4FSSA

Crystal structure of a ras p21 protein activator (rasa1) from homo sapiens at 2.25 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a RAS p21 protein activator (RASA1) from Homo sapiens at 2.25 A resolution
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras GTPase-activating protein 1
total genus 14
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4fssA00
4Z8AA 3PVLA 4OMPA 1AOJA 3I5SA 1RLQC 3VS6A 3SEMA 1M3AA 1PHTA 4OMNA 2RQUA 2X3WD 2RQRA 1J3TA 1M30A 1VYTA 1X2KA 2C0TA 2EGAA 1A0NB 1ZUKA 1AWWA 3JV3A 1IO6A 4X1VA 1SHGA 1H3HA 4LUEA 1TUCA 2BZXA 1AWJA 1U5SA 2AKKA 3EHQA 1ZUUA 1T3SA 3H41A 2KGTA 2CUBA 4AFQC 1EFNA 1Y57A 2DJQA 1WA7A 2JT4A 1BB9A 4RTTA 2ESWA 1NEGA 3NMZC 1MV0B 2KT8A 2CUDA 1T3LA 3RNJA 1OEBA 2JMCA 1TG0A 1G2BA 4J9EA 2KYMA 3GBQA 1K9AA 2LJ0A 2YSQA 1B07A 2KROA 3H0IA 1ZLMA 1T0JA 5FWCA 2ROLA 2GNCA 1JXOA 2DRKA 3ULRB 2PNIA 2EGEA 1UJYA 2KYBA 2EYZA 5GJWB 1RI9A 1ZSGA 2O88A 1W1FA 2V1QA 5HCKA 4GLMA 3VS4A 2CH4W 5IH2A 2FPDA 2JM9A 5ECAA 3PE0A 3NGPA 2MCNA 4AFUC 4HVWA 2J7IA 5IHIA 4LN2A 4GBQA 3VS0A 2J05A 1NEBA 1PRMC 1X6GA 1CKBA 4AFZC 2RQTA 1OV3A 2DL5A 1UGVA 4DEXA 1X2QA 1QLYA 2KNBB 2L2PA 2YUQA 2DL7A 4LUDA 4ZNXA 1KFZA 2FEIA 4WCIA 3IQLA 4CC3A 2OAWA 3I5RA 2LQWA 1WLPB 2LZ6B 1AD5A 3TVTA 1V1CA 4AFSC 3H0HA 1VYVA 1QWEA 3CQTA 1SHFA 1UJ0A 3EHRA 1H8KA 2DL3A 1ABOA 2L3PA 4J9BA 2J06A 1GRIA 2EVRA 1RLPC 4JZ4A 3ZL7C 1ZX6A 2VVKA 3I35A 4F17A 2HEQA 2L0AA 2DA9A 2RQWA 4JJBA 1Z9QA 2KRNA 4J9DA 1CKAA 1NYGA 1U3OA 4J9GA 4F16A 5IXBA 2E5KA 1ZBJA 2DILA 2J6KA 5IXFA 1PNJA 4RTZA 1CSKA 1GFCA 1GBRA 2W10A 1NM7A 2GBQA 1FYNA 4RUGA 2RNAA 3EG2A 3TSZA 3SHWA 1K0XA 3QWXX 1W6XA 1Y0MA 2M0YA 2P4RA 3EG0A 4QT7A 4FSSA 2H8HA 2EPDA 1WX6A 3C0CA 2A36A 2GTJA 2LX7A 2MIOA 1BK2A 4JJDA 2D8HA 3VS5A 2DF6A 1N5ZA 2LJ3A 4HVUA 5IHKA 3O5ZA 2ED0A 2JTEA 1E7OA 1GFDA 3EG1A 4Z89A 4Y92A 1AZEA 4OMOA 1XOVA 2KXDA 2K79A 1YCSB 1TUDA 2HCKA 4E6RA 1SEMA 5EC7A 1UECA 1QKXA 1KIKA 1AEYA 1M27C 2JS0A 3VS1A 4AG1C 1JU5C 1JXMA 2AZVA 2ENMA 1WXTA 1NYFA 1UDLA 1HSQA 1GCQA 1WXBA 2D1XA 2JW4A 1H92A 5L23A 1QWFA 4DEYA 1AWXA 2DL8A 4EIKA 5I11A 3EG3A 1T0HA 4OMQA 1KSWA 2VWFA 4LNPA 2JM8A 4RTUA 2EYWA 2KXCA 1U06A 1OPLA 1ZUYA 2RQVA 4AG2C 2HBWA 4HXJA 2J6OA 2L3SA 2A08A 2DX1A 3VS7A 2M51A 3A98A 1WYXA 2FRWA 2F2WA 5GJVB 3THKA 4JPBW 1JQQA 2AKLA 3M0RA 3M0QA 3NHNA 1PKTA 1M3BA 1GL5A 3REAB 2JXBA 4CC4B 1RUWA 1NLOC 2LNHB 2RMOA 2C0IA 1I0CA 2CSQA 2DM1A 1ABQA 2DL4A 2K2MA 1BBZA 3EGUA 4LE9A 1UHFA 1S1NA 2DBMA 3UF4A 1SPKA 2OI3A 2D0NA 2FPFA 2L3QA 2JMAA 3LH5A 2MOXA 1MUZA 2NWMA 3QWYA 2EW3A 2LCSA 2CH4A 1M8MA 3M0TA 4A63B 2CT4A 2OJ2A 2ED1A 2J6FA 2GQIA 4J9IA 1OPKA 2DE0X 2VKNA 1HD3A 1YN8A 2LJ1A 2RPNA 4RTWA 1UUEA 2DBKA 4J9CA 2A37A 3VRZA 2O9VA 3REBB 1X6BA 2DLPA 2EYYA 2ABLA 4CC2A 1WXUA 2DMOA 2G6FX 2EBPA 4JJCA 2CT3A 1FMKA 4IIOA 1K4US 2BTTA 5IHNA 1WI7A 1E6GA 3UA7A 1VA7A 2D8JA 1K1ZA 4HVVA 2YDLA 1VYUA 2CSIA 2HDAA 4OMLA 2FRYA 1AZGB 2DYBA 1GCQC 1LCKA 2JS2A 4RTXA 2LMJA 3UA6A 2YUNA 1W70A 2BZYA 2DVJA 5I22A 4Z88A 1YNZA 2KR3A 4KRTA 1QKWA 3M0UA 1K0SA 1UG1A 4K11A 4J9FA 1UFFA 1G83A 1NLPC 2GGRA 1HJDA 2X3XD 2F2XA 2DRMA 2DNUA 2V1RA 1YWPA 4D8DA 3UATA 1YP5A 3TSWA 3M0SA 2FO0A 4D8KA 1OOTA 1ARKA 2KEAA 1SSHA 2ECZA 2O9SA 3FJ5A 1E6HA 2ROTA 2FPEA 1BU1A 2PTKA 2W0ZA 2O31A 1SRLA 3I9QA 2GTOA 1I07A 3M0PA 1AVZC 2LQNA 1GCPA 2KT1A 1MV3A 4JZ3A 1B3QA 2IIMA 2PZ1A 5FW9A 1WDXA 3VRYA 4RTYA 2K7AA 1X43A 2CREA 2YUOA 5FWBA 2HSPA 2KBTA 2AK5A 2LP5A 1GBQA 4ORZA 1I1JA 1M3CA 2EQIA 2QDLA 4HCKA 1NG2A 4CC7A 2YT6A 3PVQA 1PWTA 3NPFA 2KE9A 4ESRA 1K76A 1QCFA 1KJWA 1SRMA 2KRMA 2KRSA 4F14A 2NUZA 2SEMA 2YUPA 1PKSA 3KFVA 4IIMA 4RTVA 3R6NA 1JEGA 1X69A 4M4ZA 3U23A 1X27A 4R0KA 2BZ8A 3RBBB 3VS3A 2SRCA 2K9GA 3H0FA 2FG0A 4OMMA 1UHCA 4J9HA 3VS2A 2EYXA 2O2OA 2B86A 1WFWA 2F2VA 2XMFA 2K3BA 2C0OA 1AWOA 1JO8A 1WIEA 1UTIA 2CDTA 2EKHA 2K6DA 2RN8A 1Z9ZA 1UE9A 2I0NA 1YWOA 2EGCA 2RF0A 1PRLC 2AZSA 2A28A
chains in the Genus database with same CATH superfamily
3PVLA 3OYEA 3PMTA 4OMPA 3G4SQ 2XG8D 3A8HB 1M3AA 4E7ZA 4PL6A 4C92D 4E7LA 3GF5A 3SWNB 1M30A 5LJ3e 1I4K1 3CEYA 1N9SA 1ZUKA 1AWWA 4LDWA 3EFOA 4EMGA 4EMKC 4A4GA 1AWJA 3CBOA 2MK5A 3CCRA 3EHQA 3VU3C 1ZUUA 1RACB 1T3SA 2FYKA 2CUBA 2NUTA 1VQKA 2K2VA 2DJQA 3JCMh 1D3BA 1VQNA 2ESWA 4RG8A 3NMZC 4LDXA 1MV0B 3M5AA 5GMKh 3RNJA 4C5GA 4M7DD 2RM4A 2LC4A 4KT0E 5GAOr 1VQMT 5GMKl 3JB9G 1YJ9Q 5KYWA 3H0IA 1ZLMA 1T0JA 2ROLA 1YJWA 2GNCA 4DBFA 1YJNQ 1JXOA 2ZPBB 4JDSA 5IN1A 2DO3A 2RI3A 4M75C 1UJYA 4MZTA 3J7AF 1MMAA 2F69A 3VS4A 1VQ4A 2JM9A 5IAYA 1VQLQ 5ECAA 2XU8A 3NGPA 4GBQA 4C0ZA 3S3OA 2J05A 4QQDA 2I2LA 1C0MA 1M2VA 3OW2P 2RQTA 4OB1B 1QVGS 2DL5A 4ATOA 3A1PA 4ZGJB 1QVPA 1K9MR 1WPYA 4UC4A 4ZNXA 1W4SA 3JCMW 4CC3A 4XTYA 1WLPB 2LZ6B 4M77D 1M9SA 1B34B 3H0HA 7AT1B 2RJCA 1M5Q1 1QWEA 1YJWT 3BDLA 4PJOD 3EFSA 4J9BA 5LJ3j 2QA4Q 2CZ0B 1VQ7A 5LJ3g 1RAAB 1NPRA 1ZX6A 3CCVQ 2VVKA 1IHWA 3I56A 4F17A 2XDPA 4PJMA 4B9XA 2L0AA 1NJIC 3L2WA 2D0QB 1Z9QA 5I21A 2JJ9A 5GMKi 2M02A 4PJOF 5IXBA 2E5KA 1ZBJA 5CKFA 3Q1JA 2DILA 3R6OA 3CC7A 3EGDA 2ZZDA 1PNJA 1GBRA 1KD1U 2W10A 1NM7A 5LJ5g 4RUGA 1TTHB 2LTOA 1MMGA 5LJ5d 1VQNQ 3HRUA 4ZTJA 1YJNA 2P4RA 2E65A 1TWBA 4II1A 2E64A 4HCCA 3BDUA 2EPDA 4JJDA 1WJQA 2WSEE 2D8HA 4A4KA 3S6WA 4DBQA 4HVUA 5IHKA 3SWNA 1WJRA 2RB6A 3LGLA 2ED0A 2BIVA 4M78D 3JCMJ 2K57A 4V2SA 4ZGDB 5EC7A 2QG9B 1VQKQ 4BI8B 3CD6Q 1AEYA 2DAQA 2XKOC 1GXIE 1LNXA 2D1XA 3L42A 3MP6A 4DEYA 1AWXA 1OX9A 1TH7A 1TOVA 1KSWA 3AHUA 1I5LA 2VWFA 1BI3A 2HKQB 5M9OA 3MPUB 4PFPA 1Q82U 3NTIA 4DOWA 4HXJA 2DX1A 3CCVT 1IZ6A 1JJ2S 4C8QB 1N6AA 4FYVB 3FDRA 1RAHB 1OULA 4R56A 3M0QA 3QO3A 2NUPA 1QVGP 4Z02A 3X20B 4XU2A 2RHXA 3REAB 4CC4B 2K3XA 2RD1A 2LNHB 2RMOA 2X4JA 2NYSA 2DTOA 3G1JA 1YJNT 1BBZA 1Q7YC 4LE9A 1PSFA 1YITT 2OI3A 2D0NA 1G8XA 3RMSA 5GANf 3I56Q 5CQXA 5IT9E 3G7ZA 4C92E 4J6YA 1O75A 4A63B 2CT4A 2OJ2A 5GAN6 3CCSQ 3MEAA 5FRMA 3JCMe 3CCQQ 4ELZC 3CD6T 4RCBA 2CS7A 2DBKA 2WACA 2HAXA 4F7UE 5GAN8 2X4YA 4NOYA 5GAN3 4M7DB 2DMOA 1VQPA 2EBPA 4E7SA 1FMKA 4M75D 3X24B 4EPCA 1K4US 1SG5A 1WI7A 1E6GA 3UA7A 4HCBA 2E6ZA 1AZGB 2JUFA 1GCQC 5CR2A 1UGPB 4FYYB 1LCKA 3VJPA 4M7AD 2E10A 3MHXA 3SFMA 2BZYA 1OI1A 2DVJA 5I22A 4Z88A 5J39A 1QQJA 2MWPA 3HFNA 4KRTA 