4FS7A

Crystal structure of a leucine-rich repeat protein (bacova_04585) from bacteroides ovatus atcc 8483 at 1.19 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
393
structure length
383
Chain Sequence
YDFVIDEITYNFTKEHGTVEVSGLREFLNPLVVNIPPVVTYKDNKYDVVSIGYAAFQGCRKVTEIKIPSTVREIGEFAFENCSKLEIINIPDSVKMIGRCTFSGCYALKSILLPLMLKSIGVEAFKGCDFKEITIPEGVTVIGDEAFATCESLEYVSLPDSMETLHNGLFSGCGKLKSIKLPRNLKIIRDYCFAECILLENMEFPNSLYYLGDFALSKTGVKNIIIPDSFTELGKSVFYGCTDLESISIQNNKLRIGGSLFYNCSGLKKVIYGSVIVPEKTFYGCSSLTEVKLLDSVKFIGEEAFESCTSLVSIDLPYLVEEIGKRSFRGCTSLSNINFPLSLRKIGANAFQGCINLKKVELPKRLEQYRYDFEDTTKFKWIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical leucine rich repeat protein (BACOVA_04585) from Bacteroides ovatus ATCC 8483 at 1.19 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Protein binding
total genus 128
structure length 383
sequence length 393
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fs7A00
4FS7A 5GQRK 4BSRA 2O6QA 1OZNA 4FHOA 2Z65A 5GS0A 2V9SA 4R08A 2Z66A 4Z79A 4PERA 2Z63A 2OMYA 2WQXA 1QYYA 4ARRA 2CA6A 2O6SA 4RWTC 1ZIWA 4R6FA 4AW4A 1A9NA 2ASSB 1XCDA 3ULVA 3UN9A 1KOHA 4PEQB 1KOOA 1U0ND 5GMFA 4L3FA 4BSSA 5FTTB 3GOZA 5CMPA 2RR6A 3C6PB 1W8AA 1O6SA 2OMZA 4KNGA 1H6TA 3C6OB 3RFEA 3G3AA 5GMHA 2XOTA 4R09A 4LSCA 4KXFB 4V2CA 2ASTB 3W3JA 3E4GA 5AWCA 1FT8A 1XECA 3RIZA 2Z82A 3OJAB 2BNHA 2OMXA 1IO0A 2JE1A 3RGZA 3G04C 2OMUA 3W3LA 4BSUA 4Z8GA 3WPHA 5AWBA 3WPFA 3G3BA 4PSJA 1OTNA 2BEXA 4PKIG 4AY9X 1G9UA 1XEUA 2Z64A 5D3IA 2IFGA 5IYXC 4TZHA 4M7EC 4RCAB 2UZYA 4CP6A 4CILA 2Z7XA 3WPGA 4J4LA 4Y61B 1XKUA 4M7EA 2WFHA 2P1OB 3RW6A 3JB9j 5B4PA 4PQ8A 1P8TA 4FD0A 4IM6A 2Z62A 5AWAA 1Z7XW 4XOSA 5IJCA 4XGOA 2RA8A 3UL8A 1M9SA 4WYKA 3G39A 1DFJI 3W3MA 3M19A 1YRGA 4QXEA 3OJAA 4ARNA 3RW7A 3UL7A 4R5DA 3WN4A 2WQWA 3ZYNA 4WP6A 3W3NA 4GT6A 1H6UA 4CNCA 1D0BA 4LSXC 4QC0A 1WWLA 4FDWA 2Y5QA 2JQDA 4V2DA 4ECOA 4NKHA 4LSXA 4UFRA 4U06A 3E3ZA 4R6JA 4U09A 1O6TA 4I6JB 4ECNA 4OQTA 4Q3GA 1K5GC 4LI2A 