4FTWA

Crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
IMTRKLTFGRRGAAPGEATSLVVFLHGYGADGADLLGLAEPLAPHLPGTAFVAPDAPEPCRACGFGFQWFPIPWLDGSSETAAAEGMAAAARDLDAFHDERLAEEGLPPEALALVGFSQGTMMALHVAPRRAEEIAGIVGFSGRLLAPERLAEEARSKPPVLLVHGDADPVVPFADMSLAGEALAEAGFTTYGHVMKGTGHGIAPDGLSVALAFLKERLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enhanced enantioselectivity of a carboxyl esterase from Rhodobacter sphaeroides by directed evolution.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Hydrolase
molecule keywords Phospholipase/Carboxylesterase
total genus 71
structure length 220
sequence length 220
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ftwA00
1XQXA 2H1IA 3LP5A 1VA5A 4A16A 4X3CA 3I2GA 3HC7A 4KE8A 3IUQA 5DNWA 2QVBA 1X2EA 1K63A 2VJBA 3DL4A 4J3JA 4QDTA 3STXA 1RP1A 2P8SA 1VXRA 4IQ4A 1ODCA 1CEXA 1Q0ZA 4BC0A 2ZSHA 3L1JA 3O4IA 4P92A 5HFNA 1L7RA 1IZ8A 2ZJ7A 5FOQA 1CUFA 2PM8A 4QDOA 2BGNA 4FDMA 5CURA 1QO9A 2QR5A 3EBLA 4QLOA 5HF5A 5DTJA 1IUNA 1XQWA 1UOOA 1WOMA 3H18A 3ZPXA 4EA6A 1CVLA 1LPPA 4PV7A 3WK7A 3WL8A 2VA9A 1WB6A 4IH1A 2WU4A 4Y2QA 3D2BA 4Y2TA 1ZGCA 4J0DA 5ALNA 2FUKA 2BFNA 2XUPA 1DWOA 2I78A 4L3WA 4QNNA 2OCKA 3G0GA 5DYWA 2JGLA 1KU6A 5JAUA 1F0PA 4OSEA 4TGLA 2G4LA 3ILSA 3VISA 2WG0A 2VF2A 3VVLA 1UK9A 3OURA 1F8UA 2HA2A 1Y7IA 4BE9A 2WHPA 2PX6A 1EK2A 2PU7A 4I4CA 5I9IA 4G1FA 1E89A 4U2GA 1WM1A 5AK4A 3HEAA 2QUAA 3F9CA 5JD6A 4BB0A 3WMRA 3F96A 3D5EA 1YAHA 4X92A 4KAJA 4BC1A 3WWDA 5KBYA 5AKHA 2GYUA 5K3DA 4BVKA 5E4TA 1J06A 5KWIA 4YX9A 4J0JA 5IVDA 1AURA 1FFDA 1EDDA 3MUNA 4H0CA 1YSCA 5JAOA 4EHBA 2HA0A 3DLTA 2JGFA 4DLNA 1T2NA 5AKEA 2X76A 5AOCA 4FBLA 3K2IA 3QPCA 5AI6A 1XZBA 3K6KA 3R41A 2J4CA 3A70A 3FOBA 2XUFA 4XVCA 2OPHA 3WJ2A 2OGZA 3C45A 3KWFA 2FX5A 4X85A 2D0DA 3QVMA 1H2YA 5LLSA 1YR2A 2WTMA 4GBGA 2XI4A 2XQIA 1XRNA 2WIDA 5FLKA 1CUVA 4X97A 1XFDA 5CT8A 1P0QA 5FPPA 2DHDA 1BEEA 5FKJA 3V48A 4WY8A 1L7QA 5EIAA 2OCIA 1OCEA 4YK7A 4FWBA 2QRUA 3WI7A 4LYEA 4Y2YA 1IUPA 3SK0A 3I28A 1EVEA 1ZD3A 1TRHA 4DNFA 2B20A 4Y7DA 3ICWA 5AI0A 1P0IA 3QZUA 5IVHA 4CFSA 1E8DA 1A8UA 1WPXA 2O2HA 2QJWA 4G9GA 5HCUA 2VJDA 3G8YA 5HF6A 3A6ZA 5AI9A 5DWDA 4J7AA 3T52A 1MNQA 1CUDA 2GYWA 2VT7A 3LLCA 2PSEA 4H7FA 1FFCA 1YB7A 1EXWA 2EDCA 3SX4A 2CMFA 3STTA 3FYUB 2XQJA 1VKHA 1XLVA 3F8SA 4UFPA 4QLAA 4UHDA 1R9NA 2JGKA 4AO6A 2J3QA 2OGSA 3M81A 5I8PA 5ALYA 4LHEA 1B41A 3H19A 2CJPA 2VJCA 2HIHA 4OB7A 4J0KA 3O4HA 2PSDA 1LBSA 1EDEA 4QA9A 3IUNA 2YXPX 4AO7A 4U2FA 1AC5A 1QFSA 1VLQA 5K3CA 4B7ZA 2H7CA 3O9MA 1Q83A 1K8QA 3DEAA 4C01A 4UHCA 2JBWA 1JJIA 1UFOA 2XMCA 5CMLA 1XQVA 3WLAA 5AM1A 3QPDA 1VOTA 4G4GA 3AFIA 3KWJA 3WK5A 2DHCA 2YH2A 2XUKA 5CW2A 1LZKA 4YPVA 2JEYA 4H7HA 4XX1A 3C6YA 1NX9A 3EF3A 4PQEA 3H2KA 5EHZA 4HVTA 5AK6A 2OCLA 1VA4A 2W6CX 3B3QA 4ZXFA 3D7RA 4NMWA 4Q1VA 4C4XA 5JYCA 2IITA 5AOBA 5LZ5A 3WWCA 3H0CA 4H7DA 4QEKA 1ZI6A 1QIHA 4M0EA 3FSGA 5C8XA 4DNPA 5AICA 1JJFA 1N8SA 3H2JA 2WQZA 1KU0A 3C8DA 3ED1A 4UHBA 4X95A 1K6EA 2XQFA 3RLIA 1UK8A 5JAPA 2GZRA 3V1LA 1MX9A 4OPMA 1Z68A 2XDWA 3IULA 5JIBA 4I3FA 3EQ9A 4JNCA 1CUAA 3E4DA 4KE7A 5ALZA 2O2GA 4INZA 5J3JA 2PBLA 4W1PA 3PFBA 1QJ4A 3QMWA 2XUAA 4MJ3A 1P0PA 1R88A 4PNZA 4BTVA 3C43A 2QS9A 4BP9A 1R9MA 4KR0A 4MWTA 4LIPD 5JZSA 1QIJA 5ALWA 1SFRA 1MU0A 7YASA 3WA6A 2H7XA 4NS4A 4Q3OA 4KYVA 5E4YA 4K5QA 2V9ZA 4RGYA 4DMFA 5LZ2A 1TKRA 3F98A 1O6FA 3R3WA 5HZGA 3GELA 1T4MA 4HAIA 4JYMA 5LP1A 3HXKA 5LIPA 2ACEA 4WFJA 1KEZA 2WIJA 2XE4A 4QDZA 3W9UA 1GPNA 2Z8ZA 4Y2VA 1H2WA 2G5TA 5E2IA 3OPMA 3DS8A 2BKLA 1VXOA 3KXPA 1MX5A 4Y2XA 1OILA 2HA6A 1XZGA 1ORVA 2WIGA 1XQYA 2Z5GA 2XMDA 3HACA 1VE6A 1XRLA 1CUHA 4FLFA 2Y6VA 3H1AA 4NZZA 4HRXA 4GLBA 1A88A 2WJ4A 5DYTA 3B5EA 4UPDA 5HF8A 3UUEA 1WCYA 1FSSA 1BRTA 4PW0A 2PL5A 3CXUA 2C7BA 2QM0A 1THTA 4D9JA 2AJ8A 4U2EA 2JIDA 4C87A 3Q0TA 1GXSA 2VSQA 2HFJA 1DX4A 2OAEA 1ZI9A 3KD2A 1USWA 2YASA 1UKAA 4AZ3A 2E3JA 2DCMA 2ZYSA 1FFEA 1GPLA 2UZ0A 3GBSA 2VEOA 2RIPA 4BZWA 5EIEA 1BEZA 4OU4A 4X00A 4S0XA 5AIBA 3R3UA 1GPKA 4MYSA 1GQRA 1CUJA 3M3DA 5EI5A 5AIAA 3AILA 3PUHA 3WZMA 4EY6A 5HF9A 1LNSA 3A2MA 1MAHA 1E3QA 2I3DA 3I1IA 1F0NA 2ROQA 1RWQA 4OYYA 3V1MA 4ZI5A 3DYIA 4DMCA 1CPYA 3IURA 3WIBA 1S8OA 2WG2A 4Y9SA 5FRDA 4UHFA 2VTVA 2PPLA 5DNVA 4AMYA 5ALUA 1HQDA 5C7YA 1UZAA 1SOMA 3G0CA 3HRHA 5BV7A 3H2HA 5D6OA 1N1MA 2XUOA 2Z8XA 1DT5A 3WWEA 5EHQA 1EVQA 3F97A 5LZ4A 4H7KA 3G9ZA 1TCAA 1R50A 1XKLA 1VZ2A 1JU3A 1ZD4A 2ES4A 2O7VA 4C6HA 3FBWA 5SYMA 4ETWA 3WK4A 2HU7A 3FAKA 5AJHA 1A8QA 3L1HA 4WDRA 2DQZA 4L0CA 4Y2JA 1U65A 4P93A 3WIOA 4ARBA 1CUWA 2G63A 2WTNA 5HKAA 1U8EA 4CIAA 1SC9A 3HLKA 3DCNA 2HA4A 1EB9A 5T4BA 2QOEA 4UFNA 4X7BA 4ZV7A 1PJAA 1W1IA 4BATA 1TCCA 3K9BA 4HRYA 4N5IX 5DNUA 3BE8A 2Z3WA 2DR0A 1ZJ5A 1J1IA 1CQWA 5LKAA 1CUYA 1U4NA 4H77A 5AKJA 5ALQA 1DWQA 2HHAA 4W1RA 5ALTA 1LPOA 3DD5A 4DIUA 1Y7HA 4H7EA 1W6RA 3UUFA 2R11A 4BVLA 1EHYA 2O7RA 1QIIA 2CBGA 1J07A 1JKMA 1CV2A 1SCIA 4B82A 3NOXA 2PSJA 1IUOA 2OLEA 4X6UA 5ISMA 4C4ZA 4BTLA 1YA8A 2C5FA 1TK3A 5FUMA 4BCCA 3WKCA 4DMKA 3U0VA 4EZIA 4P9NA 3YASA 3WQHA 4B0PA 3WYNA 3BF7A 4HZGA 4MQMA 2FJ0A 3O4GA 5ALEA 1QIKA 3R3XA 5EHXA 1JMKC 5E4JA 3QBJA 3NGMA 5ALLA 2ZJ6A 5JD4A 4ZRDA 2IIVA 