4FTWA

Crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
b'IMTRKLTFGRRGAAPGEATSLVVFLHGYGADGADLLGLAEPLAPHLPGTAFVAPDAPEPCRACGFGFQWFPIPWLDGSSETAAAEGMAAAARDLDAFHDERLAEEGLPPEALALVGFSQGTMMALHVAPRRAEEIAGIVGFSGRLLAPERLAEEARSKPPVLLVHGDADPVVPFADMSLAGEALAEAGFTTYGHVMKGTGHGIAPDGLSVALAFLKERLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase/Carboxylesterase
molecule tags Hydrolase
source organism Rhodobacter sphaeroides
publication title Enhanced enantioselectivity of a carboxyl esterase from Rhodobacter sphaeroides by directed evolution.
pubmed doi rcsb
total genus 71
structure length 220
sequence length 220
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ftwA00
1UK9A 3QPAA 5A7GA 2GZRA 4CG3A 4GI1A 4HXFB 4WDQA 2XUAA 3KWFA 4CCYA 5FUMA 5HF9A 4N8DA 2WG1A 3HI4A 1NX9A 2Z5GA 3T4UA 2C7BA 4EA6A 2BAGA 1QIKA 4QEKA 2XQFA 3I2KA 1QE3A 2DHDA 2JGLA 4BZZA 1E8MA 3DOIA 2WIJA 2PSFA 1VA4A 3W9BA 3BXPA 3DKKA 2Q0XA 4C4XA 3GFFA 3S8YA 4AB1A 5LLSA 5HFNA 1QOZA 3ESCA 2CBGA 1LPNA 1MX9A 2QUBA 1UOPA 3STVA 3C6BA 3AIKA 2D0DA 3CXUA 5AI5A 3QITA 3RM3A 2O2HA 3V1NA 1CUIA 3B12A 1UKCA 1H2YA 4TPKA 1KU6A 1VLQA 4BTVA 1PJAA 2YYSA 2JGIA 3BE8A 1QFMA 2IITA 4P92A 5EGNA 5HK8A 3C45A 5ALSA 3TGLA 1CVLA 4AX4A 2GBGA 5A6VA 3HYSA 5CW2A 2WHPA 4LHEA 5EI5A 5D7BA 1CUEA 4TVKA 1E8NA 1AURA 4J0HA 1C4XA 5HQ3A 1D07A 2QRUA 1TAHA 1E3QA 1UZAA 2O2IA 3IULA 1W6RA 5D3KA 3ICWA 2WJ4A 4U2DA 3HLKA 1QO9A 4JYMA 1HKHA 1P0QA 3C8DA 5AI6A 4Z49A 1MO2A 1LGYA 5LZ8A 4XJVA 2WIGA 3K9BA 4RNCA 2VJDA 4UFNA 1SCKA 5CH3A 4NVRA 4KEAA 1XQWA 1ZI6A 2O7RA 4LYDA 5I7UA 3DQZA 1MX1A 2W6CX 3AZPA 4HRXA 1XZMA 4KAFA 3FVRA 1LZKA 1XZHA 3FLBA 1B41A 3HABA 3EQ7A 4L3WA 1SCIA 5AM3A 1P0MA 5AI4A 4KE7A 4NMWA 4OYLA 2RHWA 2WU3A 2OQIA 3W05A 5H3HA 2OCIA 3QMWA 5CRIA 1QIDA 2AJLI 4W1PA 4HS9A 2CB9A 4I19A 5ISMA 