1OTMA 1GWBA 2R9UA 4FCGA 4KT1A 1O6VA 4LSAA 4CC4A 1OTOA 4HQ1A 3M18A 2A0ZA 4R5CA 3VQ1A 5IJDA 3W3KA 4Q62A 5GS2B 1FO1A 3SB4A 1M0ZA 4K17A 3WPCA 5GMGA 5CMNA 1SQ0B 3A79B 4R0AA 1DCEA 3WPBA 4B8CD 3W3GA 4Z64C 4YEBB 1K5DC 2P1NB 2P1MB 3WPIA 3ZYJA 3C6NB 1A4YA 2V70A 5HDHA 3WPDA 4Z61C 4NKGA 1DS9A 2JE0A 4P8SA 4BV4R 1JL5A 4QBZA 2OMWA 3REZA 3KJ4A 3RJ0A 2P1QB 1M10B 4L3AA 4RCWA 4R6AA 2O6RA 4C2BB 2ELLA 4XSQA 3G06A 3UL9A 3PMHG 3O53A 1FS2A 1OGQA 2Q4GW 3OGKB 2Z81A 5A5CA 5HZLB 4LXRA 4MQWX 5B0NA 4H09A 2WQVA 1M9LA 2ID5A 5B0TA 4Q3IA 4LI1A 3P72A 2Z7XB 1P8VA 3O6NA 4R07A 2UZXA 5LFNA 4V2EA 1PGVA 4CC4C 4P91A 3CIGA 2OMTA 1P9AG 4CNMA 4GLPA 4C2AB 1FQVA 2V9TB 3RGXA 2XWTC 4G8AA 4R6GA 3OGLB 3ULUA 3TSRE 2FT3A 3OGMB 4MN8B 5IJBA 3RFSA 3E6JA 3DZEA 1OOKG 3CIYA 2OMVA 4J0MA 4U08A 4R58A 4EZGA 2WQUA 4FMZA 3ULAA 3CVRA 3E2JA 1XWDC 1LTXA 3ZYIA 3VQ2A 3FXIA 4U7LA 3BZ5A 4LXSA 5AZ5A 2P1PB 3ZYOA 4Z94G 3RFJA 3WPEA 5AWDA
chains in the Genus database with same CATH superfamily
4FS7A 5GQRK 4BSRA 2O6QA 1OZNA 4FHOA 2Z65A 5GS0A 2V9SA 4R08A 2Z66A 4Z79A 4PERA 2Z63A 2OMYA 2WQXA 1QYYA 4ARRA 2CA6A 2O6SA 4RWTC 1ZIWA 4R6FA 4AW4A 1A9NA 2ASSB 1XCDA 3ULVA 3UN9A 1KOHA 4PEQB 1KOOA 1U0ND 5GMFA 4L3FA 4BSSA 5FTTB 3GOZA 5CMPA 2RR6A 3C6PB 1W8AA 1O6SA 2OMZA 4KNGA 1H6TA 3C6OB 3RFEA 3G3AA 5GMHA 2XOTA 4R09A 4LSCA 4KXFB 4V2CA 2ASTB 3W3JA 3E4GA 5AWCA 1FT8A 1XECA 3RIZA 2Z82A 3OJAB 2BNHA 2OMXA 1IO0A 2JE1A 3RGZA 3G04C 2OMUA 3W3LA 4BSUA 4Z8GA 3WPHA 5AWBA 3WPFA 3G3BA 4PSJA 1OTNA 2BEXA 4PKIG 4AY9X 1G9UA 1XEUA 2Z64A 5D3IA 2IFGA 5IYXC 4TZHA 4M7EC 4RCAB 2UZYA 4CP6A 4CILA 2Z7XA 3WPGA 4J4LA 4Y61B 1XKUA 4M7EA 2WFHA 2P1OB 3RW6A 3JB9j 5B4PA 4PQ8A 1P8TA 4FD0A 4IM6A 2Z62A 5AWAA 1Z7XW 4XOSA 5IJCA 4XGOA 2RA8A 3UL8A 1M9SA 4WYKA 3G39A 1DFJI 3W3MA 3M19A 1YRGA 4QXEA 3OJAA 4ARNA 3RW7A 3UL7A 4R5DA 3WN4A 2WQWA 3ZYNA 4WP6A 3W3NA 4GT6A 1H6UA 4CNCA 1D0BA 4LSXC 4QC0A 1WWLA 4FDWA 2Y5QA 2JQDA 4V2DA 4ECOA 4NKHA 4LSXA 4UFRA 4U06A 3E3ZA 4R6JA 4U09A 1O6TA 4I6JB 4ECNA 4OQTA 4Q3GA 