3VJMA 1MT3A 4X90A 4B83A 3T4UA 4TVKA 4BP8A 2V98A 1ISPA 1UXOA 1AUOA 4ZGBA 1DU4A 1C4XA 4ZWNA 3RKSA 4EY5A 3E3AA 3EQ8A 1FFAA 3CN9A 2QT9A 1DWPA 3DNMA 3O9VA 5JAHA 5K3AA 5F4ZA 1YB6A 5AHXA 2Z3ZA 4XIIA 2V96A 5HK8A 4PO3X 4Q3KA 5K3FB 4KAFA 3BJRA 1GKLA 3C87A 1XZIA 5K3BA 5ALPA 2WHRA 4P08A 5CTAA 4JYPA 1EINA 1JMYA 3LCRA 4X91A 3W06A 3E1GA 4QWMA 1G42A 2O2IA 4KRXA 5EIHA 3D3NA 3PFCA 4EB0A 4V2IA 3I6YA 3GFFA 2RHTA 3IUMA 4L9AA 3OM8A 4HXEB 3R3ZA 4CCYA 2DHEA 6YASA 3AZPA 3BWXA 3G02A 4B80A 1QTRA 3SWWA 5EFZA 3TRDA 1JT2A 3RARA 3PF9A 2PKYX 4PSDA 3WKEA 5T4HA 2OCGA 1CRLA 2GBIA 1D07A 3RK4A 3FYUC 4AX4A 4HTAA 4W1QA 1AZWA 5EHNA 1LPBB 2VT6A 3D4LA 4GEGA 1F6WA 3AIKA 3V9AA 4BRSA 2HDWA 5CT4A 3LS2A 3H04A 1C7JA 5JALA 2XUQA 5KWJA 2X5XA 2JGJA 3QMVA 3VJKA 4Q3LA 3I2IA 5ALVA 5ALRA 5CH5A 2XQGA 2HRRA 2H9YA 4UBKA 3N2ZB 2AJLI 1YCDA 3JWEA 4MQLA 4ITVA 4DGQA 1LZLA 3LIIA 2WFZA 2BUAA 3G9UA 2PSHA 1XROA 2BUCA 3WK8A 3ESDA 4WFKA 3WKBA 3PI6A 3WK6A 3W04A 1CUCA 2XB6A 1BROA 3BXPA 1H22A 2NW6A 2XUDA 3OOSA 4Q34A 1YASA 2WILA 2GBGA 3ESAA 4CCYB 2ORYA 1G5FA 3IIIA 5A6VA 5AOAA 4CIBA 3W05A 2WUGA 1XZJA 1CUIA 2QMQA 1EX9A 4UBLA 4UBJA 2XT0A 5C8ZA 1DQZA 3SC2A 4FNGA 1UOPA 4K6HA 3QM1A 1XZHA 1CQZA 1H23A 3GROA 4AB1A 1QO7A 3HJUA 1WB5A 1EA5A 3H2IA 1MPXA 3DL7A 3M82A 3E0XA 4DYHA 4IH4A 4UBMA 2DFPA 2WSLA 1MO2A 1HDEA 3KDAA 5AKGA 1JU4A 1WHSA 1M33A 4BDSA 3W9BA 4X6XA 4DM7A 3FYTA 4W9RA 1DTEA 1OXMA 5ALMA 1BS9A 1QTIA 2HU8A 1ZD5A 4Q05A 4X6YA 2RAUA 3O95A 1GQSA 5A7HA 2R8BA 3STUA 2B61A 5EGNA 5CT5A 2HRQA 1QIFA 3WL6A 4N8DA 2Q0XA 4KRYA 5ALOA 1ACJA 4DNOA 4B6GA 3QITA 2Y1KA 4UBNA 2XUGA 1G4HA 4BAZA 2HL6A 3R0VA 3R40A 3CCCA 4OU5A 2QTBA 2HADA 2RI6A 1QIDA 2VAXA 5JZ9A 4LXGA 1BE0A 2CEKA 3G0DA 1AGYA 5AK3A 1AKNA 1TAHA 2AJCA 4CCWA 4UUQA 5ALXA 5JZBA 3QMMA 3I1YA 4FMPA 5JADA 3IBTA 4FFWA 1CUXA 2IX9A 3MVEA 3TEJA 3KSRA 1YS1X 4K6GA 5K3EA 4J0CA 4LXHA 3DKKA 2G5PA 2XMRA 1MNAA 2VJAA 1HKHA 3F67A 3OG9A 2XUIA 4GW3A 4UHEA 1LPNA 2C0QA 2OGTA 5D3ZA 4LKOA 2BUBA 3TGLA 2LIPA 3GUUA 5HFAA 1J2EA 1H2ZA 2PUHA 3GZJA 4HXGA 4XWGA 5IKXA 3AZOA 4BRZA 4AZ0A 2OAGA 5ALKA 2CKMA 5A7FA 4BCDA 5D3KA 3DQZA 3KOOA 1H2XA 3FLBA 3MUOA 4UBOA 4G4JA 3WKAA 3G9XA 4E14A 1QZ3A 2GZSA 1X2BA 3IA2A 1YA4A 1U2EA 2XMZA 3ZI7A 3U1TA 1CR6A 4F5ZA 4BAGA 5C8VA 2DSNA 1PFQA 4BCBA 2HM7A 3PF8A 2EDAA 3HYSA 1EH5A 1XRRA 5JARA 3PICA 4G5XA 1N5MA 5FPQA 1W75A 3NWOA 3QYJA 5ALDA 3IDAA 4ARAA 1WB4A 4MEAA 2WG1A 2EEPA 4WDQA 5IVKA 1XZFA 1QIEA 2WU3A 3CN7A 2WHQA 4Z49A 1NU8A 3B12A 3FWHA 2I03A 2WHPB 1G66A 2XLCA 4PF1A 3V1NA 1LPMA 3R3VA 1A7UA 2QKYA 1FFBA 3BF8A 1R3DA 4CI9A 3ICVA 4E11A 4GDMA 3WWOA 3ZLTA 2HA3A 1Q84A 1MN6A 1BN6A 4KEAA 3GA7A 1IVYA 1YS2X 2WUDA 3MGAA 3P2MA 5A71A 4H7IA 4DNQA 5JANA 5ALGA 4HS9A 4AXBA 4JUIA 5CRIA 1FJ2A 1EI9A 3H1BA 4H7JA 1W52X 3DDUA 4G8DA 5AKYA 1JJBA 5LZ7A 3FVRA 5ALSA 3S8YA 5AM4A 1EDBA 3FVTA 4IHAA 4EY8A 1VE7A 4X93A 5AH0A 2ACKA 5CXXA 1HLGA 4N5HX 2WM2A 4QE3A 1AX9A 1ODSA 1QOZA 2OQIA 3CCBA 1E8MA 1LGYA 3WL7A 3H17A 5AI5A 4KAAA 3BIWA 3X3HA 3WWPA 1ZI8A 2VQ6A 5AKXA 2OQVA 4BVJA 4AN0A 1CFJA 2QUBA 4GXNA 2BJHA 1DX6A 3I2JA 3C70A 3WJ1A 5IVIA 3FNBA 4ZREA 2PSFA 4H35A 1QGED 4X94A 3BIXA 5BOVA 3UMJA 1ZIYA 4U2CA 4B9AA 4QDUA 2AXEA 4U2DA 1E8NA 5A7GA 2WLSA 3L1IA 3ANSA 2CB9A 4YASA 2GYVA 1K5PA 4GHWA 1GGVA 4AMZA 1L7AA 2JGEA 2OG1A 3D2CA 5DTIA 1XZLA 4F21A 2XUHA 2ZSIA 3STVA 3AZQA 4PSCA 2H7YA 1UWCA 1ETHA 2WFLB 1WPRA 5LZ8A 5K5EA 4UHHA 5HKBA 3VDXA 4Y2PA 2DQYA 1VZ3A 4KE9A 3D2AA 3C6ZA 2QJRA 4N8SA 5T4FA 2XUJA 1XZAA 5D7BA 4EY4A 5FXMA 4J0HA 1CUSA 4RPCA 2ZJFA 4GI1A 4PSUA 4A23A 4G4IA 2ZVDA 5ALFA 4Q82A 1UKBA 2XQKA 5AP9A 4FNMA 2Y2UA 1LLFA 5KREA 5FP0A 1X70A 2HFKA 4G8BA 3DOHA 4Y2RA 3EQ7A 3BDVA 4FKBA 4JEIA 4K6KA 5ALIA 3QPAA 2VATA 1ORWA 3FCXA 4WJLA 4UBIA 2WJ3A 1GKKA 3ZWQA 2C0PA 1ZICA 1ACLA 3D0KA 3ANTA 1QONA 1DINA 2XMQA 3DYVA 1IZ7A 1N5RA 4B84A 4DSZA 2J3DA 2J4FA 3WZLA 3I6MA 1CUEA 1P0MA 2WFMA 1MJ5A 1ZD2P 3G0IA 5AM0A 4CG1A 3G7NA 1K4YA 4ROTA 5A2GA 1EB8A 4G9EA 2CUTA 3I2FA 5LZ9A 3BJMA 2WUEA 1XLUA 1ZOIA 4MYDA 3C5WP 3FLEA 3WA7A 3AINA 4KACA 4OD0A 5HK9A 3DOIA 1MAAA 1ODTC 4MWSA 3G0BA 4CG2A 3WYDA 2C58A 4N8EA 1ZIXA 2ECFA 1TCBA 3VVMA 4FLEA 4Y2UA 1CLEA 5DYYA 4FFVA 1XZDA 2FJPA 5CT6A 5AKIA 1IMJA 5JD5A 5AM2A 1UKCA 2JEZA 1E66A 3DKRA 4OB6A 5ALHA 1AMNA 1BCSA 4BYMA 2VAVA 1LPSA 2BAGA 5BWBA 4E15A 1Q0RA 2X8BA 4QZVA 3C8HA 3AIOA 4I19A 1I6WA 1XKTA 5I7UA 4O08A 3N0TA 1TQHA 3HSSA 2B4KA 3STWA 5ALJA 3RM3A 1GT6A 5T4EA 3ZV7A 1TIBA 3DJYA 4HXFB 3FLAA 3BDIA 1XRPA 4B81A 5H3HA 4LXIA 5HQ3A 3WKDA 1PV1A 1HPLA 4A5SA 3I2KA 4C89A 2BCEA 3OC0A 2XMBA 3PE6A 1BCRA 3TJMA 5CT9A 5FV4A 1THGA 2Y2VA 1QIMA 5YASA 1CUGA 1EK1A 1MX1A 4H18A 5CXUA 4B9EA 4AN1A 5LKRA 2QXTA 5AO9A 3WK9A 2GBFA 4B85A 3I2HA 5AK5A 3S2ZA 2B9VA 3I6ZA 1B6GA 2JGIA 3C5VA 3WL5A 1BN7A 1XZMA 4FBMA 4W1SA 4FLMA 1XRQA 4NVRA 2XMGA 2CZQA 3QH4A 1NU6A 3ESBA 5HQ3B 1XZKA 3A2NA 3W2TA 2I3ZA 1Y37A 4ZV9A 2RGUA 2BGRA 4M0MA 5AM3A 4AO8A 3C6BA 3Q8WA 2RONA 1CIJA 2JGMA 3A2LA 1R1DA 2D5LA 3AUKA 5C81A 1SCQA 2JF0A 2PU5A 5CH3A 3VJLA 3AIMA 4XJVA 4KE6A 4DSAA 5AM5A 3G9TA 3V1KA 3JW8A 1CUBA 4IO0A 2PVSA 2XLBA 3D59A 4FTWA 2XMSA 3EIOA 2OXEA 4DMHA 1UT6A 2ONCA 3M83A 1A8SA 2K2QB 4GWLA 3FYUA 2HA5A 