2WILA 3C6YA 1L7QA 5KWIA 1ZOIA 3F96A 2OCKA 1DX6A 4OSEA 1MNQA 4F5ZA 3F98A 1R3DA 2H7XA 3MUNA 1UFOA 5DYWA 4H7EA 5ALFA 1XFDA 5C8ZA 5SYNA 2E3JA 2XT0A 5DWDA 3IDAA 5CH5A 3EQ8A 1GXSA 5AKJA 3TJMA 3DKRA 4OU4A 3WKDA 2Z8ZA 2OLEA 5JYCA 3D7RA 4QLOA 2DSNA 3IUQA 4X85A 3CN9A 1RWQA 3WZMA 4AMYA 4OB8A 2WTNA 1ZIYA 5DLPA 1DINA 4UBNA 4Q05A 4IH1A 1R1DA 5AM0A 2DHCA 4QZVA 3FWHA 4GEGA 2BCEA 4HTAA 4BZWA 4ARBA 2Y2VA 5ALQA 3STYA 3WK9A 3WYDA 1L7AA 2WHRA 3HZOA 4F60A 5AM2A 3F67A 1QIEA 1QO7A 2C0QA 4K6HA 3VDXA 4MYSA 5DTJA 5AHXA 5I9IA 2HRQA 2IIVA 1JJFA 3DYIA 3STWA 1TRHA 3BDIA 3HC7A 1CUCA 4KJXA 2YXPX 5HFAA 1YR2A 4F0JA 1K63A 2C58A 4Q1VA 2X8BA 2BUAA 4CCWA 2HDWA 4X90A 3N2ZB 2WJ3A 3D2AA 1H2ZA 1DWOA 5HKBA 2WIDA 1WHTA 2XMGA 5EHQA 2Y2UA 1MT3A 3VVLA 2VSQA 4B9AA 3G9TA 5K3EA 3A2MA 3Q8WA 3V1LA 3QVMA 4Y2XA 2BKLA 1XRNA 3G9ZA 3FOBA 4LXGA 5AKZA 4RE5A 1XRPA 2V98A 2RONA 3O4JA 3X3HA 4EY7A 5ALYA 4JUIA 4MYDA 5HQ3B 3BWXA 2Z3ZA 5T4HA 3DJYA 4FNGA 4E11A 1LPSA 4OB7A 3M83A 3QYJA 1RP1A 4UBLA 4XVCA 2J4CA 3R3YA 1C7IA 1XQVA 1Z68A 1UKAA 5K3CA 3A70A 5ALTA 4INZA 1EDEA 5SYMA 3G0BA 2XQGA 3BJMA 3D2BA 3RARA 5CT8A 3GELA 4OB6A 5F4ZA 2V9ZA 1JJIA 4L9AA 3KOOA 3HRHA 5EIEA 3DS8A 5AOBA 3UUFA 1XRRA 5JAUA 3ANTA 5CMLA 4BCBA 5AK4A 2B20A 2O7VA 2DCMA 4ZXFA 1YCDA 3OC0A 3I2GA 4UFOA 4EBBA 3DL7A 1IZ7A 4H35A 2RIPA 4KAJA 2H7YA 4HAIA 4BRZA 1XZBA 3D59A 3RLIA 2HIHA 2WUEA 3VJKA 2QUAA 3TRDA 1QIJA 5K3FA 2VQ6A 4WFJA 1IVYA 1ZI8A 4K5QA 3E1GA 1VE7A 2XMRA 1G4HA 4LYEA 5LIPA 3OOSA 2J3DA 1EI9A 4FMPA 3WKAA 2QM0A 1N5MA 3QMMA 4HXEB 4KE9A 5AKEA 1QIFA 2OAEA 3D3NA 2VJCA 2XDWA 5HZGA 5E4TA 5CURA 4MWSA 1CUJA 5JZSA 3FSGD 2FX5A 4J0JA 1UKBA 2G63A 1BEZA 5ALIA 2GYVA 2X5XA 4Q3LA 4G5XA 1TQHA 5DYTA 1W4LA 3D5EA 2QOEA 4DSZA 4B9EA 4JNCA 4U2CA 1UOOA 3G02A 4UHHA 4Y2JA 4U2FA 1VA5A 5ALDA 4Y9SA 4C89A 2VATA 1DWPA 2WQZA 5A71A 