4FS7A

Crystal structure of a leucine-rich repeat protein (bacova_04585) from bacteroides ovatus atcc 8483 at 1.19 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
393
structure length
383
Chain Sequence
b'YDFVIDEITYNFTKEHGTVEVSGLREFLNPLVVNIPPVVTYKDNKYDVVSIGYAAFQGCRKVTEIKIPSTVREIGEFAFENCSKLEIINIPDSVKMIGRCTFSGCYALKSILLPLMLKSIGVEAFKGCDFKEITIPEGVTVIGDEAFATCESLEYVSLPDSMETLHNGLFSGCGKLKSIKLPRNLKIIRDYCFAECILLENMEFPNSLYYLGDFALSKTGVKNIIIPDSFTELGKSVFYGCTDLESISIQNNKLRIGGSLFYNCSGLKKVIYGSVIVPEKTFYGCSSLTEVKLLDSVKFIGEEAFESCTSLVSIDLPYLVEEIGKRSFRGCTSLSNINFPLSLRKIGANAFQGCINLKKVELPKRLEQYRYDFEDTTKFKWIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical leucine rich repeat protein (BACOVA_04585) from Bacteroides ovatus ATCC 8483 at 1.19 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Protein binding
total genus 128
structure length 383
sequence length 393
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fs7A00
5GQRK 1OTMA 3WN4A 4G8AA 3OGLB 3M18A 2ELLA 2P1OB 3CIGA 3ZYIA 5CMPA 4KT1A 4R6GA 1M9SA 4LSCA 4WYKA 3ULVA 1W8AA 2Z7XA 4LXRA 3VQ2A 3G3AA 3UL7A 3OJAB 4RCWA 4LI1A 1FT8A 4FMZA 3ZYNA 3UL9A 4OQTA 3WPFA 4Z94G 3WPCA 2OMYA 4FD0A 2JE1A 4LXSA 5AWAA 5D3IA 4Q3GA 1Z7XW 2XWTC 2BNHA 2R9UA 2Z82A 2IFGA 4C2AB 1XEUA 1FS2A 2WFHA 4P91A 4R09A 3C6OB 1XECA 1XWDC 3RFSA 4LSXA 5GMFA 3W3MA 3RW7A 3OGKB 2O6SA 3E4GA 1K5GC 4J4LA 3WPDA 2FT3A 1DS9A 3E2JA 4MQWX 5AZ5A 5AWDA 4B8CD 5HDHA 5B4PA 4NKGA 4PEQB 2A0ZA 2Z62A 2XOTA 4R6AA 1K5DC 3W3GA 4AW4A 4FDWA 4UFRA 4V2DA 2V9TB 3OGMB 5GMHA 5GS0A 2Z63A 2WQVA 3RGXA 1P8TA 4LSXC 4KXFB 4YEBB 1OTNA 2Z81A 4I6JB 4Q62A 3JB9j 1YRGA 4Q3IA 1GWBA 4LSAA 3W3NA 1FQVA 3ULUA 4R5DA 1U0ND 1O6SA 3DZEA 2P1QB 4QBZA 4HQ1A 3BZ5A 2V70A 4IM6A 3WPEA 3E6JA 3G04C 2O6RA 4R6FA 2OMZA 3OJAA 1IO0A 1H6TA 2OMTA 4V2EA 1A9NA 5IJCA 1OTOA 2P1PB 2RR6A 1OOKG 4XGOA 1G9UA 1OZNA 4RWTC 2JQDA 3VQ1A 5AWBA 2P1MB 4H09A 3WPHA 4FS7A 5A5CA 5LFNA 4XOSA 1FO1A 5GS2B 3W3JA 1WWLA 2Z65A 2ID5A 4C2BB 4R08A 3WPBA 2Q4GW 