5AKKA 1CUZA 4AQDA 3IB3A 5SYNA 4U2BA 3VXKA 1LPAB 2AJBA 4WCVA 4F0JA 4WY5A 1MTZA 2GBCA 3BL8A 2C4HA 2AJDA 5BWCA 1JI3A 2QXUA 4F60A 4EBBA 1YAJA 1DT3A 1CUUA 2WIFA 4G8CA 2V97A 3O4JA 4J0GA 4DTCA 3NUZA 5JATA 4W63A 3FSGD 4WFIA 1AQLA 4J0IA 4BZZA 2HU5A 3ZLUA 5DLPA 4B0OA 5AKLA 5LYYA 4EY7A 4BE4A 1DQYA 4UFOA 3IVMA 2WKWA 5CH8A 4OCZA 4BDTA 4C88A 5FDFA 5A62A 5AI8A 5CBKA 5JASA 1XZEA 4KJXA 3ESCA 2WUFA 3PUIA 2QZPA 4CG3A 3R3YA 3LIPA 4C4YA 2C5GA 5AI4A 4BAUA 3HZOA 3HABA 4MEBA 1GZ7A 1ZJ4A 4JH0A 1R4ZA 2YYSA 4FHZA 1JFRA 1UK7A 3IUJA 4FOLA 1VJ5A 4OUKX 2ZYHA 1RYYA 1BU8A 2RHWA 4K2AA 1UK6A 1LBTA 2PUJA 2ZYRA 3OTQA 3C6XA 4BBZA 1ZGBA 1QIGA 4OB8A 2ZYIA 4X71A 4OYLA 2WIKA 1HL7A 3VKFA 4M0FA 1SCKA 3AJAA 1XRMA 1QFMA 3O0DA 3JYHA 4RNCA 1QLWA 5K3FA 3STYA 4E46A 4RE6A 1XLWA 2WJ6A 4EUSA 1W76A 3H2GA 2WFLA 3PDCA 3HI4A 1WHTA 2W22A 3ZLVA 1C7IA 4MXDA 4LYDA 5DJ5A 1E5TA 5AKZA 4RE5A 4QDXA 1W4LA 1QE3A 4IH9A 4L72A 5ESRA 1HBJA 1XZCA 1O6GA 4QWWA 4Y2SA 2HA7A 4GECA 4TPKA 5IH7A 1UOQA 3FCYA 2Y6UA 4J03A
chains in the Genus database with same CATH superfamily
2RH9B 1WD5A 2WAMA 3GARA 3MERA 4H3HB 1XQXA 4LC0A 4QBHA 1L1FA 2Y1LA 1Q16A 3QX9A 1VC2A 3TL2A 2OBBA 4RF5A 4X3CA 1KBQA 2VHUA 2DY0A 1V0JA 4LI3X 2BI7A 3R9XA 1H9CA 2R47A 1E2DA 5DNWA 4DBZA 2B6HA 3Q15C 2QVBA 2E48A 1K63A 2VJBA 3GAMA 4QDTA 2O2JA 5EXTA 4BCBA 2C2ZA 4LDQA 4NCAA 2A0YA 3B1VA 3UCFA 1GUBA 1VXRA 2ZAOA 2NWQA 4YRLA 2XE8A 3MT7A 3H9JA 1MD9A 1KMNA 3WQBA 1AGXA 2PL1A 1TO1E 3AHJA 4KUEA 4LZZA 4YJFA 3MT8A 3IPCA 3NYIA 1ZW1A 3R20A 1CDZA 1E9VA 2J3EA 1I9GA 3FWNA 4ZPXA 3ZZMA 2JHAA 1YRLA 4NF2A 3W7AA 1OB5A 3V1YA 5JLAA 3DOCA 1PU2A 2QRVA 1GZ3A 3FFTA 5NULA 1H4QA 3QNUA 4E5VA 3LFHA 1VSVA 1KSJA 5JCOA 1WMAA 2ZJ7A 4ZD6A 1UP6A 3O91A 5TVKA 1RC0A 1GEEA 1CUFA 3S2YA 3RRZA 2HTEA 1HSOA 1Y1PA 3ER8A 3V4OA 2I1QA 1HFKA 2R8XA 3KELA 2QRLA 1MA0A 4DCGA 3CXRA 2BWJA 1RCUA 2YUIA 4LCBA 4R05A 1JVSA 4XVHA 5KYVA 2YY6A 1TADA 3TF5A 4RADA 1I5RA 4I9NA 1USGA 2X77A 4ZFNA 2F7SA 2XCSB 2C03A 1A5BB 2G8NA 2I2DA 4JKYA 5DHTA 1BC5A 2YHUA 2O2CA 5IEJA 1ZUD1 3NJ4A 4ND6A 3ENNA 2A3RA 1CVLA 3CR8A 3P9IA 5H4GA 1TPYA 2A88A 4OHVA 1KF0A 3TDMA 4F4UA 1Z5OA 3UK2A 3WK7A 3W5JA 2DBQA 5JWHA 1WSDA 3CQ9A 1ZJYA 5EY5B 1PQYA 2WU4A 3NI2A 4ZVSA 5TSDA 4Z7QB 5B5SA 4Y2TA 1A9PA 2Q2OA 1EG7A 3NHPA 3PC7A 2JCYA 2AKAB 3QWAA 4J49A 4TZKA 5ALNA 3Q9UA 4EB3A 4EH1A 2EX1A 2FUKA 4CL0A 1T3ZA 3DZBA 1YB1A 4QO7A 3VR5D 4B73A 4WXYB 1DWOA 2TRSB 3K30A 4QNNA 4HEQA 3A4VA 3G2KA 5BW5A 3UG7A 2P9EA 2JG3A 3U39A 4RPHA 2DLNA 2Y76A 3EISA 4WXRA 2L69A 1KU6A 1QXSA 3L5KA 4RTJA 2AI3A 4DQKA 5F2NA 4BJ6A 4OSEA 1WTAA 4COKA 3BXEA 3N8DA 4ETNA 1AF7A 1GPDG 4ID9A 1UXKA 1Y6RA 4GLJA 1UDCA 4K40A 2QP9X 4M53A 5HKOA 2NNWB 1Y5RA 4H31A 1Z6YA 2VF2A 3VVLA 4BE9A 1P19A 3B3JA 2WHPA 2P7IA 3HYCA 1EK2A 2HQOA 2ODWA 1GG5A 1W25A 3PGVA 2PU7A 3EEBA 2ZP1A 4QPCA 1P2BA 5I9IA 3DMHA 2QSZA 4AECA 1E89A 3PDIB 4BO7A 2IS4A 1Z5VA 1WM1A 3IEPA 1KMCA 1A95A 1XHEA 4KLZA 1QZZA 4HNAA 2C2HA 2AMFA 4OOFA 1CW2B 4RY9A 4URYR 1SCAA 4CRWB 3RADC 2FA9A 3K8ZA 1EU1A 3CX7A 3ZZNA 3I4FA 5KJFA 3FVWA 5TPZA 4P2GA 4N03A 2QUAA 4B7AA 2HSGA 3UJ7A 1AGNA 4DV4B 4P81A 4C0XA 1N6LA 4WXHA 4XLLA 3U48A 4Q18A 3IPLA 1SB8A 2LW7A 3BH6A 1ZAYA 4MKZA 1YXMA 1Z4LA 2C5LA 2QW1A 3IEUA 1WXWA 1B8UA 4MV4A 2A2ZA 4PFJA 4ZGGA 4RXTA 1YDEA 1T0IA 2X0EA 2HCBA 3D5EA 1YMQA 1QQ5A 4KAJA 3JD0A 3L7DA 3TZ6A 2Q3CA 4AYTA 2XYGA 4WBXC 4EHAA 2QPTA 1D6NA 2J32A 2EKQA 3LCUA 4YFVA 1C3VA 4KPYA 3EXHB 4ZO9A 4EEZA 3WWDA 2AF4C 3CEMA 5LP6F 1DEKA 2P62A 3NIBA 3FUVA 5AKHA 3VNVA 3A25A 2V6MA 1UBSB 3B9RA 5MFPA 4LFBB 3CPSA 4IFTA 3HVHA 4JLPA 5K3DA 3GP8A 4N48A 2HK8A 2GCOB 1N2EA 1X8JA 3EULA 4OK5A 4YJGA 1J06A 4B33A 4WBNF 5KWIA 2EGUA 4LDJA 4R71A 5IVDA 3GT7A 5EAIA 4ASUA 4GBMA 2R8OA 3T54A 4H0CA 5K8IA 2PXAA 4WN9A 2FZEA 2H07A 4XE5A 5JAOA 3UAGA 2OVBA 1NW9B 3EBPA 5F4BA 5EZ6B 3UTCA 1IWBB 1KIMA 3DLTA 2JGFA 5ARCA 3FR8A 5KCZA 1HLPA 2E4AA 3CGGA 3LAWA 1G55A 2X4LA 3U4CA 3KLBA 3ONEA 3EVFA 2CDNA 5K2MA 4DM4A 2QN6A 2CMGA 1OOEA 3K4HA 3OLQA 4LE0A 3VTZA 5JW6A 3JQBC 5IZ4A 3VR6A 1XDWA 5CLHA 3SC2B 3AERA 4RK5A 3T6KA 5H81A 2XECA 3IX7A 5H0IA 3E3MA 2W6ID 1NJSA 4DLBA 2GCOA 1PLKA 4NAUA 1PJCA 2XTZA 3PGJA 1XD8A 2A33A 4JQZA 1OWOA 2BFEA 2JFPA 2C31A 1AT1A 4RWZA 4CN8A 2BHRA 4ES6A 5KQMA 4ZYWA 2OPHA 4REQA 4L78A 1FDRA 2BMAA 3C45A 4TXJA 3WJ2A 3GN1A 5I7EA 2R8PA 1A9XB 1D7AA 2H2IA 2YMQA 3LUPA 3PDJA 5LLSA 3PQ7A 1Z07A 1J0BA 1JHUA 4A0SA 2C57A 2XI4A 2VKTA 3F3MA 1ETUA 3RTBA 1QYVA 1WQ4A 3CPHA 2OFWA 2Q0HA 3PVSA 2CXUA 2B25A 4FEGA 5FTWA 2XYHA 4BYGA 4LXUA 4IIJA 3PTLA 4X97A 4NJEA 5THKA 3QA3E 1CR4A 3R4CA 4GPD1 3PQDA 2D4HA 3C15C 4K88A 4I50F 2OPBA 1YE5A 2C96A 3H9UA 1BEEA 5FKJA 2A86A 1U9IA 1A2KC 3GU3A 3ND7A 2IEGA 4JAVC 3UBMA 1FS5A 3V6LA 2PE5A 2IDMA 3ICCA 4QGSA 2QRUA 1K86A 1T9ZA 1WCIB 2QNBA 1WOYA 2VWHA 1TYDE 2YVAA 3BCSA 3LW7A 3MB5A 3ZD6A 2VSFA 2AK2A 2J6BA 3GJ8A 2R8YA 3ZNOA 2P2YA 3H9BA 1GSHA 2D59A 2PV0A 4US0R 2AZ4A 3FTNA 5IM4A 1FLDA 3AFHA 5E6SA 2QD5A 3L7KA 3OCZA 2D1YA 1SHZA 2G1KA 2GNAA 2Z8YM 4HP8A 4JLAA 5BQFA 3FTFA 2C3PA 2XRYA 4DLKA 4EG7A 1Y82A 1EXNA 3A3YA 4DNFA 2B20A 4YUWA 5LWHA 2ZYWX 5FOXA 2QTMA 3UG6A 5AI0A 4K0KB 1T9CA 4W6QA 1TO2E 4FS3A 1M6HA 5DI9A 3ZWAA 3I30X 3NBMA 