1U65A 1YS1X 1XZKA 3FNBA 5JD4A 4G8BA 3V9AA 2AJ8A 2YH2A 1USWA 1HL7A 1P0PA 4UFPA 1XLVA 1G66A 1IUPA 3I1IA 1O6FA 4HRYA 1P0IA 4PSUA 5AKLA 3IUMA 3IBTA 4AN0A 3DYVA 1EK1A 3WWDA 4DIUA 4BC0A 3M82A 1FJ2A 4C01A 5FOQA 2AXEA 1X70A 2IX9A 2JBWA 5AP9A 5IVDA 4L0CA 5EHZA 2ZSHA 4EY5A 2WIKA 5AH0A 3O9VA 1CUFA 2Z8XA 5AIBA 1ZIXA 2BGNA 3G7NA 3VVMA 3M3DA 4K6GA 1SFRA 2HADA 1QFSA 1DQZA 4PW0A 5ALHA 1MX5A 1W52X 4EHBA 1LPBB 4A23A 4U2BA 4DMFA 3PUIA 1ACLA 2ZYHA 3ANSA 2VA9A 4GECA 3A2NA 2H1IA 3AIMA 1XLWA 2XB6A 4QDTA 1OCEA 1XZGA 3WK8A 3WL5A 5LZ2A 1NU8A 3G8YA 3KSRA 2D5LA 5AO9A 2AJDA 3H2IA 2CUTA 4W1SA 5LZ4A 1LZLA 3HXKA 4Y2RA 5IH7A 1HQDA 2B4KA 1AC5A 4X6XA 5AICA 1EB9A 3G0GA 4MQMA 3FYUA 5ALXA 3I2IA 3GBSA 4NZZA 3VJLA 4Q3OA 3ZLTA 1XQXA 1F0PA 3IB3A 2XUJA 1YSCA 1BRTA 4PF1A 2NW6A 3PDCA 4MJ3A 3FYTA 3DDUA 2HA4A 1O6GA 5FPPA 1ACJA 1LNSA 5C81A 1BS9A 4KYVA 2XMDA 5I8PA 4ARAA 3A2LA 3YASA 4KRYA 1ZGBA 4WFIA 2C4HA 4UBMA 3WWPA 4ZI5A 3F8SA 3D2CA 1EXWA 5JALA 2XI4A 3RKSA 3STUA 3R3UA 4KE8A 2PM8A 1THTA 1CEXA 4D9JA 1WB6A 3QH4A 1MN6A 4FLFA 4WY8A 4WFKA 4J0DA 4QWWA 2XUPA 4EY4A 4C87A 5HF6A 3HSSA 4BRSA 4X6UA 4BVLA 1BN6A 4EY8A 1J2EA 2RI6A 4ZGBA 2FJ0A 3WYNA 1W76A 4EB0A 3H0CA 4UBKA 4EUSA 5A7FA 3AJAA 1SOMA 4BE9A 3DL4A 1TCCA 3C8HA 1CUHA 4PO3X 3CN7A 5JAOA 2WUGA 4FNMA 3F9CA 1VJ5A 4W1QA 3H2KA 1E66A 5EHNA 1QGED 3UUEA 1WCYA 2C5FA 4G9GA 4J3JA 5JATA 3LLCA 3WWOA 4DMHA 1CR6A 2JF0A 4IH4A 3FYUB 3R3ZA 1CRLA 4DSAA 4X3CA 2PUHA 4FOLA 5ALLA 4X7BA 5LYYA 4FLMA 2ZYRA 1XLUA 4C88A 4J7AA 2JEYA 2UZ0A 3FCXA 3PE6A 2Y6VA 4QDZA 3WKBA 1K5PA 5ALWA 3I2HA 4I4CA 4UHCA 1Q83A 3G9XA 2HA6A 3FAKA 4C4YA 2OXEA 1LPMA 5ALNA 2GBCA 3SX4A 1C7JA 3W04A 1F8UA 3AFIA 3LIPA 1K4YA 3WIOA 1ZD2P 3F97A 2XMCA 2PX6A 4UHDA 3DOHA 1FSSA 3R41A 3DNMA 4BVKA 1CUAA 3O4GA 2ECFA 3O4HA 5AM5A 1CQZA 1VXRA 1YA4A 1BU8A 4Y2YA 1EX9A 4H18A 