3M19A 3FXIA 1KOOA 4L3FA 3G39A 4V2CA 5B0NA 3RIZA 4CNCA 4R6JA 3PMHG 4BV4R 2Z64A 2RA8A 2WQWA 3TSRE 3O53A 2WQUA 5CMNA 1DFJI 1P8VA 3E3ZA 4PERA 4PQ8A 4Z8GA 2JE0A 2OMVA 3SB4A 3UN9A 5AWCA 1KOHA 1H6UA 4BSRA 2OMXA 3W3KA 3C6PB 4TZHA 4EZGA 4MN8B 2O6QA 3P72A 5GMGA 1D0BA 3WPGA 4QXEA 3KJ4A 4U08A 5IYXC 5IJBA 1PGVA 4K17A 4PSJA 2OMUA 1XCDA 4Z64C 4XSQA 3CIYA 4Y61B 4CC4A 2CA6A 3REZA 1QYYA 1A4YA 2ASSB 5B0TA 3RFJA 4J0MA 2UZYA 5FTTB 3G3BA 4QC0A 3ZYJA 1P9AG 3RW6A 4AY9X 3WPIA 4GLPA 3ULAA 1M10B 4U7LA 2Z7XB 1DCEA 2OMWA 4CC4C 4WP6A 4U09A 4ARNA 1M9LA 4Z61C 4FHOA 3RJ0A 1M0ZA 4GT6A 4M7EA 1JL5A 4BSSA 2V9SA 4L3AA 2Z66A 2BEXA 4R07A 1LTXA 1SQ0B 4NKHA 1OGQA 1O6VA 4Z79A 4P8SA 3W3LA 4BSUA 2P1NB 1XKUA 3RGZA 4R58A 4RCAB 2UZXA 3C6NB 3ZYOA 1ZIWA 2Y5QA 4ARRA 3GOZA 5IJDA 4CILA 4CNMA 2ASTB 2WQXA 4KNGA 4FCGA 4M7EC 3UL8A 4LI2A 4PKIG 3CVRA 3O6NA 4R5CA 3RFEA 4CP6A 4ECNA 4R0AA 3G06A 4U06A 1O6TA 5HZLB 3A79B 4ECOA
chains in the Genus database with same CATH superfamily
5GQRK 1OTMA 3WN4A 4G8AA 3OGLB 3M18A 2ELLA 2P1OB 3CIGA 3ZYIA 5CMPA 4KT1A 4R6GA 1M9SA 4LSCA 4WYKA 3ULVA 1W8AA 2Z7XA 4LXRA 3VQ2A 3G3AA 3UL7A 3OJAB 4RCWA 4NZTM 4LI1A 1FT8A 4FMZA 3ZYNA 3UL9A 4OQTA 3WPFA 4Z94G 3WPCA 2OMYA 4FD0A 2JE1A 4LXSA 5AWAA 5D3IA 4Q3GA 1Z7XW 2XWTC 2BNHA 2R9UA 2Z82A 2IFGA 4C2AB 1XEUA 1FS2A 2WFHA 4P91A 4R09A 3C6OB 1XECA 1XWDC 3RFSA 4LSXA 5GMFA 3W3MA 3RW7A 3OGKB 2O6SA 3E4GA 1K5GC 4J4LA 3WPDA 2FT3A 1DS9A 3E2JA 4MQWX 5AZ5A 5AWDA 4B8CD 5HDHA 5B4PA 4NKGA 4PEQB 2A0ZA 2Z62A 2XOTA 4R6AA 1K5DC 3W3GA 4AW4A 4FDWA 4UFRA 4V2DA 2V9TB 3OGMB 5GMHA 5GS0A 2Z63A 2WQVA 3RGXA 1P8TA 4LSXC 4KXFB 4YEBB 1OTNA 2Z81A 4I6JB 4Q62A 3JB9j 1YRGA 4Q3IA 1GWBA 4LSAA 3W3NA 1FQVA 3ULUA 4R5DA 1U0ND 1O6SA 3DZEA 2P1QB 4QBZA 4HQ1A 3BZ5A 2V70A 4IM6A 3WPEA 3E6JA 3G04C 2O6RA 4R6FA 2OMZA 3OJAA 1IO0A 1H6TA 2OMTA 4V2EA 1A9NA 5IJCA 1OTOA 2P1PB 2RR6A 1OOKG 4XGOA 1G9UA 1OZNA 4RWTC 2JQDA 3VQ1A 5AWBA 2P1MB 4H09A 3WPHA 4FS7A 5A5CA 5LFNA 4XOSA 1FO1A 5GS2B 3W3JA 1WWLA 2Z65A 2ID5A 