4FSSA

Crystal structure of a ras p21 protein activator (rasa1) from homo sapiens at 2.25 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
b'RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras GTPase-activating protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Crystal structure of a RAS p21 protein activator (RASA1) from Homo sapiens at 2.25 A resolution
rcsb
total genus 14
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4fssA00
1LCKA 2EQIA 3M0SA 4JPBW 2LMJA 3EHRA 4RTVA 2GTOA 3UA7A 2KRMA 3PE0A 3I35A 1UJ0A 4DEYA 1AWJA 1HJDA 2NWMA 2IIMA 2FO0A 2V1RA 1B07A 1UECA 1RLPC 1K0SA 2X3WD 3EGUA 3M0UA 4Z88A 2KR3A 1KJWA 1WIEA 2EGCA 1I1JA 2KRNA 2F2WA 1ZUYA 2CREA 2HBWA 2KYMA 1NYGA 5GJVB 3VS4A 2J6FA 4CC4B 2J06A 2RQWA 2E5KA 4JZ4A 1UG1A 2F2XA 4AFZC 1AZGB 2KROA 3LH5A 1ZX6A 1X2KA 1E7OA 1JEGA 4LNPA 1TUDA 3C0CA 1AWWA 3NHNA 2AKLA 2EVRA 1KFZA 4J9HA 2DNUA 2EYXA 3IQLA 1WYXA 3UA6A 2HSPA 1B3QA 2BZ8A 2JTEA 1GBRA 2JXBA 1E6GA 2GBQA 4LE9A 2KE9A 1H8KA 5IHKA 1RI9A 1HSQA 2KT8A 2JS0A 2ENMA 2KXCA 1M3CA 1GFCA 4JJBA 1T0HA 2DL8A 2L3QA 2EYZA 1UJYA 5L23A 1SPKA 2RNAA 3QWYA 2YSQA 5EC7A 1UFFA 2JT4A 2JS2A 2F2VA 4Z8AA 3SHWA 1K4US 3M0QA 1UUEA 1ZUKA 4A63B 1ARKA 2PNIA 3VS1A 3SEMA 2PTKA 1SRLA 4M4ZA 1SHFA 2DM1A 1SSHA 2D8HA 4HVVA 3VS0A 3REAB 1AEYA 3M0PA 1W70A 4RTZA 4Z89A 3I5RA 2K2MA 2HEQA 2EBPA 4ZNXA 3THKA 1M30A 1ZLMA 1NG2A 2DJQA 1PKSA 4OMOA 4OMMA 2ED0A 2EGEA 1QLYA 5HCKA 1HD3A 1AD5A 1QCFA 2JMCA 1U06A 2DVJA 1YNZA 2YUOA 3GBQA 3R6NA 2RN8A 3NPFA 2EYWA 3QWXX 2CUBA 3UF4A 4WCIA 1NLOC 4HCKA 2BZYA 4J9IA 2L3PA 1MUZA 1IO6A 3VS7A 2CT3A 2AKKA 1WXTA 2CT4A 3ULRB 1T0JA 2ESWA 2O9SA 2MCNA 1AVZC 2RQVA 5IXFA 4RTWA 2J6KA 1RUWA 4OMQA 1XOVA 2OI3A 1NEGA 1U3OA 1ZUUA 2JM9A 2ROTA 1A0NB 2MOXA 2JM8A 2L0AA 1YWOA 2LQWA 2O9VA 2LJ0A 1EFNA 4RUGA 1VYUA 1X43A 2DL7A 1AWOA 2ABLA 5I22A 2B86A 5FWCA 3VRYA 3NGPA 2DL4A 1ABOA 1CKAA 2EW3A 1WX6A 2CDTA 3PVLA 4FSSA 4Y92A 1UDLA 2FG0A 2G6FX 2JMAA 2RMOA 1Y57A 2EGAA 2EPDA 2DYBA 2LNHB 5IXBA 3JV3A 3VS2A 1X69A 4HVUA 2W0ZA 1VA7A 4R0KA 3O5ZA 2SEMA 3H0FA 2C0TA 2DLPA 2XMFA 3CQTA 1BB9A 1OPKA 1CKBA 1JQQA 3NMZC 4LUDA 3RBBB 2DF6A 4JZ3A 1JXMA 1T3LA 4AFSC 4D8DA 1Z9ZA 2W10A 1X2QA 2RPNA 2NUZA 2BTTA 2RQRA 1WXUA 4J9EA 2CSIA 4OMLA 2KBTA 1T3SA 2GGRA 4J9DA 4OMNA 1ZSGA 2A36A 2KEAA 1GFDA 4CC3A 3EG2A 1WDXA 1NYFA 5ECAA 3EG3A 1OV3A 4RTYA 2DBKA 2K7AA 2YUQA 2KXDA 2RQUA 1U5SA 1QWEA 4DEXA 1NEBA 1TUCA 4JJDA 3FJ5A 4F14A 2X3XD 2ROLA 2KT1A 1MV3A 2DL5A 2DA9A 2RQTA 1QKXA 3VS3A 3EG1A 3H0IA 2CH4W 1NLPC 4HXJA 2KYBA 5IHIA 1YCSB 2D8JA 4K11A 5IHNA 2DBMA 4F16A 1X6GA 1X6BA 1WXBA 2LJ3A 1G2BA 1GBQA 2FRYA 4AFQC 2DMOA 2YT6A 2LJ1A 1MV0B 1BU1A 2AZVA 1I07A 1W6XA 5GJWB 1GCQC 2FPDA 2DX1A 1K1ZA 1BK2A 2KGTA 2J05A 1UHFA 1UGVA 1TG0A 2K6DA 1QKWA 2KRSA 1K0XA 1JU5C 3TSZA 4HVWA 3M0TA 2EYYA 2A08A 1AZEA 1PKTA 2A28A 2C0IA 1S1NA 4CC2A 2O2OA 2YUPA 3KFVA 2DRMA 4J9BA 2DL3A 2O88A 2DILA 2LZ6B 2K79A 4ORZA 4J9GA 1PWTA 1WA7A 2AZSA 2QDLA 4IIMA 1NM7A 1M27C 1YN8A 1JO8A 3VS5A 2L2PA 4KRTA 1GCQA 1UHCA 1JXOA 2HDAA 2JW4A 5IH2A 1VYVA 4OMPA 3U23A 2FEIA 2PZ1A 2VWFA 4D8KA 2LCSA 1FMKA 2YUNA 1PRMC 1GL5A 1QWFA 3H0HA 2J7IA 3REBB 2L3SA 1KSWA 3I5SA 1YP5A 1PHTA 2DRKA 1AWXA 1UTIA 2FRWA 1M3BA 1ZBJA 1GRIA 2GQIA 1OOTA 3TSWA 2D0NA 2CUDA 2C0OA 2MIOA 4F17A 1YWPA 1X27A 5FW9A 5FWBA 1UE9A 1SEMA 2EKHA 2DE0X 1E6HA 1SRMA 4GBQA 4J9CA 3EG0A 2CH4A 2OJ2A 3TVTA 1WFWA 2RF0A 4IIOA 4JJCA 4LN2A 2KNBB 2ED1A 1M8MA 1H3HA 3I9QA 2BZXA 3M0RA 2CSQA 2LQNA 1K76A 1Y0MA 2ECZA 2OAWA 3A98A 2LP5A 2H8HA 4ESRA 3H41A 3VRZA 4RTXA 1K9AA 1KIKA 2I0NA 2K3BA 5I11A 2M51A 1J3TA 2GNCA 1I0CA 1PNJA 2VKNA 1SHGA 4AFUC 1G83A 3VS6A 3PVQA 1V1CA 2AK5A 4RTTA 4RTUA 4CC7A 1CSKA 2K9GA 1WI7A 2FPFA 2LX7A 1OEBA 1H92A 2D1XA 2HCKA 2FPEA 1N5ZA 3ZL7C 4EIKA 4X1VA 2M0YA 2P4RA 2SRCA 2A37A 2V1QA 4AG2C 1GCPA 1RLQC 4QT7A 3UATA 1FYNA 1M3AA 2VVKA 2GTJA 2J6OA 3EHQA 4AG1C 1BBZA 1W1FA 2YDLA 4E6RA 1OPLA 1AOJA 1ABQA 2O31A 4J9FA 3RNJA 1WLPB 1Z9QA 1PRLC 4GLMA 4LUEA 1VYTA
chains in the Genus database with same CATH superfamily
1BIBA 1LCKA 2CZ0B 2RJCA 1M1FA 2K4YA 3EG9B 3OYDA 2MYSA 2X4WA 3CXCA 4DBHA 1VQ9Q 3BFMA 1IHWA 3E9FA 1UJ0A 4MZPA 4PJOF 4M78B 1HJDA 2HSEB 2V1RA 1UECA 1K0SA 2X3WD 1PSEA 2QQRA 2EGCA 1I1JA 3MJXA 4E7ZA 2YLBA 3G4SA 3RMQA 1ZUYA 3CPWP 4E7LA 1VQKA 1YJ9T 4C5GA 1NYGA 3VS4A 3A8OB 8AT1B 4CC4B 2RQWA 2VXFA 1K9MU 4XU1A 3GLXA 5KYUB 3LH5A 1ZX6A 5GAMe 1E7OA 1S72A 4LNPA 3C0CA 4M77D 5CKEA 3META 2M9UA 3NHNA 3G6EQ 2AKLA 5KE3A 3MP8A 4M75F 3PIPA 3IQLA 4M78E 3VYGA 4JJNK 3UA6A 2HSPA 3S3MA 1B3QA 2BZ8A 2O4XA 1RACB 2PU9B 1PCXA 2GBQA 4LE9A 1H641 2HZYA 1RI9A 2JS0A 3CXCS 2ENMA 4ZN3A 1GFCA 2QXFA 3GF5A 3QIIA 2RI2A 2DL8A 2GFAA 4C92A 1VIEA 2KVQG 2HQXA 3QPHA 3JCMc 1YITT 2EYZA 1YJ9Q 1N8RR 1UJYA 1SPKA 3EFOA 3J81E 2DZ9A 3BDLA 3CCUA 2RNAA 3QWYA 2ZGWA 5EC7A 2MWPA 2ZPHB 1OZ2A 3RDVA 1UFFA 2JT4A 4A4GA 1K4US 1ZUKA 2CP5A 3V8KA 4M75E 2XD0A 2PTKA 4RCCA 1KK7A 3CC7T 4IURA 1S72T 4ELYC 5FU6C 2D8HA 2JOYA 4M7AA 1I5LA 2RHZA 1AEYA 4WF2A 4Z89A 3I5RA 2K2MA 2DK3A 2HEQA 1M30A 2DJQA 3G71T 1PKSA 4OMOA 2ED0A 2RA2A 5HCKA 1HD3A 1QCFA 1MMDA 2JMCA 5GMKj 3GBQA 4BB7A 4KUDK 7AT1B 3QWXX 4J83A 5C6SA 2EJ9A 3X24B 1QMCA 3H8ZA 5M9OA 3CCRT 4JS4A 4J9IA 1WQ7A 2V8KA 3ULRB 2FHDA 4Y91A 1AVZC 4KH0B 2J6KA 2RM4A 1OU9A 4OMQA 1PM3A 4L59A 2CP6A 1XOVA 3JCMV 1NEGA 1B34A 1TH7A 1ZUUA 2QTXA 5CK9A 2BKDN 4D6WA 2MOXA 2LQWA 3OSSC 1YHQA 1Q82R 3NTIA 1P92A 3KBGA 4RUGA 4C8QE 2KY9A 1VYUA 2DL7A 5LJ5f 5I22A 3VRYA 3CCQQ 3NGPA 1CKAA 1G5VA 3CCRQ 4Y92A 1UDLA 3D7SB 3EH1A 2OTJQ 5CVIA 4LDVA 2RO0A 1OULA 1M9SA 2SEMA 1GXIE 1D0XA 2DLPA 1JJ2P 2XMFA 3FB9A 4C92F 3CCLQ 4GY5A 1JQQA 3NMZC 2JTFA 5I21A 2RK2A 3RBBB 1VQNA 1VQ4T 4DBFA 4R55A 1JXMA 3HSBA 3PIOA 3R6OA 5FRNA 2RPNA 2BTTA 4II1A 4J9EA 4BI8B 1T3SA 1OZ3A 1RAGB 2HKNA 1QCOA 4J9DA 4C8QD 3CMEQ 4KGVB 1LPLA 2A7YA 2K5FA 4KGXB 5KYXB 1YHQT 2ATCB 2YUQA 1BYMA 1TU0B 2KXDA 1IGQA 3DLMA 4M7AF 3FDRA 1TUCA 3L42A 1RAEB 2YXYA 3FJ5A 5KYYB 1OX9A 2EIFA 2DL5A 2DA9A 2RQTA 5CO7A 3VS3A 2QDYB 2CH4W 3H0IA 5AT1B 2COZA 1NLPC 5IHIA 4K11A 2DTHA 1BI3A 1X6GA 4M7AD 3OYEA 3C12A 1M1GA 2OTLA 1G2BA 4IKFA 1QCNA 3VJPA 2CYZB 3RUXA 5GJWB 1GCQC 3JCMX 3CC2A 1NPPA 2J05A 1UHFA 1ZSZA 1LJOA 2X51A 1ZA2B 