5CKEA 2GFUA 1TS9A 2VGNA 2XIDA 5HKCA 3M0UA 2OTJQ 4XQ3A 2LQKA 4XK8E 4C0GA 5GAOn 1RAGB 1IHVA 3TEEA 2C06A 3M53A 2Z0WA 2VC8A 1HJDA 2RHYA 1RADB 4LD6A 2X3XD 4M77C 3I56T 3MJXA 4CI0C 3EFRA 4D8DA 2DXUA 3UATA 3M0SA 4FW1A 4PJOC 3ASKA 3OSVA 3FJ5A 1E6HA 3MEVA 2QDYB 1Y7XA 2L8DA 2RJFA 2FPEA 3H8ZA 1BU1A 1M1KU 4ZGEB 2O31A 2HD0A 1SRLA 3I9QA 2GTOA 1I07A 4KBMB 1OX8A 1Y71A 1ZHIA 3GPLA 4EDUA 2RI2A 4MDWA 1RL2A 1VQKT 1YIJT 3C95A 1X43A 2CREA 3FEOA 5FWBA 3JSCA 3QJYA 2LP5A 3EH1A 5GANj 4N4IA 1M3CA 1QVFP 3OYIA 4CC7A 2KQWA 3CPWS 2KE9A 1K76A 1QCFA 2NUPB 2KK4A 1SRMA 2KRMA 2YRDA 4F14A 4HT8A 2RK2A 2QEXT 3TREA 2YUPA 2L5QA 3V7SA 1YJ9T 4LDUA 2LT4A 1JEGA 4M4ZA 3GIBA 2RJEA 4J7IA 4R0KA 1PC0A 4AT1B 4OMMA 3CCMA 1BI2A 4PNOA 2M1HA 2K3BA 2C0OA 3FLGA 3V7CA 2K5IA 3M4YA 2EIFA 2HZYA 3DLMA 1Q81R 2RN8A 4YTLA 1UE9A 5DM7R 2I0NA 1YWOA 1LJOA 2MPXC 2OTLA 3H6ZA 4E7JA 2EGCA 4M7AG 3DB4A 4ANJA 2EQMA 2PQWA 4E2FB 1UGQB 4BE1A 2MAMA 1BI1A 4M77A 2O4XA 4JS5A 3OSSC 4A54A 2YLCA 2ZAEA 4QVDA 4XU0A 1LPLA 3E2UA 4PKCC 1G3WA 1VYTA 3VYGA 1YIJQ 3CC4A 1X2KA 3EGDB 2FZCB 1M1KR 3JV3A 4HT9A 4FU6A 3KBGA 5C6SA 4R55A 2FL7A 3GNGA 1SHGA 1TUCA 1VQLA 1U5SA 2X4WA 3JCMP 3OYHA 3JB9D 3JB9J 1VQNT 2CP7A 4AFQC 5LJ3d 4BI3A 1Y57A 3C94A 2QA4T 2EWNA 2KSSA 3KUFA 5GANh 4VUBA 1NEGA 2ZPHB 2KT8A 2CUDA 3EH2A 2RI5A 2RHIA 1YHQA 2JMCA 3JCMV 1TSFA 2QEXQ 3JB9F 1Q7YU 1ZSZB 2KYMA 1WZOA 1K9AA 4OB3B 2YSQA 2KROA 1Q86C 4C92C 3ULRB 4J7FA 2EGEA 3OS5A 4PFZA 2OTJT 2KYBA 2EYZA 4A4EA 5GJWB 1Q81C 2DIGA 1H3ZA 3HRSA 1PD0A 1W1FA 2KVQG 4GLMA 1KG1A 2CH4W 5IH2A 1QCOA 1RI0A 4KH0B 3G6EQ 5GAMd 3VS0A 3D7SB 1UB4A 1NEBA 2DD5A 4C5EA 1X6GA 4KGZB 4M78F 2MF2A 3A5ZB 2JTMA 4DBHA 4QW2A 3RKWA 5KE3A 1X2QA 5FU7C 3LWIA 1QLYA 2L2PA 1DJ7B 4LUDA 5AYFA 5LL6S 3M4GA 4NL2A 2FEIA 4JUVA 1IGQA 1MHNA 3BW1A 3I5RA 2CYZB 3HPWA 3TVTA 2HKNA 1VQ4T 2DTIA 4B6MA 4IUQA 2EQUA 3CQTA 2LCCA 1Y96A 3OBYA 3FIFA 2K5LA 3CPWA 1KQSA 4MMKA 4PJOB 1RLPC 2CP2A 2RHZA 6AT1B 4D6WA 2HEQA 3AT1B 3A8GB 4C92A 2DA9A 4JJBA 3PIOA 1VQ8T 3RR6A 3CCST 1RAFB 3E1SA 4HA8A 2ZCFB 4OB2B 5IXFA 4A4FA 1Q7YR 5HY6A 1CSKA 1GFCA 2V8KA 2GBQA 2R5MA 4IKFA 5CIUA 4M77F 2RNAA 3G6ET 3TSZA 4BACA 3QYHB 2JN0A 4QT7A 4FSSA 2EJGA 5CO7A 1BCOA 1F1BB 3QDRB 2GF7A 1WX6A 2YXYA 2GTJA 2MIOA 4OF1A 2PUOB 2DF6A 1N5ZA 2LJ3A 4JLIA 1E7OA 1AHJB 1N8RC 1GFDA 3OYLA 4B9WA 4Z89A 4Y92A 1QVGA 1PCXA 1YCSB 5I2SA 2DK3A 3ME9A 3ER0A 8AT1B 1UECA 5GAOp 1HXDA 1VQ4Q 1VQ7Q 1JXMA 3OB9A 2AZVA 5FU6B 3E9GA 1NYFA 3PIPA 4ZTFA 1GCQA 1VQ5A 2GCXA 5L23A 1QWFA 2DL8A 3EG3A 4OMQA 4BDZA 4LNPA 3CCUQ 1M2VB 2P84A 1U06A 4J5YA 2HSEB 2DIQA 2HBWA 4M77G 3VS7A 3QIIA 8ATCB 1D0YA 1WYXA 2FRWA 2F2WA 4PJLA 4IUTA 3JB9H 3SD4A 3V8KA 1KHIA 2AKLA 3OYMA 3NHNA 4BDYA 4M7DE 1M3BA 2DPPB 3QJ6A 1M1GA 2C0IA 2DM1A 5KCHA 2RJDA 2DBMA 4X34A 3MKDA 4M78B 3OBWA 2V8JA 1LOJA 2NWMA 4AMCA 2EYQA 3VYHB 3L2QA 3CXCP 1YJWQ 1M8MA 4BB7A 3CCRT 4PLLA 2ED1A 3CXCA 5FRNA 1OPKA 2BUDA 2DE0X 1HD3A 1VQ7T 2RPNA 3G71Q 3A8OB 3VRZA 3REBB 4ZN3A 1X75C 1YI2Q 3EFOB 5GANg 1KC8C 2G6FX 4M78G 4IIOA 2AIRB 1VA7A 5GAMf 2YDLA 5HK3A 5FROA 3CCVA 2JS2A 4RTXA 3QYGB 3CMAT 2LMJA 1W70A 4JRKA 4M78E 1NE8A 4EMKB 1JJ2A 1S72T 3I55A 1QKWA 1WJSA 2KI7A 1K0SA 1UG1A 1G3YA 3KXTA 3CBPA 1UFFA 1G83A 4FYXB 4F7UB 3O8VA 4C8QE 5LJ5j 3OW2A 3PTAA 3TSWA 1Q95G 2FO0A 4D8KA 1D0ZA 2KEAA 3OYYA 3UWNA 5KCOA 5GAMj 1VQMA 2CP3A 2A7YA 2DETA 2IVWA 4QVCA 3OYJA 2PTKA 2W0ZA 2A0FB 4Q5WA 4RMOA 1QVFS 2PUKB 2MMPA 3EGXA 3UPUA 2YLBA 1UGRB 2DVEA 4C92B 1WDXA 4C8QC 4FIBA 3L2ZA 3E9FA 2K3YA 4M77E 3HFOA 2QQSA 3ZFJA 5KYNA 2HSPA 3FJPA 4IUUA 2KBTA 2AK5A 2DXCA 3CMAQ 4O6JA 2ATCB 4ORZA 2EQIA 2QDLA 4GY5A 3I55Q 1EIFA 3VUBA 3PVQA 1YITQ 3A8MB 2KRSA 1I5OB 4NS5A 3JCMc 2XD0A 2NUZA 1VQ6T 1SF9A 1KQSP 2DZ9A 1PKSA 3KFVA 4RTVA 4XTWA 5CVIA 1IXDA 4M75B 2XHCA 3WVEB 2FVUA 2M16A 2K9GA 2VB6A 4LDYA 2E1HA 3OYGA 5KYWB 4XTXA 3NFCA 3OYFA 1JO8A 1WIEA 1M90R 1R0CB 4F7UA 2CDTA 1JBMA 3M9QA 2RF0A 3GNFB 1K9MU 1PRLC 2A28A 3JCMQ 4IUPA 3MEUA 3NTHA 1YJ9A 5A0GA 3TU4K 4J8OA 3SEMA 1PHTA 3URGA 3DKMA 1NJIR 2C0TA 1UEBA 3BFMA 4JLGA 4E7HA 5KE2A 1IO6A 1D0XA 3T9NA 2DZCA 1H3HA 2BZXA 1VIFA 1W2BS 3CC7T 1C1AA 2QQBA 4BI4A 2GQVA 1WA7A 1YFNA 4M7DA 1VQ6Q 4RTTA 1WQWA 1PD1A 1YI2A 5CCAA 3DLLA 1T3LA 1RAIB 4PK4A 4QQ6A 1OEBA 2L3RA 2QTXA 1G2BA 2A3LA 4F04B 1KD1R 5LJ5f 3GBQA 2X4XA 3G4SA 2LJ0A 3QSUA 1FMWA 2BE9B 1B07A 2YRVA 1M90C 3GP8A 5FWCA 2M9UA 1IREB 3CC2Q 4E7IA 5GANe 1K8AR 2KDSA 2QEXA 1D1CA 1V76A 5D6XA 4RCCA 3JCMd 3P8DA 3LX7A 2V1QA 3OYNA 5HCKA 2FPDA 4C5IA 1YIJA 4AFUC 3M54A 3SB2A 4HVWA 2J7IA 1VQPQ 5IHIA 4J6WA 2OX7A 4LN2A 2COYA 2VGMA 1M90U 1PRMC 4FT2A 1CKBA 3CCLQ 2RHUA 1WHLA 4AFZC 2XICA 4L5GA 4DEXA 3OMGA 2D9TA 3L2VA 3S3NA 3M59A 2DL7A 5GAOl 5GAMe 1OU8A 2QASA 1VQOT 1KFZA 2RA2A 3FC3A 2FHDA 1ACMB 1YITA 3IQLA 2OAWA 1NJIU 5KYUB 3CCUA 4ELYC 1V1CA 3M57A 4AFSC 2QTVA 5L8RE 1Q82R 4NL3A 1VYVA 3CCUT 2JNGA 3JCMg 1UJ0A 3JAME 3EHRA 1H8KA 2DL3A 2VASA 1W2BP 1ABOA 1QMCA 4IUVA 4QKUA 2HL5C 4MZPA 1KK7A 1GRIA 4TVRA 4XAXB 1KD1C 4JZ4A 2XI9A 3MP8A 2YRCA 3CCQT 4WF2A 5LJ3h 4J9DA 1K8AC 3BY7A 4F16A 1H641 4J6XA 1JJ2P 1HK9A 5GMKe 2QGGA 2P4TA 3INZA 3N5BB 5FU7B 1WQ7A 3SHWA 3RESA 3RKXA 1VQ6A 1UGSB 1YCYA 2DD4A 1K0XA 1PM3A 1Y0MA 3QKJA 1K8AU 1U8RA 1VQPT 5GAN2 3CCLT 2PVOB 3PFSA 3VS5A 2A36A 2LX7A 2DKGA 4XU3A 1XNIA 2JTEA 3QHSA 3V8LA 4E7KA 1K73R 1AZEA 4OMOA 2XDDA 2KXDA 3CCET 1SEMA 4Y28E 4QQGA 1YI2T 5DLOA 2PU9B 1QKXA 3OQ5A 2JS0A 2OTLT 1VUBA 3VS1A 1JU5C 4A4HA 1WXTA 1UDLA 1HSQA 1H92A 1VQ8A 1YHQT 1ZSZC 5I2MA 4EIKA 3L2RA 1T0HA 1NPPA 2JM8A 4RTUA 2KXCA 3PT9A 2KAFA 3CC7Q 1OPLA 5KH6A 1ZUYA 2AHJB 2RQVA 2J6OA 2QQAA 3QG1A 3FB9A 1TXQA 2M51A 3A98A 2XK0A 1IRXA 4M7AB 2JOYA 1JQQA 3M0RA 4E47A 4JRIA 1MMDA 5AT1B 9ATCB 2LDMA 2JXBA 1VOMA 1WHHA 1BYMA 5CKHA 1X01A 2CSQA 1ABQA 2DL4A 3EGUA 2QK0A 2EQJA 3UF4A 2F5TX 5D6WA 3VKIA 2FPFA 2L3QA 3C12A 2ZPGB 1Q86U 3LH5A 2MOXA 1MUZA 4F7UG 2NUTB 3CPFA 2LCLA 3QWYA 1K73C 2WSCE 2LCSA 2CH4A 3I55T 5DY9A 3CMET 4HKEA 1HYOA 3VV0A 2GQIA 3LGFA 2VKNA 2LJ1A 1O9SA 3PGGA 4M7DC 3CCQA 2R57A 1VQ5Q 1OZ2A 4L6V5 3CCMT 2O9VA 5LJ5h 1X6BA 3CCJT 2ABLA 4CC2A 4FSXA 1K73U 4JJCA 2KY9A 1VQOQ 3OS2A 1B34A 2BTTA 5IHNA 3CXCS 2D8JA 1VYUA 2CSIA 2HDAA 2R5AA 4OMLA 2FRYA 4M75A 2K5FA 5CAIA 4C5HA 4XTZA 3G4ST 