5AJUA 5EZYA 2OHXA 5EZYF 3DOJA 5BOSB 1ONBA 1C29B 1R4NB 4C43A 4JI8B 3QQPA 2FZ4A 3HEMA 3R0XA 2NQTA 1E2BA 3UMGA 4LJRA 5C53B 4WL0A 2HMAA 4GMXA 2B4AA 3RAEC 3SOZA 1LU9A 3QQ5A 1ULAA 1Y8QA 3PXAA 4HSGA 3QVUA 4UD6A 2J7KA 1O4VA 2EEZA 1U3UA 1ZITA 2O2HA 4YN3A 2QJWA 2J3JA 5IM4F 2CFTA 2FMFA 2JCXA 3FZEA 1HNXB 2NV6A 1J56A 5HRUA 1XSEA 3M3PA 2FH5B 4ZC8A 1FS6A 3C6KA 1CUDA 3SJ7A 2VK8A 1NVVR 4L95C 1DADA 2GZMA 2JAHA 1RQRA 1ZIOA 4MVJD 5JMTA 1EXWA 2EDCA 2FW6A 1OJ7A 1W0KA 3IKMB 4RF3A 1PFKA 3RG8A 2VP2A 2AG1A 3AOEA 1SZDA 4RDCA 2AWOA 2CMFA 3KZCA 3RC7A 4B3RB 3KTAA 1J0AA 2XQJA 1I32A 3AK4A 3GA5A 3WRWA 3QKRA 3F8SA 1Z5UA 1E1RA 5CA0A 3BMQA 1W2WB 3FCAA 1MG5A 1R9NA 3VPHA 2J3QA 1VBMA 3QW4B 3R9WA 1ZK2A 2GM5A 3RTGA 1L5HB 4QBIA 5I8PA 4GD3Q 4ZKDA 4RKQA 4H3SA 4DQUA 4R54A 3IV9A 4UTPA 1IDOA 4LZPA 2R6HA 3V4FA 1VLZA 2HIHA 4G8JA 4MMZB 3ZYZA 5ADVA 4EVIA 1GILA 3ZU3A 4G23A 2AJTA 3LI2A 4MV1A 3NOVA 4NJMA 2F43A 5CP8A 1EDEA 2PBRA 4QA9A 1FF9A 3A3KA 3GMTA 3QU4A 4ZJPA 5KU1A 5KCMA 3BMOA 1H0KA 2O8NA 2Q3DA 3M4NA 1Y4UA 3B51X 1XL0A 3AV0B 3DBVO 4J4TA 5ENDA 4KXXA 4RF4A 2XZLA 2Q5QA 1VLQA 2C7GA 5TF0A 2Q5EA 2XE7A 4XWWA 2RAVA 2H7CA 3O9MA 3D5TA 4LJ4A 3IV7A 4BGEA 4PGFA 4TL9A 2H5LA 1D8TA 1PGNA 4KITB 3NRBA 4C06A 2GCGA 4ILKA 3X1KA 1TD1A 1DBRA 2WF8A 2CL5A 4UHCA 4CF3A 1ECJA 4NZYA 1KMHA 2XNCA 3C8UA 2Y1CA 4HTFA 3R9IA 1O6CA 1L4NA 4BE7B 4TS1A 2EP8A 3JQAA 4O4HB 4IXWA 1E79A 4FFDA 1U94A 5JUWA 3JQFC 4LNHA 4D3FA 1T0BA 3UVEA 2B36A 2PMWB 2JJMA 1E62A 2J9XB 3CSDA 2D74A 3OHMA 1E92A 2I6UA 3VZRA 2H1OA 3KWJA 1E6LA 3ZHRA 2W6OA 5JAZA 1C50A 1G63A 2WKQA 1QG0A 2LWIA 3AJ9A 1M1XB 2J9GA 3M6WA 5ECWA 5JISA 1KAMA 1LDNA 2I1LA 2P7HA 3QOFA 1HTBA 2A1UB 2YH2A 2AFIA 2LKCA 4N40A 3ROPA 5I4KA 2ZUVA 1T9DA 4LYFA 1P9RA 3IQWA 4KXMA 2FPSA 4U9HS 4XARA 1VE3A 4Z4CA 3D7LA 4XX1A 3C6YA 1NX9A 2DFVA 3EF3A 4NBWA 3TLJA 5JDCC 2GHQA 4NBNA 3EB9A 2JH3A 2F8LA 1GPUA 4PRKA 1P5HA 4DBLC 4LXTA 4UPVA 4PYOA 1UT5A 2H1FA 4A4DA 1G6HA 4RH0A 2XWBF 3CLVA 1XMSA 4NMWA 3EDRA 4P4NA 3BL5A 4Q1VA 5AJTA 4LWQA 2Z4SA 4NFSA 3HYLA 1IE3A 1CQJA 3D4PA 3GQBB 1XQ1A 3LSTA 3EIEA 3IDZA 1PJTA 4KWTA 3MJDA 2C2YA 3MS2A 3WWCA 1KEEB 2B5OA 4IIFA 5AHKA 1Q0SA 1FZTA 5BSTA 1YKFA 1C2TA 3I9OA 1BH6A 5LQCA 1NXPA 2HRBA 1U1IA 1Y1SA 4MUBA 3SYKA 4URXR 2ZRCA 2A9OA 1KAGA 3FSRA 1WF3A 1V11B 2QD1A 4MO9A 4C07A 1KKUA 3A3NA 3E9CA 3C8DA 2WAYA 3IP8A 3ZTYA 2LPMA 4RCYA 1XP8A 4N3BA 3B82A 1RRMA 3IMFA 4I6JA 3SEAA 2BCGY 4CF5A 5KWVA 1Z4MA 2Y1FA 5HQTA 2R48A 4COOA 3U26A 4D96A 4HB0A 3M0EA 3K05A 4M2LA 3S55A 2V6IA 3GGJA 2OZVA 1ISSA 2ZSFA 1S02A 3CGWA 2XDWA 3PQ5A 4KLNA 4MGYR 3TEMA 4FB5A 4UEQA 4Q9DA 3A10A 3DDZX 3GJSA 4RUKA 1VDZA 1DHRA 2UXCB 3UA3A 3W5BA 4W1PA 2OZPA 1E2NA 5EHIA 1QJ4A 3QY9A 4D8YA 2F2TA 4EI9A 1FMJA 1VSBA 4LZLA 2YR0A 1N2CB 4OP1A 2HJ9A 5DX8A 5GM2A 4CBVA 2QIPA 3K96A 3UW1A 5JI2E 4MJ3A 3TTVA 3W5VA 1RKBA 1QF9A 1N7HA 5KHLB 1H8ED 1Y1TA 2J5BA 2YJNA 1S3SA 2ZCJA 5LOVA 2RGNA 3AHFA 4U8GA 1R88A 2C5AA 2G17A 5KWEA 2IIPA 1YR3A 4OHZA 5DMXA 3N0VA 4I1SA 1RABA 1LB1B 5FYDA 3KCQA 4BP9A 2COEA 4J3FA 2NZ8A 2X9LA 5G2OA 2OAP1 2X9VA 1RCTE 4MWTA 4WLUA 4LIPD 1KWGA 2CHVA 3DGEC 4CUJA 4LNUB 4FGLA 4QUGA 5B6IA 1TF2A 3AL2A 1XTBA 3ZXIA 5BMVA 1QIJA 5JZSA 1H3FA 1MAUA 2VC2B 4PAOA 1ESCA 2QLFA 3SGLA 2P3SA 5D5PA 2RGEA 5ALWA 1E58A 5E6RB 3T1HB 1MU0A 5F9FA 1I9CA 1CY4A 1YNOA 2ZJ2A 5L8VA 2H7XA 3GHYA 1HEYA 3FSEA 4JB0A 4TSFA 2WJHA 4Y9UA 3MJSA 5EWLB 1SKYE 3RS4A 1LRJA 5LD2B 2Z04A 2GTIA 3FZQA 2M32A 1HYBA 2QIOA 1EQAA 4M8SA 4F2DA 3OQMA 1V5WA 2V65A 3AF2A 2JA1A 3N8HA 2I7VA 4DMFA 5REQB 3JWIA 3U2QA 5LQRA 1TKRA 3QVOA 2XT9A 1NXWA 2WD9A 3OUTA 2BFMA 5FYQA 2D4AA 3FF1A 1HDGO 2Y9PB 4MA5A 1L7OA 5LVAA 1T4MA 2D2EA 2DPHA 4NU0A 3HFRA 4D4GA 1BSVA 1KZ9A 1MJFA 1FP1D 4YRZA 4TSRA 3K0SA 3DT9A 3V3TA 2QN1A 4JYMA 3RJMA 1OZ0A 4C1NA 1M2VB 1OXKB 1T5OA 2Q3BA 2WNHA 2A67A 3G5UA 1E1YA 5LP1A 1GZUA 4LTDA 4Q93A 1KEZA 4C08A 1QH8B 2Z8ZA 4Y2VA 1H2WA 1WCIA 2G5TA 3NJRA 2OCDA 3I4CA 3O84A 4K2HA 3A36A 1RE0A 4ZCMA 1NHWA 1MC4A 3NLLA 2YHAA 3KSUA 2C5HA 2DHRA 4M98A 3ZU2A 1LSSA 3HUUA 3ZBQA 2RHCA 4OMCA 2ZTHA 2OV3A 2YFKA 4YJ3F 5CM9C 2B99A 3E5HA 3MZ0A 1IY1A 1M83A 2C7QA 3JVEA 4DV1B 4B4KA 2GEFA 4GOJA 5BSUA 1RJ9B 3EG9B 1LRKA 3OQIA 4A82A 4GR5A 4AJ1A 1PGQA 4GPBA 4D0LB 2VHTA 4MIYA 5BNIA 4ZHSA 2HK6A 4HAZA 4RPKA 4Q9KA 3E2MA 1NNSA 3BMNA 3KAJA 1GY8A 1SXGA 4I9UA 2Z56A 3ZE8A 1VE6A 1BJRE 3KHTA 2HDOA 5BNFA 1DB3A 4PTZA 3FZGA 3DAHA 4KWHA 2H4YA 2QTVA 5BQ5A 4XUCA 2H2DA 1YI0A 2X0JA 1Q11A 4N3GA 4MPDA 621PA 2VF4X 5I9NA 4GZLA 3GP5A 2CN1A 4NARA 4CLOA 3KVYA 4EWLA 5EESA 1YZGA 2FRDA 1YZFA 4QVIA 4TVSA 3W90A 3AEZA 2Y6VA 3ANLA 1Y3CE 4FLFA 4WLVA 3EF1A 3HCRA 4NZZA 5IXJA 2O8CB 1SUCA 1ZCAA 2HAEA 4R16A 3RVSA 2V54A 2WJ4A 4QXOA 1WCV1 2NV2B 1J20A 4K9SA 4D4IA 2TSYB 1H93A 3ILHA 2GLTA 3R3SA 3TQRA 1NUPA 1B00A 3DPIA 1KOFA 2GS9A 3ZY6A 4I55F 1P2VA 1XDGA 5I5EA 2P0EA 3N53A 3W8EA 5D5QA 3ZY4A 1WUHS 4MIOA 3ZHSA 4Q3DA 2CLDX 1EJ2A 2YZMA 5MN6A 1WHSB 1GAXA 2HWYA 2FOXA 3PX3A 3QV1A 5LYJF 3OFJA 4TTIA 3DKVA 2CDCA 3C4VA 4CLOB 3FNHA 3CBQA 1K8XB 3H8WA 3FOFC 3GUCA 2O05A 2H17A 2HZBA 2OAEA 3GEEA 1ZI9A 1Y1QA 3KD2A 3QHPA 3DA8A 1BXRA 5KJEA 1T1IA 3OEHD 4J90A 1YS9A 2O3RA 2JJ2A 2IUFA 4IUCS 4JQCA 4L4RA 4KFCA 