1KHCA 3TQ7P 1K0XA 2VXEA 1D0ZA 4RG8A 4JRKA 3TEEA 4PFZA 4E47A 3MKDA 2A3LA 3FC3A 3KFVA 2DRMA 3EGDB 3OYHA 1TSFA 2DL3A 2DILA 2K79A 5IT9E 1WA7A 3HHTB 1X01A 1NM7A 3VUZA 1M27C 2L2PA 1UGRB 2JW4A 4FYXB 3VUBA 3MEAA 4LD9K 2FL7A 1RL2A 2PZ1A 2LCSA 3LX7A 5LJ5j 4B6MA 3PGGA 3OYAA 4M77B 3M55A 1QVFA 2L3SA 1UGSB 1WJRA 1YP5A 4EMKC 3QDRB 3JCMf 3CPFA 1K73R 1ZBJA 1GRIA 1R8OB 2X35A 2GQIA 3TSWA 1QVPA 2CUDA 2CZ1B 2C0OA 6AT1B 3J7AF 5FW9A 5FWBA 1UE9A 3CEYA 2DE0X 5CKBA 2YRVA 3EG0A 4FT4A 3JCMW 1MMNA 1N8RC 3L1AA 1M90C 4JJCA 1XQHA 3CC2Q 3S3OA 3I9QA 1KC8R 1IRXA 4JUVA 1I4K1 2BIVA 2ECZA 2OAWA 3A98A 1R0BG 3H41A 4F04B 1K9AA 2LRQA 3NFCA 1WQWA 1KIKA 5I11A 1VQLT 2DXTA 4BDZA 2GNCA 1JJ2S 2KAFA 5LJ3h 1Q86U 4ZGEB 4PFPA 3CCSQ 4AFUC 3ZFJA 4O5VA 2CGHA 3VS6A 3PVQA 3OYGA 3M4YA 1KQSS 3VV0A 1XJWB 2H3EB 1QVGP 2O4XB 2NUPA 2HBPA 2EQKA 4NL3A 2D1XA 2FPEA 4X9DA 3E9GA 3ZL7C 5KYNA 4X1VA 5CKDA 2QQSA 4PLLA 3OYBA 4PKCC 1MNEA 1RLQC 4PJOA 2BE7D 1FYNA 1VQ6A 1M3AA 4AG1C 1XTDA 3RNJA 4GLMA 1SSFA 1VQ7T 2V26A 2VGMA 4X9CA 4DQ2A 4KUIA 3M0SA 2LMJA 1NBEB 2XK0A 4IUQA 2E65A 1Q7YC 2DEUA 3ME9A 3PE0A 4EMGA 1AWJA 2DFUA 1K8AR 4E7IA 3A8MB 3CXCP 3X20B 2DXCA 4VUBA 2X4YA 3OYIA 3QBYA 5CAIA 2DXBA 1C0MA 1KJWA 5GAN4 3OYJA 1KD1R 5J3BA 1NPRA 3OS2A 5LJ3j 3LGFA 3EAEA 2J6FA 2XDBA 2J06A 4NS5A 4KGZB 4JZ4A 5AYFA 4AFZC 2YRCA 5HK3A 1X2KA 1UGPB 3QJYA 2DETA 3CD6A 4DBQA 1AWWA 3CC2T 4RKUE 1VQ4Q 1M90R 4J9HA 2VB6A 4JRQA 4RCBA 2NUTA 2JTEA 1GBRA 1E6GA 2YWWA 5IAYA 2F1LA 2YLCA 3BY7A 1HSQA 2KT8A 4ZTFA 5DY9A 2L3QA 3DLLA 4ME7A 1MMAA 3X26B 3OYMA 3LH0A 5A2QE 1WGSA 1WZOA 2F2VA 2GQVA 3L2UA 2VUBA 3SHWA 1PD1A 4Q5WA 1KQ1A 4CRIA 2QA4A 1YI2T 1B7TA 3CD6T 4PJOD 4M4ZA 4F7UA 3PFSA 2RK1A 3M0PA 1W70A 4RTZA 1U8RA 1K8AU 2NUTB 2XDDA 2EBPA 1BCMA 4ZNXA 3VKIA 4HCCA 1ZLMA 3E2UA 1NZ9A 2DIQA 4FW2A 4OMMA 2EGEA 5A0DA 4M7DF 3MCAB 1AD5A 2VGNA 1U06A 4OF1A 1VQ6Q 2YUOA 4RMOA 4FM4B 2F5TX 3UF4A 1Q81C 4N0AA 4FYYB 1LNXA 4HCKA 1D3BB 1SKUB 2RHXA 2BZYA 2L3PA 1IHVA 1MUZA 4L5GA 2Y4YA 4MDWA 1K9MC 1IO6A 3VS7A 1WXTA 2QQ9A 2CT4A 2DIGA 2JNGA 2MCNA 1WHLA 2RQVA 4M75G 2OI3A 2D0QB 2XU8A 4PJOC 4FCYA 2JM9A 3HFNA 1A0NB 2L0AA 1YWOA 2LC4A 2LJ0A 4TVRA 5GMKm 3OSVA 4A54A 1X43A 2WSEE 1M2VA 5FWCA 2E10A 2WSCE 2M16A 1ZHIA 1ABOA 3AT1B 1WX6A 2R5AA 2COYA 1FXXA 2EGAA 1Q86R 4J5YA 4C92D 3JV3A 4QVDA 1RAFB 4Y28E 2GCXA 1D1CA 3CQTA 3JB9D 2DF6A 3L2ZA 1T3LA 4AFSC 1BI0A 4BY6B 5CKHA 1HXDA 5HKCA 3OYCA 3V7SA 2W10A 3FEOA 1KC8U 1X2QA 1WXUA 3JB9F 1KD1C 4OMLA 2KBTA 2WACA 5FLXE 4OMNA 4FL6A 3OA6A 4O6JA 2DKGA 3CC4Q 1RABB 3EGDA 4CC3A 1VQ4A 5CQXA 3JCMQ 1NYFA 3EG3A 3FRNA 1OV3A 3T9NA 3OYFA 3CD6Q 1VQ7A 3VYHB 1FX7A 3A5ZB 2LT4A 2LTOA 3I55T 5GANj 3OS0A 2RQUA 1OQKA 1QWEA 4M77G 4M75D 2HNIA 3JB9H 1VQ8A 2K57A 2M02A 5I2MA 3H6ZA 4C92C 1QKXA 3NTHA 4XU3A 3EG1A 3V7RA 1MHNA 1EIFA 2P84A 5KE2A 3MPUB 1YCSB 5GAOn 1VQNT 2DBMA 3M59A 4F16A 1YITA 1X6BA 4KULA 2JUFA 3JCMb 4A4EA 2FB7A 3RIRA 1MV0B 1BU1A 4EMHA 3G71Q 2JN0A 1I07A 1W6XA 1K1ZA 1BK2A 2KGTA 1UGVA 5GAMf 2OTLT 2FZGB 3PMTA 4M7AC 1U1SA 2KRSA 4C5EA 3TSZA 1R0CB 1UEBA 1ZSZB 1QP3A 4CC2A 5GANe 3JCMP 2HL3A 2XG8D 3EFRA 2LT1A 3QKJA 4BE2A 2FZKB 2O88A 2RD1A 4M78C 4ORZA 2P0PA 4J9GA 1KC8C 4MDXA 1PWTA 4PJOB 5FRMA 1KQSA 1YN8A 3V8JA 5FU7B 2E3IA 1GCQA 5IH2A 3M57A 3X28B 4RG2A 4OMPA 3QO3A 2ZPIB 3U23A 1KQSP 2VWFA 1YI2A 4IUUA 1VQOT 2X4XA 3UPUA 3REBB 4QQGA 1KSWA 1VQMA 2E1HA 3CC7Q 1PHTA 2DRKA 4OB3B 1QQJA 4ELZC 1K8AC 5GAN3 4QQ6A 2DPPB 3JCMg 5C0MA 5DLOA 4ATOA 2QYZA 4XTXA 2JJ9A 3QSUA 3M9QA 1YWPA 4M7DD 3CCJQ 3CCMT 4N4IA 4DA4A 1TUGB 4BY6C 1YJWQ 4GBQA 4J9CA 2CH4A 2ZPEB 2OJ2A 2QQAA 4BI3A 4C8QF 1TOVA 3G6ET 2BZXA 2E12A 3M0RA 3FJPA 5GAN8 1EZZB 1RAHB 2K5IA 5EG2A 5DM7R 3DB3A 1ZQ1A 5GMKh 4ESRA 3VRZA 4RTXA 2P4TA 5GAMd 3L2RA 2M51A 1J3TA 4PJLA 3P8DA 1VOMA 5LJ3d 2KQWA 1KHIA 1V1CA 1WHHA 3CCSA 4E7JA 4CC7A 3WVDB 1YIJA 1IREB 2EFIA 4EPCA 4M7DC 1OEBA 1LOJA 4PJJA 2HCKA 2IPOB 1OU8A 4C8QC 1VIFA 1N8RU 3CCET 2HD0A 2P4RA 2SRCA 2A37A 2V1QA 2V8JA 1AT1B 1GCPA 3CCJA 4QT7A 4IUVA 3EHQA 2L3RA 2K2VA 1W1FA 4E6RA 4LDWA 5FU7C 3ER0A 4J9FA 4XTUA 1MMGA 1Z9QA 1PRLC 1WJSA 1ZSZC 3EGXA 3LW5E 2CZ6B 4LUEA 1KD1U 2D6FA 1QP2A 2EQIA 1BIAA 2KK4A 1U1TA 3LLRA 2EWNA 3EHRA 4J6WA 4QKUA 2HKQB 3UA7A 1H3ZA 2KRMA 2DTIA 3I35A 4J7IA 3JCMJ 2IIMA 4QW2A 1RLPC 1G3SA 4C8QA 1YIJQ 2ZPFB 5GANh 1YCYA 2AIRB 3OS5A 4PLIA 1M2VB 3MO8A 2I2LA 5GANf 2KRNA 3PT9A 2CREA 5D6WA 1QVGA 4C5HA 4B9WA 1D1BA 1M1KR 3CCEA 4QVZA 2F2XA 1AZGB 3QJ6A 2QAZA 2KROA 3QDFA 5GAOr 3GNGA 1SF9A 3G4ST 2OAUA 2VASA 3SB2A 1JEGA 5CKFA 4F7UF 2QEXT 1TUDA 3VU3C 2HQHA 2RH2A 5D6XA 4QVCA 1M2OA 3BW1A 1KFZA 4NL2A 4F7UG 2DNUA 2RHIA 3GIBA 1WYXA 2OTJT 1VQ5T 2JXBA 3CCUT 2KE9A 1H8KA 1RADB 5D7UA 2JVVA 3TCJA 5IHKA 1QW1A 5LJ5g 3CMAT 3I56T 1Q7YR 2KXCA 4JJBA 3HPWA 5GMKl 2L89A 4BUGA 1FWZA 5A0GA 3I55Q 5L23A 3OYLA 4LXCA 4BE0A 3V8LA 2JZ2A 2YSQA 4EMKB 3M56A 3G4SQ 1M5Q1 2LX9A 3GP8A 3CC7A 8ATCB 2DEQA 2BUDA 5CQYA 1O75A 1BCOA 4Z8AA 4DOVA 5LJ3g 3M0QA 3A8HB 1UUEA 2Y90A 2RI3A 1V76A 4A63B 1ARKA 3SEMA 2EQMA 4J8OA 5GAMh 1SRLA 1SHFA 1KQ2A 3DB4A 2ZPGB 2RJFA 2QGGA 3JB9G 3THKA 1NG2A 4M7DB 4MMLA 3CC4A 1QLYA 4C8QB 3O8VA 4Z02A 1VQLA 5GAN2 2CUBA 2EJFA 3URGA 2XKOC 2QGFB 1RI0A 2EQJA 3QG1A 5I2SA 2LQ8A 2MK5A 5CR2A 2ESWA 2O9SA 2P0QA 1TWBA 2B8AA 3UT1A 5IXFA 4BDYA 2QA4T 1RUWA 3DKMA 2ROTA 5GAN7 1NE8A 4FYWB 3TREA 4J7FA 3Q1JA 2O9VA 1EFNA 4PNOA 4JDSA 4P5NA 3SWNA 1AWOA 2ABLA 3KXTA 3CMET 3OW2A 2XI9A 2ZZDA 2DL4A 4J6YA 2C06A 2EW3A 3A8GB 3CCVT 2CDTA 3PVLA 4JRIA 4FSSA 4C0GA 3LYIA 3EFSA 2FG0A 4M77A 2JMAA 2RMOA 1Y57A 2LNHB 5IXBA 3C95A 3E1SA 3L2VA 3CCST 3VS2A 3OW2P 1X69A 3OMGA 1VA7A 4R0KA 2C0TA 3I56Q 2LCCA 4HCZA 5CCAA 3RKYA 3V7CA 1K73U 1OPKA 3CCJT 4M7AB 3CCMQ 4LUDA 4MZMA 3M53A 2RJDA 1NJIC 4M77C 2KDSA 2CP2A 9ATCB 2QQBA 2Z0WA 2GGRA 1YBYA 1OI1A 4KT0E 1ZSGA 2KEAA 1GFDA 3M54A 1WDXA 5ECAA 3GPLA 2MWOA 1OYXA 2X4JA 2RJEA 2DZCA 2DBKA 2K7AA 5KYWB 2DERA 3QYHB 1VQ9A 2DXUA 1X75C 3OBYA 4JLIA 1G3YA 4HCBA 4DEXA 2QI2A 1N9SA 1NEBA 5HY6A 3HRUA 4A4FA 5KYWA 2L8DA 1BKBA 2P0KA 2LNVA 4F14A 2X3XD 4N0AC 1MV3A 4IUTA 2LQKA 1YI2Q 3X25B 5KYUA 3CMAA 1X6OA 2E5QA 3CBMA 2DJZA 1I8FA 4XTYA 2D8JA 1JJ2A 1M1KC 1WXBA 1EX4A 2LJ3A 3BE3A 3ASKA 4DOWA 4AFQC 2E3HA 2YT6A 2LJ1A 2AZVA 2F5KA 5GMKe 3CCUQ 2QEXA 