5A2QE 1S72A 1XJWB 4A53A 2HBPA 1MGQA 1G3TA 2X9HA 2QQ9A 2KR3A 1N9RA 2RK1A 2CZ1B 4K11A 3MCAB 3VUZA 4J9FA 3OW2S 5KYYB 4KUDK 1NLPC 3OA6A 3RERA 1PSEA 2F2XA 2DRMA 2DXBA 2O01E 4ME7A 2EKOA 2V1RA 1Y07A 1YWPA 2JVVA 1TU0B 4PJOG 1YP5A 3CCLA 3X25B 4L59A 2ECZA 4KUIA 2QQRA 5GMKm 2XDBA 1Q86R 2HQHA 2HMAA 2ZPEB 3JRZA 3HTRA 3CPWP 1VQ5T 5LJ3f 3M0PA 2CP6A 1AVZC 5HK0A 5DLQE 2LQNA 3CMEA 1NZ9A 1MV3A 2KT1A 3CCEQ 4JZ3A 3CC2A 2IIMA 3EG9A 2PZ1A 4N0AC 4OB0B 4LDVA 4M78A 4RTYA 4X9DA 1N27A 3LYIA 4EMHA 4RKUE 2BKDN 3ZEHA 4HCKA 1NG2A 3LLRA 1KQ2A 1R0BG 2YT6A 2B8AA 3NPFA 1NBEB 1KJWA 4FCYA 3RMQA 3MEWA 2SEMA 4OGCA 2HL3A 2LNVA 4M78C 4BD3A 1OQKA 4IIMA 5J3BA 4C8QG 1KQ1A 3U23A 2AT1B 3HHTB 3RBBB 3CC2T 2SRCA 3H0FA 2FG0A 3EGXB 3PNWC 2EYXA 2O2OA 2B86A 1WFWA 2F2VA 2XMFA 2X35A 1AWOA 4JRPA 3OS1A 1R77A 2LRQA 4C8QD 5D6YA 2EKHA 1FX7A 2E3IA 1Z9ZA 1QW1A 5A0DA 3OYKA 2FZGB 2AZSA 3CCSA 4IURA 4PJNA 4X9CA 4Z8AA 5LJ5e 4MMLA 1AOJA 3I5SA 1RLQC 3VS6A 3JCMb 4M7AE 4OMNA 2RQUA 2X3WD 3PMIA 2RQRA 2L89A 1QP2A 1J3TA 3QBYA 2FB7A 2EGAA 2OAUA 1A0NB 1S72Q 1SSFA 3LW5E 2RO0A 1Q82C 4BY6B 4M75E 4DQ2A 3J81E 4X1VA 4LUEA 3V7RA 2IPOB 1R8OB 2AKKA 5GAN4 2V8IA 4CRIA 3H41A 1TUGB 2KGTA 1ZQ1A 4M75F 1EFNA 2EJFA 2JT4A 1KC8U 1BB9A 4OMFB 5GANd 4M7AF 1TG0A 2MWOA 3X28B 4J9EA 1ZA1B 4F7UF 2EJ9A 2P0PA 5KYYA 3QXEB 1LVKA 3S3MA 5KYXA 5A0LA 3P8HA 3CCEA 2DRKA 2PNIA 1RAEB 1EZZB 2FZKB 4LXCA 2YWWA 1RI9A 1ZSGA 1G3SA 1P92A 1VQ9T 2O88A 4C92F 4M7DG 3CBMA 3HP9A 2LVMA 3PE0A 2MCNA 4FW2A 1MMNA 3E19A 2JZ2A 1EX4A 2R58A 2LT1A 3MO8A 3OYAA 1Q81U 2MI6A 1OV3A 1UGVA 2QYZA 2PVDB 4C8QA 2KNBB 2YUQA 2CGHA 1KQSS 1X6OA 2MYSA 3CC4T 4WCIA 1RABB 2LQWA 1YHQQ 1VQ9A 3UDCA 1AD5A 3OMCA 4QVZA 4M7AA 2IG0A 4BE0A 2VUBA 2EFIA 1SHFA 1BKBA 1U1SA 2X51A 4JS4A 1AT1B 1C6VX 2L3PA 1IGUA 2Y4YA 2J06A 2G3RA 5KYXB 2EVRA 2DTHA 4N0AA 3CCRQ 3CD6A 3ZL7C 2NLUA 1ZSZA 3A8LB 3I35A 2QI2A 2VYTA 1G5VA 2RQWA 1KC8R 2KRNA 2VXEA 1B7TA 1CKAA 1NYGA 3H9NA 5KYUA 1U3OA 4J9GA 1JB0E 2CP5A 3CMAA 2J6KA 1D3BB 3L1AA 5GAOm 4RTZA 4P5NA 1OYXA 1FYNA 4J83A 3JB9I 3EG2A 4WTOB 2P0KA 1YBYA 3QWXX 1W6XA 2CP0A 2M0YA 1M1KC 4GLKA 3EG0A 2OTJA 4FL6A 4DA4A 3EG9B 1ZA2B 3TQ7P 2H8HA 1D1AA 1M1FA 3C0CA 1BK2A 1FXXA 3V8JA 2ZPIB 3WVDB 3O5ZA 5FU6C 5CQYA 1VQMQ 3FRNA 1XQHA 4KULA 2LX9A 3EG1A 4M75G 5C0MA 4PLIA 3QPHA 3QDFA 1XOVA 4PJJA 4C92G 2K79A 4E6RA 1TUDA 2HCKA 4HCZA 3OYCA 3CC4Q 4MZMA 1VQOA 4LD9K 3QZ9B 4PJOE 3META 4DOVA 1K9MC 4BE2A 1KIKA 4Y91A 2HQXA 1M27C 1WGSA 2QA4A 3TCJA 4AG1C 2E6NA 3HRTA 2ENMA 2ZPFB 2E70A 5FLXE 1WXBA 1WHGA 2JW4A 4C0DB 2QGFB 5I11A 4JJNK 2Y4XA 4PJOA 4XU1A 4XTUA 1WNLA 2EYWA 1V29B 4AG2C 2L3SA 2A08A 3UT1A 1VIEA 2F5KA 5GJVB 3THKA 4JPBW 2E5QA 4C0DC 3M56A 3M58A 4EMKA 2OTLQ 1PKTA 3F70A 1D09B 1I81A 3RIRA 1D1BA 1GL5A 1M4ZA 4OP0A 1RUWA 1SKUB 3OYDA 1BIBA 1NLOC 1I0CA 4KH1B 2E3HA 2K2MA 3SWNC 2PVGB 2HQEA 3X26B 1UHFA 1QP3A 2O4XB 1WHJA 2P0QA 2EQKA 1S1NA 4M7AC 3LH0A 1BCMA 1SPKA 2JMAA 1FMVA 4RG2A 2EW3A 4BUGA 3P8BB 2YHTA 2GFAA 3M0TA 3NTKA 5GAN7 3DB3A 2J6FA 5GAN5 1MNDA 4J9IA 2K4YA 1FWZA 2H3JA 1YN8A 5GAMh 4RTWA 1UUEA 3MP1A 1WHKA 2A37A 4J9CA 1OZ3A 2EAYA 2DLPA 2LQ8A 2EYYA 2CZ6B 3CCJA 1OU9A 1WXUA 3HKSA 1QCNA 3RDVA 5J26A 4KGVB 2CT3A 4XTVA 3WXMB 5D7UA 2ZGWA 1K1ZA 2M0OA 4HVVA 3CMEQ 2DYBA 1XTDA 3M55A 5CKBA 1KHCA 2JTFA 1M8VA 4M7DF 1IB8A 2BE7D 3HSBA 3UA6A 2VXFA 3C4SA 4N4HA 2YUNA 3JCMX 2HNIA 1YNZA 3QUIA 4FYWB 3CCJQ 4M77B 4N4GA 3G71A 1N8RR 5GAMg 5CKDA 2GGRA 2F1LA 1VQLT 2KMTA 2WSFE 2DJZA 2DNUA 4FT4A 2QXFA 1JRIA 3J80E 1ARKA 1OOTA 4FM4B 1SSHA 2O9SA 2E41A 2ROTA 3QZ5B 3G6EA 2COWA 3L2UA 2V26A 3SDZA 1W2BA 1WHMA 2E4HA 2RH2A 4C8QF 2DXTA 4JRQA 1Y96B 1GCPA 1B3QA 3OYBA 5FW9A 2Y90A 4OVAA 3VRYA 2K7AA 4KGXB 1ZBXA 2H3EB 2YUOA 3EAEA 1PG5B 1BI0A 1GBQA 2DEQA 1I1JA 3RKYA 1I8FA 1MNEA 2COZA 1PWTA 4ESRA 4MDXA 3OS0A 2DFUA 2D6FA 2DERA 2CZ7B 3RUXA 3R6NA 3G71T 1X69A 4OGEA 3OY9A 1X27A 5CK9A 3GOXA 2BZ8A 3VS3A 1BIAA 3BE3A 4BY6C 5GAOq 2DEUA 1UHCA 4J9HA 3VS2A 3CCMQ 3GLXA 1U1TA 4ZN1A 1VQ9Q 3JCMf 2E12A 2VV5A 3ZBDA 1M2OA 1N8RU 1UTIA 3LWHA 5GMKj 4O5VA 5EG2A 4DBRA 2K6DA 4PFOA 1QVFA 2DYIA 1VQ8Q 2QAZA 3HL8A 2CKKA 4C0FA
chains in the Genus database with same CATH topology
4Z8AA 3PVLA 4OMPA 1AOJA 3I5SA 1RLQC 3VS6A 3SEMA 1M3AA 1PHTA 4OMNA 2RQUA 2X3WD 2RQRA 1J3TA 1M30A 1VYTA 1X2KA 2C0TA 2EGAA 1A0NB 1ZUKA 1AWWA 3JV3A 1IO6A 4X1VA 1SHGA 1H3HA 4LUEA 1TUCA 2BZXA 1AWJA 1U5SA 2AKKA 3EHQA 1ZUUA 1T3SA 3H41A 2KGTA 2CUBA 4AFQC 1EFNA 1Y57A 2DJQA 1WA7A 2JT4A 1BB9A 4RTTA 2ESWA 1NEGA 3NMZC 1MV0B 2KT8A 2CUDA 1T3LA 3RNJA 1OEBA 2JMCA 1TG0A 1G2BA 4J9EA 2KYMA 3GBQA 1K9AA 2LJ0A 2YSQA 1B07A 2KROA 3H0IA 1ZLMA 1T0JA 5FWCA 2ROLA 2GNCA 1JXOA 2DRKA 3ULRB 2PNIA 2EGEA 1UJYA 2KYBA 2EYZA 5GJWB 1RI9A 1ZSGA 2O88A 1W1FA 2V1QA 5HCKA 4GLMA 3VS4A 2CH4W 5IH2A 2FPDA 2JM9A 5ECAA 3PE0A 3NGPA 2MCNA 4AFUC 4HVWA 2J7IA 5IHIA 4LN2A 4GBQA 3VS0A 2J05A 1NEBA 1PRMC 1X6GA 1CKBA 4AFZC 2RQTA 1OV3A 2DL5A 1UGVA 4DEXA 1X2QA 1QLYA 2KNBB 2L2PA 2YUQA 2DL7A 4LUDA 4ZNXA 1KFZA 2FEIA 4WCIA 3IQLA 4CC3A 2OAWA 3I5RA 2LQWA 1WLPB 2LZ6B 1AD5A 3TVTA 1V1CA 4AFSC 3H0HA 1VYVA 1QWEA 3CQTA 1SHFA 1UJ0A 3EHRA 1H8KA 2DL3A 1ABOA 2L3PA 4J9BA 2J06A 1GRIA 2EVRA 1RLPC 4JZ4A 3ZL7C 1ZX6A 2VVKA 3I35A 4F17A 2HEQA 2L0AA 2DA9A 2RQWA 4JJBA 1Z9QA 2KRNA 4J9DA 1CKAA 1NYGA 1U3OA 4J9GA 4F16A 5IXBA 2E5KA 1ZBJA 2DILA 2J6KA 5IXFA 1PNJA 4RTZA 1CSKA 1GFCA 1GBRA 2W10A 1NM7A 2GBQA 1FYNA 4RUGA 2RNAA 3EG2A 3TSZA 3SHWA 1K0XA 3QWXX 1W6XA 1Y0MA 2M0YA 2P4RA 3EG0A 4QT7A 4FSSA 2H8HA 2EPDA 1WX6A 3C0CA 2A36A 2GTJA 2LX7A 2MIOA 1BK2A 4JJDA 2D8HA 3VS5A 2DF6A 1N5ZA 2LJ3A 4HVUA 5IHKA 3O5ZA 2ED0A 2JTEA 1E7OA 1GFDA 3EG1A 4Z89A 4Y92A 1AZEA 4OMOA 1XOVA 2KXDA 2K79A 1YCSB 1TUDA 2HCKA 4E6RA 1SEMA 5EC7A 1UECA 1QKXA 1KIKA 1AEYA 1M27C 2JS0A 3VS1A 4AG1C 1JU5C 1JXMA 2AZVA 2ENMA 1WXTA 1NYFA 1UDLA 1HSQA 1GCQA 1WXBA 2D1XA 2JW4A 1H92A 5L23A 1QWFA 4DEYA 1AWXA 2DL8A 4EIKA 5I11A 3EG3A 1T0HA 4OMQA 1KSWA 2VWFA 4LNPA 2JM8A 4RTUA 2EYWA 2KXCA 1U06A 1OPLA 1ZUYA 2RQVA 4AG2C 2HBWA 4HXJA 2J6OA 2L3SA 2A08A 2DX1A 3VS7A 2M51A 3A98A 1WYXA 2FRWA 2F2WA 5GJVB 3THKA 4JPBW 1JQQA 2AKLA 3M0RA 3M0QA 3NHNA 1PKTA 1M3BA 1GL5A 3REAB 2JXBA 4CC4B 1RUWA 1NLOC 2LNHB 2RMOA 2C0IA 1I0CA 2CSQA 2DM1A 1ABQA 2DL4A 2K2MA 