4C2BB 4R08A 3WPBA 2Q4GW 3M19A 3FXIA 1KOOA 4L3FA 3G39A 4V2CA 5B0NA 3RIZA 4CNCA 4R6JA 3PMHG 4BV4R 2Z64A 2RA8A 2WQWA 3TSRE 3O53A 2WQUA 5CMNA 1DFJI 1P8VA 3E3ZA 4PERA 4PQ8A 4Z8GA 2JE0A 2OMVA 3SB4A 3UN9A 5AWCA 1KOHA 1H6UA 4BSRA 2OMXA 3W3KA 3C6PB 4TZHA 4EZGA 4MN8B 2O6QA 3P72A 5GMGA 1D0BA 3WPGA 4QXEA 3KJ4A 4U08A 5IYXC 5IJBA 1PGVA 4K17A 4PSJA 2OMUA 1XCDA 4Z64C 4XSQA 3CIYA 4Y61B 4CC4A 2CA6A 3REZA 1QYYA 1A4YA 2ASSB 5B0TA 3RFJA 4J0MA 2UZYA 5FTTB 3G3BA 4QC0A 3ZYJA 1P9AG 3RW6A 4AY9X 3WPIA 4GLPA 3ULAA 1M10B 4U7LA 2Z7XB 1DCEA 2OMWA 4CC4C 4WP6A 4U09A 4ARNA 1M9LA 4Z61C 4FHOA 3RJ0A 1M0ZA 4GT6A 4M7EA 1JL5A 4BSSA 2V9SA 4L3AA 4NZRM 2Z66A 2BEXA 4R07A 1LTXA 1SQ0B 4NKHA 1OGQA 1O6VA 4Z79A 4P8SA 3W3LA 4BSUA 2P1NB 1XKUA 3RGZA 4R58A 4RCAB 2UZXA 3C6NB 3ZYOA 1ZIWA 2Y5QA 4ARRA 3GOZA 5IJDA 4CILA 4CNMA 2ASTB 2WQXA 4KNGA 4FCGA 4M7EC 3UL8A 4LI2A 4PKIG 3CVRA 3O6NA 4R5CA 3RFEA 4CP6A 4ECNA 4R0AA 3G06A 4U06A 1O6TA 5HZLB 3A79B 4ECOA
chains in the Genus database with same CATH topology
5GQRK 1OTMA 3WN4A 4G8AA 3OGLB 3M18A 2ELLA 2P1OB 3CIGA 3ZYIA 5CMPA 4KT1A 4R6GA 1M9SA 4LSCA 4WYKA 3ULVA 1W8AA 2Z7XA 4LXRA 3VQ2A 3G3AA 3UL7A 3OJAB 4RCWA 4LI1A 1FT8A 4FMZA 3ZYNA 3UL9A 4OQTA 3WPFA 4Z94G 3WPCA 2OMYA 4FD0A 2JE1A 4LXSA 5AWAA 5D3IA 4Q3GA 1Z7XW 2XWTC 2BNHA 2R9UA 2Z82A 2IFGA 4C2AB 1XEUA 1FS2A 2WFHA 4P91A 4R09A 3C6OB 1XECA 1XWDC 3RFSA 4LSXA 5GMFA 3W3MA 3RW7A 3OGKB 2O6SA 3E4GA 1K5GC 4J4LA 3WPDA 2FT3A 1DS9A 3E2JA 4MQWX 5AZ5A 5AWDA 4B8CD 5HDHA 5B4PA 4NKGA 4PEQB 2A0ZA 2Z62A 2XOTA 4R6AA 1K5DC 3W3GA 4AW4A 4FDWA 4UFRA 4V2DA 2V9TB 3OGMB 5GMHA 5GS0A 2Z63A 2WQVA 3RGXA 1P8TA 4LSXC 4KXFB 4YEBB 1OTNA 2Z81A 4I6JB 4Q62A 3JB9j 1YRGA 4Q3IA 1GWBA 4LSAA 3W3NA 1FQVA 3ULUA 4R5DA 1U0ND 1O6SA 3DZEA 2P1QB 4QBZA 4HQ1A 3BZ5A 2V70A 4IM6A 3WPEA 3E6JA 3G04C 2O6RA 4R6FA 2OMZA 3OJAA 1IO0A 1H6TA 2OMTA 4V2EA 1A9NA 5IJCA 1OTOA 2P1PB 2RR6A 1OOKG 4XGOA 1G9UA 1OZNA 4RWTC 2JQDA 3VQ1A 5AWBA 2P1MB 4H09A 3WPHA 4FS7A 5A5CA 5LFNA 4XOSA 1FO1A 5GS2B 3W3JA 1WWLA 