4E7HA 2FPDA 2EAYA 1HYOA 1TG0A 3EG9A 1YITQ 3AHUA 4HVWA 1W2BP 2EYYA 2OTJA 3JCMh 1VQ5A 5KCOA 1AZEA 3JCMe 1VQ8T 3OMCA 4OB0B 3I56A 1M4ZA 2YUPA 4M7DG 4BD3A 1RAIB 3C94A 4J9BA 3CCVQ 4BI4A 1Y71A 2DD5A 4MMKA 4M75A 1YFNA 4JLGA 1S72Q 4E7SA 2AZSA 2QDLA 4PL6A 4V2SA 2LDMA 1AHJB 1M90U 1JO8A 4LDYA 3VS5A 3GNFB 4KRTA 2EQUA 1UHCA 2YHTA 3HRSA 1VQ7Q 2FVUA 1C6VX 1VYVA 3HP9A 2FEIA 4M78D 1FMKA 3OS1A 2IVWA 1PRMC 1GL5A 1QWFA 2ZCFB 3HKSA 4FT2A 3M5AA 1VQ8Q 2QEXQ 1UTIA 5GAOq 2QK0A 4FU6A 1OOTA 5LJ3f 4C0FA 1N6AA 4M75C 4F17A 1X27A 1WJQA 1SEMA 2YRDA 1VQ5Q 3OQ5A 2EKHA 1E6HA 1SRMA 4OGCA 4C0DC 1PSFA 4B9XA 3CMAQ 3FLGA 1Q81U 3TVTA 5LJ5h 2RF0A 4JRPA 4IIOA 4LN2A 4F7UE 2QASA 2ED1A 4HA8A 1H3HA 5CIUA 2HMAA 4M77E 4EMKA 2LP5A 2H8HA 1IZ6A 1TXQA 2NUPB 3PTAA 1QVFS 1MNDA 3M4GA 1PG5B 1V29B 2K3BA 4KBMB 4KH1B 2DAQA 1Y07A 3CBOA 4GLKA 1JRIA 3CCVA 1SHGA 2EKOA 3KUFA 4XTZA 2AK5A 3L2QA 4RTTA 3OYKA 1IB8A 1CSKA 2ZAEA 2X9HA 2EJGA 4PJOG 5GANg 3CCMA 2FPFA 3I55A 1N5ZA 4FSXA 2PVOB 2L5QA 4XTVA 2PVDB 3ZBDA 3G6EA 2O01E 4AG2C 1Y96A 3QUIA 2K3YA 4LDUA 2VVKA 2GTJA 2J6OA 1VUBA 4XK8E 2E4HA 1OPLA 1AOJA 1UB4A 2DD4A 1WHGA 1WLPB 4EDUA 3SDZA 1VYTA 1VQKQ 3N5BB 2QA4Q 1O9SA 1VQ6T 4JPBW 3JB9I 4RTVA 2GTOA 5GMKi 5LJ3e 2CS7A 3EGXB 2FZCB 2MAMA 4DEYA 2COWA 4MZTA 2NWMA 2FO0A 3FIFA 1B07A 2VC8A 3EGUA 3M0UA 4Z88A 1C1AA 2KR3A 2XDPA 3CCQT 1YJNA 2BE9B 2R57A 3MHXA 1D09B 1WIEA 4A4KA 1G3WA 5GANd 4A4HA 1W2BA 3OBWA 4N4GA 3S6WA 2F2WA 3RERA 3NTKA 2HBWA 2KYMA 5GAOm 5GJVB 4C0DB 1I81A 2E5KA 1UG1A 2RI5A 1VQOQ 3PNWC 3MEUA 4J6XA 1OX8A 2IG0A 2E41A 4R56A 3OB9A 2EVRA 1ZA1B 4OMFB 1K9MR 1Q95G 3RKXA 4E2FB 2EYXA 2LVMA 2V8IA 1G8XA 1IGUA 4PJOE 2HL5C 2CZ7B 1YJWT 2DTOA 1N9RA 4C5IA 1VQLQ 2PVGB 1M3CA 4X34A 3M58A 2OTLQ 1T0HA 2R58A 2RB6A 3QYGB 4M7DA 1SG5A 5DLQE 2XHCA 3CPWS 2JS2A 3LWHA 2PNIA 3VS1A 3RESA 3G1JA 3QZ9B 2DM1A 1SSHA 2M0OA 1VQPQ 1D0YA 4HVVA 3EFOB 3C4SA 3VS0A 3REAB 5GAN5 1UGQB 3UWNA 2E64A 4FYVB 4LDXA 3G7ZA 4XU2A 2EYQA 2CKKA 2NLUA 3F70A 5LL6S 4C92B 4CI0C 2DVJA 1YNZA 1HK9A 3R6NA 2RN8A 3JRZA 5IN1A 3NPFA 2EYWA 2H3JA 1VQNQ 4WCIA 1NLOC 3SD4A 5HK0A 1Q81R 5GAOp 2CT3A 2AKKA 2PQWA 2DYIA 1NJIR 1T0JA 2CP3A 1FMVA 2MPXC 4HT8A 3TU4K 5GAMj 5LJ5e 4WTOB 4RTWA 2PUKB 2MI6A 1G3TA 1PD0A 5GAMg 1U3OA 4M77F 1BI2A 3S3NA 2JM8A 2HQEA 4PJNA 4ZTJA 2B86A 1RAAB 2LCLA 4M7DE 4E7KA 3CC4T 2PUOB 1I5OB 1W4SA 2G6FX 5L8RE 2RHYA 2EPDA 2DYBA 1BI1A 1TS9A 3INZA 2QTVA 3CPWA 3JB9J 4HVUA 2W0ZA 3J80E 1B34B 3O5ZA 3H0FA 4A53A 1Q82U 1BB9A 1WHKA 4PFOA 1CKBA 3QHSA 4JS5A 3JCMd 2K3XA 4JZ3A 4UC4A 4D8DA 1Z9ZA 2Y4XA 4HT9A 1YJNT 2DO3A 1WHJA 2NUZA 1JB0E 3OW2S 3SWNC 2RQRA 2CSIA 2F69A 3CCEQ 2A36A 4FW1A 3EG2A 2AT1B 4L6V5 3WXMB 1FMWA 2ZPBB 4RTYA 4C92G 3RMSA 1Q7YU 3MP1A 1Y7XA 4ZGJB 1U5SA 3OYNA 2KSSA 5FROA 1R77A 4JJDA 3EH2A 3A8LB 3OYYA 1IXDA 2ROLA 2KT1A 1VQ9T 1N27A 4XAXB 1MGQA 2VV5A 1KG1A 2JTMA 3CCQA 1WPYA 1YJWA 2OX7A 4HXJA 5GAN6 2KYBA 4M78F 3MEWA 1M1KU 4M7AG 5IHNA 2RHUA 3ZEHA 1YJ9A 2M1HA 3HTRA 1GBQA 2FRYA 2DMOA 4XQ3A 2CP7A 2MMPA 1Q86C 2DX1A 2VYTA 4OVAA 1JBMA 4YTLA 5KYYA 2MF2A 2K6DA 1QKWA 4BE1A 1JU5C 4OB1B 2E6NA 1QVGS 1F1BB 3M0TA 3GOXA 2A08A 2NYSA 3WVEB 1VQKT 4PJMA 1PKTA 2A28A 2C0IA 1S1NA 4N4HA 1W2BS 2O2OA 4NOYA 2FYKA 3E19A 2GFUA 4QQDA 5KYXA 4ANJA 2LZ6B 3LGLA 4IIMA 1NJIU 2CP0A 1VQPT 1VQOA 1JXOA 2HDAA 3QZ5B 4OGEA 5KH6A 4IUPA 1VQMT 4OB2B 1Y96B 4BACA 4D8KA 3UDCA 2YUNA 2QG9B 3BDUA 4M78G 3H0HA 2J7IA 1YJNQ 2A0FB 3I5SA 2XICA 1AWXA 2FRWA 3H9NA 1M3BA 2GF7A 3A1PA 1TTHB 3P8HA 1QVFP 2D0NA 3SFMA 3LWIA 2MIOA 4FIBA 4M78A 3P8BB 3L2WA 2R5MA 4HKEA 1K73C 4F7UB 3SWNB 1D1AA 3CMEA 1WFWA 1VQMQ 1ACMB 3MEVA 3MP6A 2DVEA 4ZN1A 5LJ5d 1ZBXA 2KNBB 1WNLA 1M8MA 1VQPA 2CSQA 2LQNA 1K76A 1M8VA 3HRTA 3G71A 1Y0MA 3OY9A 4XTWA 1YHQQ 3CCLA 1D3BA 5D6YA 5GAOl 3RKWA 1WHMA 4PK4A 2WSFE 3HFOA 2KMTA 4M7AE 2I0NA 1XNIA 3CBPA 3JAME 1I0CA 1PNJA 2VKNA 2HAXA 3CCRA 1G83A 1PC0A 2E6ZA 2KI7A 2AHJB 4RTUA 4C0ZA 2K9GA 1WI7A 4LD6A 5J39A 2D9TA 2G3RA 3RR6A 2LX7A 3JSCA 1LVKA 4DBRA 1H92A 3PMIA 1YIJT 4EIKA 5J26A 4XU0A 2M0YA 4C92E 5KCHA 5FU6B 4AT1B 1DJ7B 4AMCA 2E70A 1Q82C 5A0LA 3UATA 4OP0A 3HL8A 4M75B 1BBZA 3QXEB 2YDLA 3CCLT 2K5LA 1ABQA 2O31A 4ZGDB 2XIDA 4C8QG
chains in the Genus database with same CATH topology
1LCKA 2EQIA 3M0SA 4JPBW 2LMJA 3EHRA 4RTVA 2GTOA 3UA7A 2KRMA 3PE0A 3I35A 1UJ0A 4DEYA 1AWJA 1HJDA 2NWMA 2IIMA 2FO0A 2V1RA 1B07A 1UECA 1RLPC 1K0SA 2X3WD 3EGUA 3M0UA 4Z88A 2KR3A 1KJWA 1WIEA 2EGCA 1I1JA 2KRNA 2F2WA 1ZUYA 2CREA 2HBWA 2KYMA 1NYGA 5GJVB 3VS4A 2J6FA 4CC4B 2J06A 2RQWA 2E5KA 4JZ4A 1UG1A 2F2XA 4AFZC 1AZGB 2KROA 3LH5A 1ZX6A 1X2KA 1E7OA 1JEGA 4LNPA 1TUDA 3C0CA 1AWWA 3NHNA 2AKLA 2EVRA 1KFZA 4J9HA 2DNUA 2EYXA 3IQLA 1WYXA 3UA6A 2HSPA 1B3QA 2BZ8A 2JTEA 1GBRA 2JXBA 1E6GA 2GBQA 4LE9A 2KE9A 1H8KA 5IHKA 1RI9A 1HSQA 2KT8A 2JS0A 2ENMA 2KXCA 1M3CA 1GFCA 4JJBA 1T0HA 2DL8A 2L3QA 2EYZA 1UJYA 5L23A 1SPKA 2RNAA 3QWYA 2YSQA 5EC7A 1UFFA 2JT4A 2JS2A 2F2VA 4Z8AA 3SHWA 1K4US 3M0QA 1UUEA 1ZUKA 4A63B 1ARKA 2PNIA 3VS1A 3SEMA 2PTKA 1SRLA 4M4ZA 1SHFA 2DM1A 1SSHA 2D8HA 4HVVA 3VS0A 3REAB 1AEYA 3M0PA 1W70A 4RTZA 4Z89A 3I5RA 2K2MA 2HEQA 2EBPA 4ZNXA 3THKA 1M30A 1ZLMA 1NG2A 2DJQA 1PKSA 4OMOA 4OMMA 2ED0A 2EGEA 1QLYA 5HCKA 1HD3A 1AD5A 1QCFA 2JMCA 1U06A 2DVJA 1YNZA 2YUOA 3GBQA 3R6NA 2RN8A 3NPFA 2EYWA 3QWXX 2CUBA 3UF4A 4WCIA 1NLOC 4HCKA 2BZYA 4J9IA 2L3PA 1MUZA 1IO6A 3VS7A 2CT3A 2AKKA 1WXTA 2CT4A 3ULRB 1T0JA 2ESWA 2O9SA 2MCNA 1AVZC 2RQVA 5IXFA 4RTWA 2J6KA 1RUWA 4OMQA 1XOVA 2OI3A 1NEGA 1U3OA 1ZUUA 2JM9A 2ROTA 1A0NB 2MOXA 2JM8A 2L0AA 1YWOA 2LQWA 2O9VA 2LJ0A 1EFNA 4RUGA 1VYUA 1X43A 2DL7A 1AWOA 2ABLA 5I22A 2B86A 5FWCA 3VRYA 3NGPA 2DL4A 1ABOA 1CKAA 2EW3A 1WX6A 2CDTA 3PVLA 4FSSA 4Y92A 1UDLA 2FG0A 2G6FX 2JMAA 2RMOA 1Y57A 2EGAA 2EPDA 2DYBA 2LNHB 5IXBA 3JV3A 3VS2A 1X69A 4HVUA 2W0ZA 1VA7A 4R0KA 3O5ZA 2SEMA 3H0FA 2C0TA 2DLPA 2XMFA 3CQTA 1BB9A 1OPKA 1CKBA 1JQQA 3NMZC 4LUDA 3RBBB 2DF6A 4JZ3A 1JXMA 1T3LA 4AFSC 4D8DA 1Z9ZA 2W10A 1X2QA 2RPNA 2NUZA 2BTTA 2RQRA 1WXUA 4J9EA 2CSIA 4OMLA 2KBTA 1T3SA 2GGRA 4J9DA 4OMNA 1ZSGA 2A36A 2KEAA 1GFDA 4CC3A 3EG2A 1WDXA 1NYFA 5ECAA 3EG3A 1OV3A 4RTYA 2DBKA 2K7AA 2YUQA 2KXDA 2RQUA 1U5SA 1QWEA 4DEXA 1NEBA 1TUCA 4JJDA 3FJ5A 4F14A 2X3XD 2ROLA 2KT1A 1MV3A 