1K5GC 4LI2A 1OTMA 1GWBA 2R9UA 4FCGA 4KT1A 1O6VA 4LSAA 4CC4A 1OTOA 4HQ1A 3M18A 2A0ZA 4R5CA 3VQ1A 5IJDA 3W3KA 4Q62A 5GS2B 1FO1A 3SB4A 1M0ZA 4K17A 3WPCA 5GMGA 5CMNA 1SQ0B 3A79B 4R0AA 1DCEA 3WPBA 4B8CD 3W3GA 4Z64C 4YEBB 1K5DC 2P1NB 2P1MB 3WPIA 3ZYJA 4NZRM 3C6NB 1A4YA 2V70A 5HDHA 3WPDA 4Z61C 4NKGA 1DS9A 2JE0A 4P8SA 4BV4R 1JL5A 4QBZA 2OMWA 3REZA 3KJ4A 3RJ0A 2P1QB 1M10B 4L3AA 4RCWA 4R6AA 2O6RA 4C2BB 2ELLA 4XSQA 3G06A 3UL9A 3PMHG 3O53A 1FS2A 1OGQA 2Q4GW 3OGKB 2Z81A 5A5CA 5HZLB 4LXRA 4MQWX 5B0NA 4H09A 2WQVA 1M9LA 2ID5A 5B0TA 4Q3IA 4LI1A 3P72A 2Z7XB 1P8VA 3O6NA 4R07A 2UZXA 5LFNA 4V2EA 1PGVA 4CC4C 4P91A 3CIGA 2OMTA 1P9AG 4CNMA 4GLPA 4C2AB 1FQVA 2V9TB 3RGXA 2XWTC 4G8AA 4R6GA 3OGLB 4NZTM 3ULUA 3TSRE 2FT3A 3OGMB 4MN8B 5IJBA 3RFSA 3E6JA 3DZEA 1OOKG 3CIYA 2OMVA 4J0MA 4U08A 4R58A 4EZGA 2WQUA 4FMZA 3ULAA 3CVRA 3E2JA 1XWDC 1LTXA 3ZYIA 3VQ2A 3FXIA 4U7LA 3BZ5A 4LXSA 5AZ5A 2P1PB 3ZYOA 4Z94G 3RFJA 3WPEA 5AWDA
chains in the Genus database with same CATH topology
4FS7A 5GQRK 4BSRA 2O6QA 1OZNA 4FHOA 2Z65A 5GS0A 2V9SA 4R08A 2Z66A 4Z79A 4PERA 2Z63A 2OMYA 2WQXA 1QYYA 4ARRA 2CA6A 2O6SA 4RWTC 1ZIWA 4R6FA 4AW4A 1A9NA 2ASSB 1XCDA 3ULVA 3UN9A 1KOHA 4PEQB 1KOOA 1U0ND 5GMFA 4L3FA 4BSSA 5FTTB 3GOZA 5CMPA 2RR6A 3C6PB 1W8AA 1O6SA 2OMZA 4KNGA 1H6TA 3C6OB 3RFEA 3G3AA 5GMHA 2XOTA 4R09A 4LSCA 4KXFB 4V2CA 2ASTB 3W3JA 3E4GA 5AWCA 1FT8A 1XECA 3RIZA 2Z82A 3OJAB 2BNHA 2OMXA 1IO0A 2JE1A 3RGZA 3G04C 2OMUA 3W3LA 4BSUA 4Z8GA 3WPHA 5AWBA 3WPFA 3G3BA 4PSJA 1OTNA 2BEXA 4PKIG 4AY9X 1G9UA 1XEUA 2Z64A 5D3IA 2IFGA 5IYXC 4TZHA 4M7EC 4RCAB 2UZYA 4CP6A 4CILA 2Z7XA 3WPGA 4J4LA 4Y61B 1XKUA 4M7EA 2WFHA 2P1OB 3RW6A 3JB9j 5B4PA 4PQ8A 1P8TA 4FD0A 4IM6A 2Z62A 5AWAA 1Z7XW 4XOSA 5IJCA 4XGOA 2RA8A 3UL8A 1M9SA 4WYKA 3G39A 1DFJI 3W3MA 3M19A 1YRGA 4QXEA 3OJAA 4ARNA 3RW7A 3UL7A 4R5DA 3WN4A 2WQWA 3ZYNA 4WP6A 3W3NA 4GT6A 1H6UA 4CNCA 1D0BA 4LSXC 4QC0A 1WWLA 4FDWA 2Y5QA 2JQDA 4V2DA 4ECOA 4NKHA 4LSXA 4UFRA 4U06A 3E3ZA 4R6JA 4U09A 1O6TA 