2FG5A 1Z5PA 3GAAA 1QYIA 1Z6AA 1EKXA 2FGKA 1UKAA 1KKLA 1Z6XA 2FUG6 2I8AA 2YASA 1RI5A 2YWJA 2YWHA 3ESQA 1E6UA 1O5OA 2FUNB 2ZYSA 3GLTA 3J7TA 5DWVA 5BSGA 4QM6A 3EFHA 3NJ8A 1TA9A 1FRNA 1P1CA 4XI9A 2VEOA 3KHKA 2OQ2A 3D9QX 4Z8YA 1O5IA 2HLDA 1L5WA 2Q1SA 2VI5A 4OU4A 3CUTA 3E5RA 3U1VA 1J0DA 4X00A 1A2QA 2IXTA 5AIBA 1H0SA 2AYYA 5TQ0B 1P5ZB 3FIUA 9LDTA 1YJBA 1GT91 1ZN9A 2AZTA 4MYSA 4Z3DA 4HDNA 4IOKA 5G4LA 2VYQA 5D87A 3V34A 1CF4A 3QWIA 5CDFA 3K6JA 3I8OA 5G0TA 5AIAA 5A0VA 1YDMA 3FPSA 4URZR 4EMTA 5C52B 3PUHA 2CLMB 4MRPA 5DM0A 3WGGA 1XVIA 1P74A 4LY9A 4RPGA 1TYBE 1R6DA 2X5OA 3KFXA 4WOJA 4XFKA 4I81A 2YICA 3FZYA 4K05A 3S4YA 3K31A 4CQLB 4ZCTA 1E6EA 1KQ3A 3A2MA 4KXUA 4CKCB 1FUEA 5TGZA 3TGPA 2ILVA 3ILYA 1B42A 1RWNA 2I6TA 1D0VA 5ELLA 1WLYA 3DEYX 3OMLA 1D2AA 1ADCA 3HDQA 4N3NA 1F0NA 1M34E 5FOWA 2Q99A 3EPJA 4N5MA 3A06A 1DBWA 4D46A 4UM9B 1OD6A 3P20A 1AUQA 2AFIB 7ABPA 5KI6A 3B8EA 3V1MA 2VEDA 2OQRA 5G0SA 2X5JO 3DYIA 3EH1A 3LLSA 3OOHA 1DKMA 4P53A 4Q9HA 1FSZA 5FPHA 3WGTA 4CDRA 4DF3A 3GPLA 4N5NA 3T8YA 3CNLA 4LK2A 4FSXA 3KUKA 3NC1C 4HK4A 3BAFA 1WQ3A 3PRJA 3VR4A 1YZVA 4HH0A 3N39C 1OXUA 1HORA 3IXMA 4NU8X 4RD1A 3JYQA 3KL4A 4I08A 1NJ8A 3SFTA 2X8WA 4OM7A 2Q8QA 4P0PB 1U0SY 4KV7A 3G0CA 3HRHA 3HZZA 2R2GA 5DW3A 1FMCA 1K6XA 2XSZD 2HMVA 4PC6A 3ML1A 4F38A 1DT5A 4HWGA 3WWEA 3OTOB 1VJTA 1UPFA 1U90A 3M4JA 5DRTA 5F23A 4H7KA 4YALA 2AG8A 1KZ4A 1NDUA 2O9JA 3QU5A 1TCAA 1XTIA 3H97A 4OHCA 1ZYUA 3VSCA 2VXYA 4ASUD 2B7LA 1VZ2A 3LQRA 1CVRA 4LYYA 4YJ2F 3M4XA 1ZD4A 4B6RA 4FFBA 3HM2A 1QFXA 3DZJA 4RQTA 4OQMA 3ZU5A 4MQFA 4AWXA 4FZ5A 4UCWA 2H5JA 4OJMX 3RYCB 2HU7A 1PZGA 3LDAA 5EZ5A 2HCTA 4ZT5A 3KKLA 1ZO8A 5FR2A 1SIOA 2N46A 2EJTA 5AJHA 5JBQA 3FB1A 1PD0A 3REFA 3OX3A 4L0CA 1TW2A 4M8NE 1SH7A 2DWOA 3LOUA 4Q9NA 2VYNA 4C2TA 2RHRA 1DAEA 1CUWA 2XA2A 3AC0A 3GFOA 1R0YA 2QRPA 4CIAA 2G9RA 3IEVA 1D4FA 3N7UA 1C7QA 1VJDA 4DLPA 1SC9A 4KQGA 1PEDA 1KJQA 1L5RA 1TJYA 2WHYA 3IQFA 3KZKA 4WESA 3W2HA 5K9ZA 4D2IA 1RWKA 1FUIA 4QOHA 4DLLA 1OZGA 3KKZA 2E9SA 4RPLA 1YZNA 2QOEA 3FPJA 4GYWA 1LX6A 4M7PA 3V8PA 1XMXA 1XG5A 2PUFA 5DHPA 4A2QA 4X84A 3PNMA 2H65A 4RIHA 4DUGD 4KN6A 2WYVA 4PX9A 4DSUA 3NHZA 3WLLA 3K9BA 3M4YA 2Q4TA 3VMFA 3HO1A 1GTRA 2WTBA 3FDFA 3PA8A 2I22A 4RELA 3C48A 2QEQA 3ZHVA 1QV6A 2QJTA 4ABYA 3DFZA 4C5BA 2WJZB 4D6XA 1ZJ5A 2PKWA 1ZNXA 4DCSA 2EERA 4UMVA 1CQWA 4LXXA 4PYMA 5JNSA 4OX9B 4F56A 4MKRA 2RK3A 1Y3DE 3QNWA 5JFOA 3TH5A 3F73A 1E3WA 2OBFA 4LY3A 4LV6A 4X8MA 4ZIRB 1U4NA 2YJTD 2XJ9A 3TKYA 4DRYA 2AWNA 2OV4A 4IDOA 3RT7A 2WZDA 4J4HA 1SU6A 3CW2A 2WSYB 3RFTA 5EJ7A 1WP4A 2ZIAA 4CNQA 4O63O 1MIHA 3H7AA 4EG5A 4KLRA 5ALTA 4F97A 5EHGA 2YDXA 4C04A 2GERA 2UUBB 3DD5A 3DDHA 4DIUA 5FR1A 2A3NA 3WLNA 3W6NA 3EFBA 4EPWA 2OFXA 5HJ7A 2HU2A 4NYIR 3EWAA 4ZEOA 4GKBA 1VYHA 1CS4C 1AKUA 3JYLA 4MUMA 5CIQA 4BMPB 2A30A 3SXPA 4CU2A 1EHYA 1KORA 2O7RA 3D7MA 2GK6A 3D7KA 2QAJA 2OXIA 5KDDA 2IYOA 4GM1A 1M1YE 2VXCA 3K7EA 2W4QA 4M1MA 2GXQA 4YMIA 3MTDA 1U0HC 3MD9A 4CMJA 5C7OO 5BNTA 4TYWA 5CCDA 2OLJA 3NOXA 4TV8A 4MWDA 2FSVA 4TS4A 5DI3A 2C92A 4FOOA 4NV1A 4L8GA 5BNZA 2PFSA 1B43A 5EERA 4ND2A 3P2OA 1CX9B 1CJCA 1NYQA 3E9DA 4XJTA 4OHUA 3T7EA 4JJZA 1PEKE 2XCUA 4KUGA 1NXOA 4P4GA 1NMYA 2C5FA 2FFRA 4EMUA 5FUMA 1G8AA 4DQXA 4XTRA 5HVNA 5JXWA 3H83A 3WKCA 4K9QA 1RPNA 2FDRA 4CG0A 1TEHA 2FPKA 1XAIA 3E7XA 5TPWB 2IKQA 3VYVA 2Z2JA 3FMOB 1TLFA 2MCFA 3WFZA 4EYSA 3WSTA 3MWLA 3BF7A 4K81B 1V9LA 5IN5A 1IJEA 4MQMA 1FC0A 3OJOA 1QIKA 2SNIE 3QKSA 3B1ZA 3LLMA 5E2AA 1RC1A 5CK4A 5E4JA 4YRAA 3UJHA 3F5DA 1FB5A 1VE1A 3NGMA 3VOTA 3IE1A 1B8VA 2ZJ6A 4ZRDA 2DEUA 2VPXA 3W4JA 4FZJA 4MA0A 1E7RA 1KEPA 1RWMA 2FEPA 2W7TA 3GCWA 4D79A 4JHXA 3DC7A 1GA6A 4TRJA 1OU4A 3KTAB 4TVKA 3JR3A 2AG0A 3KZVA 1QC5A 3NTXA 5DXAA 2V98A 1FW8A 3KQTA 1CBUA 3BE4A 4I1IA 2E89A 2DQ4A 1EFVB 4EVRA 4Q1FA 4KMRA 4JR1A 2Q07A 4LRQA 1AUOA 2HWKA 2ZU6A 5F1KA 4ZGBA 3GLHA 4MUGA 4ZT2A 3NYWA 5B7GA 1E1DA 3RKSA 3A58B 1CF2O 2ZBFA 1YTUA 4TV9A 2QUJA 4BX9A 2WWXA 5DNYB 2QPOA 3K9HA 5JCJD 5C4IA 1KZ6A 3CIOA 1SC1A 1WCXA 2J30A 3M6LA 1GPWB 4DTIA 5GONB 2UZ3A 3AJ8A 4A8JC 2HV8A 5AHXA 4FIZA 2K87A 3ZDXB 3PXBA 3V00A 3N2GB 2V96A 4QATA 4AI6A 4PO3X 1H0RA 1TVEA 2GTHA 1TMGE 1Y3HA 1RRFA 3LHDA 1QGYA 2QTTA 4Z1OA 3BJRA 4BNHA 4OKIA 1OWLA 1XZIA 2QTRA 4HGQA 4P08A 3NMUF 3VR3D 1EINA 2HK9A 2G08A 1GITA 1Z2OX 3L7JA 4WINA 4EHFA 4U9UA 5G0UA 3GVCA 3EUWA 4K1LA 2Y77A 4KI0A 3MWEB 5CX1B 3UANA 4A0QA 5K4HA 5LWQA 2CVPA 2FXVA 4UBKA 3JU3A 1XOIA 1NDQA 3DDOA 4ND1A 2WQ6A 3CWQA 1Q3TA 1AY0A 1TQ8A 2CHQA 3A1FA 3IMEA 2O2IA 4KRXA 5EIHA 2RH4A 2QR3A 3CFYA 3D3NA 4IAOA 1GU7A 4R8MA 1MLDA 1XNQB 5LXTA 4UNNA 3I6YA 1WLSA 1NW4A 3RT9A 3K4QA 4HB3A 1GHTA 2IU6A 1ISFA 1NX6A 3E84A 5B2ZA 3WAKA 2V0GA 2LZ0A 3OM8A 4HXEB 5H3LA 2R0QC 5FBZA 1X86B 5EWMA 4X54A 4REMA 1BCRB 1CDEA 2GXSA 2C83A 3C74A 3BWXA 3SE7A 2MIIA 1ECLA 4HQ0A 3WICA 4UCXA 1GDTA 2WYIA 1P77A 1W9HA 1PR4A 2VYFA 1JT2A 3OZRA 3PDIA 4UUMA 3RARA 2XDQA 3L8MA 3ZK7A 3G1UA 5M34A 3Q40A 4B2LA 3L41A 4GZMA 5F2OA 3GVHA 4US1R 4B5LA 2AZMA 3FJYA 2ZRKA 2Y66A 3U4IA 4EX7A 4YRCA 1P81A 4BWFB 1CRLA 2ORED 2E6KA 1C9NA 1IRXA 1SD5A 5LQJA 2IYSA 5FWAA 4R0NA 3RK4A 3FYUC 1MOSA 5CNJA 4AX4A 3K0CC 3DZ8A 3TLXA 4W1QA 