1BBZA 3EGUA 4LE9A 1UHFA 1S1NA 2DBMA 3UF4A 1SPKA 2OI3A 2D0NA 2FPFA 2L3QA 2JMAA 3LH5A 2MOXA 1MUZA 2NWMA 3QWYA 2EW3A 2LCSA 2CH4A 1M8MA 3M0TA 4A63B 2CT4A 2OJ2A 2ED1A 2J6FA 2GQIA 4J9IA 1OPKA 2DE0X 2VKNA 1HD3A 1YN8A 2LJ1A 2RPNA 4RTWA 1UUEA 2DBKA 4J9CA 2A37A 3VRZA 2O9VA 3REBB 1X6BA 2DLPA 2EYYA 2ABLA 4CC2A 1WXUA 2DMOA 2G6FX 2EBPA 4JJCA 2CT3A 1FMKA 4IIOA 1K4US 2BTTA 5IHNA 1WI7A 1E6GA 3UA7A 1VA7A 2D8JA 1K1ZA 4HVVA 2YDLA 1VYUA 2CSIA 2HDAA 4OMLA 2FRYA 1AZGB 2DYBA 1GCQC 1LCKA 2JS2A 4RTXA 2LMJA 3UA6A 2YUNA 1W70A 2BZYA 2DVJA 5I22A 4Z88A 1YNZA 2KR3A 4KRTA 1QKWA 3M0UA 1K0SA 1UG1A 4K11A 4J9FA 1UFFA 1G83A 1NLPC 2GGRA 1HJDA 2X3XD 2F2XA 2DRMA 2DNUA 2V1RA 1YWPA 4D8DA 3UATA 1YP5A 3TSWA 3M0SA 2FO0A 4D8KA 1OOTA 1ARKA 2KEAA 1SSHA 2ECZA 2O9SA 3FJ5A 1E6HA 2ROTA 2FPEA 1BU1A 2PTKA 2W0ZA 2O31A 1SRLA 3I9QA 2GTOA 1I07A 3M0PA 1AVZC 2LQNA 1GCPA 2KT1A 1MV3A 4JZ3A 1B3QA 2IIMA 2PZ1A 5FW9A 1WDXA 3VRYA 4RTYA 2K7AA 1X43A 2CREA 2YUOA 5FWBA 2HSPA 2KBTA 2AK5A 2LP5A 1GBQA 4ORZA 1I1JA 1M3CA 2EQIA 2QDLA 4HCKA 1NG2A 4CC7A 2YT6A 3PVQA 1PWTA 3NPFA 2KE9A 4ESRA 1K76A 1QCFA 1KJWA 1SRMA 2KRMA 2KRSA 4F14A 2NUZA 2SEMA 2YUPA 1PKSA 3KFVA 4IIMA 4RTVA 3R6NA 1JEGA 1X69A 4M4ZA 3U23A 1X27A 4R0KA 2BZ8A 3RBBB 3VS3A 2SRCA 2K9GA 3H0FA 2FG0A 4OMMA 1UHCA 4J9HA 3VS2A 2EYXA 2O2OA 2B86A 1WFWA 2F2VA 2XMFA 2K3BA 2C0OA 1AWOA 1JO8A 1WIEA 1UTIA 2CDTA 2EKHA 2K6DA 2RN8A 1Z9ZA 1UE9A 2I0NA 1YWOA 2EGCA 2RF0A 1PRLC 2AZSA 2A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8A A;  3PVL A;  4OMP A;  1AOJ A;  3I5S A;  1RLQ C;  3VS6 A;  3SEM A;  1M3A A;  1PHT A;  4OMN A;  2RQU A;  2X3W D;  2RQR A;  1J3T A;  1M30 A;  1VYT A;  1X2K A;  2C0T A;  2EGA A;  1A0N B;  1ZUK A;  1AWW A;  3JV3 A;  1IO6 A;  4X1V A;  1SHG A;  1H3H A;  4LUE A;  1TUC A;  2BZX A;  1AWJ A;  1U5S A;  2AKK A;  3EHQ A;  1ZUU A;  1T3S A;  3H41 A;  2KGT A;  2CUB A;  4AFQ C;  1EFN A;  1Y57 A;  2DJQ A;  1WA7 A;  2JT4 A;  1BB9 A;  4RTT A;  2ESW A;  1NEG A;  3NMZ C;  1MV0 B;  2KT8 A;  2CUD A;  1T3L A;  3RNJ A;  1OEB A;  2JMC A;  1TG0 A;  1G2B A;  4J9E A;  2KYM A;  3GBQ A;  1K9A A;  2LJ0 A;  2YSQ A;  1B07 A;  2KRO A;  3H0I A;  1ZLM A;  1T0J A;  5FWC A;  2ROL A;  2GNC A;  1JXO A;  2DRK A;  3ULR B;  2PNI A;  2EGE A;  1UJY A;  2KYB A;  2EYZ A;  5GJW B;  1RI9 A;  1ZSG A;  2O88 A;  1W1F A;  2V1Q A;  5HCK A;  4GLM A;  3VS4 A;  2CH4 W;  5IH2 A;  2FPD A;  2JM9 A;  5ECA A;  3PE0 A;  3NGP A;  2MCN A;  4AFU C;  4HVW A;  2J7I A;  5IHI A;  4LN2 A;  4GBQ A;  3VS0 A;  2J05 A;  1NEB A;  1PRM C;  1X6G A;  1CKB A;  4AFZ C;  2RQT A;  1OV3 A;  2DL5 A;  1UGV A;  4DEX A;  1X2Q A;  1QLY A;  2KNB B;  2L2P A;  2YUQ A;  2DL7 A;  4LUD A;  4ZNX A;  1KFZ A;  2FEI A;  4WCI A;  3IQL A;  4CC3 A;  2OAW A;  3I5R A;  2LQW A;  1WLP B;  2LZ6 B;  1AD5 A;  3TVT A;  1V1C A;  4AFS C;  3H0H A;  1VYV A;  1QWE A;  3CQT A;  1SHF A;  1UJ0 A;  3EHR A;  1H8K A;  2DL3 A;  1ABO A;  2L3P A;  4J9B A;  2J06 A;  1GRI A;  2EVR A;  1RLP C;  4JZ4 A;  3ZL7 C;  1ZX6 A;  2VVK A;  3I35 A;  4F17 A;  2HEQ A;  2L0A A;  2DA9 A;  2RQW A;  4JJB A;  1Z9Q A;  2KRN A;  4J9D A;  1CKA A;  1NYG A;  1U3O A;  4J9G A;  4F16 A;  5IXB A;  2E5K A;  1ZBJ A;  2DIL A;  2J6K A;  5IXF A;  1PNJ A;  4RTZ A;  1CSK A;  1GFC A;  1GBR A;  2W10 A;  1NM7 A;  2GBQ A;  1FYN A;  4RUG A;  2RNA A;  3EG2 A;  3TSZ A;  3SHW A;  1K0X A;  3QWX X;  1W6X A;  1Y0M A;  2M0Y A;  2P4R A;  3EG0 A;  4QT7 A;  4FSS A;  2H8H A;  2EPD A;  1WX6 A;  3C0C A;  2A36 A;  2GTJ A;  2LX7 A;  2MIO A;  1BK2 A;  4JJD A;  2D8H A;  3VS5 A;  2DF6 A;  1N5Z A;  2LJ3 A;  4HVU A;  5IHK A;  3O5Z A;  2ED0 A;  2JTE A;  1E7O A;  1GFD A;  3EG1 A;  4Z89 A;  4Y92 A;  1AZE A;  4OMO A;  1XOV A;  2KXD A;  2K79 A;  1YCS B;  1TUD A;  2HCK A;  4E6R A;  1SEM A;  5EC7 A;  1UEC A;  1QKX A;  1KIK A;  1AEY A;  1M27 C;  2JS0 A;  3VS1 A;  4AG1 C;  1JU5 C;  1JXM A;  2AZV A;  2ENM A;  1WXT A;  1NYF A;  1UDL A;  1HSQ A;  1GCQ A;  1WXB A;  2D1X A;  2JW4 A;  1H92 A;  5L23 A;  1QWF A;  4DEY A;  1AWX A;  2DL8 A;  4EIK A;  5I11 A;  3EG3 A;  1T0H A;  4OMQ A;  1KSW A;  2VWF A;  4LNP A;  2JM8 A;  4RTU A;  2EYW A;  2KXC A;  1U06 A;  1OPL A;  1ZUY A;  2RQV A;  4AG2 C;  2HBW A;  4HXJ A;  2J6O A;  2L3S A;  2A08 A;  2DX1 A;  3VS7 A;  2M51 A;  3A98 A;  1WYX A;  2FRW A;  2F2W A;  5GJV B;  3THK A;  4JPB W;  1JQQ A;  2AKL A;  3M0R A;  3M0Q A;  3NHN A;  1PKT A;  1M3B A;  1GL5 A;  3REA B;  2JXB A;  4CC4 B;  1RUW A;  1NLO C;  2LNH B;  2RMO A;  2C0I A;  1I0C A;  2CSQ A;  2DM1 A;  1ABQ A;  2DL4 A;  2K2M A;  1BBZ A;  3EGU A;  4LE9 A;  1UHF A;  1S1N A;  2DBM A;  3UF4 A;  1SPK A;  2OI3 A;  2D0N A;  2FPF A;  2L3Q A;  2JMA A;  3LH5 A;  2MOX A;  1MUZ A;  2NWM A;  3QWY A;  2EW3 A;  2LCS A;  2CH4 A;  1M8M A;  3M0T A;  4A63 B;  2CT4 A;  2OJ2 A;  2ED1 A;  2J6F A;  2GQI A;  4J9I A;  1OPK A;  2DE0 X;  2VKN A;  1HD3 A;  1YN8 A;  2LJ1 A;  2RPN A;  4RTW A;  1UUE A;  2DBK A;  4J9C A;  2A37 A;  3VRZ A;  2O9V A;  3REB B;  1X6B A;  2DLP A;  2EYY A;  2ABL A;  4CC2 A;  1WXU A;  2DMO A;  2G6F X;  2EBP A;  4JJC A;  2CT3 A;  1FMK A;  4IIO A;  1K4U S;  2BTT A;  5IHN A;  1WI7 A;  1E6G A;  3UA7 A;  1VA7 A;  2D8J A;  1K1Z A;  4HVV A;  2YDL A;  1VYU A;  2CSI A;  2HDA A;  4OML A;  2FRY A;  1AZG B;  2DYB A;  1GCQ C;  1LCK A;  2JS2 A;  4RTX A;  2LMJ A;  3UA6 A;  2YUN A;  1W70 A;  2BZY A;  2DVJ A;  5I22 A;  4Z88 A;  1YNZ A;  2KR3 A;  4KRT A;  1QKW A;  3M0U A;  1K0S A;  1UG1 A;  4K11 A;  4J9F A;  1UFF A;  1G83 A;  1NLP C;  2GGR A;  1HJD A;  2X3X D;  2F2X A;  2DRM A;  2DNU A;  2V1R A;  1YWP A;  4D8D A;  3UAT A;  1YP5 A;  3TSW A;  3M0S A;  2FO0 A;  4D8K A;  1OOT A;  1ARK A;  2KEA A;  1SSH A;  2ECZ A;  2O9S A;  3FJ5 A;  1E6H A;  2ROT A;  2FPE A;  1BU1 A;  2PTK A;  2W0Z A;  2O31 A;  1SRL A;  3I9Q A;  2GTO A;  1I07 A;  3M0P A;  1AVZ C;  2LQN A;  1GCP A;  2KT1 A;  1MV3 A;  4JZ3 A;  1B3Q A;  2IIM A;  2PZ1 A;  5FW9 A;  1WDX A;  3VRY A;  4RTY A;  2K7A A;  1X43 A;  2CRE A;  2YUO A;  5FWB A;  2HSP A;  2KBT A;  2AK5 A;  2LP5 A;  1GBQ A;  4ORZ A;  1I1J A;  1M3C A;  2EQI A;  2QDL A;  4HCK A;  1NG2 A;  4CC7 A;  2YT6 A;  3PVQ A;  1PWT A;  3NPF A;  2KE9 A;  4ESR A;  1K76 A;  1QCF A;  1KJW A;  1SRM A;  2KRM A;  2KRS A;  4F14 A;  2NUZ A;  2SEM A;  2YUP A;  1PKS A;  3KFV A;  4IIM A;  4RTV A;  3R6N A;  1JEG A;  1X69 A;  4M4Z A;  3U23 A;  1X27 A;  4R0K A;  2BZ8 A;  3RBB B;  3VS3 A;  2SRC A;  2K9G A;  3H0F A;  2FG0 A;  4OMM A;  1UHC A;  4J9H A;  3VS2 A;  2EYX A;  2O2O A;  2B86 A;  1WFW A;  2F2V A;  2XMF A;  2K3B A;  2C0O A;  1AWO A;  1JO8 A;  1WIE A;  1UTI A;  2CDT A;  2EKH A;  2K6D A;  2RN8 A;  1Z9Z A;  1UE9 A;  2I0N A;  1YWO A;  2EGC A;  2RF0 A;  1PRL C;  2AZS A;  2A28 A; 