2Z65A 2ID5A 4C2BB 4R08A 3WPBA 2Q4GW 3M19A 3FXIA 1KOOA 4L3FA 3G39A 4V2CA 5B0NA 3RIZA 4CNCA 4R6JA 3PMHG 4BV4R 2Z64A 2RA8A 2WQWA 3TSRE 3O53A 2WQUA 5CMNA 1DFJI 1P8VA 3E3ZA 4PERA 4PQ8A 4Z8GA 2JE0A 2OMVA 3SB4A 3UN9A 5AWCA 1KOHA 1H6UA 4BSRA 2OMXA 3W3KA 3C6PB 4TZHA 4EZGA 4MN8B 2O6QA 3P72A 5GMGA 1D0BA 3WPGA 4QXEA 3KJ4A 4U08A 5IYXC 5IJBA 1PGVA 4K17A 4PSJA 2OMUA 1XCDA 4Z64C 4XSQA 3CIYA 4Y61B 4CC4A 2CA6A 3REZA 1QYYA 1A4YA 2ASSB 5B0TA 3RFJA 4J0MA 2UZYA 5FTTB 3G3BA 4QC0A 3ZYJA 1P9AG 3RW6A 4AY9X 3WPIA 4GLPA 3ULAA 1M10B 4U7LA 2Z7XB 1DCEA 2OMWA 4CC4C 4WP6A 4U09A 4ARNA 1M9LA 4Z61C 4FHOA 3RJ0A 1M0ZA 4GT6A 4M7EA 1JL5A 4BSSA 2V9SA 4L3AA 2Z66A 2BEXA 4R07A 1LTXA 1SQ0B 4NKHA 1OGQA 1O6VA 4Z79A 4P8SA 3W3LA 4BSUA 2P1NB 1XKUA 3RGZA 4R58A 4RCAB 2UZXA 3C6NB 3ZYOA 1ZIWA 2Y5QA 4ARRA 3GOZA 5IJDA 4CILA 4CNMA 2ASTB 2WQXA 4KNGA 4FCGA 4M7EC 3UL8A 4LI2A 4PKIG 3CVRA 3O6NA 4R5CA 3RFEA 4CP6A 4ECNA 4R0AA 3G06A 4U06A 1O6TA 5HZLB 3A79B 4ECOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQR K;  1OTM A;  3WN4 A;  4G8A A;  3OGL B;  3M18 A;  2ELL A;  2P1O B;  3CIG A;  3ZYI A;  5CMP A;  4KT1 A;  4R6G A;  1M9S A;  4LSC A;  4WYK A;  3ULV A;  1W8A A;  2Z7X A;  4LXR A;  3VQ2 A;  3G3A A;  3UL7 A;  3OJA B;  4RCW A;  4LI1 A;  1FT8 A;  4FMZ A;  3ZYN A;  3UL9 A;  4OQT A;  3WPF A;  4Z94 G;  3WPC A;  2OMY A;  4FD0 A;  2JE1 A;  4LXS A;  5AWA A;  5D3I A;  4Q3G A;  1Z7X W;  2XWT C;  2BNH A;  2R9U A;  2Z82 A;  2IFG A;  4C2A B;  1XEU A;  1FS2 A;  2WFH A;  4P91 A;  4R09 A;  3C6O B;  1XEC A;  1XWD C;  3RFS A;  4LSX A;  5GMF A;  3W3M A;  3RW7 A;  3OGK B;  2O6S A;  3E4G A;  1K5G C;  4J4L A;  3WPD A;  2FT3 A;  1DS9 A;  3E2J A;  4MQW X;  5AZ5 A;  5AWD A;  4B8C D;  5HDH A;  5B4P A;  4NKG A;  4PEQ B;  2A0Z A;  2Z62 A;  2XOT A;  4R6A A;  1K5D C;  3W3G A;  4AW4 A;  4FDW A;  4UFR A;  4V2D A;  2V9T B;  3OGM B;  5GMH A;  5GS0 A;  2Z63 A;  2WQV A;  3RGX A;  1P8T A;  4LSX C;  4KXF B;  4YEB B;  1OTN A;  2Z81 A;  4I6J B;  4Q62 A;  