2DL5A 2DA9A 2RQTA 1QKXA 3VS3A 3EG1A 3H0IA 2CH4W 1NLPC 4HXJA 2KYBA 5IHIA 1YCSB 2D8JA 4K11A 5IHNA 2DBMA 4F16A 1X6GA 1X6BA 1WXBA 2LJ3A 1G2BA 1GBQA 2FRYA 4AFQC 2DMOA 2YT6A 2LJ1A 1MV0B 1BU1A 2AZVA 1I07A 1W6XA 5GJWB 1GCQC 2FPDA 2DX1A 1K1ZA 1BK2A 2KGTA 2J05A 1UHFA 1UGVA 1TG0A 2K6DA 1QKWA 2KRSA 1K0XA 1JU5C 3TSZA 4HVWA 3M0TA 2EYYA 2A08A 1AZEA 1PKTA 2A28A 2C0IA 1S1NA 4CC2A 2O2OA 2YUPA 3KFVA 2DRMA 4J9BA 2DL3A 2O88A 2DILA 2LZ6B 2K79A 4ORZA 4J9GA 1PWTA 1WA7A 2AZSA 2QDLA 4IIMA 1NM7A 1M27C 1YN8A 1JO8A 3VS5A 2L2PA 4KRTA 1GCQA 1UHCA 1JXOA 2HDAA 2JW4A 5IH2A 1VYVA 4OMPA 3U23A 2FEIA 2PZ1A 2VWFA 4D8KA 2LCSA 1FMKA 2YUNA 1PRMC 1GL5A 1QWFA 3H0HA 2J7IA 3REBB 2L3SA 1KSWA 3I5SA 1YP5A 1PHTA 2DRKA 1AWXA 1UTIA 2FRWA 1M3BA 1ZBJA 1GRIA 2GQIA 1OOTA 3TSWA 2D0NA 2CUDA 2C0OA 2MIOA 4F17A 1YWPA 1X27A 5FW9A 5FWBA 1UE9A 1SEMA 2EKHA 2DE0X 1E6HA 1SRMA 4GBQA 4J9CA 3EG0A 2CH4A 2OJ2A 3TVTA 1WFWA 2RF0A 4IIOA 4JJCA 4LN2A 2KNBB 2ED1A 1M8MA 1H3HA 3I9QA 2BZXA 3M0RA 2CSQA 2LQNA 1K76A 1Y0MA 2ECZA 2OAWA 3A98A 2LP5A 2H8HA 4ESRA 3H41A 3VRZA 4RTXA 1K9AA 1KIKA 2I0NA 2K3BA 5I11A 2M51A 1J3TA 2GNCA 1I0CA 1PNJA 2VKNA 1SHGA 4AFUC 1G83A 3VS6A 3PVQA 1V1CA 2AK5A 4RTTA 4RTUA 4CC7A 1CSKA 2K9GA 1WI7A 2FPFA 2LX7A 1OEBA 1H92A 2D1XA 2HCKA 2FPEA 1N5ZA 3ZL7C 4EIKA 4X1VA 2M0YA 2P4RA 2SRCA 2A37A 2V1QA 4AG2C 1GCPA 1RLQC 4QT7A 3UATA 1FYNA 1M3AA 2VVKA 2GTJA 2J6OA 3EHQA 4AG1C 1BBZA 1W1FA 2YDLA 4E6RA 1OPLA 1AOJA 1ABQA 2O31A 4J9FA 3RNJA 1WLPB 1Z9QA 1PRLC 4GLMA 4LUEA 1VYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCK A;  2EQI A;  3M0S A;  4JPB W;  2LMJ A;  3EHR A;  4RTV A;  2GTO A;  3UA7 A;  2KRM A;  3PE0 A;  3I35 A;  1UJ0 A;  4DEY A;  1AWJ A;  1HJD A;  2NWM A;  2IIM A;  2FO0 A;  2V1R A;  1B07 A;  1UEC A;  1RLP C;  1K0S A;  2X3W D;  3EGU A;  3M0U A;  4Z88 A;  2KR3 A;  1KJW A;  1WIE A;  2EGC A;  1I1J A;  2KRN A;  2F2W A;  1ZUY A;  2CRE A;  2HBW A;  2KYM A;  1NYG A;  5GJV B;  3VS4 A;  2J6F A;  4CC4 B;  2J06 A;  2RQW A;  2E5K A;  4JZ4 A;  1UG1 A;  2F2X A;  4AFZ C;  1AZG B;  2KRO A;  3LH5 A;  1ZX6 A;  1X2K A;  1E7O A;  1JEG A;  4LNP A;  1TUD A;  3C0C A;  1AWW A;  3NHN A;  2AKL A;  2EVR A;  1KFZ A;  4J9H A;  2DNU A;  2EYX A;  3IQL A;  1WYX A;  3UA6 A;  2HSP A;  1B3Q A;  2BZ8 A;  2JTE A;  1GBR A;  2JXB A;  1E6G A;  2GBQ A;  4LE9 A;  2KE9 A;  1H8K A;  5IHK A;  1RI9 A;  1HSQ A;  2KT8 A;  2JS0 A;  2ENM A;  2KXC A;  1M3C A;  1GFC A;  4JJB A;  1T0H A;  2DL8 A;  2L3Q A;  2EYZ A;  1UJY A;  5L23 A;  1SPK A;  2RNA A;  3QWY A;  2YSQ A;  5EC7 A;  1UFF A;  2JT4 A;  2JS2 A;  2F2V A;  4Z8A A;  3SHW A;  1K4U S;  3M0Q A;  1UUE A;  1ZUK A;  4A63 B;  1ARK A;  2PNI A;  3VS1 A;  3SEM A;  2PTK A;  1SRL A;  4M4Z A;  1SHF A;  2DM1 A;  1SSH A;  2D8H A;  4HVV A;  3VS0 A;  3REA B;  1AEY A;  3M0P A;  1W70 A;  4RTZ A;  4Z89 A;  3I5R A;  2K2M A;  2HEQ A;  2EBP A;  4ZNX A;  3THK A;  1M30 A;  1ZLM A;  1NG2 A;  2DJQ A;  1PKS A;  4OMO A;  4OMM A;  2ED0 A;  2EGE A;  1QLY A;  5HCK A;  1HD3 A;  1AD5 A;  1QCF A;  2JMC A;  1U06 A;  2DVJ A;  1YNZ A;  2YUO A;  3GBQ A;  3R6N A;  2RN8 A;  3NPF A;  2EYW A;  3QWX X;  2CUB A;  3UF4 A;  4WCI A;  1NLO C;  4HCK A;  2BZY A;  4J9I A;  2L3P A;  1MUZ A;  1IO6 A;  3VS7 A;  2CT3 A;  2AKK A;  1WXT A;  2CT4 A;  3ULR B;  1T0J A;  2ESW A;  2O9S A;  2MCN A;  1AVZ C;  2RQV A;  5IXF A;  4RTW A;  2J6K A;  1RUW A;  4OMQ A;  1XOV A;  2OI3 A;  1NEG A;  1U3O A;  1ZUU A;  2JM9 A;  2ROT A;  1A0N B;  2MOX A;  2JM8 A;  2L0A A;  1YWO A;  2LQW A;  2O9V A;  2LJ0 A;  1EFN A;  4RUG A;  1VYU A;  1X43 A;  2DL7 A;  1AWO A;  2ABL A;  5I22 A;  2B86 A;  5FWC A;  3VRY A;  3NGP A;  2DL4 A;  1ABO A;  1CKA A;  2EW3 A;  1WX6 A;  2CDT A;  3PVL A;  4FSS A;  4Y92 A;  1UDL A;  2FG0 A;  2G6F X;  2JMA A;  2RMO A;  1Y57 A;  2EGA A;  2EPD A;  2DYB A;  2LNH B;  5IXB A;  3JV3 A;  3VS2 A;  1X69 A;  4HVU A;  2W0Z A;  1VA7 A;  4R0K A;  3O5Z A;  2SEM A;  3H0F A;  2C0T A;  2DLP A;  2XMF A;  3CQT A;  1BB9 A;  1OPK A;  1CKB A;  1JQQ A;  3NMZ C;  4LUD A;  3RBB B;  2DF6 A;  4JZ3 A;  1JXM A;  1T3L A;  4AFS C;  4D8D A;  1Z9Z A;  2W10 A;  1X2Q A;  2RPN A;  2NUZ A;  2BTT A;  2RQR A;  1WXU A;  4J9E A;  2CSI A;  4OML A;  2KBT A;  1T3S A;  2GGR A;  4J9D A;  4OMN A;  1ZSG A;  2A36 A;  2KEA A;  1GFD A;  4CC3 A;  3EG2 A;  1WDX A;  1NYF A;  5ECA A;  3EG3 A;  1OV3 A;  4RTY A;  2DBK A;  2K7A A;  2YUQ A;  2KXD A;  2RQU A;  1U5S A;  1QWE A;  4DEX A;  1NEB A;  1TUC A;  4JJD A;  3FJ5 A;  4F14 A;  2X3X D;  2ROL A;  2KT1 A;  1MV3 A;  2DL5 A;  2DA9 A;  2RQT A;  1QKX A;  3VS3 A;  3EG1 A;  3H0I A;  2CH4 W;  1NLP C;  4HXJ A;  2KYB A;  5IHI A;  1YCS B;  2D8J A;  4K11 A;  5IHN A;  2DBM A;  4F16 A;  1X6G A;  1X6B A;  1WXB A;  2LJ3 A;  1G2B A;  1GBQ A;  2FRY A;  4AFQ C;  2DMO A;  2YT6 A;  2LJ1 A;  1MV0 B;  1BU1 A;  2AZV A;  1I07 A;  1W6X A;  5GJW B;  1GCQ C;  2FPD A;  2DX1 A;  1K1Z A;  1BK2 A;  2KGT A;  2J05 A;  1UHF A;  1UGV A;  1TG0 A;  2K6D A;  1QKW A;  2KRS A;  1K0X A;  1JU5 C;  3TSZ A;  4HVW A;  3M0T A;  2EYY A;  2A08 A;  1AZE A;  1PKT A;  2A28 A;  2C0I A;  1S1N A;  4CC2 A;  2O2O A;  2YUP A;  3KFV A;  2DRM A;  4J9B A;  2DL3 A;  2O88 A;  2DIL A;  2LZ6 B;  2K79 A;  4ORZ A;  4J9G A;  1PWT A;  1WA7 A;  2AZS A;  2QDL A;  4IIM A;  1NM7 A;  1M27 C;  1YN8 A;  1JO8 A;  3VS5 A;  2L2P A;  4KRT A;  1GCQ A;  1UHC A;  1JXO A;  2HDA A;  2JW4 A;  5IH2 A;  1VYV A;  4OMP A;  3U23 A;  2FEI A;  2PZ1 A;  2VWF A;  4D8K A;  2LCS A;  1FMK A;  2YUN A;  1PRM C;  1GL5 A;  1QWF A;  3H0H A;  2J7I A;  3REB B;  2L3S A;  1KSW A;  3I5S A;  1YP5 A;  1PHT A;  2DRK A;  1AWX A;  1UTI A;  2FRW A;  1M3B A;  1ZBJ A;  1GRI A;  2GQI A;  1OOT A;  3TSW A;  2D0N A;  2CUD A;  2C0O A;  2MIO A;  4F17 A;  1YWP A;  1X27 A;  5FW9 A;  5FWB A;  1UE9 A;  1SEM A;  2EKH A;  2DE0 X;  1E6H A;  1SRM A;  4GBQ A;  4J9C A;  3EG0 A;  2CH4 A;  2OJ2 A;  3TVT A;  1WFW A;  2RF0 A;  4IIO A;  4JJC A;  4LN2 A;  2KNB B;  2ED1 A;  1M8M A;  1H3H A;  3I9Q A;  2BZX A;  3M0R A;  2CSQ A;  2LQN A;  1K76 A;  1Y0M A;  2ECZ A;  2OAW A;  3A98 A;  2LP5 A;  2H8H A;  4ESR A;  3H41 A;  3VRZ A;  4RTX A;  1K9A A;  1KIK A;  2I0N A;  2K3B A;  5I11 A;  2M51 A;  1J3T A;  2GNC A;  1I0C A;  1PNJ A;  2VKN A;  1SHG A;  4AFU C;  1G83 A;  3VS6 A;  3PVQ A;  1V1C A;  2AK5 A;  4RTT A;  4RTU A;  4CC7 A;  1CSK A;  2K9G A;  1WI7 A;  2FPF A;  2LX7 A;  1OEB A;  1H92 A;  2D1X A;  2HCK A;  2FPE A;  1N5Z A;  3ZL7 C;  4EIK A;  4X1V A;  2M0Y A;  2P4R A;  2SRC A;  2A37 A;  2V1Q A;  4AG2 C;  1GCP A;  1RLQ C;  4QT7 A;  3UAT A;  1FYN A;  1M3A A;  2VVK A;  2GTJ A;  2J6O A;  3EHQ A;  4AG1 C;  1BBZ A;  1W1F A;  2YDL A;  4E6R A;  1OPL A;  1AOJ A;  1ABQ A;  2O31 A;  4J9F A;  3RNJ A;  1WLP B;  1Z9Q A;  1PRL C;  4GLM A;  4LUE A;  1VYT A; 