#chains in the Genus database with same CATH topology
 3PVL A;  3OYE A;  3PMT A;  4OMP A;  3G4S Q;  2XG8 D;  3A8H B;  1M3A A;  4E7Z A;  4PL6 A;  4C92 D;  4E7L A;  3GF5 A;  3SWN B;  1M30 A;  5LJ3 e;  1I4K 1;  3CEY A;  1N9S A;  1ZUK A;  1AWW A;  4LDW A;  3EFO A;  4EMG A;  4EMK C;  4A4G A;  1AWJ A;  3CBO A;  2MK5 A;  3CCR A;  3EHQ A;  3VU3 C;  1ZUU A;  1RAC B;  1T3S A;  2FYK A;  2CUB A;  2NUT A;  1VQK A;  2K2V A;  2DJQ A;  3JCM h;  1D3B A;  1VQN A;  2ESW A;  4RG8 A;  3NMZ C;  4LDX A;  1MV0 B;  3M5A A;  5GMK h;  3RNJ A;  4C5G A;  4M7D D;  2RM4 A;  2LC4 A;  4KT0 E;  5GAO r;  1VQM T;  5GMK l;  3JB9 G;  1YJ9 Q;  5KYW A;  3H0I A;  1ZLM A;  1T0J A;  2ROL A;  1YJW A;  2GNC A;  4DBF A;  1YJN Q;  1JXO A;  2ZPB B;  4JDS A;  5IN1 A;  2DO3 A;  2RI3 A;  4M75 C;  1UJY A;  4MZT A;  3J7A F;  1MMA A;  2F69 A;  3VS4 A;  1VQ4 A;  2JM9 A;  5IAY A;  1VQL Q;  5ECA A;  2XU8 A;  3NGP A;  4GBQ A;  4C0Z A;  3S3O A;  2J05 A;  4QQD A;  2I2L A;  1C0M A;  1M2V A;  3OW2 P;  2RQT A;  4OB1 B;  1QVG S;  2DL5 A;  4ATO A;  3A1P A;  4ZGJ B;  1QVP A;  1K9M R;  1WPY A;  4UC4 A;  4ZNX A;  1W4S A;  3JCM W;  4CC3 A;  4XTY A;  1WLP B;  2LZ6 B;  4M77 D;  1M9S A;  1B34 B;  3H0H A;  7AT1 B;  2RJC A;  1M5Q 1;  1QWE A;  1YJW T;  3BDL A;  4PJO D;  3EFS A;  4J9B A;  5LJ3 j;  2QA4 Q;  2CZ0 B;  1VQ7 A;  5LJ3 g;  1RAA B;  1NPR A;  1ZX6 A;  3CCV Q;  2VVK A;  1IHW A;  3I56 A;  4F17 A;  2XDP A;  4PJM A;  4B9X A;  2L0A A;  1NJI C;  3L2W A;  2D0Q B;  1Z9Q A;  5I21 A;  2JJ9 A;  5GMK i;  2M02 A;  4PJO F;  5IXB A;  2E5K A;  1ZBJ A;  5CKF A;  3Q1J A;  2DIL A;  3R6O A;  3CC7 A;  3EGD A;  2ZZD A;  1PNJ A;  1GBR A;  1KD1 U;  2W10 A;  1NM7 A;  5LJ5 g;  4RUG A;  1TTH B;  2LTO A;  1MMG A;  5LJ5 d;  1VQN Q;  3HRU A;  4ZTJ A;  1YJN A;  2P4R A;  2E65 A;  1TWB A;  4II1 A;  2E64 A;  4HCC A;  3BDU A;  2EPD A;  4JJD A;  1WJQ A;  2WSE E;  2D8H A;  4A4K A;  3S6W A;  4DBQ A;  4HVU A;  5IHK A;  3SWN A;  1WJR A;  2RB6 A;  3LGL A;  2ED0 A;  2BIV A;  4M78 D;  3JCM J;  2K57 A;  4V2S A;  4ZGD B;  5EC7 A;  2QG9 B;  1VQK Q;  4BI8 B;  3CD6 Q;  1AEY A;  2DAQ A;  2XKO C;  1GXI E;  1LNX A;  2D1X A;  3L42 A;  3MP6 A;  4DEY A;  1AWX A;  1OX9 A;  1TH7 A;  1TOV A;  1KSW A;  3AHU A;  1I5L A;  2VWF A;  1BI3 A;  2HKQ B;  5M9O A;  3MPU B;  4PFP A;  1Q82 U;  3NTI A;  4DOW A;  4HXJ A;  2DX1 A;  3CCV T;  1IZ6 A;  1JJ2 S;  4C8Q B;  1N6A A;  4FYV B;  3FDR A;  1RAH B;  1OUL A;  4R56 A;  3M0Q A;  3QO3 A;  2NUP A;  1QVG P;  4Z02 A;  3X20 B;  4XU2 A;  2RHX A;  3REA B;  4CC4 B;  2K3X A;  2RD1 A;  2LNH B;  2RMO A;  2X4J A;  2NYS A;  2DTO A;  3G1J A;  1YJN T;  1BBZ A;  1Q7Y C;  4LE9 A;  1PSF A;  1YIT T;  2OI3 A;  2D0N A;  1G8X A;  3RMS A;  5GAN f;  3I56 Q;  5CQX A;  5IT9 E;  3G7Z A;  4C92 E;  4J6Y A;  1O75 A;  4A63 B;  2CT4 A;  2OJ2 A;  5GAN 6;  3CCS Q;  3MEA A;  5FRM A;  3JCM e;  3CCQ Q;  4ELZ C;  3CD6 T;  4RCB A;  2CS7 A;  2DBK A;  2WAC A;  2HAX A;  4F7U E;  5GAN 8;  2X4Y A;  4NOY A;  5GAN 3;  4M7D B;  2DMO A;  1VQP A;  2EBP A;  4E7S A;  1FMK A;  4M75 D;  3X24 B;  4EPC A;  1K4U S;  1SG5 A;  1WI7 A;  1E6G A;  3UA7 A;  4HCB A;  2E6Z A;  1AZG B;  2JUF A;  1GCQ C;  5CR2 A;  1UGP B;  4FYY B;  1LCK A;  3VJP A;  4M7A D;  2E10 A;  3MHX A;  3SFM A;  2BZY A;  1OI1 A;  2DVJ A;  5I22 A;  4Z88 A;  5J39 A;  1QQJ A;  2MWP A;  3HFN A;  4KRT A;  5CKE A;  2GFU A;  1TS9 A;  2VGN A;  2XID A;  5HKC A;  3M0U A;  2OTJ Q;  4XQ3 A;  2LQK A;  4XK8 E;  4C0G A;  5GAO n;  1RAG B;  1IHV A;  3TEE A;  2C06 A;  3M53 A;  2Z0W A;  2VC8 A;  1HJD A;  2RHY A;  1RAD B;  4LD6 A;  2X3X D;  4M77 C;  3I56 T;  3MJX A;  4CI0 C;  3EFR A;  4D8D A;  2DXU A;  3UAT A;  3M0S A;  4FW1 A;  4PJO C;  3ASK A;  3OSV A;  3FJ5 A;  1E6H A;  3MEV A;  2QDY B;  1Y7X A;  2L8D A;  2RJF A;  2FPE A;  3H8Z A;  1BU1 A;  1M1K U;  4ZGE B;  2O31 A;  2HD0 A;  1SRL A;  3I9Q A;  2GTO A;  1I07 A;  4KBM B;  1OX8 A;  1Y71 A;  1ZHI A;  3GPL A;  4EDU A;  2RI2 A;  4MDW A;  1RL2 A;  1VQK T;  1YIJ T;  3C95 A;  1X43 A;  2CRE A;  3FEO A;  5FWB A;  3JSC A;  3QJY A;  2LP5 A;  3EH1 A;  5GAN j;  4N4I A;  1M3C A;  1QVF P;  3OYI A;  4CC7 A;  2KQW A;  3CPW S;  2KE9 A;  1K76 A;  1QCF A;  2NUP B;  2KK4 A;  1SRM A;  2KRM A;  2YRD A;  4F14 A;  4HT8 A;  2RK2 A;  2QEX T;  3TRE A;  2YUP A;  2L5Q A;  3V7S A;  1YJ9 T;  4LDU A;  2LT4 A;  1JEG A;  4M4Z A;  3GIB A;  2RJE A;  4J7I A;  4R0K A;  1PC0 A;  4AT1 B;  4OMM A;  3CCM A;  1BI2 A;  4PNO A;  2M1H A;  2K3B A;  2C0O A;  3FLG A;  3V7C A;  2K5I A;  3M4Y A;  2EIF A;  2HZY A;  3DLM A;  1Q81 R;  2RN8 A;  4YTL A;  1UE9 A;  5DM7 R;  2I0N A;  1YWO A;  1LJO A;  2MPX C;  2OTL A;  3H6Z A;  4E7J A;  2EGC A;  4M7A G;  3DB4 A;  4ANJ A;  2EQM A;  2PQW A;  4E2F B;  1UGQ B;  4BE1 A;  2MAM A;  1BI1 A;  4M77 A;  2O4X A;  4JS5 A;  3OSS C;  4A54 A;  2YLC A;  2ZAE A;  4QVD A;  4XU0 A;  1LPL A;  3E2U A;  4PKC C;  1G3W A;  1VYT A;  3VYG A;  1YIJ Q;  3CC4 A;  1X2K A;  3EGD B;  2FZC B;  1M1K R;  3JV3 A;  4HT9 A;  4FU6 A;  3KBG A;  5C6S A;  4R55 A;  2FL7 A;  3GNG A;  1SHG A;  1TUC A;  1VQL A;  1U5S A;  2X4W A;  3JCM P;  3OYH A;  3JB9 D;  3JB9 J;  1VQN T;  2CP7 A;  4AFQ C;  5LJ3 d;  4BI3 A;  1Y57 A;  3C94 A;  2QA4 T;  2EWN A;  2KSS A;  3KUF A;  5GAN h;  4VUB A;  1NEG A;  2ZPH B;  2KT8 A;  2CUD A;  3EH2 A;  2RI5 A;  2RHI A;  1YHQ A;  2JMC A;  3JCM V;  1TSF A;  2QEX Q;  3JB9 F;  1Q7Y U;  1ZSZ B;  2KYM A;  1WZO A;  1K9A A;  4OB3 B;  2YSQ A;  2KRO A;  1Q86 C;  4C92 C;  3ULR B;  4J7F A;  2EGE A;  3OS5 A;  4PFZ A;  2OTJ T;  2KYB A;  2EYZ A;  4A4E A;  