3JB9 j;  1YRG A;  4Q3I A;  1GWB A;  4LSA A;  3W3N A;  1FQV A;  3ULU A;  4R5D A;  1U0N D;  1O6S A;  3DZE A;  2P1Q B;  4QBZ A;  4HQ1 A;  3BZ5 A;  2V70 A;  4IM6 A;  3WPE A;  3E6J A;  3G04 C;  2O6R A;  4R6F A;  2OMZ A;  3OJA A;  1IO0 A;  1H6T A;  2OMT A;  4V2E A;  1A9N A;  5IJC A;  1OTO A;  2P1P B;  2RR6 A;  1OOK G;  4XGO A;  1G9U A;  1OZN A;  4RWT C;  2JQD A;  3VQ1 A;  5AWB A;  2P1M B;  4H09 A;  3WPH A;  4FS7 A;  5A5C A;  5LFN A;  4XOS A;  1FO1 A;  5GS2 B;  3W3J A;  1WWL A;  2Z65 A;  2ID5 A;  4C2B B;  4R08 A;  3WPB A;  2Q4G W;  3M19 A;  3FXI A;  1KOO A;  4L3F A;  3G39 A;  4V2C A;  5B0N A;  3RIZ A;  4CNC A;  4R6J A;  3PMH G;  4BV4 R;  2Z64 A;  2RA8 A;  2WQW A;  3TSR E;  3O53 A;  2WQU A;  5CMN A;  1DFJ I;  1P8V A;  3E3Z A;  4PER A;  4PQ8 A;  4Z8G A;  2JE0 A;  2OMV A;  3SB4 A;  3UN9 A;  5AWC A;  1KOH A;  1H6U A;  4BSR A;  2OMX A;  3W3K A;  3C6P B;  4TZH A;  4EZG A;  4MN8 B;  2O6Q A;  3P72 A;  5GMG A;  1D0B A;  3WPG A;  4QXE A;  3KJ4 A;  4U08 A;  5IYX C;  5IJB A;  1PGV A;  4K17 A;  4PSJ A;  2OMU A;  1XCD A;  4Z64 C;  4XSQ A;  3CIY A;  4Y61 B;  4CC4 A;  2CA6 A;  3REZ A;  1QYY A;  1A4Y A;  2ASS B;  5B0T A;  3RFJ A;  4J0M A;  2UZY A;  5FTT B;  3G3B A;  4QC0 A;  3ZYJ A;  1P9A G;  3RW6 A;  4AY9 X;  3WPI A;  4GLP A;  3ULA A;  1M10 B;  4U7L A;  2Z7X B;  1DCE A;  2OMW A;  4CC4 C;  4WP6 A;  4U09 A;  4ARN A;  1M9L A;  4Z61 C;  4FHO A;  3RJ0 A;  1M0Z A;  4GT6 A;  4M7E A;  1JL5 A;  4BSS A;  2V9S A;  4L3A A;  2Z66 A;  2BEX A;  4R07 A;  1LTX A;  1SQ0 B;  4NKH A;  1OGQ A;  1O6V A;  4Z79 A;  4P8S A;  3W3L A;  4BSU A;  2P1N B;  1XKU A;  3RGZ A;  4R58 A;  4RCA B;  2UZX A;  3C6N B;  3ZYO A;  1ZIW A;  2Y5Q A;  4ARR A;  3GOZ A;  5IJD A;  4CIL A;  4CNM A;  2AST B;  2WQX A;  4KNG A;  4FCG A;  4M7E C;  3UL8 A;  4LI2 A;  4PKI G;  3CVR A;  3O6N A;  4R5C A;  3RFE A;  4CP6 A;  4ECN A;  4R0A A;  3G06 A;  4U06 A;  1O6T A;  5HZL B;  3A79 B;  4ECO A; 
#chains in the Genus database with same CATH topology
