4FRQA

Crystal structure of bbbb+udp+gal at ph 9.5 with mpd as the cryoprotectant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
278
structure length
277
Chain Sequence
VYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISACERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 277
sequence length 278
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4frqA00
1O7QA 3SPTA 3POLA 2P72A 2V0LA 5C3AA 5C4BA 1H7LA 2RJ9A 3RSBA 2RJ0A 2RJ7A 2VS3A 4LW3A 2OI5A 2GGOA 4AYLA 5FYEA 4HO2A 1G9RA 2XWMA 3ZLLA 3PKPA 2FY7A 4Y9XA 4D48A 3SXBA 2PX7A 1FRWA 1H7EA 2FYCB 2DPWA 1QWJA 3V0OA 2I5EA 2XWNA 2AM5A 2O1FA 3CKJA 4P00A 1VGUA 3U2UA 1INJA 1G97A 1VPAA 3U0YA 1YROB 4LW6A 1FR8A 1R7XA 5HS2A 4FQWA 1G0RA 2VFZA 1W57A 2I7BA 3HL3A 1INIA 4YS8A 1H7GA 1OQMB 2Y4JA 1YP4A 3OH3A 1LZJA 2X5SA 4EVWA 4NANA 1ZIZA 3D8VA 1HM8A 4EE3A 3TQDA 2OI7A 4Y7UA 4D0TA 2XWLA 5CQOA 2FYAA 5BXCA 3OAMA 5L6SA 4B4MA 2YQHA 1V82A 1W55A 4NALA 2AGDA 3R2WA 2WGZA 5JQQA 1XHBA 1ZCVA 4AC3A 2PA4A 1ZCTA 1LL0A 1FWYA 3CKVA 2P6WA 4FRAA 2RJ1A 4CVHA 5CMGX 2YESA 4Y6NA 2QKXA 1G95A 4Y64A 3I0HA 1FO9A 1KWSA 4M4KA 1MP3A 3K8EA 3E25A 3T7OA 3Q80A 3V0LA 1ZJ0A 1TW5A 5C1HA 4J18A 2VSIA 3CKQA 2Z86A 3I0JA 3OH4A 4ZDQA 4Y62A 1FGGA 1R7YA 3IOHA 1WSZA 1EYRA 1S4NA 1H5SD 1G93A 1ZI4A 5C1GA 2WVLA 1S4PA 1SS9A 3PNNA 2Q4JA 1FOAA 1EZIA 4JD0A 1FZWA 4HG6A 4BMAA 4D11A 1VH1A 4MNDA 4KC2A 4D11C 1ZDFA 1R82A 1JVDA 1ZJ1A 1R7UA 1ZI1A 2AE7A 3DK5A 3E26A 2YC3A 3SX5A 4DE7A 4HOCA 1FGXA 1H3MA 3SX8A 1GQ9A 4MYBA 3I0KA 3I0FA 4CJBA 2JCLA 3SXEA 3V90A 4KC1A 4R7PA 1XZ6A 4FREA 3ZF8A 3V0NA 3U0XA 3F1CA 4FCUA 1E5KA 5IFYA 3KIAA 3PKQA 3SX7A 3SXGA 4CJCA 2VSHA 1JYLA 3V0PA 1LZIA 1JV1A 2V0JA 4P02A 5CQLX 2VS5A 2RJ6A 3EE5A 4B5BA 2Z87A 5FU0A 1ZCUA 1MP5A 3OKRA 1H5TB 2CU2A 2D7RA 4FRQA 3FWWA 3OH1A 2E3DA 3T7MA 1VH3A 2YQSA 2RIZA 1NF5B 3RMWA 3V0QA 4AAWA 2OI6A 1TZFA 3V91A 1O7OA 1H5SB 1VZUA 3USRA 3K8DA 1GQCA 3O3PA 1H5SA 3Q4SA 2ICXA 4KQLA 1WT1A 3JUKA 1H5SC 2RJ8A 2AH9A 2JCKA 5AJPA 4UEGA 1ZHJA 5C4CA 1JVGA 5IDSA 2XMEA 1ON6A 2MZBA 1VGWA 1YP3A 3U2VA 1G23A 3BCVA 4EEGA 2FYBA 5C49A 3I0CA 4D0ZA 1W77A 3SXDA 5EJ1A 5IDTA 2RITA 2WVKA 2Y4KA 3BRKX 2Y6PA 1HJLA 2Y7AA 1TVYA 2BO8A 4CJ8A 5C3DA 1NWGB 4EEMA 1H7TA 1V83A 1WT0A 3JUJA 2RIYA 3USQA 3NGWA 4B3UA 3I0IX 1G3LA 5CMHA 4G3QA 4FRLA 1GA8A 1QGSA 2RIXA 5C8RA 4XWIA 3OC9A 1G2VA 3U2WA 2ZU9A 2UX8A 3IOJA 3JTJA 4NAKA 1HM0A 2X60A 2BO7A 4FCEA 4G3PA 2YQCA 4B2XA 4KC4A 4Y7FA 3I0EA 3U2TA 2A8WA 4B4BA 1GX4A 1K4VA 1JYKA 3GUEA 4L41C 1FXJA 2WEEA 2FFUA 5C36A 3I0GA 4HO8A 3OH0A 1H4DA 2OEGA 1H7QA 5AJOA 4Y7VA 2QH5A 4IRPA 4B2WA 1I52A 1OMZA 4B4GA 1O0RA 1MP4A 3IOIA 4FRBA 2I5KA 4KPXA 3RMVA 5L6VA 3V8ZA 1R7TA 1VICA 1H7HA 2ZU7A 2APCA 1S4OA 1HV9A 5FTVA 2AECA 1G8OA 1H5RB 1TW1A 2VXMA 1H5RA 1NKHB 2OEFA 4FRMA 2AM3A 4AYJA 5FUHA 3SXAA 2QGIA 1YP2A 2RJ4A 4HCQA 3I0LA 4K6RA 4FROA 3V0MA 4BQHA 4EEOA 1NMMB 2X65A 1GWVA 4KNRA 3ZLKA 2JCOA 2D7IA 3Q7UA 4KNXA 3I0DA 4GBPA 5C48A 5CMJA 2AESA 3DUVA 4Y7GA 4HO3A 1H7FA 1V84A 2P73A 3TZTA 3D5NA 1IINA 4Y6UA 4G3SA 1H4CA 3F1YA 5DDTA 1H5TA 2AM4A 2V0KA 4M2BA 5DDVA 2WVMA 4DDZA 1WT2A 5CQMX 1WT3A 2V0IA 4HO6A 1LZ0A 5FTSA 1ZI5A 4EE5A 2Y4LA 3FOQA 1VM8A 1R81A 3ZGFA 2X5ZA 4KXOA 4KT7A 1IIMA 2ZU8A 5AJNA 3SX3A 2JCJA 2O1HA 4Y7TA 1LVWA 3QVBA 5C1LA 1VGTA 1GWWA 3CGXA 5CQPA 2WE9A 4M28A 4ASJA 3OGZA 1LZ7A 3ST8A 5C4DA 1ZDGA 2PGYA 2W0VA 2GGQA 4IRQA 5EIYA 4HO4A 4NAIA 1JV3A 1NQIB 4EE4A 2BO4A 1ON8A 1ZJOA 1MC3A 2ICYA 4M2AA 5C47A 5EJZA 1VZXA 3U2XA 2BO6A 2YCMA 2A8UA 4EEAA 3D98A 3DJ4A 4FRHA 4ASYA 5C3BA 1HM9A 3CU0A 4HO5A 4Y63A 1PZTA 2O1GA 2VD4A 2VXLA 4HO0A 2NXVA 2D0JA 4ARWA 2E8BA 2V0HA 3CKNA 2XMHA 1NHEB 2WAWA 3ZGGA 4E1KA 5C4FA 2Y4MA 5I1FA 2YC5A 3V8YA 1GX0A 4G87A 2YQJA 4C2SA 1Z90A 4ECMA 1QG8A 4JISA 1PZYB 4HO9A 1QGQA 1ZCYA 4KPZA 5J49A 5C4EA 3N9WA 4FRDA 2RJ5A 4B42A 1R7VA 2VS4A 1WVCA 1ZJ2A 2PGVA 3R3IA 1R80A 2W0WA 1O23B 1H4EA 1FR9A 5CMIA 1FG5N 3T7NA 3CKOA 5C38A 4FRPA 5CMFX 4DECA 1ZJ3A 1FO8A 5CQNX 3OH2A 1ZI3A 1VGZA 1G1LA 3LW6A 4KRVA 5FV9A 1OMXA 1LL3A 1VZTA 2FYDB 1LL2A 1FXOA 1ZJPA 2FFVA 5FU8A 1HJJA 3SXCA