5GJW B;  1Q81 C;  2DIG A;  1H3Z A;  3HRS A;  1PD0 A;  1W1F A;  2KVQ G;  4GLM A;  1KG1 A;  2CH4 W;  5IH2 A;  1QCO A;  1RI0 A;  4KH0 B;  3G6E Q;  5GAM d;  3VS0 A;  3D7S B;  1UB4 A;  1NEB A;  2DD5 A;  4C5E A;  1X6G A;  4KGZ B;  4M78 F;  2MF2 A;  3A5Z B;  2JTM A;  4DBH A;  4QW2 A;  3RKW A;  5KE3 A;  1X2Q A;  5FU7 C;  3LWI A;  1QLY A;  2L2P A;  1DJ7 B;  4LUD A;  5AYF A;  5LL6 S;  3M4G A;  4NL2 A;  2FEI A;  4JUV A;  1IGQ A;  1MHN A;  3BW1 A;  3I5R A;  2CYZ B;  3HPW A;  3TVT A;  2HKN A;  1VQ4 T;  2DTI A;  4B6M A;  4IUQ A;  2EQU A;  3CQT A;  2LCC A;  1Y96 A;  3OBY A;  3FIF A;  2K5L A;  3CPW A;  1KQS A;  4MMK A;  4PJO B;  1RLP C;  2CP2 A;  2RHZ A;  6AT1 B;  4D6W A;  2HEQ A;  3AT1 B;  3A8G B;  4C92 A;  2DA9 A;  4JJB A;  3PIO A;  1VQ8 T;  3RR6 A;  3CCS T;  1RAF B;  3E1S A;  4HA8 A;  2ZCF B;  4OB2 B;  5IXF A;  4A4F A;  1Q7Y R;  5HY6 A;  1CSK A;  1GFC A;  2V8K A;  2GBQ A;  2R5M A;  4IKF A;  5CIU A;  4M77 F;  2RNA A;  3G6E T;  3TSZ A;  4BAC A;  3QYH B;  2JN0 A;  4QT7 A;  4FSS A;  2EJG A;  5CO7 A;  1BCO A;  1F1B B;  3QDR B;  2GF7 A;  1WX6 A;  2YXY A;  2GTJ A;  2MIO A;  4OF1 A;  2PUO B;  2DF6 A;  1N5Z A;  2LJ3 A;  4JLI A;  1E7O A;  1AHJ B;  1N8R C;  1GFD A;  3OYL A;  4B9W A;  4Z89 A;  4Y92 A;  1QVG A;  1PCX A;  1YCS B;  5I2S A;  2DK3 A;  3ME9 A;  3ER0 A;  8AT1 B;  1UEC A;  5GAO p;  1HXD A;  1VQ4 Q;  1VQ7 Q;  1JXM A;  3OB9 A;  2AZV A;  5FU6 B;  3E9G A;  1NYF A;  3PIP A;  4ZTF A;  1GCQ A;  1VQ5 A;  2GCX A;  5L23 A;  1QWF A;  2DL8 A;  3EG3 A;  4OMQ A;  4BDZ A;  4LNP A;  3CCU Q;  1M2V B;  2P84 A;  1U06 A;  4J5Y A;  2HSE B;  2DIQ A;  2HBW A;  4M77 G;  3VS7 A;  3QII A;  8ATC B;  1D0Y A;  1WYX A;  2FRW A;  2F2W A;  4PJL A;  4IUT A;  3JB9 H;  3SD4 A;  3V8K A;  1KHI A;  2AKL A;  3OYM A;  3NHN A;  4BDY A;  4M7D E;  1M3B A;  2DPP B;  3QJ6 A;  1M1G A;  2C0I A;  2DM1 A;  5KCH A;  2RJD A;  2DBM A;  4X34 A;  3MKD A;  4M78 B;  3OBW A;  2V8J A;  1LOJ A;  2NWM A;  4AMC A;  2EYQ A;  3VYH B;  3L2Q A;  3CXC P;  1YJW Q;  1M8M A;  4BB7 A;  3CCR T;  4PLL A;  2ED1 A;  3CXC A;  5FRN A;  1OPK A;  2BUD A;  2DE0 X;  1HD3 A;  1VQ7 T;  2RPN A;  3G71 Q;  3A8O B;  3VRZ A;  3REB B;  4ZN3 A;  1X75 C;  1YI2 Q;  3EFO B;  5GAN g;  1KC8 C;  2G6F X;  4M78 G;  4IIO A;  2AIR B;  1VA7 A;  5GAM f;  2YDL A;  5HK3 A;  5FRO A;  3CCV A;  2JS2 A;  4RTX A;  3QYG B;  3CMA T;  2LMJ A;  1W70 A;  4JRK A;  4M78 E;  1NE8 A;  4EMK B;  1JJ2 A;  1S72 T;  3I55 A;  1QKW A;  1WJS A;  2KI7 A;  1K0S A;  1UG1 A;  1G3Y A;  3KXT A;  3CBP A;  1UFF A;  1G83 A;  4FYX B;  4F7U B;  3O8V A;  4C8Q E;  5LJ5 j;  3OW2 A;  3PTA A;  3TSW A;  1Q95 G;  2FO0 A;  4D8K A;  1D0Z A;  2KEA A;  3OYY A;  3UWN A;  5KCO A;  5GAM j;  1VQM A;  2CP3 A;  2A7Y A;  2DET A;  2IVW A;  4QVC A;  3OYJ A;  2PTK A;  2W0Z A;  2A0F B;  4Q5W A;  4RMO A;  1QVF S;  2PUK B;  2MMP A;  3EGX A;  3UPU A;  2YLB A;  1UGR B;  2DVE A;  4C92 B;  1WDX A;  4C8Q C;  4FIB A;  3L2Z A;  3E9F A;  2K3Y A;  4M77 E;  3HFO A;  2QQS A;  3ZFJ A;  5KYN A;  2HSP A;  3FJP A;  4IUU A;  2KBT A;  2AK5 A;  2DXC A;  3CMA Q;  4O6J A;  2ATC B;  4ORZ A;  2EQI A;  2QDL A;  4GY5 A;  3I55 Q;  1EIF A;  3VUB A;  3PVQ A;  1YIT Q;  3A8M B;  2KRS A;  1I5O B;  4NS5 A;  3JCM c;  2XD0 A;  2NUZ A;  1VQ6 T;  1SF9 A;  1KQS P;  2DZ9 A;  1PKS A;  3KFV A;  4RTV A;  4XTW A;  5CVI A;  1IXD A;  4M75 B;  2XHC A;  3WVE B;  2FVU A;  2M16 A;  2K9G A;  2VB6 A;  4LDY A;  2E1H A;  3OYG A;  5KYW B;  4XTX A;  3NFC A;  3OYF A;  1JO8 A;  1WIE A;  1M90 R;  1R0C B;  4F7U A;  2CDT A;  1JBM A;  3M9Q A;  2RF0 A;  3GNF B;  1K9M U;  1PRL C;  2A28 A;  3JCM Q;  4IUP A;  3MEU A;  3NTH A;  1YJ9 A;  5A0G A;  3TU4 K;  4J8O A;  3SEM A;  1PHT A;  3URG A;  3DKM A;  1NJI R;  2C0T A;  1UEB A;  3BFM A;  4JLG A;  4E7H A;  5KE2 A;  1IO6 A;  1D0X A;  3T9N A;  2DZC A;  1H3H A;  2BZX A;  1VIF A;  1W2B S;  3CC7 T;  1C1A A;  2QQB A;  4BI4 A;  2GQV A;  1WA7 A;  1YFN A;  4M7D A;  1VQ6 Q;  4RTT A;  1WQW A;  1PD1 A;  1YI2 A;  5CCA A;  3DLL A;  1T3L A;  1RAI B;  4PK4 A;  4QQ6 A;  1OEB A;  2L3R A;  2QTX A;  1G2B A;  2A3L A;  4F04 B;  1KD1 R;  5LJ5 f;  3GBQ A;  2X4X A;  3G4S A;  2LJ0 A;  3QSU A;  1FMW A;  2BE9 B;  1B07 A;  2YRV A;  1M90 C;  3GP8 A;  5FWC A;  2M9U A;  1IRE B;  3CC2 Q;  4E7I A;  5GAN e;  1K8A R;  2KDS A;  2QEX A;  1D1C A;  1V76 A;  5D6X A;  4RCC A;  3JCM d;  3P8D A;  3LX7 A;  2V1Q A;  3OYN A;  5HCK A;  2FPD A;  4C5I A;  1YIJ A;  4AFU C;  3M54 A;  3SB2 A;  4HVW A;  2J7I A;  1VQP Q;  5IHI A;  4J6W A;  2OX7 A;  4LN2 A;  2COY A;  2VGM A;  1M90 U;  1PRM C;  4FT2 A;  1CKB A;  3CCL Q;  2RHU A;  1WHL A;  4AFZ C;  2XIC A;  4L5G A;  4DEX A;  3OMG A;  2D9T A;  3L2V A;  3S3N A;  3M59 A;  2DL7 A;  5GAO l;  5GAM e;  1OU8 A;  2QAS A;  1VQO T;  1KFZ A;  2RA2 A;  3FC3 A;  2FHD A;  1ACM B;  1YIT A;  3IQL A;  2OAW A;  1NJI U;  5KYU B;  3CCU A;  4ELY C;  1V1C A;  3M57 A;  4AFS C;  2QTV A;  5L8R E;  1Q82 R;  4NL3 A;  1VYV A;  3CCU T;  2JNG A;  3JCM g;  1UJ0 A;  3JAM E;  3EHR A;  1H8K A;  2DL3 A;  2VAS A;  1W2B P;  1ABO A;  1QMC A;  4IUV A;  4QKU A;  2HL5 C;  4MZP A;  1KK7 A;  1GRI A;  4TVR A;  4XAX B;  1KD1 C;  4JZ4 A;  2XI9 A;  3MP8 A;  2YRC A;  3CCQ T;  4WF2 A;  5LJ3 h;  4J9D A;  1K8A C;  3BY7 A;  4F16 A;  1H64 1;  4J6X A;  1JJ2 P;  1HK9 A;  5GMK e;  2QGG A;  2P4T A;  3INZ A;  3N5B B;  5FU7 B;  1WQ7 A;  3SHW A;  3RES A;  3RKX A;  1VQ6 A;  1UGS B;  1YCY A;  2DD4 A;  1K0X A;  1PM3 A;  1Y0M A;  3QKJ A;  1K8A U;  1U8R A;  1VQP T;  5GAN 2;  3CCL T;  2PVO B;  3PFS A;  3VS5 A;  2A36 A;  2LX7 A;  2DKG A;  4XU3 A;  1XNI A;  2JTE A;  3QHS A;  3V8L A;  4E7K A;  1K73 R;  1AZE A;  4OMO A;  2XDD A;  2KXD A;  3CCE T;  1SEM A;  4Y28 E;  4QQG A;  1YI2 T;  5DLO A;  2PU9 B;  1QKX A;  3OQ5 A;  2JS0 A;  2OTL T;  1VUB A;  3VS1 A;  1JU5 C;  4A4H A;  1WXT A;  1UDL A;  1HSQ A;  1H92 A;  1VQ8 A;  1YHQ T;  1ZSZ C;  5I2M A;  4EIK A;  3L2R A;  1T0H A;  1NPP A;  2JM8 A;  4RTU A;  2KXC A;  3PT9 A;  2KAF A;  3CC7 Q;  1OPL A;  5KH6 A;  1ZUY A;  2AHJ B;  2RQV A;  2J6O A;  2QQA A;  3QG1 A;  3FB9 A;  1TXQ A;  2M51 A;  3A98 A;  2XK0 A;  1IRX A;  