1D7OA 1YCHA 4MLDA 1BEUB 4DIOA 3P2JA 4PCLA 2VT6A 1RQ7A 3I58A 1ELOA 1UDWA 1K75A 2DUWA 4Q3AA 4Z2YA 3EYWA 4WECA 1XQ9A 2ECOA 4TWIA 5IEBA 1D9XA 3QVXA 3AIKA 2EZ8A 4CQJA 3DL2A 3JRXA 4XCQA 3OM1A 5DN6A 1VMKA 3AT1A 1PG2A 1ORDA 3CRNA 1AXGA 3HJNA 2XUQA 5CGQB 5CDGA 5JALA 5KWJA 2X5XA 4ZAGA 3T9BA 2JGJA 2H31A 2OO5A 3FF4A 5DCLA 1NI4B 4ZHQF 3A6GA 3PCTA 2PO7A 5CH5A 4JD5A 2A9RA 3ZJ5A 1UBHS 1Q91A 4DT1B 1LTHR 3FGZA 1EUDB 2N0SA 2HIGA 3D7NA 2BKEA 1U0JA 2G07A 1CIPA 1M6YA 2FUEA 3N2ZB 1LDGA 1FU4A 1KJWA 1L0BA 1TTHA 2ZE5A 3C1UA 5DM1A 3ZEAA 1K5DA 3NWEA 4J9VA 4BMDA 2OZLB 3JWEA 4W7SA 4FPXA 1JFVA 2OFPA 3PGMA 1UM8A 2MINB 2ZUUA 4FGWA 3UAVA 1JIJA 1E1MA 3TOVA 3U13A 2PQMA 2BUAA 3T3IA 1WXQA 1XROA 4MP6A 4OUDA 5K99A 4GI3A 2OFOA 3WK8A 3ESDA 2D7CA 3LTNC 2Y67A 3KK0A 4KXFB 1ZH0A 2BEVB 4XASA 3DLHA 3PI6A 1LNQA 5KQPA 2V7WA 5BSMA 3UGKA 2UZAA 1CUCA 3DB2A 4KR2A 4Z4IA 4Q12A 1U7WA 1RYHA 5KHAA 2H00A 3K53A 3NETA 4MKGA 3BXPA 4R1NA 4M60A 2BHSA 1DJQA 1P1FA 1VE9A 1EGAA 4EABA 4EHIA 2AN4A 1TL7C 2NW6A 4ID3A 3F6SA 3MC1A 1KETA 3Q8KA 4B74A 3DZKA 4CR6A 2HX1A 1G5FA 1IB6A 3IIIA 5A6VA 5AOAA 3E70C 1EEHA 1XT6A 1KO1A 1AGPA 5JCZA 3M1LA 2OR3A 5CPBA 1R0LA 3AR2A 2IV2X 4KIFA 4Q47A 4XD7A 2JJYA 3W05A 2WUGA 2HJVA 1KZ1A 2OM6A 5CW1A 1CUIA 1JLHA 1N0HA 2QMQA 5CCBA 1EX9A 5A0FA 4DG8A 1J7KA 1HRKA 3ZZTA 2FOIA 3RUHA 3HB5X 3EXFA 5B37A 1L4KA 1TA4A 2ZTSA 2PZFA 5FULA 5FI5A 1R10A 1LWNA 1XZPA 3E1KA 3UTDA 4ZYTA 3PPYA 2EX0A 3OETA 3D7SA 5AUQA 5C8ZA 4TMXA 1FSFA 1PL7A 4TT3D 4BIMA 3UPTA 1NMXA 5AW8A 3FHJA 1DQZA 3TKAA 2B3TA 3V8BA 1UT8A 2FZKA 1WZCA 4JC4A 5I9BA 4DQLA 4F12A 1K27A 1JNYA 1SY7A 5FI0B 3RHTA 1XTRA 2BFPA 1T9GR 3GDOA 1OLXB 1QDLB 4EVSA 1X7DA 5B2FA 2EW1A 3EQZA 2I65A 3OSZA 4H0FA 4CEIA 1YRAA 2JASA 3AEKA 1XZHA 3BTOA 5C9ZA 2PIAA 4J07A 1OWNA 4M88A 4AB1A 4IHQA 1K8YB 1Z0IA 3HRKA 2O8FB 1EA5A 3CF2A 3ZNPA 5C8YB 4BO4A 1RXEA 2EP5A 3DWIA 4BFWA 3E0XA 4ND4A 3A9TA 3KVNA 3SZGA 3LL7A 1P5RA 2EG5A 1OFVA 2ZRBA 2DFPA 2VP5A 1TE2A 2G04A 4QJ5A 3FJOA 4TV9B 2CMKA 3WGVA 5A4DA 3HGMA 5IUJC 1LI4A 5JQGB 2FZ5A 4G6ZA 4QC2A 3QVLA 3SMQA 3Q85A 1M33A 3K09C 3Q7SA 4A2WA 2QUZA 4M0KA 3G13A 5GONA 5A3SA 5MDHA 5FNVB 1EFVA 4F5WA 2Z4TA 4DJTA 2A14A 3FYTA 4W9RA 3LUBA 3SSNA 1T29A 4D0NA 5BY2A 1NNEA 1UJNA 3WDKA 2ISSD 3OEED 2ZIUB 1YS7A 2UUAB 4YAFA 4KXYA 4HH4A 4PLZA 1ZD5A 4Q05A 2D5AA 4XVRA 3A1UA 3K6SB 3NVAA 3VYUB 4KQXA 3ZE6A 3T94A 1JHPA 2FY8A 3MLAA 3P9QA 1URPA 5AVOA 2QTWB 4LVNA 3WFJA 3QMPA 4NH4A 4DUPA 1QS0A 1XDSA 1RI3A 3OEWA 3AYZB 2B61A 2FSUA 3A14A 3M5WA 5EGNA 5IYZA 3GLQA 4LYHA 5CT5A 2DG2A 3RBVA 3RSLA 2WRZA 3GEMA 4MHSA 2ZRJA 2EV9A 2KYRA 3EXIB 4M22A 4S04A 3D4NA 6NULA 1TOAA 2R6AA 4N8DA 1DP4A 1XK7A 2ATVA 4II7A 5TPWA 2E55A 5K2OA 4CVNA 3AKYA 2P4SA 4AY5A 3EGOA 4DNOA 1JSXA 3G2IA 3QV2A 3KB1A 4BHTA 2VF5X 3I76A 4B6GA 4OHBA 1KZGB 1ILEA 3DMYA 2A1TR 3AEUA 3QOWA 3HV0A 3VVCA 3LQ4A 4F1KA 1RPJA 2HOQA 1J39A 2PWYA 4BAZA 3B89A 3H8JA 4D92A 1I2MA 2PZEA 2WD8A 2AI2A 2Q27A 3ZV4A 2PS0A 3T1YB 2FP3A 2GUWA 1DGQA 2C9OA 3K1YA 3C7AA 3LVRE 2HB6A 4KPFC 1I1NA 2EAUA 3I9LA 2PD6A 5DP1A 4X24A 2A4KA 4TL7A 1SK8A 1BXRB 5EUBA 2YNMC 1CZRA 1M2FA 1UZMA 2HADA 3BD9A 1R5NA 2RI6A 4ZVQA 2VAXA 2DQKA 3GMIA 3IT0A 3JZAA 4YAIA 4HGZA 3L1UA 4LJLA 1QQTA 5HCIA 1AGYA 4AG5A 2CV2A 1AKNA 3U4GA 1DZ3A 7GPBA 1N5DA 4OA5A 3QEOA 3RE1A 3EY9A 4DXAA 5CNMA 1TC1A 2VIIA 4TQAA 1CDDA 5EJFA 4JXXA 3PX7A 1GJRA 3LXMA 4XSHA 1EZ4A 4Z5XA 2OCYC 2PTGA 2QBYA 3M49A 4KO2S 2CJYA 5T6MA 4NEGA 3U9TA 4UUQA 1R6UA 1JFLA 2IYXA 4CEHA 1UBRS 2FPUA 2FYTA 4HNHA 1KVSA 4ZO6A 3QMMA 2QNRA 3AERB 5DI3B 2A1IA 1WSAA 3UPUA 3I1YA 1VE5A 4M87A 1EFRD 2JAOA 3WR5A 4N0EA 3CNOA 2I2FA 5F73A 3CLKA 3RVRA 4K6FA 3MRXA 1MA3A 2JIQA 2JHPA 1ZHFA 1V41E 2ADMA 1MDBA 1ONOA 3TEJA 2ZS9A 1X3SA 1ZGJA 3R3JA 4FT2A 3KSRA 1HT1E 1GLNA 2OC4A 1K92A 1V3UA 4GVXA 5D3MB 3RIMA 4J0CA 2RE8A 3AIIA 3DKKA 2V45A 1EWKA 3NAZA 1SQ0A 2IP4A 1PWHA 2X5KO 2XMRA 3I1JA 1MNAA 2VJAA 1HKHA 5GOZA 4FW9A 2P40A 2UZ4A 2L17A 2ZZNA 2H9IA 5IDWA 4E31A 3U7FB 1N2CA 1KXJA 2OO7A 3CKYA 2CNBA 5EIOA 2A92A 3JYOA 3NTQA 5SICE 5JEEA 2J9RA 4FQ8A 4BJ1A 5I45A 3H1PA 3WNVA 3W1VA 4E1BA 5IJ9B 3QBDA 5KQRA 5E7IA 3HCEA 5TARA 2FTKE 3WFIA 2AD1A 5A4JA 1ZVMA 1ZL2A 2CZCA 2IXEA 2RGRA 1M8FA 3OJXA 3HJFA 4BV2A 3P96A 1DPFA 3OQBA 4OIMA 1X1AA 2HJGA 4FD3A 4ZVUA 3TGLA 4ILEA 1HE1C 2VWPA 3TD9A 1FX0B 1E79D 1ONPA 4DQDA 2EJVA 1M1NB 1Y1LA 5KU7A 3GLSA 5EQTA 5C5EA 4U5XA 4DMRA 1C9EA 4MGHA 3PSHA 1YE3A 1H6AA 1WVIA 1EWQA 4JB8A 4ER3A 5FBRB 1NXQA 5GOTA 1AOXA 1RM3A 3P7MA 4HTFB 4ZMSA 1XZQA 2CZGA 2DE0X 3MF4A 1O94C 4ALMA 2JIMA 1S9DA 3KQPA 3EZ2A 1R5BA 4JLSA 4U1RA 3VSAA 5CDTA 2O19A 1UPUA 4YJKA 5L53A 4N18A 3F3SA 5CLIA 3U4DA 1GSAA 2CKMA 2Y1XA 3NH6A 3NHWA 2TMDA 3E53A 5D3KA 5DBFA 2RGCA 5A7FA 2L82A 4JUFA 1AKQA 1VM6A 2IOHA 2PDAA 3PNSA 5IRCD 1C1DA 1W49A 2D13A 4FXPA 1QQBA 1H2XA 3RREA 4QU8A 1L5MA 2HD4A 4RS3A 1HE8B 1D6MA 2MSCB 3CNEA 1R8QA 1RPAA 2VAWA 2FRDC 3LVFO 3DT6A 3QKUA 4BX3A 4G4JA 1LK0A 4OLFA 4B6FA 1HG0A 3I1FA 1BGVA 3IVRA 4FP9A 3QE0A 4JFAA 4RAQA 1JEDA 3RG2A 5CG1A 2X1VA 4XD7D 1MEJA 4E6PA 2YJ6A 4A91A 3R09A 3PEVA 2GCPA 4L8WB 3BZUA 1N78A 3BGWA 4PLTA 1XZNA 3IHLA 1GG9A 1YBAA 2QJFA 3ZI7A 4LNUA 1RVV1 4OTZA 4CF6A 1HXHA 1QCDA 4MVYA 