chains in the Genus database with same CATH superfamily
1O7QA 3SPTA 3POLA 2P72A 2V0LA 5C3AA 5C4BA 1H7LA 2RJ9A 3RSBA 2RJ0A 2RJ7A 2VS3A 4LW3A 2OI5A 2GGOA 4AYLA 5FYEA 4HO2A 1G9RA 2XWMA 3ZLLA 3PKPA 2FY7A 4Y9XA 4D48A 3SXBA 2PX7A 1FRWA 1H7EA 2FYCB 2DPWA 1QWJA 3V0OA 2I5EA 2XWNA 2AM5A 2O1FA 3CKJA 4P00A 1VGUA 3U2UA 1INJA 1G97A 1VPAA 3U0YA 1YROB 4LW6A 1FR8A 1R7XA 5HS2A 4FQWA 1G0RA 2VFZA 1W57A 2I7BA 3HL3A 1INIA 4YS8A 1H7GA 1OQMB 2Y4JA 1YP4A 3OH3A 1LZJA 2X5SA 4EVWA 4NANA 1ZIZA 3D8VA 1HM8A 4EE3A 4Q7CA 3TQDA 2OI7A 4Y7UA 4D0TA 2XWLA 5CQOA 2FYAA 5BXCA 3OAMA 5L6SA 4B4MA 2YQHA 1V82A 1W55A 4NALA 2AGDA 3R2WA 2WGZA 5JQQA 1XHBA 1ZCVA 4AC3A 2PA4A 1ZCTA 1LL0A 1FWYA 3CKVA 2P6WA 4FRAA 2RJ1A 4CVHA 5CMGX 2YESA 4Y6NA 2QKXA 1G95A 4Y64A 3I0HA 1FO9A 1KWSA 4M4KA 1MP3A 3K8EA 2C0NA 3E25A 3T7OA 3Q80A 3V0LA 1ZJ0A 1TW5A 5C1HA 4J18A 2VSIA 3CKQA 2Z86A 3I0JA 3OH4A 4ZDQA 4Y62A 1FGGA 1R7YA 3IOHA 1WSZA 1EYRA 1S4NA 1H5SD 1G93A 1ZI4A 5C1GA 2WVLA 1S4PA 1SS9A 3PNNA 2Q4JA 1FOAA 1EZIA 4JD0A 1FZWA 4HG6A 4BMAA 4D11A 1VH1A 4MNDA 4KC2A 4D11C 1ZDFA 1R82A 1JVDA 1ZJ1A 1R7UA 1ZI1A 2AE7A 3DK5A 3E26A 2YC3A 3SX5A 4DE7A 4HOCA 1FGXA 1H3MA 3SX8A 1GQ9A 4MYBA 3I0KA 3I0FA 4CJBA 2JCLA 3SXEA 3V90A 4KC1A 4R7PA 1XZ6A 4FREA 3ZF8A 3V0NA 3U0XA 3F1CA 4FCUA 4MIXA 1E5KA 5IFYA 3KIAA 3PKQA 3SX7A 3SXGA 4CJCA 2VSHA 1JYLA 3V0PA 1LZIA 1JV1A 2V0JA 4P02A 5CQLX 2VS5A 2RJ6A 3EE5A 4B5BA 2Z87A 5FU0A 1ZCUA 1MP5A 3OKRA 1H5TB 2CU2A 2D7RA 4FRQA 3FWWA 3OH1A 2E3DA 3T7MA 1VH3A 2YQSA 2RIZA 1NF5B 3RMWA 3V0QA 4AAWA 2OI6A 1TZFA 3V91A 1O7OA 1H5SB 1VZUA 3USRA 3K8DA 1GQCA 3O3PA 1H5SA 3Q4SA 2ICXA 4KQLA 1WT1A 3JUKA 1H5SC 2RJ8A 2AH9A 2JCKA 5AJPA 4UEGA 1ZHJA 5C4CA 1JVGA 5IDSA 2XMEA 1ON6A 4FIXA 2MZBA 1VGWA 1YP3A 3U2VA 1G23A 3BCVA 4EEGA 2FYBA 5C49A 3I0CA 4D0ZA 1W77A 3SXDA 5EJ1A 5IDTA 2RITA 2WVKA 2Y4KA 3BRKX 2Y6PA 1HJLA 2Y7AA 1TVYA 2BO8A 4CJ8A 5C3DA 1NWGB 4EEMA 1H7TA 1V83A 1WT0A 3JUJA 2RIYA 3USQA 3NGWA 4B3UA 3I0IX 1G3LA 5CMHA 4G3QA 4FRLA 2J0BA 1GA8A 1QGSA 2RIXA 5C8RA 4XWIA 3OC9A 1G2VA 3U2WA 2ZU9A 2UX8A 3IOJA 3JTJA 4NAKA 1HM0A 2X60A 2BO7A 4FCEA 4G3PA 2YQCA 4B2XA 4KC4A 4Y7FA 2J0AA 3I0EA 3U2TA 2A8WA 4B4BA 1GX4A 1K4VA 1JYKA 3GUEA 4L41C 1FXJA 2WEEA 2FFUA 5C36A 3I0GA 4HO8A 3OH0A 1H4DA 2OEGA 1H7QA 5AJOA 4Y7VA 2QH5A 4IRPA 4B2WA 1I52A 1OMZA 4B4GA 1O0RA 1MP4A 3IOIA 4FRBA 2I5KA 4KPXA 3RMVA 5L6VA 5D91A 3V8ZA 1R7TA 1VICA 1H7HA 2ZU7A 2APCA 1S4OA 1HV9A 5FTVA 2AECA 1G8OA 1H5RB 1TW1A 2VXMA 1H5RA 1NKHB 2OEFA 4FRMA 2AM3A 4AYJA 4O6NA 5FUHA 3SXAA 3SXCA 2QGIA 1YP2A 2RJ4A 4HCQA 3I0LA 4K6RA 4FROA 3V0MA 4BQHA 4EEOA 1NMMB 2X65A 1GWVA 4KNRA 3ZLKA 2JCOA 2D7IA 3Q7UA 4KNXA 3I0DA 4GBPA 5C48A 5CMJA 2AESA 3DUVA 4Y7GA 4HO3A 1H7FA 1V84A 2P73A 3TZTA 3D5NA 1IINA 4Y6UA 4G3SA 1H4CA 3F1YA 5DDTA 1H5TA 2AM4A 2V0KA 4M2BA 5DDVA 2WVMA 4DDZA 1WT2A 5CQMX 1WT3A 2V0IA 4HO6A 1LZ0A 5FTSA 1ZI5A 4EE5A 2Y4LA 3FOQA 1VM8A 1R81A 3ZGFA 2X5ZA 4KXOA 4KT7A 1IIMA 2ZU8A 5AJNA 3SX3A 2JCJA 2O1HA 4Y7TA 1LVWA 3QVBA 5C1LA 1VGTA 1GWWA 3CGXA 5CQPA 2WE9A 4M28A 4ASJA 3OGZA 1LZ7A 3ST8A 5C4DA 1ZDGA 2PGYA 2W0VA 2GGQA 4IRQA 