4I6JB 4ECNA 4OQTA 4Q3GA 1K5GC 4LI2A 1OTMA 1GWBA 2R9UA 4FCGA 4KT1A 1O6VA 4LSAA 4CC4A 1OTOA 4HQ1A 3M18A 2A0ZA 4R5CA 3VQ1A 5IJDA 3W3KA 4Q62A 5GS2B 1FO1A 3SB4A 1M0ZA 4K17A 3WPCA 5GMGA 5CMNA 1SQ0B 3A79B 4R0AA 1DCEA 3WPBA 4B8CD 3W3GA 4Z64C 4YEBB 1K5DC 2P1NB 2P1MB 3WPIA 3ZYJA 3C6NB 1A4YA 2V70A 5HDHA 3WPDA 4Z61C 4NKGA 1DS9A 2JE0A 4P8SA 4BV4R 1JL5A 4QBZA 2OMWA 3REZA 3KJ4A 3RJ0A 2P1QB 1M10B 4L3AA 4RCWA 4R6AA 2O6RA 4C2BB 2ELLA 4XSQA 3G06A 3UL9A 3PMHG 3O53A 1FS2A 1OGQA 2Q4GW 3OGKB 2Z81A 5A5CA 5HZLB 4LXRA 4MQWX 5B0NA 4H09A 2WQVA 1M9LA 2ID5A 5B0TA 4Q3IA 4LI1A 3P72A 2Z7XB 1P8VA 3O6NA 4R07A 2UZXA 5LFNA 4V2EA 1PGVA 4CC4C 4P91A 3CIGA 2OMTA 1P9AG 4CNMA 4GLPA 4C2AB 1FQVA 2V9TB 3RGXA 2XWTC 4G8AA 4R6GA 3OGLB 3ULUA 3TSRE 2FT3A 3OGMB 4MN8B 5IJBA 3RFSA 3E6JA 3DZEA 1OOKG 3CIYA 2OMVA 4J0MA 4U08A 4R58A 4EZGA 2WQUA 4FMZA 3ULAA 3CVRA 3E2JA 1XWDC 1LTXA 3ZYIA 3VQ2A 3FXIA 4U7LA 3BZ5A 4LXSA 5AZ5A 2P1PB 3ZYOA 4Z94G 3RFJA 3WPEA 5AWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FS7 A;  5GQR K;  4BSR A;  2O6Q A;  1OZN A;  4FHO A;  2Z65 A;  5GS0 A;  2V9S A;  4R08 A;  2Z66 A;  4Z79 A;  4PER A;  2Z63 A;  2OMY A;  2WQX A;  1QYY A;  4ARR A;  2CA6 A;  2O6S A;  4RWT C;  1ZIW A;  4R6F A;  4AW4 A;  1A9N A;  2ASS B;  1XCD A;  3ULV A;  3UN9 A;  1KOH A;  4PEQ B;  1KOO A;  1U0N D;  5GMF A;  4L3F A;  4BSS A;  5FTT B;  3GOZ A;  5CMP A;  2RR6 A;  3C6P B;  1W8A A;  1O6S A;  2OMZ A;  4KNG A;  1H6T A;  3C6O B;  3RFE A;  3G3A A;  5GMH A;  2XOT A;  4R09 A;  4LSC A;  4KXF B;  4V2C A;  2AST B;  3W3J A;  3E4G A;  5AWC A;  1FT8 A;  1XEC A;  3RIZ A;  2Z82 A;  3OJA B;  2BNH A;  2OMX A;  1IO0 A;  2JE1 A;  3RGZ A;  3G04 C;  2OMU A;  3W3L A;  4BSU A;  4Z8G A;  3WPH A;  5AWB A;  3WPF A;  3G3B A;  4PSJ A;  1OTN A;  2BEX A;  4PKI G;  4AY9 X;  1G9U A;  1XEU A;  2Z64 A;  5D3I A;  2IFG A;  5IYX C;  4TZH A;  4M7E C;  4RCA B;  2UZY A;  4CP6 A;  4CIL A;  2Z7X A;  3WPG A;  4J4L A;  4Y61 B;  1XKU A;  4M7E A;  2WFH A;  2P1O B;  3RW6 