 5GQR K;  1OTM A;  3WN4 A;  4G8A A;  3OGL B;  3M18 A;  2ELL A;  2P1O B;  3CIG A;  3ZYI A;  5CMP A;  4KT1 A;  4R6G A;  1M9S A;  4LSC A;  4WYK A;  3ULV A;  1W8A A;  2Z7X A;  4LXR A;  3VQ2 A;  3G3A A;  3UL7 A;  3OJA B;  4RCW A;  4NZT M;  4LI1 A;  1FT8 A;  4FMZ A;  3ZYN A;  3UL9 A;  4OQT A;  3WPF A;  4Z94 G;  3WPC A;  2OMY A;  4FD0 A;  2JE1 A;  4LXS A;  5AWA A;  5D3I A;  4Q3G A;  1Z7X W;  2XWT C;  2BNH A;  2R9U A;  2Z82 A;  2IFG A;  4C2A B;  1XEU A;  1FS2 A;  2WFH A;  4P91 A;  4R09 A;  3C6O B;  1XEC A;  1XWD C;  3RFS A;  4LSX A;  5GMF A;  3W3M A;  3RW7 A;  3OGK B;  2O6S A;  3E4G A;  1K5G C;  4J4L A;  3WPD A;  2FT3 A;  1DS9 A;  3E2J A;  4MQW X;  5AZ5 A;  5AWD A;  4B8C D;  5HDH A;  5B4P A;  4NKG A;  4PEQ B;  2A0Z A;  2Z62 A;  2XOT A;  4R6A A;  1K5D C;  3W3G A;  4AW4 A;  4FDW A;  4UFR A;  4V2D A;  2V9T B;  3OGM B;  5GMH A;  5GS0 A;  2Z63 A;  2WQV A;  3RGX A;  1P8T A;  4LSX C;  4KXF B;  4YEB B;  1OTN A;  2Z81 A;  4I6J B;  4Q62 A;  3JB9 j;  1YRG A;  4Q3I A;  1GWB A;  4LSA A;  3W3N A;  1FQV A;  3ULU A;  4R5D A;  1U0N D;  1O6S A;  3DZE A;  2P1Q B;  4QBZ A;  4HQ1 A;  3BZ5 A;  2V70 A;  4IM6 A;  3WPE A;  3E6J A;  3G04 C;  2O6R A;  4R6F A;  2OMZ A;  3OJA A;  1IO0 A;  1H6T A;  2OMT A;  4V2E A;  1A9N A;  5IJC A;  1OTO A;  2P1P B;  2RR6 A;  1OOK G;  4XGO A;  1G9U A;  1OZN A;  4RWT C;  2JQD A;  3VQ1 A;  5AWB A;  2P1M B;  4H09 A;  3WPH A;  4FS7 A;  5A5C A;  5LFN A;  4XOS A;  1FO1 A;  5GS2 B;  3W3J A;  1WWL A;  2Z65 A;  2ID5 A;  4C2B B;  4R08 A;  3WPB A;  2Q4G W;  3M19 A;  3FXI A;  1KOO A;  4L3F A;  3G39 A;  4V2C A;  5B0N A;  3RIZ A;  4CNC A;  4R6J A;  3PMH G;  4BV4 R;  2Z64 A;  2RA8 A;  2WQW A;  3TSR E;  3O53 A;  2WQU A;  5CMN A;  1DFJ I;  1P8V A;  3E3Z A;  4PER A;  4PQ8 A;  4Z8G A;  2JE0 A;  2OMV A;  3SB4 A;  3UN9 A;  5AWC A;  1KOH A;  1H6U A;  4BSR A;  2OMX A;  3W3K A;  3C6P B;  4TZH A;  4EZG A;  4MN8 B;  2O6Q A;  3P72 A;  5GMG A;  1D0B A;  3WPG A;  4QXE A;  3KJ4 A;  4U08 