5EIYA 4HO4A 4NAIA 1JV3A 1NQIB 4EE4A 2BO4A 1ON8A 1ZJOA 1MC3A 2ICYA 4M2AA 5C47A 5EJZA 1VZXA 3U2XA 2BO6A 2YCMA 2A8UA 4EEAA 3D98A 3DJ4A 4FRHA 4ASYA 5C3BA 1HM9A 3CU0A 4HO5A 4Y63A 1PZTA 2O1GA 2VD4A 2VXLA 4HO0A 2NXVA 2D0JA 4ARWA 2E8BA 2V0HA 3CKNA 2XMHA 1NHEB 2WAWA 3ZGGA 4E1KA 5C4FA 2Y4MA 5I1FA 2YC5A 3V8YA 1GX0A 4G87A 2YQJA 4C2SA 1Z90A 4ECMA 1QG8A 4JISA 1PZYB 4HO9A 1QGQA 1ZCYA 4KPZA 4FIYA 5J49A 5C4EA 3N9WA 4FRDA 2RJ5A 4B42A 1R7VA 2VS4A 1WVCA 1ZJ2A 2PGVA 3R3IA 1R80A 2W0WA 1O23B 5D92A 1H4EA 1FR9A 5CMIA 1FG5N 3T7NA 3CKOA 5C38A 4FRPA 5CMFX 4DECA 1ZJ3A 2VK9A 1FO8A 5CQNX 3OH2A 1ZI3A 1VGZA 1G1LA 3LW6A 4KRVA 5FV9A 1OMXA 1LL3A 1VZTA 2FYDB 1LL2A 1FXOA 1ZJPA 2FFVA 5FU8A 1HJJA 4O6MA
chains in the Genus database with same CATH topology
1O7QA 3SPTA 3POLA 2P72A 2V0LA 5C3AA 5C4BA 1H7LA 2RJ9A 3RSBA 2RJ0A 2RJ7A 2VS3A 4LW3A 2OI5A 2GGOA 4AYLA 5FYEA 4HO2A 1G9RA 2XWMA 3ZLLA 3PKPA 2FY7A 4Y9XA 4D48A 3SXBA 2PX7A 1FRWA 1H7EA 2FYCB 2DPWA 1QWJA 3V0OA 2I5EA 2XWNA 2AM5A 2O1FA 3CKJA 4P00A 1VGUA 3U2UA 1INJA 1G97A 1VPAA 3U0YA 1YROB 4LW6A 1FR8A 1R7XA 5HS2A 4FQWA 1G0RA 2VFZA 1W57A 2I7BA 3HL3A 1INIA 4YS8A 1H7GA 1OQMB 2Y4JA 1YP4A 3OH3A 1LZJA 2X5SA 4EVWA 4NANA 1ZIZA 3D8VA 1HM8A 4EE3A 4Q7CA 3TQDA 2OI7A 4Y7UA 4D0TA 2XWLA 5CQOA 2FYAA 5BXCA 3OAMA 5L6SA 4B4MA 2YQHA 1V82A 1W55A 4NALA 2AGDA 3R2WA 2WGZA 5JQQA 1XHBA 1ZCVA 4AC3A 2PA4A 1ZCTA 1LL0A 1FWYA 3CKVA 2P6WA 4FRAA 2RJ1A 4CVHA 5CMGX 2YESA 4Y6NA 2QKXA 1G95A 4Y64A 3I0HA 1FO9A 1KWSA 4M4KA 1MP3A 3K8EA 2C0NA 3E25A 3T7OA 3Q80A 3V0LA 1ZJ0A 1TW5A 5C1HA 4J18A 2VSIA 3CKQA 2Z86A 3I0JA 3OH4A 4ZDQA 4Y62A 1FGGA 1R7YA 3IOHA 1WSZA 1EYRA 1S4NA 1H5SD 1G93A 1ZI4A 5C1GA 2WVLA 1S4PA 1SS9A 3PNNA 2Q4JA 1FOAA 1EZIA 4JD0A 1FZWA 4HG6A 4BMAA 4D11A 1VH1A 4MNDA 4KC2A 4D11C 1ZDFA 1R82A 1JVDA 1ZJ1A 1R7UA 1ZI1A 2AE7A 3DK5A 3E26A 2YC3A 3SX5A 4DE7A 4HOCA 1FGXA 1H3MA 3SX8A 1GQ9A 4MYBA 3I0KA 3I0FA 4CJBA 2JCLA 3SXEA 3V90A 4KC1A 4R7PA 1XZ6A 4FREA 3ZF8A 3V0NA 3U0XA 3F1CA 4FCUA 4MIXA 1E5KA 5IFYA 3KIAA 3PKQA 3SX7A 3SXGA 4CJCA 2VSHA 1JYLA 3V0PA 1LZIA 1JV1A 2V0JA 4P02A 5CQLX 2VS5A 2RJ6A 3EE5A 4B5BA 2Z87A 5FU0A 1ZCUA 1MP5A 3OKRA 1H5TB 2CU2A 2D7RA 4FRQA 3FWWA 3OH1A 2E3DA 3T7MA 1VH3A 2YQSA 2RIZA 1NF5B 3RMWA 3V0QA 4AAWA 2OI6A 1TZFA 3V91A 1O7OA 1H5SB 1VZUA 3USRA 3K8DA 1GQCA 3O3PA 1H5SA 3Q4SA 2ICXA 4KQLA 1WT1A 3JUKA 1H5SC 2RJ8A 2AH9A 2JCKA 5AJPA 4UEGA 1ZHJA 5C4CA 1JVGA 5IDSA 2XMEA 1ON6A 4FIXA 2MZBA 1VGWA 1YP3A 3U2VA 1G23A 3BCVA 4EEGA 2FYBA 5C49A 3I0CA 4D0ZA 1W77A 3SXDA 5EJ1A 5IDTA 2RITA 2WVKA 2Y4KA 3BRKX 2Y6PA 1HJLA 2Y7AA 1TVYA 2BO8A 4CJ8A 5C3DA 1NWGB 4EEMA 1H7TA 1V83A 1WT0A 3JUJA 2RIYA 3USQA 3NGWA 4B3UA 3I0IX 1G3LA 5CMHA 4G3QA 4FRLA 2J0BA 1GA8A 1QGSA 2RIXA 5C8RA 4XWIA 3OC9A 1G2VA 3U2WA 2ZU9A 2UX8A 3IOJA 3JTJA 4NAKA 1HM0A 2X60A 2BO7A 4FCEA 4G3PA 2YQCA 4B2XA 4KC4A 4Y7FA 2J0AA 3I0EA 3U2TA 2A8WA 4B4BA 1GX4A 1K4VA 1JYKA 3GUEA 4L41C 1FXJA 2WEEA 2FFUA 5C36A 3I0GA 4HO8A 3OH0A 1H4DA 2OEGA 1H7QA 5AJOA 4Y7VA 2QH5A 4IRPA 4B2WA 1I52A 1OMZA 4B4GA 1O0RA 1MP4A 3IOIA 4FRBA 2I5KA 4KPXA 3RMVA 5L6VA 5D91A 3V8ZA 1R7TA 1VICA 1H7HA 2ZU7A 2APCA 1S4OA 1HV9A 5FTVA 2AECA 1G8OA 1H5RB 1TW1A 2VXMA 1H5RA 1NKHB 2OEFA 4FRMA 2AM3A 4AYJA 4O6NA 5FUHA 3SXAA 3SXCA 2QGIA 1YP2A 2RJ4A 4HCQA 3I0LA 4K6RA 4FROA 3V0MA 4BQHA 4EEOA 1NMMB 2X65A 1GWVA 4KNRA 3ZLKA 2JCOA 2D7IA 3Q7UA 4KNXA 3I0DA 4GBPA 5C48A 5CMJA 2AESA 3DUVA 4Y7GA 4HO3A 1H7FA 1V84A 2P73A 3TZTA 3D5NA 1IINA 4Y6UA 4G3SA 1H4CA 3F1YA 5DDTA 1H5TA 2AM4A 2V0KA 4M2BA 5DDVA 2WVMA 4DDZA 1WT2A 5CQMX 1WT3A 2V0IA 4HO6A 1LZ0A 5FTSA 1ZI5A 4EE5A 