A;  3JB9 j;  5B4P A;  4PQ8 A;  1P8T A;  4FD0 A;  4IM6 A;  2Z62 A;  5AWA A;  1Z7X W;  4XOS A;  5IJC A;  4XGO A;  2RA8 A;  3UL8 A;  1M9S A;  4WYK A;  3G39 A;  1DFJ I;  3W3M A;  3M19 A;  1YRG A;  4QXE A;  3OJA A;  4ARN A;  3RW7 A;  3UL7 A;  4R5D A;  3WN4 A;  2WQW A;  3ZYN A;  4WP6 A;  3W3N A;  4GT6 A;  1H6U A;  4CNC A;  1D0B A;  4LSX C;  4QC0 A;  1WWL A;  4FDW A;  2Y5Q A;  2JQD A;  4V2D A;  4ECO A;  4NKH A;  4LSX A;  4UFR A;  4U06 A;  3E3Z A;  4R6J A;  4U09 A;  1O6T A;  4I6J B;  4ECN A;  4OQT A;  4Q3G A;  1K5G C;  4LI2 A;  1OTM A;  1GWB A;  2R9U A;  4FCG A;  4KT1 A;  1O6V A;  4LSA A;  4CC4 A;  1OTO A;  4HQ1 A;  3M18 A;  2A0Z A;  4R5C A;  3VQ1 A;  5IJD A;  3W3K A;  4Q62 A;  5GS2 B;  1FO1 A;  3SB4 A;  1M0Z A;  4K17 A;  3WPC A;  5GMG A;  5CMN A;  1SQ0 B;  3A79 B;  4R0A A;  1DCE A;  3WPB A;  4B8C D;  3W3G A;  4Z64 C;  4YEB B;  1K5D C;  2P1N B;  2P1M B;  3WPI A;  3ZYJ A;  3C6N B;  1A4Y A;  2V70 A;  5HDH A;  3WPD A;  4Z61 C;  4NKG A;  1DS9 A;  2JE0 A;  4P8S A;  4BV4 R;  1JL5 A;  4QBZ A;  2OMW A;  3REZ A;  3KJ4 A;  3RJ0 A;  2P1Q B;  1M10 B;  4L3A A;  4RCW A;  4R6A A;  2O6R A;  4C2B B;  2ELL A;  4XSQ A;  3G06 A;  3UL9 A;  3PMH G;  3O53 A;  1FS2 A;  1OGQ A;  2Q4G W;  3OGK B;  2Z81 A;  5A5C A;  5HZL B;  4LXR A;  4MQW X;  5B0N A;  4H09 A;  2WQV A;  1M9L A;  2ID5 A;  5B0T A;  4Q3I A;  4LI1 A;  3P72 A;  2Z7X B;  1P8V A;  3O6N A;  4R07 A;  2UZX A;  5LFN A;  4V2E A;  1PGV A;  4CC4 C;  4P91 A;  3CIG A;  2OMT A;  1P9A G;  4CNM A;  4GLP A;  4C2A B;  1FQV A;  2V9T B;  3RGX A;  2XWT C;  4G8A A;  4R6G A;  3OGL B;  3ULU A;  3TSR E;  2FT3 A;  3OGM B;  4MN8 B;  5IJB A;  3RFS A;  3E6J A;  3DZE A;  1OOK G;  3CIY A;  2OMV A;  4J0M A;  4U08 A;  4R58 A;  4EZG A;  2WQU A;  4FMZ A;  3ULA A;  3CVR A;  3E2J A;  1XWD C;  1LTX A;  3ZYI A;  3VQ2 A;  3FXI A;  4U7L A;  3BZ5 A;  4LXS A;  5AZ5 A;  2P1P B;  3ZYO A;  4Z94 G;  3RFJ A;  3WPE A;  5AWD A; 
#chains in the Genus database with same CATH topology
