZ9A 3VKFC 2QNKA 1H8TB 1V6IA 2R042 2RHPA 3LSDA 3VZLA 3BPZA 5JOWA 1VAMA 1DYPA 1JOJA 1DG6A 2ZCWA 2RS12 4UXAA 1CJDA 4GKXA 4HK9A 4QMAA 2ZPXA 4YZ3A 2D93A 2IFWA 1ASJ2 1S55A 1WW6A 1OPOA 2RMU3 3TAYA 3IDBB 1UZYA 2JG8B 3LZZA 3OTFA 4HBNA 4HK8A 4LR4A 1ZBA3 4YSFA 3AJZA 1ENSA 1Q56A 4PLMA 3M3QA 1NZCA 1ENQA 1RGSA 2NN8A 1GNZA 2Q0AA 3FHIB 3OD4A 3ES4A 4AQ2A 4FAHA 5CFDC 1LTEA 2BWCA 4FSJA 4YFWA 2IXJA 1G6NA 4Y20B 4M3CA 5DG2A 3S7EA 2ZA9A 1SBDA 2B39A 2DCYA 4CP1A 1FNZA 3U0ZA 1Z7S2 2A3XA 3AMNA 4YGBA 1DLLA 1Z0HA 3FLPA 3FC0A 1DGWX 1MS1A 1I3HA 3HT1A 3S6PA 2YROA 4KG8A 2BBVA 1MQTA 1J3QA 2ZAHA 5BNPA 4X8NA 4OHWA 1MS0A 1S0IA 2A3WA 2A70A 2PHFA 3I54A 4LBQA 4YVSC 5JCTA 2HEYF 1LU2A 4S2DA 1O4TA 1W0OA 1ULFA 4ASLA 2ZHKA 2OW4A 4LO4B 4Z92B 2NLRA 1VBC1 2E53A 1I5ZA 1Q8QA 2A6YA 4CDQC 1RB8G 4P9LA 4XDQA 2C9AA 1BVVA 4JGYB 2R32A 3DN7A 2AR6A 4A7KA 4S2FA 5F6KA 2XJRA 1ZA4A 1GSLA 1UU6A 2YV8A 5J98B 1Q8SA 4LULA 3ZYRA 3WP6A 3B9CA 3VKNA 3R4DB 1FOD3 4JTNA 5JLVA 5KXCA 2JG8A 4IV3A 4ITCA 1PGL1 1MVQA 3AP7A 4CEWA 4LHKA 3SCFA 1GZWB 1QU0A 1VB4A 1CESA 1HV1A 4I3PA 2PN5A 2X29A 1FATA 1UL9A 1PGW1 3R05A 4ATEA 4HZFA 4AXOA 2P3IA 4O9GA 4YVWC 3VZJA 1OD5A 4AVSA 4L11A 3PVNA 4INDA 4JVAA 1LHWA 2D40A 4HPKA 2DCJA 2HEVF 2KXLA 5K0UB 1SFYA 1O3QA 2A3YA 1LESA 1G86A 3ZFGB 1NCRC 3BCWA 5JVVA 2AREA 1ND2C 3WDVA 4Z2WA 3ZYJB 1J3PA 1LU1A 4IEOA 4XPVA 1U5IA 3A0NA 5J09A 3RYPA 2MPFA 4DZGA 1X82A 4R8HA 3I7DA 3K48A 3VBRC 1PO13 5F9TA 4COVA 2XLGA 5FTTC 4Q8LA 2ZABA 3DGTA 1EV11 4MGIE 2A6WA 4COUA 2G9FA 3ENRA 2R1DA 1UMZA 2Q1MA 2GMMA 3ZFEA 3RPQA 4IEZA 1I9RA 4RQPC 1LOAA 1QJU3 3KM5A 1H2LA 1XE8A 2YUEA 4RGAA 4WVWA 1G8WA 1HRI2 5LK5A 4R9BA 4N7UA 2CAUA 2D6MA 3N7JA 2R062 3A0KA 4AW7A 3HIFA 2XWJB 4XTPA 3NKGA 1MEC2 1LEDA 1TNRA 1S0EA 1AR93 1RUC3 1DFQA 4QPIB 2N7GA 1MQTC 3I2DA 2D6KA 3S7IA 5FBZA 5BNOB 2WT2A 1G9BA 1GKBA 1QHDA 4AFAA 5SV8A 3D82A 5DDJ2 1UU5A 4AI2A 2XPJA 4E4DX 4JC1A 3PVBB 3WT3A 2TEPA 3KT4A 3ZYPA 1OLQA 2ZGPA 3I8TA 4XOGA 4N9IA 4MGYE 5C4WC 2BNOA 2RS31 3DF0A 3WINE 4AI3A 4COWA 4AHXA 3O5SA 3MIDA 3PJYA 1N3PA 4JV4A 1FX5A 1H8TC 2WIIB 3AX4A 1S0DA 2B45X 2DYCA 3O12A 3SH3A 1AHSA 1N1SA 1PVC3 1PZ9A 3ZN6B 1AR63 3RJRA 2D44A 4YGEA 2WNVB 3DUIA 2HWE1 1REDA 1X8MA 5JI7A 4B7EA 3SHRA 1REFA 5C9AB 2XJPA 4GB31 1LR5A 1S2BA 1QXJA 5GALA 2B42B 5C8WA 1VRH2 2BEOA 3MW4A 4Q4Y3 2Y38A 4C0BA 2JG8C 3NKTA 4R52A 3VBSA 3V0AA 1G9DA 3QH7A 4HKLA 1DQ4A 3AZZA 1LKNA 1ZREA 1WLDA 2NP0A 1D4M3 4OLLA 3IPVA 2WJSA 4FPOB 5E1RA 3U11A 1OLRA 2JJ6A 3B5LB 5KHIA 1Q8VA 4SBVA 3RZZA 2NQYA 2ET1A 3L9JT 2VVDA 3U07A 5CBLA 1WLTA 3BOPA 3WUDA 2SLIA 4QXKA 4AFCA 3HBZA 4BWOA 1LHUA 3AMMA 4A3XA 2O0OA 1RVF3 4I3GA 3MLJA 2VXRA