#chains in the Genus database with same CATH topology
 1BIB A;  1LCK A;  2CZ0 B;  2RJC A;  1M1F A;  2K4Y A;  3EG9 B;  3OYD A;  2MYS A;  2X4W A;  3CXC A;  4DBH A;  1VQ9 Q;  3BFM A;  1IHW A;  3E9F A;  1UJ0 A;  4MZP A;  4PJO F;  4M78 B;  1HJD A;  2HSE B;  2V1R A;  1UEC A;  1K0S A;  2X3W D;  1PSE A;  2QQR A;  2EGC A;  1I1J A;  3MJX A;  4E7Z A;  2YLB A;  3G4S A;  3RMQ A;  1ZUY A;  3CPW P;  4E7L A;  1VQK A;  1YJ9 T;  4C5G A;  1NYG A;  3VS4 A;  3A8O B;  8AT1 B;  4CC4 B;  2RQW A;  2VXF A;  1K9M U;  4XU1 A;  3GLX A;  5KYU B;  3LH5 A;  1ZX6 A;  5GAM e;  1E7O A;  1S72 A;  4LNP A;  3C0C A;  4M77 D;  5CKE A;  3MET A;  2M9U A;  3NHN A;  3G6E Q;  2AKL A;  5KE3 A;  3MP8 A;  4M75 F;  3PIP A;  3IQL A;  4M78 E;  3VYG A;  4JJN K;  3UA6 A;  2HSP A;  3S3M A;  1B3Q A;  2BZ8 A;  2O4X A;  1RAC B;  2PU9 B;  1PCX A;  2GBQ A;  4LE9 A;  1H64 1;  2HZY A;  1RI9 A;  2JS0 A;  3CXC S;  2ENM A;  4ZN3 A;  1GFC A;  2QXF A;  3GF5 A;  3QII A;  2RI2 A;  2DL8 A;  2GFA A;  4C92 A;  1VIE A;  2KVQ G;  2HQX A;  3QPH A;  3JCM c;  1YIT T;  2EYZ A;  1YJ9 Q;  1N8R R;  1UJY A;  1SPK A;  3EFO A;  3J81 E;  2DZ9 A;  3BDL A;  3CCU A;  2RNA A;  3QWY A;  2ZGW A;  5EC7 A;  2MWP A;  2ZPH B;  1OZ2 A;  3RDV A;  1UFF A;  2JT4 A;  4A4G A;  1K4U S;  1ZUK A;  2CP5 A;  3V8K A;  4M75 E;  2XD0 A;  2PTK A;  4RCC A;  1KK7 A;  3CC7 T;  4IUR A;  1S72 T;  4ELY C;  5FU6 C;  2D8H A;  2JOY A;  4M7A A;  1I5L A;  2RHZ A;  1AEY A;  4WF2 A;  4Z89 A;  3I5R A;  2K2M A;  2DK3 A;  2HEQ A;  1M30 A;  2DJQ A;  3G71 T;  1PKS A;  4OMO A;  2ED0 A;  2RA2 A;  5HCK A;  1HD3 A;  1QCF A;  1MMD A;  2JMC A;  5GMK j;  3GBQ A;  4BB7 A;  4KUD K;  7AT1 B;  3QWX X;  4J83 A;  5C6S A;  2EJ9 A;  3X24 B;  1QMC A;  3H8Z A;  5M9O A;  3CCR T;  4JS4 A;  4J9I A;  1WQ7 A;  2V8K A;  3ULR B;  2FHD A;  4Y91 A;  1AVZ C;  4KH0 B;  2J6K A;  2RM4 A;  1OU9 A;  4OMQ A;  1PM3 A;  4L59 A;  2CP6 A;  1XOV A;  3JCM V;  1NEG A;  1B34 A;  1TH7 A;  1ZUU A;  2QTX A;  5CK9 A;  2BKD N;  4D6W A;  2MOX A;  2LQW A;  3OSS C;  1YHQ A;  1Q82 R;  3NTI A;  1P92 A;  3KBG A;  4RUG A;  4C8Q E;  2KY9 A;  1VYU A;  2DL7 A;  5LJ5 f;  5I22 A;  3VRY A;  3CCQ Q;  3NGP A;  1CKA A;  1G5V A;  3CCR Q;  4Y92 A;  1UDL A;  3D7S B;  3EH1 A;  2OTJ Q;  5CVI A;  4LDV A;  2RO0 A;  1OUL A;  1M9S A;  2SEM A;  1GXI E;  1D0X A;  2DLP A;  1JJ2 P;  2XMF A;  3FB9 A;  4C92 F;  3CCL Q;  4GY5 A;  1JQQ A;  3NMZ C;  2JTF A;  5I21 A;  2RK2 A;  3RBB B;  1VQN A;  1VQ4 T;  4DBF A;  4R55 A;  1JXM A;  3HSB A;  3PIO A;  3R6O A;  5FRN A;  2RPN A;  2BTT A;  4II1 A;  4J9E A;  4BI8 B;  1T3S A;  1OZ3 A;  1RAG B;  2HKN A;  1QCO A;  4J9D A;  4C8Q D;  3CME Q;  4KGV B;  1LPL A;  2A7Y A;  2K5F A;  4KGX B;  5KYX B;  1YHQ T;  2ATC B;  2YUQ A;  1BYM A;  1TU0 B;  2KXD A;  1IGQ A;  3DLM A;  4M7A F;  3FDR A;  1TUC A;  3L42 A;  1RAE B;  2YXY A;  3FJ5 A;  5KYY B;  1OX9 A;  2EIF A;  2DL5 A;  2DA9 A;  2RQT A;  5CO7 A;  3VS3 A;  2QDY B;  2CH4 W;  3H0I A;  5AT1 B;  2COZ A;  1NLP C;  5IHI A;  4K11 A;  2DTH A;  1BI3 A;  1X6G A;  4M7A D;  3OYE A;  3C12 A;  1M1G A;  2OTL A;  1G2B A;  4IKF A;  1QCN A;  3VJP A;  2CYZ B;  3RUX A;  5GJW B;  1GCQ C;  3JCM X;  3CC2 A;  1NPP A;  2J05 A;  1UHF A;  1ZSZ A;  1LJO A;  2X51 A;  1ZA2 B;  1KHC A;  3TQ7 P;  1K0X A;  2VXE A;  1D0Z A;  4RG8 A;  4JRK A;  3TEE A;  4PFZ A;  4E47 A;  3MKD A;  2A3L A;  3FC3 A;  3KFV A;  2DRM A;  3EGD B;  3OYH A;  1TSF A;  2DL3 A;  2DIL A;  2K79 A;  5IT9 E;  1WA7 A;  3HHT B;  1X01 A;  1NM7 A;  3VUZ A;  1M27 C;  2L2P A;  1UGR B;  2JW4 A;  4FYX B;  3VUB A;  3MEA A;  4LD9 K;  2FL7 A;  1RL2 A;  2PZ1 A;  2LCS A;  3LX7 A;  5LJ5 j;  4B6M A;  3PGG A;  3OYA A;  4M77 B;  3M55 A;  1QVF A;  2L3S A;  1UGS B;  1WJR A;  1YP5 A;  4EMK C;  3QDR B;  3JCM f;  3CPF A;  1K73 R;  1ZBJ A;  1GRI A;  1R8O B;  2X35 A;  2GQI A;  3TSW A;  1QVP A;  2CUD A;  2CZ1 B;  2C0O A;  6AT1 B;  3J7A F;  5FW9 A;  5FWB A;  1UE9 A;  3CEY A;  2DE0 X;  5CKB A;  2YRV A;  3EG0 A;  4FT4 A;  3JCM W;  1MMN A;  1N8R C;  3L1A A;  1M90 C;  4JJC A;  1XQH A;  3CC2 Q;  3S3O A;  3I9Q A;  1KC8 R;  1IRX A;  4JUV A;  1I4K 1;  2BIV A;  2ECZ A;  2OAW A;  3A98 A;  1R0B G;  3H41 A;  4F04 B;  1K9A A;  2LRQ A;  3NFC A;  1WQW A;  1KIK A;  5I11 A;  1VQL T;  2DXT A;  4BDZ A;  2GNC A;  1JJ2 S;  2KAF A;  5LJ3 h;  1Q86 U;  4ZGE B;  4PFP A;  3CCS Q;  4AFU C;  3ZFJ A;  4O5V A;  2CGH A;  3VS6 A;  3PVQ A;  3OYG A;  3M4Y A;  1KQS S;  3VV0 A;  1XJW B;  2H3E B;  1QVG P;  2O4X B;  2NUP A;  2HBP A;  2EQK A;  4NL3 A;  2D1X A;  2FPE A;  4X9D A;  3E9G A;  3ZL7 C;  5KYN A;  4X1V A;  5CKD A;  2QQS A;  4PLL A;  3OYB A;  4PKC C;  1MNE A;  1RLQ C;  4PJO A;  2BE7 D;  1FYN A;  1VQ6 A;  1M3A A;  4AG1 C;  1XTD A;  3RNJ A;  4GLM A;  1SSF A;  1VQ7 T;  2V26 A;  2VGM A;  4X9C A;  4DQ2 A;  4KUI A;  3M0S A;  2LMJ A;  1NBE B;  2XK0 A;  4IUQ A;  2E65 A;  1Q7Y C;  2DEU A;  3ME9 A;  3PE0 A;  4EMG A;  1AWJ A;  2DFU A;  1K8A R;  4E7I A;  3A8M B;  3CXC P;  3X20 B;  2DXC A;  4VUB A;  2X4Y A;  3OYI A;  3QBY A;  5CAI A;  2DXB A;  1C0M A;  1KJW A;  5GAN 4;  3OYJ A;  1KD1 R;  5J3B A;  1NPR A;  3OS2 A;  5LJ3 j;  3LGF A;  3EAE A;  2J6F A;  2XDB A;  2J06 A;  4NS5 A;  4KGZ B;  4JZ4 A;  5AYF A;  4AFZ C;  2YRC A;  5HK3 A;  1X2K A;  1UGP B;  3QJY A;  2DET A;  3CD6 A;  4DBQ A;  1AWW A;  3CC2 T;  4RKU E;  1VQ4 Q;  1M90 R;  4J9H A;  2VB6 A;  4JRQ A;  4RCB A;  2NUT A;  2JTE A;  1GBR A;  1E6G A;  2YWW A;  5IAY A;  2F1L A;  2YLC A;  3BY7 A;  1HSQ A;  2KT8 A;  4ZTF A;  5DY9 A;  2L3Q A;  3DLL