 4FS7 A;  5GQR K;  4BSR A;  2O6Q A;  1OZN A;  4FHO A;  2Z65 A;  5GS0 A;  2V9S A;  4R08 A;  2Z66 A;  4Z79 A;  4PER A;  2Z63 A;  2OMY A;  2WQX A;  1QYY A;  4ARR A;  2CA6 A;  2O6S A;  4RWT C;  1ZIW A;  4R6F A;  4AW4 A;  1A9N A;  2ASS B;  1XCD A;  3ULV A;  3UN9 A;  1KOH A;  4PEQ B;  1KOO A;  1U0N D;  5GMF A;  4L3F A;  4BSS A;  5FTT B;  3GOZ A;  5CMP A;  2RR6 A;  3C6P B;  1W8A A;  1O6S A;  2OMZ A;  4KNG A;  1H6T A;  3C6O B;  3RFE A;  3G3A A;  5GMH A;  2XOT A;  4R09 A;  4LSC A;  4KXF B;  4V2C A;  2AST B;  3W3J A;  3E4G A;  5AWC A;  1FT8 A;  1XEC A;  3RIZ A;  2Z82 A;  3OJA B;  2BNH A;  2OMX A;  1IO0 A;  2JE1 A;  3RGZ A;  3G04 C;  2OMU A;  3W3L A;  4BSU A;  4Z8G A;  3WPH A;  5AWB A;  3WPF A;  3G3B A;  4PSJ A;  1OTN A;  2BEX A;  4PKI G;  4AY9 X;  1G9U A;  1XEU A;  2Z64 A;  5D3I A;  2IFG A;  5IYX C;  4TZH A;  4M7E C;  4RCA B;  2UZY A;  4CP6 A;  4CIL A;  2Z7X A;  3WPG A;  4J4L A;  4Y61 B;  1XKU A;  4M7E A;  2WFH A;  2P1O B;  3RW6 A;  3JB9 j;  5B4P A;  4PQ8 A;  1P8T A;  4FD0 A;  4IM6 A;  2Z62 A;  5AWA A;  1Z7X W;  4XOS A;  5IJC A;  4XGO A;  2RA8 A;  3UL8 A;  1M9S A;  4WYK A;  3G39 A;  1DFJ I;  3W3M A;  3M19 A;  1YRG A;  4QXE A;  3OJA A;  4ARN A;  3RW7 A;  3UL7 A;  4R5D A;  3WN4 A;  2WQW A;  3ZYN A;  4WP6 A;  3W3N A;  4GT6 A;  1H6U A;  4CNC A;  1D0B A;  4LSX C;  4QC0 A;  1WWL A;  4FDW A;  2Y5Q A;  2JQD A;  4V2D A;  4ECO A;  4NKH A;  4LSX A;  4UFR A;  4U06 A;  3E3Z A;  4R6J A;  4U09 A;  1O6T A;  4I6J B;  4ECN A;  4OQT A;  4Q3G A;  1K5G C;  4LI2 A;  1OTM A;  1GWB A;  2R9U A;  4FCG A;  4KT1 A;  1O6V A;  4LSA A;  4CC4 A;  1OTO A;  4HQ1 A;  3M18 A;  2A0Z A;  4R5C A;  3VQ1 A;  5IJD A;  3W3K A;  4Q62 A;  5GS2 B;  1FO1 A;  3SB4 A;  1M0Z A;  4K17 A;  3WPC A;  5GMG A;  5CMN A;  1SQ0 B;  3A79 B;  4R0A A;  1DCE A;  3WPB A;  4B8C D;  3W3G A;  4Z64 C;  4YEB B;  1K5D C;  2P1N B;  2P1M B;  3WPI A;  3ZYJ A;  4NZR M;  3C6N B;  1A4Y A;  2V70 A;  5HDH A;  3WPD A;  4Z61 C;  4NKG A;  1DS9 