4CFSA 4IQ4A 2WIFA 1CFJA 1CUBA 1ORWA 5A7HA 1HDEA 4Y2SA 3IIIA 2DQYA 2VJBA 5CXXA 4I3FA 2XLBA 5FRDA 3I28A 2WLSA 3GROA 2OGZA 5DNWA 1QLWA 1AKNA 3JWEA 5D3ZA 5ALMA 4W9RA 2RAUA 5IVIA 3CCBA 4CG1A 3ILSA 3EIOA 1GGVA 1SCQA 2VJAA 2WFZA 1WB5A 2ZSIA 3C70A 1N8SA 1E8DA 1JMYA 1UK8A 3OM8A 4KACA 4OPMA 2XQJA 4ZWNA 1AGYA 3BL8A 4GBGA 2XMBA 4N8SA 1EDBA 2I78A 5K3DA 5BWBA 1FFCA 1ZD4A 3LP5A 4QDUA 1MNAA 4BVJA 1QONA 5BWCA 3GA7A 1PV1A 3FBWA 1YA8A 1WB4A 1YB6A 2HRRA 4P93A 1NU6A 2ZVDA 3WK7A 4DYHA 4PSCA 4UHEA 5FDFA 2ROQA 5E2IA 4BAGA 1UXOA 1MAHA 4AO8A 3B5EA 3I6YA 2WUFA 2HA2A 4RPCA 4QA9A 1J07A 4FBMA 1W1IA 4ZREA 2I3DA 5ALZA 3PUHA 4CIAA 2CKMA 2Z3WA 5JIBA 4DNPA 1EVEA 2WG2A 1VZ3A 1CUXA 5ALJA 3MUOA 4PQEA 1JKMA 4BDSA 1QIHA 1BCSA 3WKCA 5LZ9A 1BROA 5IKXA 1JT2A 1MTZA 1GZ7A 3O0DA 1VXOA 1BCRA 4AO7A 4BYMA 1GPNA 2HFJA 1TCAA 1H2WA 1Q0ZA 1R88A 1ZD5A 4E15A 1CUDA 5AOCA 4J0IA 3T52A 1EB8A 2PPLA 2CJPA 2GYWA 2C0PA 5EIHA 4BDTA 4PSDA 3WL7A 2JEZA 3AZOA 4DGQA 4DNOA 1QJ4A 1VKHA 3I2JA 3EBLA 4PNZA 3KXPA 2OCGA 2QR5A 5LP1A 1J06A 1AUOA 4FTWA 4BC1A 5JAPA 3EQ9A 1UK6A 1U2EA 2HL6A 1XZEA 2WTMA 2XUDA 4OCZA 3OPMA 4GW3A 3L1JA 4BE4A 2OQVA 2HA3A 1XRLA 5KBYA 3U1TA 1TCBA 1M33A 1QTIA 5A62A 5CT6A 4GDMA 3AZQA 1XRMA 1DU4A 3LIIA 4X6YA 4WDRA 1A88A 1TK3A 2H9YA 5AI9A 4BTLA 1DX4A 3BIXA 4OYYA 5LZ5A 4AZ0A 1YB7A 2LIPA 2PSDA 2ONCA 3WK6A 1QIIA 4G9EA 4BATA 4B83A 3BJRA 5JADA 2OCLA 3I6ZA 4IHAA 4RE6A 5K3FB 3IVMA 4OU5A 4B7ZA 3H2HA 4M0MA 1DTEA 4QDXA 2WG0A 4AXBA 2VT7A 3WJ2A 4XX1A 2XLCA 1KEZA 3QBJA 1YASA 3KWJA 4G4JA 1HLGA 3IA2A 3KDAA 1QTRA 5AK5A 4KR0A 3ZV7A 3WA6A 3SWWA 1ODCA 1G42A 2XMZA 1UOQA 2BJHA 4GXNA 1VZ2A 1E5TA 3AIOA 1YAHA 2PVSA 1GKLA 2FJPA 3WL8A 5AKGA 4O08A 5KREA 3D4LA 2ZJ6A 5AI8A 1R50A 2QS9A 5FLKA 1A7UA 3H19A 1WPRA 5K3BA 1N1MA 1VE6A 3U0VA 4G8DA 5LKRA 3C87A 3H18A 4UBOA 4JEIA 2VT6A 