A;  4ME7 A;  1MMA A;  3X26 B;  3OYM A;  3LH0 A;  5A2Q E;  1WGS A;  1WZO A;  2F2V A;  2GQV A;  3L2U A;  2VUB A;  3SHW A;  1PD1 A;  4Q5W A;  1KQ1 A;  4CRI A;  2QA4 A;  1YI2 T;  1B7T A;  3CD6 T;  4PJO D;  4M4Z A;  4F7U A;  3PFS A;  2RK1 A;  3M0P A;  1W70 A;  4RTZ A;  1U8R A;  1K8A U;  2NUT B;  2XDD A;  2EBP A;  1BCM A;  4ZNX A;  3VKI A;  4HCC A;  1ZLM A;  3E2U A;  1NZ9 A;  2DIQ A;  4FW2 A;  4OMM A;  2EGE A;  5A0D A;  4M7D F;  3MCA B;  1AD5 A;  2VGN A;  1U06 A;  4OF1 A;  1VQ6 Q;  2YUO A;  4RMO A;  4FM4 B;  2F5T X;  3UF4 A;  1Q81 C;  4N0A A;  4FYY B;  1LNX A;  4HCK A;  1D3B B;  1SKU B;  2RHX A;  2BZY A;  2L3P A;  1IHV A;  1MUZ A;  4L5G A;  2Y4Y A;  4MDW A;  1K9M C;  1IO6 A;  3VS7 A;  1WXT A;  2QQ9 A;  2CT4 A;  2DIG A;  2JNG A;  2MCN A;  1WHL A;  2RQV A;  4M75 G;  2OI3 A;  2D0Q B;  2XU8 A;  4PJO C;  4FCY A;  2JM9 A;  3HFN A;  1A0N B;  2L0A A;  1YWO A;  2LC4 A;  2LJ0 A;  4TVR A;  5GMK m;  3OSV A;  4A54 A;  1X43 A;  2WSE E;  1M2V A;  5FWC A;  2E10 A;  2WSC E;  2M16 A;  1ZHI A;  1ABO A;  3AT1 B;  1WX6 A;  2R5A A;  2COY A;  1FXX A;  2EGA A;  1Q86 R;  4J5Y A;  4C92 D;  3JV3 A;  4QVD A;  1RAF B;  4Y28 E;  2GCX A;  1D1C A;  3CQT A;  3JB9 D;  2DF6 A;  3L2Z A;  1T3L A;  4AFS C;  1BI0 A;  4BY6 B;  5CKH A;  1HXD A;  5HKC A;  3OYC A;  3V7S A;  2W10 A;  3FEO A;  1KC8 U;  1X2Q A;  1WXU A;  3JB9 F;  1KD1 C;  4OML A;  2KBT A;  2WAC A;  5FLX E;  4OMN A;  4FL6 A;  3OA6 A;  4O6J A;  2DKG A;  3CC4 Q;  1RAB B;  3EGD A;  4CC3 A;  1VQ4 A;  5CQX A;  3JCM Q;  1NYF A;  3EG3 A;  3FRN A;  1OV3 A;  3T9N A;  3OYF A;  3CD6 Q;  1VQ7 A;  3VYH B;  1FX7 A;  3A5Z B;  2LT4 A;  2LTO A;  3I55 T;  5GAN j;  3OS0 A;  2RQU A;  1OQK A;  1QWE A;  4M77 G;  4M75 D;  2HNI A;  3JB9 H;  1VQ8 A;  2K57 A;  2M02 A;  5I2M A;  3H6Z A;  4C92 C;  1QKX A;  3NTH A;  4XU3 A;  3EG1 A;  3V7R A;  1MHN A;  1EIF A;  2P84 A;  5KE2 A;  3MPU B;  1YCS B;  5GAO n;  1VQN T;  2DBM A;  3M59 A;  4F16 A;  1YIT A;  1X6B A;  4KUL A;  2JUF A;  3JCM b;  4A4E A;  2FB7 A;  3RIR A;  1MV0 B;  1BU1 A;  4EMH A;  3G71 Q;  2JN0 A;  1I07 A;  1W6X A;  1K1Z A;  1BK2 A;  2KGT A;  1UGV A;  5GAM f;  2OTL T;  2FZG B;  3PMT A;  4M7A C;  1U1S A;  2KRS A;  4C5E A;  3TSZ A;  1R0C B;  1UEB A;  1ZSZ B;  1QP3 A;  4CC2 A;  5GAN e;  3JCM P;  2HL3 A;  2XG8 D;  3EFR A;  2LT1 A;  3QKJ A;  4BE2 A;  2FZK B;  2O88 A;  2RD1 A;  4M78 C;  4ORZ A;  2P0P A;  4J9G A;  1KC8 C;  4MDX A;  1PWT A;  4PJO B;  5FRM A;  1KQS A;  1YN8 A;  3V8J A;  5FU7 B;  2E3I A;  1GCQ A;  5IH2 A;  3M57 A;  3X28 B;  4RG2 A;  4OMP A;  3QO3 A;  2ZPI B;  3U23 A;  1KQS P;  2VWF A;  1YI2 A;  4IUU A;  1VQO T;  2X4X A;  3UPU A;  3REB B;  4QQG A;  1KSW A;  1VQM A;  2E1H A;  3CC7 Q;  1PHT A;  2DRK A;  4OB3 B;  1QQJ A;  4ELZ C;  1K8A C;  5GAN 3;  4QQ6 A;  2DPP B;  3JCM g;  5C0M A;  5DLO A;  4ATO A;  2QYZ A;  4XTX A;  2JJ9 A;  3QSU A;  3M9Q A;  1YWP A;  4M7D D;  3CCJ Q;  3CCM T;  4N4I A;  4DA4 A;  1TUG B;  4BY6 C;  1YJW Q;  4GBQ A;  4J9C A;  2CH4 A;  2ZPE B;  2OJ2 A;  2QQA A;  4BI3 A;  4C8Q F;  1TOV A;  3G6E T;  2BZX A;  2E12 A;  3M0R A;  3FJP A;  5GAN 8;  1EZZ B;  1RAH B;  2K5I A;  5EG2 A;  5DM7 R;  3DB3 A;  1ZQ1 A;  5GMK h;  4ESR A;  3VRZ A;  4RTX A;  2P4T A;  5GAM d;  3L2R A;  2M51 A;  1J3T A;  4PJL A;  3P8D A;  1VOM A;  5LJ3 d;  2KQW A;  1KHI A;  1V1C A;  1WHH A;  3CCS A;  4E7J A;  4CC7 A;  3WVD B;  1YIJ A;  1IRE B;  2EFI A;  4EPC A;  4M7D C;  1OEB A;  1LOJ A;  4PJJ A;  2HCK A;  2IPO B;  1OU8 A;  4C8Q C;  1VIF A;  1N8R U;  3CCE T;  2HD0 A;  2P4R A;  2SRC A;  2A37 A;  2V1Q A;  2V8J A;  1AT1 B;  1GCP A;  3CCJ A;  4QT7 A;  4IUV A;  3EHQ A;  2L3R A;  2K2V A;  1W1F A;  4E6R A;  4LDW A;  5FU7 C;  3ER0 A;  4J9F A;  4XTU A;  1MMG A;  1Z9Q A;  1PRL C;  1WJS A;  1ZSZ C;  3EGX A;  3LW5 E;  2CZ6 B;  4LUE A;  1KD1 U;  2D6F A;  1QP2 A;  2EQI A;  1BIA A;  2KK4 A;  1U1T A;  3LLR A;  2EWN A;  3EHR A;  4J6W A;  4QKU A;  2HKQ B;  3UA7 A;  1H3Z A;  2KRM A;  2DTI A;  3I35 A;  4J7I A;  3JCM J;  2IIM A;  4QW2 A;  1RLP C;  1G3S A;  4C8Q A;  1YIJ Q;  2ZPF B;  5GAN h;  1YCY A;  2AIR B;  3OS5 A;  4PLI A;  1M2V B;  3MO8 A;  2I2L A;  5GAN f;  2KRN A;  3PT9 A;  2CRE A;  5D6W A;  1QVG A;  4C5H A;  4B9W A;  1D1B A;  1M1K R;  3CCE A;  4QVZ A;  2F2X A;  1AZG B;  3QJ6 A;  2QAZ A;  2KRO A;  3QDF A;  5GAO r;  3GNG A;  1SF9 A;  3G4S T;  2OAU A;  2VAS A;  3SB2 A;  1JEG A;  5CKF A;  4F7U F;  2QEX T;  1TUD A;  3VU3 C;  2HQH A;  2RH2 A;  5D6X A;  4QVC A;  1M2O A;  3BW1 A;  1KFZ A;  4NL2 A;  4F7U G;  2DNU A;  2RHI A;  3GIB A;  1WYX A;  2OTJ T;  1VQ5 T;  2JXB A;  3CCU T;  2KE9 A;  1H8K A;  1RAD B;  5D7U A;  2JVV A;  3TCJ A;  5IHK A;  1QW1 A;  5LJ5 g;  3CMA T;  3I56 T;  1Q7Y R;  2KXC A;  4JJB A;  3HPW A;  5GMK l;  2L89 A;  4BUG A;  1FWZ A;  5A0G A;  3I55 Q;  5L23 A;  3OYL A;  4LXC A;  4BE0 A;  3V8L A;  2JZ2 A;  2YSQ A;  4EMK B;  3M56 A;  3G4S Q;  1M5Q 1;  2LX9 A;  3GP8 A;  3CC7 A;  8ATC B;  2DEQ A;  2BUD A;  5CQY A;  1O75 A;  1BCO A;  4Z8A A;  4DOV A;  5LJ3 g;  3M0Q A;  3A8H B;  1UUE A;  2Y90 A;  2RI3 A;  1V76 A;  4A63 B;  1ARK A;  3SEM A;  2EQM A;  4J8O A;  5GAM h;  1SRL A;  1SHF A;  1KQ2 A;  3DB4 A;  2ZPG B;  2RJF A;  2QGG A;  3JB9 G;  3THK A;  1NG2 A;  4M7D B;  4MML A;  3CC4 A;  1QLY A;  4C8Q B;  3O8V A;  4Z02 A;  1VQL A;  5GAN 2;  2CUB A;  2EJF A;  3URG A;  2XKO C;  2QGF B;  1RI0 A;  2EQJ A;  3QG1 A;  5I2S A;  2LQ8 A;  2MK5 A;  5CR2 A;  2ESW A;  2O9S A;  2P0Q A;  1TWB A;  2B8A A;  3UT1 A;  5IXF A;  4BDY A;  2QA4 T;  1RUW A;  3DKM A;  2ROT A;  5GAN 7;  1NE8 A;  4FYW B;  3TRE A;  4J7F A;  3Q1J A;  2O9V A;  1EFN A;  4PNO A;  4JDS A;  4P5N A;  3SWN A;  1AWO A;  2ABL A;  3KXT A;  3CME T;  3OW2 A;  2XI9 A;  2ZZD A;  2DL4 A;  4J6Y A;  2C06 A;  2EW3 A;  3A8G B;  3CCV T;  2CDT A;  3PVL A;  4JRI A;  4FSS A;  4C0G A;  3LYI A;  3EFS A;  2FG0 A;  4M77 A;  2JMA A;  2RMO A;  1Y57 A;  2LNH B;  5IXB A;  3C95 A;  3E1S A;  3L2V A;  3CCS T;  3VS2 A;  3OW2 P;  1X69 A;  3OMG A;  1VA7 A;  4R0K A;  2C0T A;  3I56 Q;  2LCC A;  4HCZ A;  5CCA A;  3RKY A;  3V7C A;  1K73 U;  1OPK A;  3CCJ T;  4M7A B;  3CCM Q;  4LUD A;  