4M7A B;  2JOY A;  1JQQ A;  3M0R A;  4E47 A;  4JRI A;  1MMD A;  5AT1 B;  9ATC B;  2LDM A;  2JXB A;  1VOM A;  1WHH A;  1BYM A;  5CKH A;  1X01 A;  2CSQ A;  1ABQ A;  2DL4 A;  3EGU A;  2QK0 A;  2EQJ A;  3UF4 A;  2F5T X;  5D6W A;  3VKI A;  2FPF A;  2L3Q A;  3C12 A;  2ZPG B;  1Q86 U;  3LH5 A;  2MOX A;  1MUZ A;  4F7U G;  2NUT B;  3CPF A;  2LCL A;  3QWY A;  1K73 C;  2WSC E;  2LCS A;  2CH4 A;  3I55 T;  5DY9 A;  3CME T;  4HKE A;  1HYO A;  3VV0 A;  2GQI A;  3LGF A;  2VKN A;  2LJ1 A;  1O9S A;  3PGG A;  4M7D C;  3CCQ A;  2R57 A;  1VQ5 Q;  1OZ2 A;  4L6V 5;  3CCM T;  2O9V A;  5LJ5 h;  1X6B A;  3CCJ T;  2ABL A;  4CC2 A;  4FSX A;  1K73 U;  4JJC A;  2KY9 A;  1VQO Q;  3OS2 A;  1B34 A;  2BTT A;  5IHN A;  3CXC S;  2D8J A;  1VYU A;  2CSI A;  2HDA A;  2R5A A;  4OML A;  2FRY A;  4M75 A;  2K5F A;  5CAI A;  4C5H A;  4XTZ A;  3G4S T;  5A2Q E;  1S72 A;  1XJW B;  4A53 A;  2HBP A;  1MGQ A;  1G3T A;  2X9H A;  2QQ9 A;  2KR3 A;  1N9R A;  2RK1 A;  2CZ1 B;  4K11 A;  3MCA B;  3VUZ A;  4J9F A;  3OW2 S;  5KYY B;  4KUD K;  1NLP C;  3OA6 A;  3RER A;  1PSE A;  2F2X A;  2DRM A;  2DXB A;  2O01 E;  4ME7 A;  2EKO A;  2V1R A;  1Y07 A;  1YWP A;  2JVV A;  1TU0 B;  4PJO G;  1YP5 A;  3CCL A;  3X25 B;  4L59 A;  2ECZ A;  4KUI A;  2QQR A;  5GMK m;  2XDB A;  1Q86 R;  2HQH A;  2HMA A;  2ZPE B;  3JRZ A;  3HTR A;  3CPW P;  1VQ5 T;  5LJ3 f;  3M0P A;  2CP6 A;  1AVZ C;  5HK0 A;  5DLQ E;  2LQN A;  3CME A;  1NZ9 A;  1MV3 A;  2KT1 A;  3CCE Q;  4JZ3 A;  3CC2 A;  2IIM A;  3EG9 A;  2PZ1 A;  4N0A C;  4OB0 B;  4LDV A;  4M78 A;  4RTY A;  4X9D A;  1N27 A;  3LYI A;  4EMH A;  4RKU E;  2BKD N;  3ZEH A;  4HCK A;  1NG2 A;  3LLR A;  1KQ2 A;  1R0B G;  2YT6 A;  2B8A A;  3NPF A;  1NBE B;  1KJW A;  4FCY A;  3RMQ A;  3MEW A;  2SEM A;  4OGC A;  2HL3 A;  2LNV A;  4M78 C;  4BD3 A;  1OQK A;  4IIM A;  5J3B A;  4C8Q G;  1KQ1 A;  3U23 A;  2AT1 B;  3HHT B;  3RBB B;  3CC2 T;  2SRC A;  3H0F A;  2FG0 A;  3EGX B;  3PNW C;  2EYX A;  2O2O A;  2B86 A;  1WFW A;  2F2V A;  2XMF A;  2X35 A;  1AWO A;  4JRP A;  3OS1 A;  1R77 A;  2LRQ A;  4C8Q D;  5D6Y A;  2EKH A;  1FX7 A;  2E3I A;  1Z9Z A;  1QW1 A;  5A0D A;  3OYK A;  2FZG B;  2AZS A;  3CCS A;  4IUR A;  4PJN A;  4X9C A;  4Z8A A;  5LJ5 e;  4MML A;  1AOJ A;  3I5S A;  1RLQ C;  3VS6 A;  3JCM b;  4M7A E;  4OMN A;  2RQU A;  2X3W D;  3PMI A;  2RQR A;  2L89 A;  1QP2 A;  1J3T A;  3QBY A;  2FB7 A;  2EGA A;  2OAU A;  1A0N B;  1S72 Q;  1SSF A;  3LW5 E;  2RO0 A;  1Q82 C;  4BY6 B;  4M75 E;  4DQ2 A;  3J81 E;  4X1V A;  4LUE A;  3V7R A;  2IPO B;  1R8O B;  2AKK A;  5GAN 4;  2V8I A;  4CRI A;  3H41 A;  1TUG B;  2KGT A;  1ZQ1 A;  4M75 F;  1EFN A;  2EJF A;  2JT4 A;  1KC8 U;  1BB9 A;  4OMF B;  5GAN d;  4M7A F;  1TG0 A;  2MWO A;  3X28 B;  4J9E A;  1ZA1 B;  4F7U F;  2EJ9 A;  2P0P A;  5KYY A;  3QXE B;  1LVK A;  3S3M A;  5KYX A;  5A0L A;  3P8H A;  3CCE A;  2DRK A;  2PNI A;  1RAE B;  1EZZ B;  2FZK B;  4LXC A;  2YWW A;  1RI9 A;  1ZSG A;  1G3S A;  1P92 A;  1VQ9 T;  2O88 A;  4C92 F;  4M7D G;  3CBM A;  3HP9 A;  2LVM A;  3PE0 A;  2MCN A;  4FW2 A;  1MMN A;  3E19 A;  2JZ2 A;  1EX4 A;  2R58 A;  2LT1 A;  3MO8 A;  3OYA A;  1Q81 U;  2MI6 A;  1OV3 A;  1UGV A;  2QYZ A;  2PVD B;  4C8Q A;  2KNB B;  2YUQ A;  2CGH A;  1KQS S;  1X6O A;  2MYS A;  3CC4 T;  4WCI A;  1RAB B;  2LQW A;  1YHQ Q;  1VQ9 A;  3UDC A;  1AD5 A;  3OMC A;  4QVZ A;  4M7A A;  2IG0 A;  4BE0 A;  2VUB A;  2EFI A;  1SHF A;  1BKB A;  1U1S A;  2X51 A;  4JS4 A;  1AT1 B;  1C6V X;  2L3P A;  1IGU A;  2Y4Y A;  2J06 A;  2G3R A;  5KYX B;  2EVR A;  2DTH A;  4N0A A;  3CCR Q;  3CD6 A;  3ZL7 C;  2NLU A;  1ZSZ A;  3A8L B;  3I35 A;  2QI2 A;  2VYT A;  1G5V A;  2RQW A;  1KC8 R;  2KRN A;  2VXE A;  1B7T A;  1CKA A;  1NYG A;  3H9N A;  5KYU A;  1U3O A;  4J9G A;  1JB0 E;  2CP5 A;  3CMA A;  2J6K A;  1D3B B;  3L1A A;  5GAO m;  4RTZ A;  4P5N A;  1OYX A;  1FYN A;  4J83 A;  3JB9 I;  3EG2 A;  4WTO B;  2P0K A;  1YBY A;  3QWX X;  1W6X A;  2CP0 A;  2M0Y A;  1M1K C;  4GLK A;  3EG0 A;  2OTJ A;  4FL6 A;  4DA4 A;  3EG9 B;  1ZA2 B;  3TQ7 P;  2H8H A;  1D1A A;  1M1F A;  3C0C A;  1BK2 A;  1FXX A;  3V8J A;  2ZPI B;  3WVD B;  3O5Z A;  5FU6 C;  5CQY A;  1VQM Q;  3FRN A;  1XQH A;  4KUL A;  2LX9 A;  3EG1 A;  4M75 G;  5C0M A;  4PLI A;  3QPH A;  3QDF A;  1XOV A;  4PJJ A;  4C92 G;  2K79 A;  4E6R A;  1TUD A;  2HCK A;  4HCZ A;  3OYC A;  3CC4 Q;  4MZM A;  1VQO A;  4LD9 K;  3QZ9 B;  4PJO E;  3MET A;  4DOV A;  1K9M C;  4BE2 A;  1KIK A;  4Y91 A;  2HQX A;  1M27 C;  1WGS A;  2QA4 A;  3TCJ A;  4AG1 C;  2E6N A;  3HRT A;  2ENM A;  2ZPF B;  2E70 A;  5FLX E;  1WXB A;  1WHG A;  2JW4 A;  4C0D B;  2QGF B;  5I11 A;  4JJN K;  2Y4X A;  4PJO A;  4XU1 A;  4XTU A;  1WNL A;  2EYW A;  1V29 B;  4AG2 C;  2L3S A;  2A08 A;  3UT1 A;  1VIE A;  2F5K A;  5GJV B;  3THK A;  4JPB W;  2E5Q A;  4C0D C;  3M56 A;  3M58 A;  4EMK A;  2OTL Q;  1PKT A;  3F70 A;  1D09 B;  1I81 A;  3RIR A;  1D1B A;  1GL5 A;  1M4Z A;  4OP0 A;  1RUW A;  1SKU B;  3OYD A;  1BIB A;  1NLO C;  1I0C A;  4KH1 B;  2E3H A;  2K2M A;  3SWN C;  2PVG B;  2HQE A;  3X26 B;  1UHF A;  1QP3 A;  2O4X B;  1WHJ A;  2P0Q A;  2EQK A;  1S1N A;  4M7A C;  3LH0 A;  1BCM A;  1SPK A;  2JMA A;  1FMV A;  4RG2 A;  2EW3 A;  4BUG A;  3P8B B;  2YHT A;  2GFA A;  3M0T A;  3NTK A;  5GAN 7;  3DB3 A;  2J6F A;  5GAN 5;  1MND A;  4J9I A;  2K4Y A;  1FWZ A;  2H3J A;  1YN8 A;  5GAM h;  4RTW A;  1UUE A;  3MP1 A;  1WHK A;  2A37 A;  4J9C A;  1OZ3 A;  2EAY A;  2DLP A;  2LQ8 A;  2EYY A;  2CZ6 B;  3CCJ A;  1OU9 A;  1WXU A;  3HKS A;  1QCN A;  3RDV A;  5J26 A;  4KGV B;  2CT3 A;  4XTV A;  3WXM B;  5D7U A;  2ZGW A;  1K1Z A;  2M0O A;  4HVV A;  3CME Q;  2DYB A;  1XTD A;  3M55 A;  5CKB A;  1KHC A;  2JTF A;  1M8V A;  4M7D F;  1IB8 A;  2BE7 D;  3HSB A;  3UA6 A;  2VXF A;  3C4S A;  4N4H A;  2YUN A;  3JCM X;  2HNI A;  1YNZ A;  3QUI A;  4FYW B;  3CCJ Q;  4M77 B;  4N4G A;  3G71 A;  1N8R R;  5GAM g;  5CKD A;  2GGR A;  2F1L A;  1VQL T;  2KMT A;  2WSF E;  2DJZ A;  2DNU A;  4FT4 A;  2QXF A;  1JRI A;  3J80 E;  1ARK A;  1OOT A;  4FM4 B;  1SSH A;  2O9S A;  2E41 A;  2ROT A;  3QZ5 B;  3G6E A;  2COW A;  3L2U A;  2V26 A;  3SDZ A;  1W2B A;  1WHM A;  2E4H A;  2RH2 A;  4C8Q F;  2DXT A;  4JRQ A;  1Y96 B;  1GCP A;  1B3Q A;  3OYB A;  5FW9 A;  2Y90 A;  4OVA A;  3VRY A;  2K7A A;  4KGX B;  1ZBX A;  2H3E B;  2YUO A;  3EAE A;  1PG5 B;  1BI0 A;  1GBQ A;  2DEQ A;  1I1J A;  3RKY A;  1I8F A;  1MNE A;  2COZ A;  1PWT A;  4ESR A;  4MDX A;  3OS0 A;  2DFU A;  2D6F A;  2DER A;  2CZ7 B;  3RUX A;  3R6N A;  3G71 T;  1X69 A;  4OGE A;  3OY9 A;  1X27 A;  5CK9 A;  3GOX A;  2BZ8 A;  3VS3 A;  1BIA A;  3BE3 A;  4BY6 C;  5GAO q;  2DEU A;  1UHC A;  4J9H A;  3VS2 A;  3CCM Q;  3GLX A;  1U1T A;  4ZN1 A;  1VQ9 Q;  3JCM f;  2E12 A;  2VV5 A;  3ZBD A;  1M2O A;  1N8R U;  1UTI A;  3LWH A;  5GMK j;  4O5V A;  5EG2 A;  4DBR A;  2K6D A;  4PFO A;  1QVF A;  2DYI A;  1VQ8 Q;  2QAZ A;  3HL8 A;  2CKK A;  4C0F A; 