2ZYSA 4BBZA 3ESBA 1I6WA 2R11A 4OD0A 3OURA 3FSGA 4B6GA 4J0CA 1DWQA 5AIAA 3H1BA 1GQRA 3G9UA 4YASA 4A16A 2QJRA 3A6ZA 3AILA 1K6EA 5ESRA 1CUVA 1EVQA 3AUKA 2QVBA 3ICVA 5C8VA 4AQDA 2HA7A 1RYYA 3WIBA 2WHPB 1IZ8A 5T4BA 1S8OA 1XKLA 4AZ3A 2W22A 4HVTA 2ES4A 5IVKA 4FKBA 4EY6A 2Y1KA 5BV7A 2WJ6A 5AM1A 6YASA 2RGUA 3WA7A 4X71A 2P8SA 3KD2A 5IVHA 1F6WA 4H7IA 4YPVA 1JJBA 2RHTA 2GZSA 4LKOA 4Y2VA 3MVEA 1Y7IA 3Q0TA 4CI9A 4Y7DA 1VOTA 4V2IA 2CMFA 3VKFA 2DFPA 2EEPA 3R0VA 1H2XA 3V48A 4B85A 3BDVA 5AKXA 4DMCA 3SC2A 5A2GA 5HF5A 2VTVA 3QPCA 4UBJA 2QXTA 3WMRA 4H7DA 2XUKA 4IO0A 3N0TA 1GPKA 1WOMA 1R9NA 2VF2A 5ALOA 2OG1A 3JW8A 1LBSA 2JIDA 1HBJA 1HPLA 2YASA 1JU3A 4B0OA 5AK6A 4BP9A 4FHZA 4FFWA 5CH8A 3W2TA 2HU7A 1R9MA 2X76A 4BCCA 4KAAA 4H0CA 3HEAA 2OGTA 2QT9A 2XMQA 2I3ZA 2HA5A 3E3AA 3HJUA 2XUOA 5DNVA 4UHBA 4H7KA 5FXMA 4DTCA 2VAVA 1AZWA 3C6XA 5JAHA 1OILA 2J3QA 1Q84A 5C8XA 3SK0A 4DLNA 3C5VA 2PU7A 4J03A 2AJBA 2HHAA 1QZ3A 3EF3A 3L1HA 1XZJA 4WCVA 5EFZA 3STXA 3ZPXA 2ZJFA 2H7CA 3WLAA 1EINA 4M0EA 1LPAB 2QTBA 3BIWA 3GUUA 4U2EA 4OUKX 3FCYA 3ZLUA 2QKYA 1XRQA 4X00A 3FYUC 2XUQA 3O4IA 4MWTA 3UMJA 1T2NA 3H2GA 5J3JA 4H77A 4CG2A 2HFKA 4N8EA 4UHFA 2QZPA 4FLEA 2JGMA 1YS2X 2XMSA 4CIBA 5ALKA 3WKEA 2Y6UA 1WPXA 5T4EA 1GKKA 2G5TA 1XZCA 2PBLA 1X2EA 3ZI7A 4J0GA 4G4IA 1K8QA 1WHSA 3QPDA 2CZQA 4Y2PA 2WFLB 4LXHA 1PFQA 3ZLVA 2J4FA 1Y7HA 3BF8A 4DNFA 4FWBA 4H7FA 2JGEA 7YASA 4B82A 3PF9A 1N5RA 4A5SA 2R8BA 1LBTA 4UPDA 4Q34A 4IH9A 3DEAA 5AKKA 2B61A 5JD6A 1XZDA 1JFRA 4TGLA 5FP0A 5ALEA 1QIGA 1UK7A 4YX9A 5AK3A 1U8EA 3I1YA 1CQWA 4GHWA 5CT4A 1FFAA 2HA0A 2HU8A 1AQLA 4B80A 2WUDA 4F21A 3FLAA 2XQKA 3ESDA 1FFBA 1ZI9A 3PFBA 4HZGA 2AJCA 4X95A 4AMZA 1SC9A 4WY5A 2BUCA 1AX9A 3PICA 1EK2A 2PU5A 5ALUA 4JYPA 1JMKC 1XZAA 1H23A 1R4ZA 1CUUA 3JYHA 5AM4A 4P9NA 4QE3A 5AJHA 3W9UA 4K6KA 4QNNA 