4MZM A;  3M53 A;  2RJD A;  1NJI C;  4M77 C;  2KDS A;  2CP2 A;  9ATC B;  2QQB A;  2Z0W A;  2GGR A;  1YBY A;  1OI1 A;  4KT0 E;  1ZSG A;  2KEA A;  1GFD A;  3M54 A;  1WDX A;  5ECA A;  3GPL A;  2MWO A;  1OYX A;  2X4J A;  2RJE A;  2DZC A;  2DBK A;  2K7A A;  5KYW B;  2DER A;  3QYH B;  1VQ9 A;  2DXU A;  1X75 C;  3OBY A;  4JLI A;  1G3Y A;  4HCB A;  4DEX A;  2QI2 A;  1N9S A;  1NEB A;  5HY6 A;  3HRU A;  4A4F A;  5KYW A;  2L8D A;  1BKB A;  2P0K A;  2LNV A;  4F14 A;  2X3X D;  4N0A C;  1MV3 A;  4IUT A;  2LQK A;  1YI2 Q;  3X25 B;  5KYU A;  3CMA A;  1X6O A;  2E5Q A;  3CBM A;  2DJZ A;  1I8F A;  4XTY A;  2D8J A;  1JJ2 A;  1M1K C;  1WXB A;  1EX4 A;  2LJ3 A;  3BE3 A;  3ASK A;  4DOW A;  4AFQ C;  2E3H A;  2YT6 A;  2LJ1 A;  2AZV A;  2F5K A;  5GMK e;  3CCU Q;  2QEX A;  4E7H A;  2FPD A;  2EAY A;  1HYO A;  1TG0 A;  3EG9 A;  1YIT Q;  3AHU A;  4HVW A;  1W2B P;  2EYY A;  2OTJ A;  3JCM h;  1VQ5 A;  5KCO A;  1AZE A;  3JCM e;  1VQ8 T;  3OMC A;  4OB0 B;  3I56 A;  1M4Z A;  2YUP A;  4M7D G;  4BD3 A;  1RAI B;  3C94 A;  4J9B A;  3CCV Q;  4BI4 A;  1Y71 A;  2DD5 A;  4MMK A;  4M75 A;  1YFN A;  4JLG A;  1S72 Q;  4E7S A;  2AZS A;  2QDL A;  4PL6 A;  4V2S A;  2LDM A;  1AHJ B;  1M90 U;  1JO8 A;  4LDY A;  3VS5 A;  3GNF B;  4KRT A;  2EQU A;  1UHC A;  2YHT A;  3HRS A;  1VQ7 Q;  2FVU A;  1C6V X;  1VYV A;  3HP9 A;  2FEI A;  4M78 D;  1FMK A;  3OS1 A;  2IVW A;  1PRM C;  1GL5 A;  1QWF A;  2ZCF B;  3HKS A;  4FT2 A;  3M5A A;  1VQ8 Q;  2QEX Q;  1UTI A;  5GAO q;  2QK0 A;  4FU6 A;  1OOT A;  5LJ3 f;  4C0F A;  1N6A A;  4M75 C;  4F17 A;  1X27 A;  1WJQ A;  1SEM A;  2YRD A;  1VQ5 Q;  3OQ5 A;  2EKH A;  1E6H A;  1SRM A;  4OGC A;  4C0D C;  1PSF A;  4B9X A;  3CMA Q;  3FLG A;  1Q81 U;  3TVT A;  5LJ5 h;  2RF0 A;  4JRP A;  4IIO A;  4LN2 A;  4F7U E;  2QAS A;  2ED1 A;  4HA8 A;  1H3H A;  5CIU A;  2HMA A;  4M77 E;  4EMK A;  2LP5 A;  2H8H A;  1IZ6 A;  1TXQ A;  2NUP B;  3PTA A;  1QVF S;  1MND A;  3M4G A;  1PG5 B;  1V29 B;  2K3B A;  4KBM B;  4KH1 B;  2DAQ A;  1Y07 A;  3CBO A;  4GLK A;  1JRI A;  3CCV A;  1SHG A;  2EKO A;  3KUF A;  4XTZ A;  2AK5 A;  3L2Q A;  4RTT A;  3OYK A;  1IB8 A;  1CSK A;  2ZAE A;  2X9H A;  2EJG A;  4PJO G;  5GAN g;  3CCM A;  2FPF A;  3I55 A;  1N5Z A;  4FSX A;  2PVO B;  2L5Q A;  4XTV A;  2PVD B;  3ZBD A;  3G6E A;  2O01 E;  4AG2 C;  1Y96 A;  3QUI A;  2K3Y A;  4LDU A;  2VVK A;  2GTJ A;  2J6O A;  1VUB A;  4XK8 E;  2E4H A;  1OPL A;  1AOJ A;  1UB4 A;  2DD4 A;  1WHG A;  1WLP B;  4EDU A;  3SDZ A;  1VYT A;  1VQK Q;  3N5B B;  2QA4 Q;  1O9S A;  1VQ6 T;  4JPB W;  3JB9 I;  4RTV A;  2GTO A;  5GMK i;  5LJ3 e;  2CS7 A;  3EGX B;  2FZC B;  2MAM A;  4DEY A;  2COW A;  4MZT A;  2NWM A;  2FO0 A;  3FIF A;  1B07 A;  2VC8 A;  3EGU A;  3M0U A;  4Z88 A;  1C1A A;  2KR3 A;  2XDP A;  3CCQ T;  1YJN A;  2BE9 B;  2R57 A;  3MHX A;  1D09 B;  1WIE A;  4A4K A;  1G3W A;  5GAN d;  4A4H A;  1W2B A;  3OBW A;  4N4G A;  3S6W A;  2F2W A;  3RER A;  3NTK A;  2HBW A;  2KYM A;  5GAO m;  5GJV B;  4C0D B;  1I81 A;  2E5K A;  1UG1 A;  2RI5 A;  1VQO Q;  3PNW C;  3MEU A;  4J6X A;  1OX8 A;  2IG0 A;  2E41 A;  4R56 A;  3OB9 A;  2EVR A;  1ZA1 B;  4OMF B;  1K9M R;  1Q95 G;  3RKX A;  4E2F B;  2EYX A;  2LVM A;  2V8I A;  1G8X A;  1IGU A;  4PJO E;  2HL5 C;  2CZ7 B;  1YJW T;  2DTO A;  1N9R A;  4C5I A;  1VQL Q;  2PVG B;  1M3C A;  4X34 A;  3M58 A;  2OTL Q;  1T0H A;  2R58 A;  2RB6 A;  3QYG B;  4M7D A;  1SG5 A;  5DLQ E;  2XHC A;  3CPW S;  2JS2 A;  3LWH A;  2PNI A;  3VS1 A;  3RES A;  3G1J A;  3QZ9 B;  2DM1 A;  1SSH A;  2M0O A;  1VQP Q;  1D0Y A;  4HVV A;  3EFO B;  3C4S A;  3VS0 A;  3REA B;  5GAN 5;  1UGQ B;  3UWN A;  2E64 A;  4FYV B;  4LDX A;  3G7Z A;  4XU2 A;  2EYQ A;  2CKK A;  2NLU A;  3F70 A;  5LL6 S;  4C92 B;  4CI0 C;  2DVJ A;  1YNZ A;  1HK9 A;  3R6N A;  2RN8 A;  3JRZ A;  5IN1 A;  3NPF A;  2EYW A;  2H3J A;  1VQN Q;  4WCI A;  1NLO C;  3SD4 A;  5HK0 A;  1Q81 R;  5GAO p;  2CT3 A;  2AKK A;  2PQW A;  2DYI A;  1NJI R;  1T0J A;  2CP3 A;  1FMV A;  2MPX C;  4HT8 A;  3TU4 K;  5GAM j;  5LJ5 e;  4WTO B;  4RTW A;  2PUK B;  2MI6 A;  1G3T A;  1PD0 A;  5GAM g;  1U3O A;  4M77 F;  1BI2 A;  3S3N A;  2JM8 A;  2HQE A;  4PJN A;  4ZTJ A;  2B86 A;  1RAA B;  2LCL A;  4M7D E;  4E7K A;  3CC4 T;  2PUO B;  1I5O B;  1W4S A;  2G6F X;  5L8R E;  2RHY A;  2EPD A;  2DYB A;  1BI1 A;  1TS9 A;  3INZ A;  2QTV A;  3CPW A;  3JB9 J;  4HVU A;  2W0Z A;  3J80 E;  1B34 B;  3O5Z A;  3H0F A;  4A53 A;  1Q82 U;  1BB9 A;  1WHK A;  4PFO A;  1CKB A;  3QHS A;  4JS5 A;  3JCM d;  2K3X A;  4JZ3 A;  4UC4 A;  4D8D A;  1Z9Z A;  2Y4X A;  4HT9 A;  1YJN T;  2DO3 A;  1WHJ A;  2NUZ A;  1JB0 E;  3OW2 S;  3SWN C;  2RQR A;  2CSI A;  2F69 A;  3CCE Q;  2A36 A;  4FW1 A;  3EG2 A;  2AT1 B;  4L6V 5;  3WXM B;  1FMW A;  2ZPB B;  4RTY A;  4C92 G;  3RMS A;  1Q7Y U;  3MP1 A;  1Y7X A;  4ZGJ B;  1U5S A;  3OYN A;  2KSS A;  5FRO A;  1R77 A;  4JJD A;  3EH2 A;  3A8L B;  3OYY A;  1IXD A;  2ROL A;  2KT1 A;  1VQ9 T;  1N27 A;  4XAX B;  1MGQ A;  2VV5 A;  1KG1 A;  2JTM A;  3CCQ A;  1WPY A;  1YJW A;  2OX7 A;  4HXJ A;  5GAN 6;  2KYB A;  4M78 F;  3MEW A;  1M1K U;  4M7A G;  5IHN A;  2RHU A;  3ZEH A;  1YJ9 A;  2M1H A;  3HTR A;  1GBQ A;  2FRY A;  2DMO A;  4XQ3 A;  2CP7 A;  2MMP A;  1Q86 C;  2DX1 A;  2VYT A;  4OVA A;  1JBM A;  4YTL A;  5KYY A;  2MF2 A;  2K6D A;  1QKW A;  4BE1 A;  1JU5 C;  4OB1 B;  2E6N A;  1QVG S;  1F1B B;  3M0T A;  3GOX A;  2A08 A;  2NYS A;  3WVE B;  1VQK T;  4PJM A;  1PKT A;  2A28 A;  2C0I A;  1S1N A;  4N4H A;  1W2B S;  2O2O A;  4NOY A;  2FYK A;  3E19 A;  2GFU A;  4QQD A;  5KYX A;  4ANJ A;  2LZ6 B;  3LGL A;  4IIM A;  1NJI U;  2CP0 A;  1VQP T;  1VQO A;  1JXO A;  2HDA A;  3QZ5 B;  4OGE A;  5KH6 A;  4IUP A;  1VQM T;  4OB2 B;  1Y96 B;  4BAC A;  4D8K A;  3UDC A;  2YUN A;  2QG9 B;  3BDU A;  4M78 G;  3H0H A;  2J7I A;  1YJN Q;  2A0F B;  3I5S A;  2XIC A;  1AWX A;  2FRW A;  3H9N A;  1M3B A;  2GF7 A;  3A1P A;  1TTH B;  3P8H A;  1QVF P;  2D0N A;  3SFM A;  3LWI A;  2MIO A;  4FIB A;  4M78 A;  3P8B B;  3L2W A;  2R5M A;  4HKE A;  1K73 C;  4F7U B;  3SWN B;  1D1A A;  3CME A;  1WFW A;  1VQM Q;  1ACM B;  3MEV A;  3MP6 A;  2DVE A;  4ZN1 A;  5LJ5 d;  1ZBX A;  2KNB B;  1WNL A;  1M8M A;  1VQP A;  2CSQ A;  2LQN A;  1K76 A;  1M8V A;  3HRT A;  3G71 A;  1Y0M A;  3OY9 A;  4XTW A;  1YHQ Q;  3CCL A;  1D3B A;  5D6Y A;  5GAO l;  3RKW A;  1WHM A;  4PK4 A;  2WSF E;  3HFO A;  2KMT A;  4M7A E;  2I0N A;  1XNI A;  3CBP A;  3JAM E;  1I0C A;  1PNJ A;  2VKN A;  2HAX A;  3CCR A;  1G83 A;  1PC0 A;  2E6Z A;  2KI7 A;  2AHJ B;  4RTU A;  4C0Z A;  2K9G A;  1WI7 A;  4LD6 A;  5J39 A;  2D9T A;  2G3R A;  3RR6 A;  2LX7 A;  3JSC A;  1LVK A;  4DBR A;  1H92 A;  3PMI A;  1YIJ T;  4EIK A;  5J26 A;  4XU0 A;  2M0Y A;  4C92 E;  5KCH A;  5FU6 B;  4AT1 B;  1DJ7 B;  4AMC A;  2E70 A;  1Q82 C;  5A0L A;  3UAT A;  4OP0 A;  3HL8 A;  4M75 B;  1BBZ A;  3QXE B;  2YDL A;  3CCL T;  2K5L A;  1ABQ A;  2O31 A;  4ZGD B;  2XID A;  4C8Q G; 