2Y4LA 3FOQA 1VM8A 1R81A 3ZGFA 2X5ZA 4KXOA 4KT7A 1IIMA 2ZU8A 5AJNA 3SX3A 2JCJA 2O1HA 4Y7TA 1LVWA 3QVBA 5C1LA 1VGTA 1GWWA 3CGXA 5CQPA 2WE9A 4M28A 4ASJA 3OGZA 1LZ7A 3ST8A 5C4DA 1ZDGA 2PGYA 2W0VA 2GGQA 4IRQA 5EIYA 4HO4A 4NAIA 1JV3A 1NQIB 4EE4A 2BO4A 1ON8A 1ZJOA 1MC3A 2ICYA 4M2AA 5C47A 5EJZA 1VZXA 3U2XA 2BO6A 2YCMA 2A8UA 4EEAA 3D98A 3DJ4A 4FRHA 4ASYA 5C3BA 1HM9A 3CU0A 4HO5A 4Y63A 1PZTA 2O1GA 2VD4A 2VXLA 4HO0A 2NXVA 2D0JA 4ARWA 2E8BA 2V0HA 3CKNA 2XMHA 1NHEB 2WAWA 3ZGGA 4E1KA 5C4FA 2Y4MA 5I1FA 2YC5A 3V8YA 1GX0A 4G87A 2YQJA 4C2SA 1Z90A 4ECMA 1QG8A 4JISA 1PZYB 4HO9A 1QGQA 1ZCYA 4KPZA 4FIYA 5J49A 5C4EA 3N9WA 4FRDA 2RJ5A 4B42A 1R7VA 2VS4A 1WVCA 1ZJ2A 2PGVA 3R3IA 1R80A 2W0WA 1O23B 5D92A 1H4EA 1FR9A 5CMIA 1FG5N 3T7NA 3CKOA 5C38A 4FRPA 5CMFX 4DECA 1ZJ3A 2VK9A 1FO8A 5CQNX 3OH2A 1ZI3A 1VGZA 1G1LA 3LW6A 4KRVA 5FV9A 1OMXA 1LL3A 1VZTA 2FYDB 1LL2A 1FXOA 1ZJPA 2FFVA 5FU8A 1HJJA 4O6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Q A;  3SPT A;  3POL A;  2P72 A;  2V0L A;  5C3A A;  5C4B A;  1H7L A;  2RJ9 A;  3RSB A;  2RJ0 A;  2RJ7 A;  2VS3 A;  4LW3 A;  2OI5 A;  2GGO A;  4AYL A;  5FYE A;  4HO2 A;  1G9R A;  2XWM A;  3ZLL A;  3PKP A;  2FY7 A;  4Y9X A;  4D48 A;  3SXB A;  2PX7 A;  1FRW A;  1H7E A;  2FYC B;  2DPW A;  1QWJ A;  3V0O A;  2I5E A;  2XWN A;  2AM5 A;  2O1F A;  3CKJ A;  4P00 A;  1VGU A;  3U2U A;  1INJ A;  1G97 A;  1VPA A;  3U0Y A;  1YRO B;  4LW6 A;  1FR8 A;  1R7X A;  5HS2 A;  4FQW A;  1G0R A;  2VFZ A;  1W57 A;  2I7B A;  3HL3 A;  1INI A;  4YS8 A;  1H7G A;  1OQM B;  2Y4J A;  1YP4 A;  3OH3 A;  1LZJ A;  2X5S A;  4EVW A;  4NAN A;  1ZIZ A;  3D8V A;  1HM8 A;  4EE3 A;  3TQD A;  2OI7 A;  4Y7U A;  4D0T A;  2XWL A;  5CQO A;  2FYA A;  5BXC A;  3OAM A;  5L6S A;  4B4M A;  2YQH A;  1V82 A;  1W55 A;  4NAL A;  2AGD A;  3R2W A;  2WGZ A;  5JQQ A;  1XHB A;  1ZCV A;  4AC3 A;  2PA4 A;  1ZCT A;  1LL0 A;  1FWY A;  3CKV A;  2P6W A;  4FRA A;  2RJ1 A;  4CVH A;  5CMG X;  2YES A;  4Y6N A;  2QKX A;  1G95 A;  4Y64 A;  3I0H A;  1FO9 A;  1KWS A;  4M4K A;  1MP3 A;  3K8E A;  3E25 A;  3T7O A;  3Q80 A;  3V0L A;  1ZJ0 A;  1TW5 A;  5C1H A;  4J18 A;  2VSI A;  3CKQ A;  2Z86 A;  3I0J A;  3OH4 A;  4ZDQ A;  4Y62 A;  1FGG A;  1R7Y A;  3IOH A;  1WSZ A;  1EYR A;  1S4N A;  1H5S D;  1G93 A;  1ZI4 A;  5C1G A;  2WVL A;  1S4P A;  1SS9 A;  3PNN A;  2Q4J A;  1FOA A;  1EZI A;  4JD0 A;  1FZW A;  4HG6 A;  4BMA A;  4D11 A;  1VH1 A;  4MND A;  4KC2 A;  4D11 C;  1ZDF A;  1R82 A;  1JVD A;  1ZJ1 A;  1R7U A;  1ZI1 A;  2AE7 A;  3DK5 A;  3E26 A;  2YC3 A;  3SX5 A;  4DE7 A;  4HOC A;  1FGX A;  1H3M A;  3SX8 A;  1GQ9 A;  4MYB A;  3I0K A;  3I0F A;  4CJB A;  2JCL A;  3SXE A;  3V90 A;  4KC1 A;  4R7P A;  1XZ6 A;  4FRE A;  3ZF8 A;  3V0N A;  3U0X A;  3F1C A;  4FCU A;  1E5K A;  5IFY A;  3KIA A;  3PKQ A;  3SX7 A;  3SXG A;  4CJC A;  2VSH A;  1JYL A;  3V0P A;  1LZI A;  1JV1 A;  2V0J A;  4P02 A;  5CQL X;  2VS5 A;  2RJ6 A;  3EE5 A;  4B5B A;  2Z87 A;  5FU0 A;  1ZCU A;  1MP5 A;  3OKR A;  1H5T B;  2CU2 A;  2D7R A;  4FRQ A;  3FWW A;  3OH1 A;  2E3D A;  3T7M A;  1VH3 A;  2YQS A;  2RIZ A;  1NF5 B;  3RMW A;  3V0Q A;  4AAW A;  2OI6 A;  1TZF A;  3V91 A;  1O7O A;  1H5S B;  1VZU A;  3USR A;  3K8D A;  1GQC A;  3O3P A;  1H5S A;  3Q4S A;  2ICX A;  4KQL A;  1WT1 A;  3JUK A;  1H5S C;  2RJ8 A;  2AH9 A;  2JCK A;  5AJP A;  4UEG A;  1ZHJ A;  5C4C A;  1JVG A;  5IDS A;  2XME A;  1ON6 A;  2MZB A;  1VGW A;  1YP3 A;  3U2V A;  1G23 A;  3BCV A;  4EEG A;  2FYB A;  5C49 A;  3I0C A;  4D0Z A;  1W77 A;  3SXD A;  5EJ1 A;  