#chains in the Genus database with same CATH homology
 4Z8A A;  3PVL A;  4OMP A;  1AOJ A;  3I5S A;  1RLQ C;  3VS6 A;  3SEM A;  1M3A A;  1PHT A;  4OMN A;  2RQU A;  2X3W D;  2RQR A;  1J3T A;  1M30 A;  1VYT A;  1X2K A;  2C0T A;  2EGA A;  1A0N B;  1ZUK A;  1AWW A;  3JV3 A;  1IO6 A;  4X1V A;  1SHG A;  1H3H A;  4LUE A;  1TUC A;  2BZX A;  1AWJ A;  1U5S A;  2AKK A;  3EHQ A;  1ZUU A;  1T3S A;  3H41 A;  2KGT A;  2CUB A;  4AFQ C;  1EFN A;  1Y57 A;  2DJQ A;  1WA7 A;  2JT4 A;  1BB9 A;  4RTT A;  2ESW A;  1NEG A;  3NMZ C;  1MV0 B;  2KT8 A;  2CUD A;  1T3L A;  3RNJ A;  1OEB A;  2JMC A;  1TG0 A;  1G2B A;  4J9E A;  2KYM A;  3GBQ A;  1K9A A;  2LJ0 A;  2YSQ A;  1B07 A;  2KRO A;  3H0I A;  1ZLM A;  1T0J A;  5FWC A;  2ROL A;  2GNC A;  1JXO A;  2DRK A;  3ULR B;  2PNI A;  2EGE A;  1UJY A;  2KYB A;  2EYZ A;  5GJW B;  1RI9 A;  1ZSG A;  2O88 A;  1W1F A;  2V1Q A;  5HCK A;  4GLM A;  3VS4 A;  2CH4 W;  5IH2 A;  2FPD A;  2JM9 A;  5ECA A;  3PE0 A;  3NGP A;  2MCN A;  4AFU C;  4HVW A;  2J7I A;  5IHI A;  4LN2 A;  4GBQ A;  3VS0 A;  2J05 A;  1NEB A;  1PRM C;  1X6G A;  1CKB A;  4AFZ C;  2RQT A;  1OV3 A;  2DL5 A;  1UGV A;  4DEX A;  1X2Q A;  1QLY A;  2KNB B;  2L2P A;  2YUQ A;  2DL7 A;  4LUD A;  4ZNX A;  1KFZ A;  2FEI A;  4WCI A;  3IQL A;  4CC3 A;  2OAW A;  3I5R A;  2LQW A;  1WLP B;  2LZ6 B;  1AD5 A;  3TVT A;  1V1C A;  4AFS C;  3H0H A;  1VYV A;  1QWE A;  3CQT A;  1SHF A;  1UJ0 A;  3EHR A;  1H8K A;  2DL3 A;  1ABO A;  2L3P A;  4J9B A;  2J06 A;  1GRI A;  2EVR A;  1RLP C;  4JZ4 A;  3ZL7 C;  1ZX6 A;  2VVK A;  3I35 A;  4F17 A;  2HEQ A;  2L0A A;  2DA9 A;  2RQW A;  4JJB A;  1Z9Q A;  2KRN A;  4J9D A;  1CKA A;  1NYG A;  1U3O A;  4J9G A;  4F16 A;  5IXB A;  2E5K A;  1ZBJ A;  2DIL A;  2J6K A;  5IXF A;  1PNJ A;  4RTZ A;  1CSK A;  1GFC A;  1GBR A;  2W10 A;  1NM7 A;  2GBQ A;  1FYN A;  4RUG A;  2RNA A;  3EG2 A;  3TSZ A;  3SHW A;  1K0X A;  3QWX X;  1W6X A;  1Y0M A;  2M0Y A;  2P4R A;  3EG0 A;  4QT7 A;  4FSS A;  2H8H A;  2EPD A;  1WX6 A;  3C0C A;  2A36 A;  2GTJ A;  2LX7 A;  2MIO A;  1BK2 A;  4JJD A;  2D8H A;  3VS5 A;  2DF6 A;  1N5Z A;  2LJ3 A;  4HVU A;  5IHK A;  3O5Z A;  2ED0 A;  2JTE A;  1E7O A;  1GFD A;  3EG1 A;  4Z89 A;  4Y92 A;  1AZE A;  4OMO A;  1XOV A;  2KXD A;  2K79 A;  1YCS B;  1TUD A;  2HCK A;  4E6R A;  1SEM A;  5EC7 A;  1UEC A;  1QKX A;  1KIK A;  1AEY A;  1M27 C;  2JS0 A;  3VS1 A;  4AG1 C;  1JU5 C;  1JXM A;  2AZV A;  2ENM A;  1WXT A;  1NYF A;  1UDL A;  1HSQ A;  1GCQ A;  1WXB A;  2D1X A;  2JW4 A;  1H92 A;  5L23 A;  1QWF A;  4DEY A;  1AWX A;  2DL8 A;  4EIK A;  5I11 A;  3EG3 A;  1T0H A;  4OMQ A;  1KSW A;  2VWF A;  4LNP A;  2JM8 A;  4RTU A;  2EYW A;  2KXC A;  1U06 A;  1OPL A;  1ZUY A;  2RQV A;  4AG2 C;  2HBW A;  4HXJ A;  2J6O A;  2L3S A;  2A08 A;  2DX1 A;  3VS7 A;  2M51 A;  3A98 A;  1WYX A;  2FRW A;  2F2W A;  5GJV B;  3THK A;  4JPB W;  1JQQ A;  2AKL A;  3M0R A;  3M0Q A;  3NHN A;  1PKT A;  1M3B A;  1GL5 A;  3REA B;  2JXB A;  4CC4 B;  1RUW A;  1NLO C;  2LNH B;  2RMO A;  2C0I A;  1I0C A;  2CSQ A;  2DM1 A;  1ABQ A;  2DL4 A;  2K2M A;  1BBZ A;  3EGU A;  4LE9 A;  1UHF A;  1S1N A;  2DBM A;  3UF4 A;  1SPK A;  2OI3 A;  2D0N A;  2FPF A;  2L3Q A;  2JMA A;  3LH5 A;  2MOX A;  1MUZ A;  2NWM A;  3QWY A;  2EW3 A;  2LCS A;  2CH4 A;  1M8M A;  3M0T A;  4A63 B;  2CT4 A;  2OJ2 A;  2ED1 A;  2J6F A;  2GQI A;  4J9I A;  1OPK A;  2DE0 X;  2VKN A;  1HD3 A;  1YN8 A;  2LJ1 A;  2RPN A;  4RTW A;  1UUE A;  2DBK A;  4J9C A;  2A37 A;  3VRZ A;  2O9V A;  3REB B;  1X6B A;  2DLP A;  2EYY A;  2ABL A;  4CC2 A;  1WXU A;  2DMO A;  2G6F X;  2EBP A;  4JJC A;  2CT3 A;  1FMK A;  4IIO A;  1K4U S;  2BTT A;  5IHN A;  1WI7 A;  1E6G A;  3UA7 A;  1VA7 A;  2D8J A;  1K1Z A;  4HVV A;  2YDL A;  1VYU A;  2CSI A;  2HDA A;  4OML A;  2FRY A;  1AZG B;  2DYB A;  1GCQ C;  1LCK A;  2JS2 A;  4RTX A;  2LMJ A;  3UA6 A;  2YUN A;  1W70 A;  2BZY A;  2DVJ A;  5I22 A;  4Z88 A;  1YNZ A;  2KR3 A;  4KRT A;  1QKW A;  3M0U A;  1K0S A;  1UG1 A;  4K11 A;  4J9F A;  1UFF A;  1G83 A;  1NLP C;  2GGR A;  1HJD A;  2X3X D;  2F2X A;  2DRM A;  2DNU A;  2V1R A;  1YWP A;  4D8D A;  3UAT A;  1YP5 A;  3TSW A;  3M0S A;  2FO0 A;  4D8K A;  1OOT A;  1ARK A;  2KEA A;  1SSH A;  2ECZ A;  2O9S A;  3FJ5 A;  1E6H A;  2ROT A;  2FPE A;  1BU1 A;  2PTK A;  2W0Z A;  2O31 A;  1SRL A;  3I9Q A;  2GTO A;  1I07 A;  3M0P A;  1AVZ C;  2LQN A;  1GCP A;  2KT1 A;  1MV3 A;  4JZ3 A;  1B3Q A;  2IIM A;  2PZ1 A;  5FW9 A;  1WDX A;  3VRY A;  4RTY A;  2K7A A;  1X43 A;  2CRE A;  2YUO A;  5FWB A;  2HSP A;  2KBT A;  2AK5 A;  2LP5 A;  1GBQ A;  4ORZ A;  1I1J A;  1M3C A;  2EQI A;  2QDL A;  4HCK A;  1NG2 A;  4CC7 A;  2YT6 A;  3PVQ A;  1PWT A;  3NPF A;  2KE9 A;  4ESR A;  1K76 A;  1QCF A;  1KJW A;  1SRM A;  2KRM A;  2KRS A;  4F14 A;  2NUZ A;  2SEM A;  2YUP A;  1PKS A;  3KFV A;  4IIM A;  4RTV A;  3R6N A;  1JEG A;  1X69 A;  4M4Z A;  3U23 A;  1X27 A;  4R0K A;  2BZ8 A;  3RBB B;  3VS3 A;  2SRC A;  2K9G A;  3H0F A;  2FG0 A;  4OMM A;  1UHC A;  4J9H A;  3VS2 A;  2EYX A;  2O2O A;  2B86 A;  1WFW A;  2F2V A;  2XMF A;  2K3B A;  2C0O A;  1AWO A;  1JO8 A;  1WIE A;  1UTI A;  2CDT A;  2EKH A;  2K6D A;  2RN8 A;  1Z9Z A;  1UE9 A;  2I0N A;  1YWO A;  2EGC A;  2RF0 A;  1PRL C;  2AZS A;  2A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...