1ISRA 4BX8A 4C7BA 5C8VA 2HO4A 3S2EA 1WBBA 2FK8A 4UVIA 1T25A 1QGOA 3HL0A 3AG6A 5CA0B 5C18A 3OT5A 2NSYA 3DE2X 3EEOA 8AT1A 4MICA 1HR0B 4JI5B 4JC8A 3CUEF 2VHJA 3EFOB 5BSWA 1G8HA 2I80A 4LSGA 4BMNA 3VX3A 2QT0A 3BH7A 1PJZA 1IHDA 4NHOA 2QD2A 2VBIA 2H63A 2KS6A 3FDIA 5FPQA 1M6EX 1ZFNA 4WERA 1W75A 1Y8RB 3IVXA 5B4VA 4B43A 1E2FA 4ZZ3A 1KOGA 2ONJA 3W7BA 3AJEA 4FX5A 1P60A 4MEAA 4CLDA 4GXRA 4UNRA 2CFOA 2EEPA 2I9PA 3B3GA 4WDQA 1QIEA 3B3FA 2A8YA 4G4SP 2FZWA 2JBAB 1ZC3A 3JYNA 4TOIA 3QLVA 4FEYA 8ADHA 4H1WA 2FFAA 3CN7A 2G77B 4KXQA 4Z49A 1OXTA 2N1MA 4D4HA 2CD9A 2I3AA 3KZXA 2XR1A 2I03A 2WHPB 3LG2A 4IXMA 2H4JA 4KI7A 1FNDA 1M6WA 2MHCA 1C4KA 4R5MA 3SEZA 2Z3VA 3NVKI 1SBCA 3V1NA 4EUFA 4IVNA 4YLEA 5I7FA 5HRCA 3ZU6A 1MX3A 2BI8A 3KYCA 3LYAA 4LQ4A 2VPPA 2YHIA 4QAJA 2ZWAA 1FFBA 3H84A 1J8QA 2NO6A 3LZ6A 3KIPA 4E11A 2I55A 1S2NA 4NMLA 1YULA 4MW5A 3GA7A 3O90A 4FN5A 1IVYA 1EBBA 2WUDA 1BHQ1 3NWJA 5B64A 2OD7A 3OPXA 5A71A 4DNQA 1OH6A 1DUVG 1KPGA 5KTYA 3PJRA 3GVIA 3JY6A 3EMDA 1VIYA 3MJ4A 2P2SA 1JJAA 4JYBA 4LF9B 3ABSB 1T4CB 3Q2KA 2EJUA 1W1UA 4AXBA 4FZRA 4EYOA 2PKEA 1P45A 3TCXB 4KIWA 1FJ2A 3N05A 3LK6A 4FOTA 4TUYA 5EXEA 5BQOA 1K3TA 4GSKA 3C7DB 1HA3A 1HTWA 1Z56C 3PLNA 4L4SA 1W52X 3ECCA 3OLCX 4LDPA 5IJXA 3DDUA 4G8DA 2GEJA 5KTPA 4HAVA 2Q4RA 4EQ6A 3ABOB 1P33A 2ORVA 5B1IA 3S8YA 2YJZA 1DIRA 1H9AA 1EDBA 1U3WA 5AM4A 3QU7A 3HZHA 1U4OA 4D25A 2DJ5A 1SUAA 2AUMA 2ENWA 2ZRAA 3HY4A 1BXZA 3QFHA 3FYDA 1C3JA 4HRAA 4JGGA 4URFA 3TTTA 5LMUB 1SULA 3K70D 3K6SA 4CGZA 1WKVA 1GL6A 3ELBA 4A7PA 4AF8A 4ZDJA 1ZK0A 2BFDB 1NIPA 3H5NA 4HPXB 1MVLA 1ZGHA 4EIWA 5K0FA 4B4OA 3LKBA 2ACKA 3L7AA 4HLUC 4RNDB 2J31A 2AFHB 3O8OA 1HLGA 4XIFA 1NBIA 4PM4A 1PZNA 5CXXA 5DOZA 2AF3C 4IJWA 4XKJA 4OL9A 4YWJA 3B13B 2JEOA 3KV3O 1YVEI 4TROA 4H4CA 4H6XA 5FX2A 1H3EA 3H8VA 3DTVD 4Y6LA 1EBUA 3TUJC 4CQLA 4IDEA 3QHQA 2NU7B 4HDOB 2Y3IA 1XRSB 3THXB 5JSUA 5LQUA 4I14A 3LQ1A 4DJDC 1TUIA 5EE3A 4CN9A 2NXNA 1LGYA 1PWXA 1U9YA 2NO5A 3GJRA 2JIOA 2FEMA 3W2IA 1ZHHA 3UJ3X 2QL9A 3UY4A 4CR8A 1SHJA 4RORA 1EHCA 4X1YB 2I3GA 4QHYA 1LI5A 4RZQA 1LLUA 1Z29A 5I8WA 5ES3A 4V0LA 5DNAA 3H17A 3WOVA 4AM8A 5J4YA 2B3DA 2XDQB 2ZYAA 5IXSA 4GKKB 3MCZA 1N9GB 4KAAA 3X3HA 3N58A 4PYQA 4WZAE 4PANA 1TJNA 4UM9D 5AKXA 1MORA 2OQVA 1KJ9A 3WGZA 3IPXA 1BKSB 1PUJA 3HJCA 2VHXA 4IIXA 2X0FA 3ADKA 1E7QA 1OFUX 5CDUA 4EL0A 4HWRA 5D84A 4OQEA 4LSMA 1K2VN 2HF7A 1XNHA 2IU0A 4D9NA 1NJGA 1MC5A 4OM8A 5IZCA 1N4AA 5TPZD 1ZIYA 1DKLA 3OM0A 3PVCA 4OP3A 3S1AA 1WXFA 4DLTA 4RSRA 1PJQA 5H9VA 5EPUA 2AXEA 4U2DA 2KM1A 3R7AA 5JAIA 4ER6A 3U4MA 1Z5ZA 3PBKA 3L0IB 4M7OA 2Y71A 1A9YA 3OZVA 3JARB 2L42A 2CB9A 2HIAA 2BP7A 2Z30A 3C3YA 3NBXX 4DDVA 4JT2A 3OE5A 4JYAB 5IYZB 2UAGA 5EWLA 4AMZA 2P79A 1GDHA 4DLZA 3NVDA 3WMGA 2OG1A 3D2CA 4GS5A 1XZLA 4RZXA 4JLOA 1Q6YA 1KDPA 5EPEA 4UNSA 2ZSIA 1MHTA 4HBZA 3M3HA 1NN5A 1Y4AE 3FUUA 3OIGA 1ETHA 3NNNA 1OC2A 4RDIA 4S2EA 4LBVA 5HKBA 4QGGA 5AQEA 4BO6A 3ZCSA 2FSFA 4ZZ2A 2HLDD 1VZ3A 5TC4A 4MDFA 1QS0B 3MG9A 4P3PA 4BIIA 2E4ZA 1ML3A 4FMCB 5KTRA 4DAOA 3EC1A 2NPOA 4EL5A 2WAAA 3I04A 4J0HA 5ILOA 1FTWA 3TLYA 1TK2A 2ZJFA 2IWRA 4DPMA 3II6X 4PSUA 4A23A 2BVNA 4JLMA 4CM4B 2GVDC 2QMZA 2IPAB 3GRKA 5AJVB 3BCRA 4KVFA 1JH9A 4C7JA 3TZCA 2QYTA 1KQOA 3PE4A 3LDFA 4Q82A 1UKBA 3BMCB 3ENZA 2FB9A 3O6VA 3O31A 1OI7A 4FFOA 3TINA 2B8TA 3BGSA 4KODA 4BMYA 5C35A 2OMEA 2J3IA 3DFMA 1T36B 4K28A 4MULA 3EXIA 4EUHA 1EFDN 5KREA 4JUCA 3LZCA 4FB4A 4PN3A 4YUAA 2XZOA 1NMQA 1U8FO 1SG0A 4R6WA 2IW1A 2O1XA 4GH5A 5CM2Z 4OHRA 1DRUA 1UC5B 3DOHA 3ZWCA 1GR0A 4Q37A 3PFHA 1LWOA 2IGTA 2XAUA 2H4ZA 3C98A 4ERNA 4CQMB 1QLHA 1YZQA 4FKBA 3DLPX 1J42A 1P39A 2M2IA 3CW8X 3ME5A 4J1SA 3QPAA 4JEIA 4K6KA 1ORWA 1RSZA 2Z95A 1J4AA 5FCDA 5TEWA 1GQFA 1OXXK 4AJLA 3SZUA 5LDHA 1OI2A 3N1UA 1EA7A 4KR6A 3KEQA 1U9JA 2F3TA 4ME6A 5BR8B 2WKRA 1NBMA 1Z13A 1GXSB 3CLRD 3U5ZB 1N3IA 2YRFA 4GL2A 1IZZA 2EQBA 1NSFA 1V11A 1PG0A 2C0PA 2HWXA 3DLIA 3PS9A 4P8RA 3RS9A 3O8RA 4Q21A 2ZROA 3HB0A 2WBLC 4A8TA 4R0VA 3U80A 3D0KA 4RPIA 1NR5A 1K9SA 4M46A 1FNCA 3TDNA 5C34B 3L93A 5DOVA 3T7AA 4QQNA 1QONA 1DINA 3S8MA 3DYVA 3SEQA 3DT8A 4Y1RB 4DZZA 2HY7A 1QHHB 2P1ZA 3UYLA 3K9GA 3E7PA 4IZHA 1Q2UA 1UMDA 3I5MA 2J3DA 3TRKA 3OOYA 4BVAA 1CUEA 4NYJR 3TXXA 3FRIA 4ZT7A 4O2RA 4NOMA 2YFQA 4IQFA 2MSLA 3ZGVA 2W6JA 3G0IA 3KUXA 3GK3A 4C14A 2HBZA 4LJKA 4PLFA 4TN1A 2IUTA 4TMWA 2WVGA 4RSMA 1VBFA 4B3XA 4C0WA 1AVTA 1GNRA 4FHDA 1BWQA 1R0ZA 1D2EA 4F3TA 3HCPA 4G9EA 4DIKA 1SBTA 4OLBA 2FF7A 5LZ9A 5CHYA 1D4ZA 3ZHOA 1AHHA 4P4UA 5KPDA 2WMOB 2ZYUX 1NP6A 2WUEA 4C4SA 1SCNE 1JF8A 3K5WA 3VKUA 1U5BA 1ZOIA 1ZK3A 3CF4G 1PT5A 2YW2A 4OAOA 1KS9A 3ZDFA 1VJ1A 4BMXA 3C5WP 3FLEA 4D9KA 2B5WA 3MFYA 3NTUA 3TW0A 5HM6A 3WA7A 1WBJB 5EKXA 2UYQA 3KYIB 3DAOA 3ESRA 4J1NA 3OOEA 1JA9A 3ZGOA 4RVOA 3N7TA 4MWSA 2NZUG 3G0BA 3GF4A 3VTAA 4JP3A 4CG2A 3WYDA 2GWHA 2C58A 3NAQA 4JL6A 4E0BA 721PA 5D86A 2CYAA 2AG6A 3GGGA 1JAYA 4B76A 4YXFA 2JLVA 1Q77A 4ZDWA 3FBGA 5EA2A 3QKIA 3RU2A 1U9IC 2IUUA 3VVMA 4KC0A 1YQEA 3AW9A 2VWQA 4FLEA 4UXHA 4H9GA 4D81A 4RMHA 1SXJB 2EW2A 3V8MA 3RVKA 1B3RA 4N41A 1GGEA 4P4SA 3T95A 2G36A 2P77A 2R2AA 3TXYA 4CODB 4FFVA 2ZUBA 4QFBA 1XZDA 2FR8A 4BNLA 4I1YA 4XGRA 