5IDT A;  2RIT A;  2WVK A;  2Y4K A;  3BRK X;  2Y6P A;  1HJL A;  2Y7A A;  1TVY A;  2BO8 A;  4CJ8 A;  5C3D A;  1NWG B;  4EEM A;  1H7T A;  1V83 A;  1WT0 A;  3JUJ A;  2RIY A;  3USQ A;  3NGW A;  4B3U A;  3I0I X;  1G3L A;  5CMH A;  4G3Q A;  4FRL A;  1GA8 A;  1QGS A;  2RIX A;  5C8R A;  4XWI A;  3OC9 A;  1G2V A;  3U2W A;  2ZU9 A;  2UX8 A;  3IOJ A;  3JTJ A;  4NAK A;  1HM0 A;  2X60 A;  2BO7 A;  4FCE A;  4G3P A;  2YQC A;  4B2X A;  4KC4 A;  4Y7F A;  3I0E A;  3U2T A;  2A8W A;  4B4B A;  1GX4 A;  1K4V A;  1JYK A;  3GUE A;  4L41 C;  1FXJ A;  2WEE A;  2FFU A;  5C36 A;  3I0G A;  4HO8 A;  3OH0 A;  1H4D A;  2OEG A;  1H7Q A;  5AJO A;  4Y7V A;  2QH5 A;  4IRP A;  4B2W A;  1I52 A;  1OMZ A;  4B4G A;  1O0R A;  1MP4 A;  3IOI A;  4FRB A;  2I5K A;  4KPX A;  3RMV A;  5L6V A;  3V8Z A;  1R7T A;  1VIC A;  1H7H A;  2ZU7 A;  2APC A;  1S4O A;  1HV9 A;  5FTV A;  2AEC A;  1G8O A;  1H5R B;  1TW1 A;  2VXM A;  1H5R A;  1NKH B;  2OEF A;  4FRM A;  2AM3 A;  4AYJ A;  5FUH A;  3SXA A;  2QGI A;  1YP2 A;  2RJ4 A;  4HCQ A;  3I0L A;  4K6R A;  4FRO A;  3V0M A;  4BQH A;  4EEO A;  1NMM B;  2X65 A;  1GWV A;  4KNR A;  3ZLK A;  2JCO A;  2D7I A;  3Q7U A;  4KNX A;  3I0D A;  4GBP A;  5C48 A;  5CMJ A;  2AES A;  3DUV A;  4Y7G A;  4HO3 A;  1H7F A;  1V84 A;  2P73 A;  3TZT A;  3D5N A;  1IIN A;  4Y6U A;  4G3S A;  1H4C A;  3F1Y A;  5DDT A;  1H5T A;  2AM4 A;  2V0K A;  4M2B A;  5DDV A;  2WVM A;  4DDZ A;  1WT2 A;  5CQM X;  1WT3 A;  2V0I A;  4HO6 A;  1LZ0 A;  5FTS A;  1ZI5 A;  4EE5 A;  2Y4L A;  3FOQ A;  1VM8 A;  1R81 A;  3ZGF A;  2X5Z A;  4KXO A;  4KT7 A;  1IIM A;  2ZU8 A;  5AJN A;  3SX3 A;  2JCJ A;  2O1H A;  4Y7T A;  1LVW A;  3QVB A;  5C1L A;  1VGT A;  1GWW A;  3CGX A;  5CQP A;  2WE9 A;  4M28 A;  4ASJ A;  3OGZ A;  1LZ7 A;  3ST8 A;  5C4D A;  1ZDG A;  2PGY A;  2W0V A;  2GGQ A;  4IRQ A;  5EIY A;  4HO4 A;  4NAI A;  1JV3 A;  1NQI B;  4EE4 A;  2BO4 A;  1ON8 A;  1ZJO A;  1MC3 A;  2ICY A;  4M2A A;  5C47 A;  5EJZ A;  1VZX A;  3U2X A;  2BO6 A;  2YCM A;  2A8U A;  4EEA A;  3D98 A;  3DJ4 A;  4FRH A;  4ASY A;  5C3B A;  1HM9 A;  3CU0 A;  4HO5 A;  4Y63 A;  1PZT A;  2O1G A;  2VD4 A;  2VXL A;  4HO0 A;  2NXV A;  2D0J A;  4ARW A;  2E8B A;  2V0H A;  3CKN A;  2XMH A;  1NHE B;  2WAW A;  3ZGG A;  4E1K A;  5C4F A;  2Y4M A;  5I1F A;  2YC5 A;  3V8Y A;  1GX0 A;  4G87 A;  2YQJ A;  4C2S A;  1Z90 A;  4ECM A;  1QG8 A;  4JIS A;  1PZY B;  4HO9 A;  1QGQ A;  1ZCY A;  4KPZ A;  5J49 A;  5C4E A;  3N9W A;  4FRD A;  2RJ5 A;  4B42 A;  1R7V A;  2VS4 A;  1WVC A;  1ZJ2 A;  2PGV A;  3R3I A;  1R80 A;  2W0W A;  1O23 B;  1H4E A;  1FR9 A;  5CMI A;  1FG5 N;  3T7N A;  3CKO A;  5C38 A;  4FRP A;  5CMF X;  4DEC A;  1ZJ3 A;  1FO8 A;  5CQN X;  3OH2 A;  1ZI3 A;  1VGZ A;  1G1L A;  3LW6 A;  4KRV A;  5FV9 A;  1OMX A;  1LL3 A;  1VZT A;  2FYD B;  1LL2 A;  1FXO A;  1ZJP A;  2FFV A;  5FU8 A;  1HJJ A;  3SXC A; 
#chains in the Genus database with same CATH topology
 1O7Q A;  3SPT A;  3POL A;  2P72 A;  2V0L A;  5C3A A;  5C4B A;  1H7L A;  2RJ9 A;  3RSB A;  2RJ0 A;  2RJ7 A;  2VS3 A;  4LW3 A;  2OI5 A;  2GGO A;  4AYL A;  5FYE A;  4HO2 A;  1G9R A;  2XWM A;  3ZLL A;  3PKP A;  2FY7 A;  4Y9X A;  4D48 A;  3SXB A;  2PX7 A;  1FRW A;  1H7E A;  2FYC B;  2DPW A;  1QWJ A;  3V0O A;  2I5E A;  2XWN A;  2AM5 A;  2O1F A;  3CKJ A;  4P00 A;  1VGU A;  3U2U A;  1INJ A;  1G97 A;  1VPA A;  3U0Y A;  1YRO B;  4LW6 A;  1FR8 A;  1R7X A;  5HS2 A;  4FQW A;  1G0R A;  2VFZ A;  1W57 A;  2I7B A;  3HL3 A;  1INI A;  4YS8 A;  1H7G A;  1OQM B;  2Y4J A;  1YP4 A;  3OH3 