#chains in the Genus database with same CATH homology
 1LCK A;  2EQI A;  3M0S A;  4JPB W;  2LMJ A;  3EHR A;  4RTV A;  2GTO A;  3UA7 A;  2KRM A;  3PE0 A;  3I35 A;  1UJ0 A;  4DEY A;  1AWJ A;  1HJD A;  2NWM A;  2IIM A;  2FO0 A;  2V1R A;  1B07 A;  1UEC A;  1RLP C;  1K0S A;  2X3W D;  3EGU A;  3M0U A;  4Z88 A;  2KR3 A;  1KJW A;  1WIE A;  2EGC A;  1I1J A;  2KRN A;  2F2W A;  1ZUY A;  2CRE A;  2HBW A;  2KYM A;  1NYG A;  5GJV B;  3VS4 A;  2J6F A;  4CC4 B;  2J06 A;  2RQW A;  2E5K A;  4JZ4 A;  1UG1 A;  2F2X A;  4AFZ C;  1AZG B;  2KRO A;  3LH5 A;  1ZX6 A;  1X2K A;  1E7O A;  1JEG A;  4LNP A;  1TUD A;  3C0C A;  1AWW A;  3NHN A;  2AKL A;  2EVR A;  1KFZ A;  4J9H A;  2DNU A;  2EYX A;  3IQL A;  1WYX A;  3UA6 A;  2HSP A;  1B3Q A;  2BZ8 A;  2JTE A;  1GBR A;  2JXB A;  1E6G A;  2GBQ A;  4LE9 A;  2KE9 A;  1H8K A;  5IHK A;  1RI9 A;  1HSQ A;  2KT8 A;  2JS0 A;  2ENM A;  2KXC A;  1M3C A;  1GFC A;  4JJB A;  1T0H A;  2DL8 A;  2L3Q A;  2EYZ A;  1UJY A;  5L23 A;  1SPK A;  2RNA A;  3QWY A;  2YSQ A;  5EC7 A;  1UFF A;  2JT4 A;  2JS2 A;  2F2V A;  4Z8A A;  3SHW A;  1K4U S;  3M0Q A;  1UUE A;  1ZUK A;  4A63 B;  1ARK A;  2PNI A;  3VS1 A;  3SEM A;  2PTK A;  1SRL A;  4M4Z A;  1SHF A;  2DM1 A;  1SSH A;  2D8H A;  4HVV A;  3VS0 A;  3REA B;  1AEY A;  3M0P A;  1W70 A;  4RTZ A;  4Z89 A;  3I5R A;  2K2M A;  2HEQ A;  2EBP A;  4ZNX A;  3THK A;  1M30 A;  1ZLM A;  1NG2 A;  2DJQ A;  1PKS A;  4OMO A;  4OMM A;  2ED0 A;  2EGE A;  1QLY A;  5HCK A;  1HD3 A;  1AD5 A;  1QCF A;  2JMC A;  1U06 A;  2DVJ A;  1YNZ A;  2YUO A;  3GBQ A;  3R6N A;  2RN8 A;  3NPF A;  2EYW A;  3QWX X;  2CUB A;  3UF4 A;  4WCI A;  1NLO C;  4HCK A;  2BZY A;  4J9I A;  2L3P A;  1MUZ A;  1IO6 A;  3VS7 A;  2CT3 A;  2AKK A;  1WXT A;  2CT4 A;  3ULR B;  1T0J A;  2ESW A;  2O9S A;  2MCN A;  1AVZ C;  2RQV A;  5IXF A;  4RTW A;  2J6K A;  1RUW A;  4OMQ A;  1XOV A;  2OI3 A;  1NEG A;  1U3O A;  1ZUU A;  2JM9 A;  2ROT A;  1A0N B;  2MOX A;  2JM8 A;  2L0A A;  1YWO A;  2LQW A;  2O9V A;  2LJ0 A;  1EFN A;  4RUG A;  1VYU A;  1X43 A;  2DL7 A;  1AWO A;  2ABL A;  5I22 A;  2B86 A;  5FWC A;  3VRY A;  3NGP A;  2DL4 A;  1ABO A;  1CKA A;  2EW3 A;  1WX6 A;  2CDT A;  3PVL A;  4FSS A;  4Y92 A;  1UDL A;  2FG0 A;  2G6F X;  2JMA A;  2RMO A;  1Y57 A;  2EGA A;  2EPD A;  2DYB A;  2LNH B;  5IXB A;  3JV3 A;  3VS2 A;  1X69 A;  4HVU A;  2W0Z A;  1VA7 A;  4R0K A;  3O5Z A;  2SEM A;  3H0F A;  2C0T A;  2DLP A;  2XMF A;  3CQT A;  1BB9 A;  1OPK A;  1CKB A;  1JQQ A;  3NMZ C;  4LUD A;  3RBB B;  2DF6 A;  4JZ3 A;  1JXM A;  1T3L A;  4AFS C;  4D8D A;  1Z9Z A;  2W10 A;  1X2Q A;  2RPN A;  2NUZ A;  2BTT A;  2RQR A;  1WXU A;  4J9E A;  2CSI A;  4OML A;  2KBT A;  1T3S A;  2GGR A;  4J9D A;  4OMN A;  1ZSG A;  2A36 A;  2KEA A;  1GFD A;  4CC3 A;  3EG2 A;  1WDX A;  1NYF A;  5ECA A;  3EG3 A;  1OV3 A;  4RTY A;  2DBK A;  2K7A A;  2YUQ A;  2KXD A;  2RQU A;  1U5S A;  1QWE A;  4DEX A;  1NEB A;  1TUC A;  4JJD A;  3FJ5 A;  4F14 A;  2X3X D;  2ROL A;  2KT1 A;  1MV3 A;  2DL5 A;  2DA9 A;  2RQT A;  1QKX A;  3VS3 A;  3EG1 A;  3H0I A;  2CH4 W;  1NLP C;  4HXJ A;  2KYB A;  5IHI A;  1YCS B;  2D8J A;  4K11 A;  5IHN A;  2DBM A;  4F16 A;  1X6G A;  1X6B A;  1WXB A;  2LJ3 A;  1G2B A;  1GBQ A;  2FRY A;  4AFQ C;  2DMO A;  2YT6 A;  2LJ1 A;  1MV0 B;  1BU1 A;  2AZV A;  1I07 A;  1W6X A;  5GJW B;  1GCQ C;  2FPD A;  2DX1 A;  1K1Z A;  1BK2 A;  2KGT A;  2J05 A;  1UHF A;  1UGV A;  1TG0 A;  2K6D A;  1QKW A;  2KRS A;  1K0X A;  1JU5 C;  3TSZ A;  4HVW A;  3M0T A;  2EYY A;  2A08 A;  1AZE A;  1PKT A;  2A28 A;  2C0I A;  1S1N A;  4CC2 A;  2O2O A;  2YUP A;  3KFV A;  2DRM A;  4J9B A;  2DL3 A;  2O88 A;  2DIL A;  2LZ6 B;  2K79 A;  4ORZ A;  4J9G A;  1PWT A;  1WA7 A;  2AZS A;  2QDL A;  4IIM A;  1NM7 A;  1M27 C;  1YN8 A;  1JO8 A;  3VS5 A;  2L2P A;  4KRT A;  1GCQ A;  1UHC A;  1JXO A;  2HDA A;  2JW4 A;  5IH2 A;  1VYV A;  4OMP A;  3U23 A;  2FEI A;  2PZ1 A;  2VWF A;  4D8K A;  2LCS A;  1FMK A;  2YUN A;  1PRM C;  1GL5 A;  1QWF A;  3H0H A;  2J7I A;  3REB B;  2L3S A;  1KSW A;  3I5S A;  1YP5 A;  1PHT A;  2DRK A;  1AWX A;  1UTI A;  2FRW A;  1M3B A;  1ZBJ A;  1GRI A;  2GQI A;  1OOT A;  3TSW A;  2D0N A;  2CUD A;  2C0O A;  2MIO A;  4F17 A;  1YWP A;  1X27 A;  5FW9 A;  5FWB A;  1UE9 A;  1SEM A;  2EKH A;  2DE0 X;  1E6H A;  1SRM A;  4GBQ A;  4J9C A;  3EG0 A;  2CH4 A;  2OJ2 A;  3TVT A;  1WFW A;  2RF0 A;  4IIO A;  4JJC A;  4LN2 A;  2KNB B;  2ED1 A;  1M8M A;  1H3H A;  3I9Q A;  2BZX A;  3M0R A;  2CSQ A;  2LQN A;  1K76 A;  1Y0M A;  2ECZ A;  2OAW A;  3A98 A;  2LP5 A;  2H8H A;  4ESR A;  3H41 A;  3VRZ A;  4RTX A;  1K9A A;  1KIK A;  2I0N A;  2K3B A;  5I11 A;  2M51 A;  1J3T A;  2GNC A;  1I0C A;  1PNJ A;  2VKN A;  1SHG A;  4AFU C;  1G83 A;  3VS6 A;  3PVQ A;  1V1C A;  2AK5 A;  4RTT A;  4RTU A;  4CC7 A;  1CSK A;  2K9G A;  1WI7 A;  2FPF A;  2LX7 A;  1OEB A;  1H92 A;  2D1X A;  2HCK A;  2FPE A;  1N5Z A;  3ZL7 C;  4EIK A;  4X1V A;  2M0Y A;  2P4R A;  2SRC A;  2A37 A;  2V1Q A;  4AG2 C;  1GCP A;  1RLQ C;  4QT7 A;  3UAT A;  1FYN A;  1M3A A;  2VVK A;  2GTJ A;  2J6O A;  3EHQ A;  4AG1 C;  1BBZ A;  1W1F A;  2YDL A;  4E6R A;  1OPL A;  1AOJ A;  1ABQ A;  2O31 A;  4J9F A;  3RNJ A;  1WLP B;  1Z9Q A;  1PRL C;  4GLM A;  4LUE A;  1VYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...