A;  5IYX C;  5IJB A;  1PGV A;  4K17 A;  4PSJ A;  2OMU A;  1XCD A;  4Z64 C;  4XSQ A;  3CIY A;  4Y61 B;  4CC4 A;  2CA6 A;  3REZ A;  1QYY A;  1A4Y A;  2ASS B;  5B0T A;  3RFJ A;  4J0M A;  2UZY A;  5FTT B;  3G3B A;  4QC0 A;  3ZYJ A;  1P9A G;  3RW6 A;  4AY9 X;  3WPI A;  4GLP A;  3ULA A;  1M10 B;  4U7L A;  2Z7X B;  1DCE A;  2OMW A;  4CC4 C;  4WP6 A;  4U09 A;  4ARN A;  1M9L A;  4Z61 C;  4FHO A;  3RJ0 A;  1M0Z A;  4GT6 A;  4M7E A;  1JL5 A;  4BSS A;  2V9S A;  4L3A A;  4NZR M;  2Z66 A;  2BEX A;  4R07 A;  1LTX A;  1SQ0 B;  4NKH A;  1OGQ A;  1O6V A;  4Z79 A;  4P8S A;  3W3L A;  4BSU A;  2P1N B;  1XKU A;  3RGZ A;  4R58 A;  4RCA B;  2UZX A;  3C6N B;  3ZYO A;  1ZIW A;  2Y5Q A;  4ARR A;  3GOZ A;  5IJD A;  4CIL A;  4CNM A;  2AST B;  2WQX A;  4KNG A;  4FCG A;  4M7E C;  3UL8 A;  4LI2 A;  4PKI G;  3CVR A;  3O6N A;  4R5C A;  3RFE A;  4CP6 A;  4ECN A;  4R0A A;  3G06 A;  4U06 A;  1O6T A;  5HZL B;  3A79 B;  4ECO A; 
#chains in the Genus database with same CATH homology
 5GQR K;  1OTM A;  3WN4 A;  4G8A A;  3OGL B;  3M18 A;  2ELL A;  2P1O B;  3CIG A;  3ZYI A;  5CMP A;  4KT1 A;  4R6G A;  1M9S A;  4LSC A;  4WYK A;  3ULV A;  1W8A A;  2Z7X A;  4LXR A;  3VQ2 A;  3G3A A;  3UL7 A;  3OJA B;  4RCW A;  4LI1 A;  1FT8 A;  4FMZ A;  3ZYN A;  3UL9 A;  4OQT A;  3WPF A;  4Z94 G;  3WPC A;  2OMY A;  4FD0 A;  2JE1 A;  4LXS A;  5AWA A;  5D3I A;  4Q3G A;  1Z7X W;  2XWT C;  2BNH A;  2R9U A;  2Z82 A;  2IFG A;  4C2A B;  1XEU A;  1FS2 A;  2WFH A;  4P91 A;  4R09 A;  3C6O B;  1XEC A;  1XWD C;  3RFS A;  4LSX A;  5GMF A;  3W3M A;  3RW7 A;  3OGK B;  2O6S A;  3E4G A;  1K5G C;  4J4L A;  3WPD A;  2FT3 A;  1DS9 A;  3E2J A;  4MQW X;  5AZ5 A;  5AWD A;  4B8C D;  5HDH A;  5B4P A;  4NKG A;  4PEQ B;  2A0Z A;  2Z62 A;  2XOT A;  4R6A A;  1K5D C;  3W3G A;  4AW4 A;  4FDW A;  4UFR A;  4V2D A;  2V9T B;  3OGM B;  5GMH A;  5GS0 A;  2Z63 A;  2WQV A;  3RGX A;  1P8T A;  4LSX C;  4KXF B;  4YEB B;  1OTN A;  2Z81 A;  4I6J B;  4Q62 A;  3JB9 