A;  1LZJ A;  2X5S A;  4EVW A;  4NAN A;  1ZIZ A;  3D8V A;  1HM8 A;  4EE3 A;  4Q7C A;  3TQD A;  2OI7 A;  4Y7U A;  4D0T A;  2XWL A;  5CQO A;  2FYA A;  5BXC A;  3OAM A;  5L6S A;  4B4M A;  2YQH A;  1V82 A;  1W55 A;  4NAL A;  2AGD A;  3R2W A;  2WGZ A;  5JQQ A;  1XHB A;  1ZCV A;  4AC3 A;  2PA4 A;  1ZCT A;  1LL0 A;  1FWY A;  3CKV A;  2P6W A;  4FRA A;  2RJ1 A;  4CVH A;  5CMG X;  2YES A;  4Y6N A;  2QKX A;  1G95 A;  4Y64 A;  3I0H A;  1FO9 A;  1KWS A;  4M4K A;  1MP3 A;  3K8E A;  2C0N A;  3E25 A;  3T7O A;  3Q80 A;  3V0L A;  1ZJ0 A;  1TW5 A;  5C1H A;  4J18 A;  2VSI A;  3CKQ A;  2Z86 A;  3I0J A;  3OH4 A;  4ZDQ A;  4Y62 A;  1FGG A;  1R7Y A;  3IOH A;  1WSZ A;  1EYR A;  1S4N A;  1H5S D;  1G93 A;  1ZI4 A;  5C1G A;  2WVL A;  1S4P A;  1SS9 A;  3PNN A;  2Q4J A;  1FOA A;  1EZI A;  4JD0 A;  1FZW A;  4HG6 A;  4BMA A;  4D11 A;  1VH1 A;  4MND A;  4KC2 A;  4D11 C;  1ZDF A;  1R82 A;  1JVD A;  1ZJ1 A;  1R7U A;  1ZI1 A;  2AE7 A;  3DK5 A;  3E26 A;  2YC3 A;  3SX5 A;  4DE7 A;  4HOC A;  1FGX A;  1H3M A;  3SX8 A;  1GQ9 A;  4MYB A;  3I0K A;  3I0F A;  4CJB A;  2JCL A;  3SXE A;  3V90 A;  4KC1 A;  4R7P A;  1XZ6 A;  4FRE A;  3ZF8 A;  3V0N A;  3U0X A;  3F1C A;  4FCU A;  4MIX A;  1E5K A;  5IFY A;  3KIA A;  3PKQ A;  3SX7 A;  3SXG A;  4CJC A;  2VSH A;  1JYL A;  3V0P A;  1LZI A;  1JV1 A;  2V0J A;  4P02 A;  5CQL X;  2VS5 A;  2RJ6 A;  3EE5 A;  4B5B A;  2Z87 A;  5FU0 A;  1ZCU A;  1MP5 A;  3OKR A;  1H5T B;  2CU2 A;  2D7R A;  4FRQ A;  3FWW A;  3OH1 A;  2E3D A;  3T7M A;  1VH3 A;  2YQS A;  2RIZ A;  1NF5 B;  3RMW A;  3V0Q A;  4AAW A;  2OI6 A;  1TZF A;  3V91 A;  1O7O A;  1H5S B;  1VZU A;  3USR A;  3K8D A;  1GQC A;  3O3P A;  1H5S A;  3Q4S A;  2ICX A;  4KQL A;  1WT1 A;  3JUK A;  1H5S C;  2RJ8 A;  2AH9 A;  2JCK A;  5AJP A;  4UEG A;  1ZHJ A;  5C4C A;  1JVG A;  5IDS A;  2XME A;  1ON6 A;  4FIX A;  2MZB A;  1VGW A;  1YP3 A;  3U2V A;  1G23 A;  3BCV A;  4EEG A;  2FYB A;  5C49 A;  3I0C A;  4D0Z A;  1W77 A;  3SXD A;  5EJ1 A;  5IDT A;  2RIT A;  2WVK A;  2Y4K A;  3BRK X;  2Y6P A;  1HJL A;  2Y7A A;  1TVY A;  2BO8 A;  4CJ8 A;  5C3D A;  1NWG B;  4EEM A;  1H7T A;  1V83 A;  1WT0 A;  3JUJ A;  2RIY A;  3USQ A;  3NGW A;  4B3U A;  3I0I X;  1G3L A;  5CMH A;  4G3Q A;  4FRL A;  2J0B A;  1GA8 A;  1QGS A;  2RIX A;  5C8R A;  4XWI A;  3OC9 A;  1G2V A;  3U2W A;  2ZU9 A;  2UX8 A;  3IOJ A;  3JTJ A;  4NAK A;  1HM0 A;  2X60 A;  2BO7 A;  4FCE A;  4G3P A;  2YQC A;  4B2X A;  4KC4 A;  4Y7F A;  2J0A A;  3I0E A;  3U2T A;  2A8W A;  4B4B A;  1GX4 A;  1K4V A;  1JYK A;  3GUE A;  4L41 C;  1FXJ A;  2WEE A;  2FFU A;  5C36 A;  3I0G A;  4HO8 A;  3OH0 A;  1H4D A;  2OEG A;  1H7Q A;  5AJO A;  4Y7V A;  2QH5 A;  4IRP A;  4B2W A;  1I52 A;  1OMZ A;  4B4G A;  1O0R A;  1MP4 A;  3IOI A;  4FRB A;  2I5K A;  4KPX A;  3RMV A;  5L6V A;  5D91 A;  3V8Z A;  1R7T A;  1VIC A;  1H7H A;  2ZU7 A;  2APC A;  1S4O A;  1HV9 A;  5FTV A;  2AEC A;  1G8O A;  1H5R B;  1TW1 A;  2VXM A;  1H5R A;  1NKH B;  2OEF A;  4FRM A;  2AM3 A;  4AYJ A;  4O6N A;  5FUH A;  3SXA A;  3SXC A;  2QGI A;  1YP2 A;  2RJ4 A;  4HCQ A;  3I0L A;  4K6R A;  4FRO A;  3V0M A;  4BQH A;  4EEO A;  1NMM B;  2X65 A;  1GWV A;  4KNR A;  3ZLK A;  2JCO A;  2D7I A;  3Q7U A;  4KNX A;  3I0D A;  4GBP A;  5C48 A;  5CMJ A;  2AES A;  3DUV A;  4Y7G A;  4HO3 A;  1H7F A;  1V84 A;  2P73 A;  3TZT A;  3D5N A;  1IIN A;  4Y6U A;  4G3S A;  1H4C A;  3F1Y A;  5DDT A;  1H5T A;  2AM4 A;  2V0K A;  4M2B A;  5DDV A;  2WVM A;  4DDZ A;  1WT2 A;  5CQM X;  1WT3 A;  2V0I A;  4HO6 A;  1LZ0 A;  