A;  2JE0 A;  4P8S A;  4BV4 R;  1JL5 A;  4QBZ A;  2OMW A;  3REZ A;  3KJ4 A;  3RJ0 A;  2P1Q B;  1M10 B;  4L3A A;  4RCW A;  4R6A A;  2O6R A;  4C2B B;  2ELL A;  4XSQ A;  3G06 A;  3UL9 A;  3PMH G;  3O53 A;  1FS2 A;  1OGQ A;  2Q4G W;  3OGK B;  2Z81 A;  5A5C A;  5HZL B;  4LXR A;  4MQW X;  5B0N A;  4H09 A;  2WQV A;  1M9L A;  2ID5 A;  5B0T A;  4Q3I A;  4LI1 A;  3P72 A;  2Z7X B;  1P8V A;  3O6N A;  4R07 A;  2UZX A;  5LFN A;  4V2E A;  1PGV A;  4CC4 C;  4P91 A;  3CIG A;  2OMT A;  1P9A G;  4CNM A;  4GLP A;  4C2A B;  1FQV A;  2V9T B;  3RGX A;  2XWT C;  4G8A A;  4R6G A;  3OGL B;  4NZT M;  3ULU A;  3TSR E;  2FT3 A;  3OGM B;  4MN8 B;  5IJB A;  3RFS A;  3E6J A;  3DZE A;  1OOK G;  3CIY A;  2OMV A;  4J0M A;  4U08 A;  4R58 A;  4EZG A;  2WQU A;  4FMZ A;  3ULA A;  3CVR A;  3E2J A;  1XWD C;  1LTX A;  3ZYI A;  3VQ2 A;  3FXI A;  4U7L A;  3BZ5 A;  4LXS A;  5AZ5 A;  2P1P B;  3ZYO A;  4Z94 G;  3RFJ A;  3WPE A;  5AWD A; 
#chains in the Genus database with same CATH homology
 4FS7 A;  5GQR K;  4BSR A;  2O6Q A;  1OZN A;  4FHO A;  2Z65 A;  5GS0 A;  2V9S A;  4R08 A;  2Z66 A;  4Z79 A;  4PER A;  2Z63 A;  2OMY A;  2WQX A;  1QYY A;  4ARR A;  2CA6 A;  2O6S A;  4RWT C;  1ZIW A;  4R6F A;  4AW4 A;  1A9N A;  2ASS B;  1XCD A;  3ULV A;  3UN9 A;  1KOH A;  4PEQ B;  1KOO A;  1U0N D;  5GMF A;  4L3F A;  4BSS A;  5FTT B;  3GOZ A;  5CMP A;  2RR6 A;  3C6P B;  1W8A A;  1O6S A;  2OMZ A;  4KNG A;  1H6T A;  3C6O B;  3RFE A;  3G3A A;  5GMH A;  2XOT A;  4R09 A;  4LSC A;  4KXF B;  4V2C A;  2AST B;  3W3J A;  3E4G A;  5AWC A;  1FT8 A;  1XEC A;  3RIZ A;  2Z82 A;  3OJA B;  2BNH A;  2OMX A;  1IO0 A;  2JE1 A;  3RGZ A;  3G04 C;  2OMU A;  3W3L A;  4BSU A;  4Z8G A;  3WPH A;  5AWB A;  3WPF A;  3G3B A;  4PSJ A;  1OTN A;  2BEX A;  4PKI G;  4AY9 X;  1G9U A;  1XEU A;  2Z64 A;  5D3I A;  2IFG A;  5IYX C;  4TZH A;  4M7E C;  4RCA B;  2UZY A;  4CP6 A;  4CIL A;  2Z7X A;  3WPG A;  4J4L A;  4Y61 B;  1XKU A;  4M7E A;  2WFH A;  2P1O B;  3RW6 