1XU7A 5ERXA 3C1OA 2PH3A 1AQJA 5AKIA 1JB9A 5AW4A 3EIHA 3HHEA 4INJA 2PRZA 3DV2A 2O7NA 4YPFA 1G3MA 1YOBA 4LBWA 3KTFA 2PO5A 2G82A 4RIIA 3FYSA 1Q7GA 2IEYA 3BCHA 1M1YA 1VIVA 1W5EA 4EPTA 1M7GA 4NU5A 2FPGB 3QXJA 3BMQB 4R81A 1FMLA 4ZU3A 2QORA 2CCGA 3UKOA 1HFEL 1V6CA 2DWUA 2WUWE 2AI1A 3GT4A 2A5GA 3NPAA 3DSRA 1LLQA 3RYIB 5B1YA 2WY2D 3ENWA 3B5IA 1F8GA 2XYVA 3BGVA 5BWBA 2OHGA 4NNPA 4X1OA 1BGXT 3IVAA 3DXZA 3PNKA 1DZIA 1NWCA 4EKDA 1Q0RA 4O1MA 1L7EA 1Z2AA 2F67A 4C6TA 3CNQS 4AU1A 4O2AF 3LHFA 3VOBA 4DREA 5C4GB 1XAHA 5DV9A 1J9EA 4B79A 5M5BA 1O9BA 4LZNA 1XJCA 4AJNA 5I7UA 3B7PA 3N0TA 3QUAA 3L7BA 3LJKA 3H5VA 2QYOA 2UUOA 1K5GA 3STWA 5ALJA 1JIVA 1T4DA 1GT6A 2F3PA 2ORIA 3EGCA 4TWJA 5H16A 5T4EA 4HJRA 4AJ9A 2DRIA 3CRZA 1W5BA 2RHBA 2ZU0C 5DHAA 1C81A 3ZV7A 5IT9A 3HN7A 4O2BF 2XNSA 3AUXA 3H6HA 4K9DA 4KYTA 3VV3A 3U44A 1SKMA 3K35A 1PWYE 1J5EB 2VRWA 1ENPA 1P7ZA 2XGOA 5HQ3A 5DCUA 4X1YA 3WKDA 4AG6A 1JAIA 4UAGA 1DC5A 4AUMA 1KTIA 3H16A 3ZBUA 1HPLA 1Q0PA 1Y9JA 1B6RA 1XTUA 3GVXA 3EEQA 3SZMA 3I2KA 4C89A 4EJSA 1NM5C 4CKXA 4TMZA 3DNPA 3T12A 4KNVA 3RHZA 1W36D 4MRMB 1O6BA 3OKPA 2FW1A 1L6RA 3OD5A 5K51A 3SX4A 2A9JA 4QBFA 4R2MA 4WEOA 2UYGA 1VRWA 3BIOA 3DTTA 4OMUA 2WV9A 4FEAA 4QDJA 3C4QA 1ZY2A 1YHYA 1BCRA 2H11A 1G21B 3CTMA 1IY0A 4HNQA 3TJMA 3WBJA 3WMFA 4W6ZA 1THGA 2Y2VA 1ZJZA 3G8DA 1YUNA 2CVZA 1EK1A 5L4LA 4QUHA 3ZH9B 1GP2A 2JA2A 4MB6A 1GKIA 1JPNA 4RD6A 4V3BA 2X9QA 1N77A 3SYTA 4CL2A 1BNCA 1C1DB 1TUGA 3S1AB 1HZZA 1QG2A 5LKRA 3GUVA 3AF3A 4LF6B 4XGQA 4JB3A 3KZOA 1VJ0A 1XL1A 3AF6A 4YRNA 4NNJA 3HVRA 2FE1A 1WB9A 1Y6FA 1CEQA 1FVFA 3EMVA 1NAHA 2YXBA 2V6GA 5A9TA 2GBFA 4MWZA 3W1WA 2YQ5A 3NWPA 2IHBA 3Q6IA 4L6AA 2D1RA 1R0XA 3T1OA 2OV1A 2AR0A 5AK5A 3P4XA 2PZBA 3S2ZA 3VU1A 2B9VA 4KU4A 1P3DA 5EMJA 1B6GA 3PTZA 2EFDB 3QX7A 2V7BA 4G41A 1DQPA 1BE8A 1FQOA 1T36A 5DT9A 1YE8A 5GONF 1L5HA 2B1IA 3I6BA 4WAUA 1BN7A 1PLLA 4PHFA 1NG9A 3LSYA 4DPLA 3QG5A 3E22B 4AJJA 3W9YA 3CIFA 5JV5A 5IK2A 2NADA 2PN1A 3HXLA 3RYHB 5A4FS 1DMSA 2CZQA 3CU5A 1FFGA 3EZYA 1N5LA 3W0LB 2NU8A 3L0DA 4Q4HB 4BY9E 1NU6A 1QRUA 4O4LF 3OVMA 1XZKA 3T7KA 3TX2A 1R0WA 4CDMA 3D31A 4C05A 4A03A 1CKEA 1VJGA 1A9XA 2XRFA 3W2TA 2C2WA 1M2HA 4QPDA 2QL7A 2AS0A 3UK7A 1EXMA 2PK3A 4PX5A 3QEAZ 3UAWA 1QO0D 5DSZA 1KMMA 2R1TB 4PCVA 2P9QA 3TOSA 4HFMA 1GFWA 2WEKA 3H5OA 3AYXB 3Q8WA 4JYCA 4GWGA 4OAPA 3MEQA 3I0MA 3LUFA 4E5DA 2YWBA 4KHPB 1NKSA 1DQNA 1Y8QB 1ENOA 1XVAA 4GICA 4QUAA 4B3JA 4EX6A 5BQ3A 1F60A 1T2AA 4M38A 4RHCA 5KMGA 1UWVA 3PK0A 5IAGA 4K1XA 4S0ZA 1ZCFA 3EXG2 3RYHA 3H11A 3TTWA 2IK8A 2C9DA 3GBPA 1DIAA 3GLUA 5AVZA 1A9OA 4PZUA 1HMYA 5C81A 1P8AA 3R1IA 2ZQ5A 2HC9A 2XJ4A 5CH3A 3Q88A 1ZNQO 3GJ3A 3I73A 1PR0A 4KE6A 5DT2A 1CZNA 1M9NA 1II8B 1W0KD 2QI9C 4MTCA 1LDBA 1O5TA 3JW8A 2ZUSA 2O0HA 1DDIA 1PJRA 1DLIA 1YQWA 3U3JA 4YP9A 5IABA 3VTFA 3GFPA 4P34A 1YA6A 3PP8A 1W5TA 2GQ0A 3CPJB 2GEBA 2PPVA 3UMSA 1BAPA 3LKZA 2WDZA 4AJOA 2V7VA 3RSCA 4MCAA 1C9KA 3DE4X 1KK3A 2B2CA 2ZI5A 3VYRB 3ZK8A 4BNGA 3BB4A 1O4WA 1RFGE 3MXOA 2REBA 1S3GA 3M6AA 4PR3A 3T15A 2O54A 3A4YA 3M83A 1J2RA 1HO3A 2BEWB 3D8RA 3TZLA 1DO0A 4MV3A 2GM3A 2K2QB 4GWLA 3ON5A 2I1WA 1BDMA 2HA5A 2RKWA 3A4NA 3KJGA 4JB2A 4NJOA 5C51B 1F7UA 1Y8CA 2CUKA 4QICA 3OCCA 2LDXA 2VDWB 2R6JA 3E6AA 5SYNA 1Z4NA 4OHXA 3SQOA 5BPHA 2ZBEA 2P2CA 5B6JA 1W7AA 2FPGA 3O2NA 3WLQA 2V6BA 1MIOA 2I4TA 2X42A 1NVVQ 3AHEA 5D01A 3SQLA 4UOZA 3U19A 2XGMA 3WB0A 3CC8A 3LT2A 3FHLA 1GA4A 3PCRB 5FUBA 5BVGB 4PAQA 4WOCA 3B2QA 2FSHA 2CXXA 3AWIA 1MTZA 1ZQ9A 2HIMA 2Q50A 3G8AA 2WWYA 4P7JA 4UHKA 3NHFA 2GBCA 2GXAA 5KVSA 2PL9A 2WWTA 3PNOA 4A9AA 2XXAA 4TLDA 2V4UA 2GETA 5AW5A 4F60A 1ZZGA 4EBBA 3IJRA 2AYXA 1AB5A 5CYOA 2AB0A 2V7QA 3FFWA 4Y98A 4YROA 5DLQC 4ENRA 4F3NA 1IQ0A 1JPUA 1W5FA 3ONVA 4NICA 1HEIA 2AC2A 4FHEA 4ZARA 2F8TA 4CTOA 1Z8FA 3V2GA 2WIFA 5ED4A 5JOQA 2YZNA 1WDKA 3B48A 3KD3A 4RVGA 5JPCA 5FUXA 1B0UA 1KZHA 4RX1A 2B30A 2UYHA 1TJPB 2NZWA 2YXNA 1W4BA 1QHXA 3L4EA 4J0GA 4KH0A 3TCKA 4ALKA 3W6OA 1IY2A 1ZMOA 2Z6QA 3HXTA 4OJQA 4W63A 2LCIA 1Z62A 5AVRA 4TL6A 1JP7A 4PZZA 1S89A 3TJRA 2HU5A 3A05A 5AJXA 4BZZA 4DCTA 2Y1DA 5BT8A 4KQFA 5J4KA 1FLVA 5DLPA 3D6JA 4EFKA 1XRJA 2I4MA 2XVXA 5TT0A 4YP5A 1DXOA 2A5FA 4P35A 4PPYA 3HRIA 5E6UB 4FE7A 1ILWA 2GZ2A 1LQUA 1L8OA 3P52A 1LVGA 5TJ9A 3IVMA 2CSUA 2R1ZA 2WKWA 3EOBI 2CXRA 3P32A 1RP7A 4QAQA 4OCZA 2WD7A 4X65B 5IF3A 4C88A 2WWFA 2ZZMA 1ISHA 3JRWA 5FDFA 1OLSA 3CR3C 6PFKA 1YUBA 4RENA 1OR8A 1B23P 1PDWA 1Z0DA 4YDSA 5LP6A 1NW8A 2QLMA 3HKDB 2WUFA 5FUWA 1K7FB 1YMUA 1QORA 1NBMD 4F2HA 4QG3A 1CY8A 1U31A 3VO1A 3JYPA 1OLXA 3DWFA 3NHAA 1JDTA 4GMHA 1ONNA 3KFLA 5KAPA 4Y9RA 4CG3A 3E35A 3GEHA 2CLKB 2NSHA 1NYLA 4ON9A 4Q0MA 4IDFA 2CJWB 3SI7A 4BNVA 1LXCA 1U11A 1YV9A 1Z7WA 2C5GA 2YMMA 5AI4A 1G38A 1GAEO 1RXYA 4I1OA 1NQXA 4FHZA 2VUTA 4TYMA 2B4QA 1WSWA 1UK7A 2FAXA 4Y67A 3IUJA 2Z0MA 4FOLA 2WMYA 4NJMB 1U6JA 1U7OA 2BEWA 2ZYHA 3AKCA 1WXEA 2WU0A 4GP7A 3B2EA 1XNRB 2WSMA 3F6PA 4P54A 3EVTA 5KYNA 3U09A 1RWOA 2GKGA 2PUJA 2ZYRA 3CW9A 3UAXA 1G0OA 4WZAA 5T5QA 4BBZA 1XEWY 3LU1A 4UHJA 2W2VA 1SOVA 3DQPA 3QLTA 1N2SA 2YWEA 2CLCX 3H2BA 4O2BA 3RRYA 4ZRMA 2C8JA 4OQYA 4GPZA 2WIKA 1HL7A 1U0OC 3I8SA 4MW9A 5AM1A 1Q0UA 1U98A