5FTS A;  1ZI5 A;  4EE5 A;  2Y4L A;  3FOQ A;  1VM8 A;  1R81 A;  3ZGF A;  2X5Z A;  4KXO A;  4KT7 A;  1IIM A;  2ZU8 A;  5AJN A;  3SX3 A;  2JCJ A;  2O1H A;  4Y7T A;  1LVW A;  3QVB A;  5C1L A;  1VGT A;  1GWW A;  3CGX A;  5CQP A;  2WE9 A;  4M28 A;  4ASJ A;  3OGZ A;  1LZ7 A;  3ST8 A;  5C4D A;  1ZDG A;  2PGY A;  2W0V A;  2GGQ A;  4IRQ A;  5EIY A;  4HO4 A;  4NAI A;  1JV3 A;  1NQI B;  4EE4 A;  2BO4 A;  1ON8 A;  1ZJO A;  1MC3 A;  2ICY A;  4M2A A;  5C47 A;  5EJZ A;  1VZX A;  3U2X A;  2BO6 A;  2YCM A;  2A8U A;  4EEA A;  3D98 A;  3DJ4 A;  4FRH A;  4ASY A;  5C3B A;  1HM9 A;  3CU0 A;  4HO5 A;  4Y63 A;  1PZT A;  2O1G A;  2VD4 A;  2VXL A;  4HO0 A;  2NXV A;  2D0J A;  4ARW A;  2E8B A;  2V0H A;  3CKN A;  2XMH A;  1NHE B;  2WAW A;  3ZGG A;  4E1K A;  5C4F A;  2Y4M A;  5I1F A;  2YC5 A;  3V8Y A;  1GX0 A;  4G87 A;  2YQJ A;  4C2S A;  1Z90 A;  4ECM A;  1QG8 A;  4JIS A;  1PZY B;  4HO9 A;  1QGQ A;  1ZCY A;  4KPZ A;  4FIY A;  5J49 A;  5C4E A;  3N9W A;  4FRD A;  2RJ5 A;  4B42 A;  1R7V A;  2VS4 A;  1WVC A;  1ZJ2 A;  2PGV A;  3R3I A;  1R80 A;  2W0W A;  1O23 B;  5D92 A;  1H4E A;  1FR9 A;  5CMI A;  1FG5 N;  3T7N A;  3CKO A;  5C38 A;  4FRP A;  5CMF X;  4DEC A;  1ZJ3 A;  2VK9 A;  1FO8 A;  5CQN X;  3OH2 A;  1ZI3 A;  1VGZ A;  1G1L A;  3LW6 A;  4KRV A;  5FV9 A;  1OMX A;  1LL3 A;  1VZT A;  2FYD B;  1LL2 A;  1FXO A;  1ZJP A;  2FFV A;  5FU8 A;  1HJJ A;  4O6M A; 
#chains in the Genus database with same CATH homology
 1O7Q A;  3SPT A;  3POL A;  2P72 A;  2V0L A;  5C3A A;  5C4B A;  1H7L A;  2RJ9 A;  3RSB A;  2RJ0 A;  2RJ7 A;  2VS3 A;  4LW3 A;  2OI5 A;  2GGO A;  4AYL A;  5FYE A;  4HO2 A;  1G9R A;  2XWM A;  3ZLL A;  3PKP A;  2FY7 A;  4Y9X A;  4D48 A;  3SXB A;  2PX7 A;  1FRW A;  1H7E A;  2FYC B;  2DPW A;  1QWJ A;  3V0O A;  2I5E A;  2XWN A;  2AM5 A;  2O1F A;  3CKJ A;  4P00 A;  1VGU A;  3U2U A;  1INJ A;  1G97 A;  1VPA A;  3U0Y A;  1YRO B;  4LW6 A;  1FR8 A;  1R7X A;  5HS2 A;  4FQW A;  1G0R A;  2VFZ A;  1W57 A;  2I7B A;  3HL3 A;  1INI A;  4YS8 A;  1H7G A;  1OQM B;  2Y4J A;  1YP4 A;  3OH3 A;  1LZJ A;  2X5S A;  4EVW A;  4NAN A;  1ZIZ A;  3D8V A;  1HM8 A;  4EE3 A;  4Q7C A;  3TQD A;  2OI7 A;  4Y7U A;  4D0T A;  2XWL A;  5CQO A;  2FYA A;  5BXC A;  3OAM A;  5L6S A;  4B4M A;  2YQH A;  1V82 A;  1W55 A;  4NAL A;  2AGD A;  3R2W A;  2WGZ A;  5JQQ A;  1XHB A;  1ZCV A;  4AC3 A;  2PA4 A;  1ZCT A;  1LL0 A;  1FWY A;  3CKV A;  2P6W A;  4FRA A;  2RJ1 A;  4CVH A;  5CMG X;  2YES A;  4Y6N A;  2QKX A;  1G95 A;  4Y64 A;  3I0H A;  1FO9 A;  1KWS A;  4M4K A;  1MP3 A;  3K8E A;  2C0N A;  3E25 A;  3T7O A;  3Q80 A;  3V0L A;  1ZJ0 A;  1TW5 A;  5C1H A;  4J18 A;  2VSI A;  3CKQ A;  2Z86 A;  3I0J A;  3OH4 A;  4ZDQ A;  4Y62 A;  1FGG A;  1R7Y A;  3IOH A;  1WSZ A;  1EYR A;  1S4N A;  1H5S D;  1G93 A;  1ZI4 A;  5C1G A;  2WVL A;  1S4P A;  1SS9 A;  3PNN A;  2Q4J A;  1FOA A;  1EZI A;  4JD0 A;  1FZW A;  4HG6 A;  4BMA A;  4D11 A;  1VH1 A;  4MND A;  4KC2 A;  4D11 C;  1ZDF A;  1R82 A;  1JVD A;  1ZJ1 A;  1R7U A;  1ZI1 A;  2AE7 A;  3DK5 A;  3E26 A;  2YC3 A;  3SX5 A;  4DE7 A;  4HOC A;  1FGX A;  1H3M A;  3SX8 A;  1GQ9 A;  4MYB A;  3I0K A;  3I0F A;  4CJB A;  2JCL A;  3SXE A;  3V90 A;  4KC1 A;  4R7P A;  1XZ6 A;  4FRE A;  3ZF8 A;  3V0N A;  3U0X A;  3F1C A;  4FCU A;  4MIX A;  1E5K A;  5IFY A;  3KIA A;  3PKQ A;  3SX7 A;  3SXG A;  4CJC A;  2VSH A;  1JYL A;  3V0P A;  1LZI A;  1JV1 A;  2V0J A;  4P02 A;  5CQL X;  2VS5 A;  2RJ6 A;  3EE5 A;  4B5B A;  2Z87 A;  5FU0 A;  1ZCU A;  1MP5 A;  3OKR A;  1H5T B;  2CU2 A;  