j;  1YRG A;  4Q3I A;  1GWB A;  4LSA A;  3W3N A;  1FQV A;  3ULU A;  4R5D A;  1U0N D;  1O6S A;  3DZE A;  2P1Q B;  4QBZ A;  4HQ1 A;  3BZ5 A;  2V70 A;  4IM6 A;  3WPE A;  3E6J A;  3G04 C;  2O6R A;  4R6F A;  2OMZ A;  3OJA A;  1IO0 A;  1H6T A;  2OMT A;  4V2E A;  1A9N A;  5IJC A;  1OTO A;  2P1P B;  2RR6 A;  1OOK G;  4XGO A;  1G9U A;  1OZN A;  4RWT C;  2JQD A;  3VQ1 A;  5AWB A;  2P1M B;  4H09 A;  3WPH A;  4FS7 A;  5A5C A;  5LFN A;  4XOS A;  1FO1 A;  5GS2 B;  3W3J A;  1WWL A;  2Z65 A;  2ID5 A;  4C2B B;  4R08 A;  3WPB A;  2Q4G W;  3M19 A;  3FXI A;  1KOO A;  4L3F A;  3G39 A;  4V2C A;  5B0N A;  3RIZ A;  4CNC A;  4R6J A;  3PMH G;  4BV4 R;  2Z64 A;  2RA8 A;  2WQW A;  3TSR E;  3O53 A;  2WQU A;  5CMN A;  1DFJ I;  1P8V A;  3E3Z A;  4PER A;  4PQ8 A;  4Z8G A;  2JE0 A;  2OMV A;  3SB4 A;  3UN9 A;  5AWC A;  1KOH A;  1H6U A;  4BSR A;  2OMX A;  3W3K A;  3C6P B;  4TZH A;  4EZG A;  4MN8 B;  2O6Q A;  3P72 A;  5GMG A;  1D0B A;  3WPG A;  4QXE A;  3KJ4 A;  4U08 A;  5IYX C;  5IJB A;  1PGV A;  4K17 A;  4PSJ A;  2OMU A;  1XCD A;  4Z64 C;  4XSQ A;  3CIY A;  4Y61 B;  4CC4 A;  2CA6 A;  3REZ A;  1QYY A;  1A4Y A;  2ASS B;  5B0T A;  3RFJ A;  4J0M A;  2UZY A;  5FTT B;  3G3B A;  4QC0 A;  3ZYJ A;  1P9A G;  3RW6 A;  4AY9 X;  3WPI A;  4GLP A;  3ULA A;  1M10 B;  4U7L A;  2Z7X B;  1DCE A;  2OMW A;  4CC4 C;  4WP6 A;  4U09 A;  4ARN A;  1M9L A;  4Z61 C;  4FHO A;  3RJ0 A;  1M0Z A;  4GT6 A;  4M7E A;  1JL5 A;  4BSS A;  2V9S A;  4L3A A;  2Z66 A;  2BEX A;  4R07 A;  1LTX A;  1SQ0 B;  4NKH A;  1OGQ A;  1O6V A;  4Z79 A;  4P8S A;  3W3L A;  4BSU A;  2P1N B;  1XKU A;  3RGZ A;  4R58 A;  4RCA B;  2UZX A;  3C6N B;  3ZYO A;  1ZIW A;  2Y5Q A;  4ARR A;  3GOZ A;  5IJD A;  4CIL A;  4CNM A;  2AST B;  2WQX A;  4KNG A;  4FCG A;  4M7E C;  3UL8 A;  4LI2 A;  4PKI G;  3CVR A;  3O6N A;  4R5C A;  3RFE A;  4CP6 A;  4ECN A;  4R0A A;  3G06 A;  4U06 A;  1O6T A;  5HZL B;  3A79 B;  4ECO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...