A;  3JB9 j;  5B4P A;  4PQ8 A;  1P8T A;  4FD0 A;  4IM6 A;  2Z62 A;  5AWA A;  1Z7X W;  4XOS A;  5IJC A;  4XGO A;  2RA8 A;  3UL8 A;  1M9S A;  4WYK A;  3G39 A;  1DFJ I;  3W3M A;  3M19 A;  1YRG A;  4QXE A;  3OJA A;  4ARN A;  3RW7 A;  3UL7 A;  4R5D A;  3WN4 A;  2WQW A;  3ZYN A;  4WP6 A;  3W3N A;  4GT6 A;  1H6U A;  4CNC A;  1D0B A;  4LSX C;  4QC0 A;  1WWL A;  4FDW A;  2Y5Q A;  2JQD A;  4V2D A;  4ECO A;  4NKH A;  4LSX A;  4UFR A;  4U06 A;  3E3Z A;  4R6J A;  4U09 A;  1O6T A;  4I6J B;  4ECN A;  4OQT A;  4Q3G A;  1K5G C;  4LI2 A;  1OTM A;  1GWB A;  2R9U A;  4FCG A;  4KT1 A;  1O6V A;  4LSA A;  4CC4 A;  1OTO A;  4HQ1 A;  3M18 A;  2A0Z A;  4R5C A;  3VQ1 A;  5IJD A;  3W3K A;  4Q62 A;  5GS2 B;  1FO1 A;  3SB4 A;  1M0Z A;  4K17 A;  3WPC A;  5GMG A;  5CMN A;  1SQ0 B;  3A79 B;  4R0A A;  1DCE A;  3WPB A;  4B8C D;  3W3G A;  4Z64 C;  4YEB B;  1K5D C;  2P1N B;  2P1M B;  3WPI A;  3ZYJ A;  3C6N B;  1A4Y A;  2V70 A;  5HDH A;  3WPD A;  4Z61 C;  4NKG A;  1DS9 A;  2JE0 A;  4P8S A;  4BV4 R;  1JL5 A;  4QBZ A;  2OMW A;  3REZ A;  3KJ4 A;  3RJ0 A;  2P1Q B;  1M10 B;  4L3A A;  4RCW A;  4R6A A;  2O6R A;  4C2B B;  2ELL A;  4XSQ A;  3G06 A;  3UL9 A;  3PMH G;  3O53 A;  1FS2 A;  1OGQ A;  2Q4G W;  3OGK B;  2Z81 A;  5A5C A;  5HZL B;  4LXR A;  4MQW X;  5B0N A;  4H09 A;  2WQV A;  1M9L A;  2ID5 A;  5B0T A;  4Q3I A;  4LI1 A;  3P72 A;  2Z7X B;  1P8V A;  3O6N A;  4R07 A;  2UZX A;  5LFN A;  4V2E A;  1PGV A;  4CC4 C;  4P91 A;  3CIG A;  2OMT A;  1P9A G;  4CNM A;  4GLP A;  4C2A B;  1FQV A;  2V9T B;  3RGX A;  2XWT C;  4G8A A;  4R6G A;  3OGL B;  3ULU A;  3TSR E;  2FT3 A;  3OGM B;  4MN8 B;  5IJB A;  3RFS A;  3E6J A;  3DZE A;  1OOK G;  3CIY A;  2OMV A;  4J0M A;  4U08 A;  4R58 A;  4EZG A;  2WQU A;  4FMZ A;  3ULA A;  3CVR A;  3E2J A;  1XWD C;  1LTX A;  3ZYI A;  3VQ2 A;  3FXI A;  4U7L A;  3BZ5 A;  4LXS A;  5AZ5 A;  2P1P B;  3ZYO A;  4Z94 G;  3RFJ A;  3WPE A;  5AWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...