2D7R A;  4FRQ A;  3FWW A;  3OH1 A;  2E3D A;  3T7M A;  1VH3 A;  2YQS A;  2RIZ A;  1NF5 B;  3RMW A;  3V0Q A;  4AAW A;  2OI6 A;  1TZF A;  3V91 A;  1O7O A;  1H5S B;  1VZU A;  3USR A;  3K8D A;  1GQC A;  3O3P A;  1H5S A;  3Q4S A;  2ICX A;  4KQL A;  1WT1 A;  3JUK A;  1H5S C;  2RJ8 A;  2AH9 A;  2JCK A;  5AJP A;  4UEG A;  1ZHJ A;  5C4C A;  1JVG A;  5IDS A;  2XME A;  1ON6 A;  4FIX A;  2MZB A;  1VGW A;  1YP3 A;  3U2V A;  1G23 A;  3BCV A;  4EEG A;  2FYB A;  5C49 A;  3I0C A;  4D0Z A;  1W77 A;  3SXD A;  5EJ1 A;  5IDT A;  2RIT A;  2WVK A;  2Y4K A;  3BRK X;  2Y6P A;  1HJL A;  2Y7A A;  1TVY A;  2BO8 A;  4CJ8 A;  5C3D A;  1NWG B;  4EEM A;  1H7T A;  1V83 A;  1WT0 A;  3JUJ A;  2RIY A;  3USQ A;  3NGW A;  4B3U A;  3I0I X;  1G3L A;  5CMH A;  4G3Q A;  4FRL A;  2J0B A;  1GA8 A;  1QGS A;  2RIX A;  5C8R A;  4XWI A;  3OC9 A;  1G2V A;  3U2W A;  2ZU9 A;  2UX8 A;  3IOJ A;  3JTJ A;  4NAK A;  1HM0 A;  2X60 A;  2BO7 A;  4FCE A;  4G3P A;  2YQC A;  4B2X A;  4KC4 A;  4Y7F A;  2J0A A;  3I0E A;  3U2T A;  2A8W A;  4B4B A;  1GX4 A;  1K4V A;  1JYK A;  3GUE A;  4L41 C;  1FXJ A;  2WEE A;  2FFU A;  5C36 A;  3I0G A;  4HO8 A;  3OH0 A;  1H4D A;  2OEG A;  1H7Q A;  5AJO A;  4Y7V A;  2QH5 A;  4IRP A;  4B2W A;  1I52 A;  1OMZ A;  4B4G A;  1O0R A;  1MP4 A;  3IOI A;  4FRB A;  2I5K A;  4KPX A;  3RMV A;  5L6V A;  5D91 A;  3V8Z A;  1R7T A;  1VIC A;  1H7H A;  2ZU7 A;  2APC A;  1S4O A;  1HV9 A;  5FTV A;  2AEC A;  1G8O A;  1H5R B;  1TW1 A;  2VXM A;  1H5R A;  1NKH B;  2OEF A;  4FRM A;  2AM3 A;  4AYJ A;  4O6N A;  5FUH A;  3SXA A;  3SXC A;  2QGI A;  1YP2 A;  2RJ4 A;  4HCQ A;  3I0L A;  4K6R A;  4FRO A;  3V0M A;  4BQH A;  4EEO A;  1NMM B;  2X65 A;  1GWV A;  4KNR A;  3ZLK A;  2JCO A;  2D7I A;  3Q7U A;  4KNX A;  3I0D A;  4GBP A;  5C48 A;  5CMJ A;  2AES A;  3DUV A;  4Y7G A;  4HO3 A;  1H7F A;  1V84 A;  2P73 A;  3TZT A;  3D5N A;  1IIN A;  4Y6U A;  4G3S A;  1H4C A;  3F1Y A;  5DDT A;  1H5T A;  2AM4 A;  2V0K A;  4M2B A;  5DDV A;  2WVM A;  4DDZ A;  1WT2 A;  5CQM X;  1WT3 A;  2V0I A;  4HO6 A;  1LZ0 A;  5FTS A;  1ZI5 A;  4EE5 A;  2Y4L A;  3FOQ A;  1VM8 A;  1R81 A;  3ZGF A;  2X5Z A;  4KXO A;  4KT7 A;  1IIM A;  2ZU8 A;  5AJN A;  3SX3 A;  2JCJ A;  2O1H A;  4Y7T A;  1LVW A;  3QVB A;  5C1L A;  1VGT A;  1GWW A;  3CGX A;  5CQP A;  2WE9 A;  4M28 A;  4ASJ A;  3OGZ A;  1LZ7 A;  3ST8 A;  5C4D A;  1ZDG A;  2PGY A;  2W0V A;  2GGQ A;  4IRQ A;  5EIY A;  4HO4 A;  4NAI A;  1JV3 A;  1NQI B;  4EE4 A;  2BO4 A;  1ON8 A;  1ZJO A;  1MC3 A;  2ICY A;  4M2A A;  5C47 A;  5EJZ A;  1VZX A;  3U2X A;  2BO6 A;  2YCM A;  2A8U A;  4EEA A;  3D98 A;  3DJ4 A;  4FRH A;  4ASY A;  5C3B A;  1HM9 A;  3CU0 A;  4HO5 A;  4Y63 A;  1PZT A;  2O1G A;  2VD4 A;  2VXL A;  4HO0 A;  2NXV A;  2D0J A;  4ARW A;  2E8B A;  2V0H A;  3CKN A;  2XMH A;  1NHE B;  2WAW A;  3ZGG A;  4E1K A;  5C4F A;  2Y4M A;  5I1F A;  2YC5 A;  3V8Y A;  1GX0 A;  4G87 A;  2YQJ A;  4C2S A;  1Z90 A;  4ECM A;  1QG8 A;  4JIS A;  1PZY B;  4HO9 A;  1QGQ A;  1ZCY A;  4KPZ A;  4FIY A;  5J49 A;  5C4E A;  3N9W A;  4FRD A;  2RJ5 A;  4B42 A;  1R7V A;  2VS4 A;  1WVC A;  1ZJ2 A;  2PGV A;  3R3I A;  1R80 A;  2W0W A;  1O23 B;  5D92 A;  1H4E A;  1FR9 A;  5CMI A;  1FG5 N;  3T7N A;  3CKO A;  5C38 A;  4FRP A;  5CMF X;  4DEC A;  1ZJ3 A;  2VK9 A;  1FO8 A;  5CQN X;  3OH2 A;  1ZI3 A;  1VGZ A;  1G1L A;  3LW6 A;  4KRV A;  5FV9 A;  1OMX A;  1LL3 A;  1VZT A;  2FYD B;  1LL2 A;  1FXO A;  1ZJP A;  2FFV A;  5FU8 A;  1HJJ A;  4O6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...