1CUZA 1LLFA 4XIIA 3WJ1A 2CEKA 1CUGA 2O2GA 3AINA 1KU0A 3ED1A 4Q3KA 4UUQA 3R3WA 3VJMA 1G5FA 3GZJA 4RGYA 5LKAA 4FDMA 5JANA 2VEOA 2XQIA 4B0PA 4B84A 3H17A 4B81A 4DM7A 4ZRDA 1UWCA 3VXKA 5FKJA 3OTQA 4Y2UA 1FFDA 4W1RA 1MJ5A 2C5GA 4LXIA 4FFVA 1B6GA 3O95A 3DD5A 3L1IA 2DR0A 5JZ9A 4QWMA 2BUBA 1DQYA 5LZ7A 4H7HA 1TIBA 1GQSA 1ZJ5A 2OPHA 4YK7A 3WQHA 4M0FA 3W06A 4N5HX 3HACA 1EA5A 1XROA 2XUIA 4MEAA 2JGFA 4E14A 1CUWA 2ACEA 3S2ZA 3NOXA 4W63A 4Y2QA 5JD5A 1ODSA 2QMQA 5CTAA 4S0XA 3VISA 5AKHA 1XZIA 5AKIA 1XZLA 1ETHA 4H7JA 4WJLA 3D0KA 1EDDA 4N5IX 1WM1A 2EDCA 2QXUA 2WFLA 3K2IA 2PUJA 1CV2A 5FPQA 3H2JA 5EHXA 2PSHA 3C5WP 5D6OA 1ZD3A 2GBFA 4X97A 2GBIA 5ALRA 2BFNA 4G8CA 5K5EA 5ALGA 3V1KA 3MGAA 1CUYA 1MAAA 1ORVA 1X2BA 2DHEA 3LCRA 3QZUA 2V97A 4ZV9A 3V1MA 3H04A 3RK4A 1TKRA 2EDAA 3I6MA 3H1AA 3R3VA 1ZGCA 3QMVA 5EIAA 1IMJA 3WI7A 3M81A 2WKWA 4ETWA 1QIMA 4LIPD 2DQZA 5CXUA 2WHQA 2JGJA 2G4LA 3PI6A 4K2AA 1GT6A 4Y2TA 4ZV7A 1XQYA 4PV7A 3I2FA 4AN1A 1CIJA 4KRXA 2FUKA 5HF8A 4L72A 3G0CA 1F0NA 2PSJA 4X91A 1JI3A 2QJWA 3LS2A 2ZJ7A 2ACKA 4X94A 2XE4A 3STTA 4ITVA 1IUOA 5JASA 3WL6A 5ALPA 2G5PA 5CT5A 4MEBA 1CPYA 3B3QA 3E4DA 4FBLA 4XWGA 2HM7A 3DCNA 5E4YA 3CCCA 2ZYIA 4MQLA 1H22A 5KWJA 1EHYA 5AOAA 1IUNA 2WU4A 3QM1A 3WK4A 3PFCA 3WWEA 3ESAA 2B9VA 4E46A 5FV4A 5DNUA 4BCDA 2HU5A 1E89A 1AMNA 4J0KA 3IUJA 1U4NA 5JARA 4G4GA 5DTIA 2BGRA 1ZJ4A 1GPLA 3FVTA 4HXGA 5AI0A 1MPXA 3NWOA 4DMKA 4JH0A 4BAUA 5DJ5A 1BEEA 1DT5A 1CUSA 1YAJA 3R3XA 2WFMA 3NGMA 5T4FA 4KE6A 5HCUA 4CCYB 1ODTC 5CT9A 2PSEA 5CBKA 4QDOA 3TEJA 2GYUA 4AO6A 3PF8A 2JGKA 1OXMA 4C4ZA 5K3AA 4BB0A 5AKYA 5YASA 4G1FA 2XUHA 1LPPA 2XUFA 1THGA 4NS4A 3OG9A 4BAZA 1Y37A 2XUGA 1LPOA 1ZICA 4MXDA 5JZBA 1XZFA 3WWCA 3IUNA 1A8SA 2K2QB 1ISPA 3K6KA 2OAGA 2V96A 4X92A 1A8QA 5E4JA 3E0XA 3WK5A 4UBIA 3IURA 3O9MA 3WZLA 4QLAA 5HK9A 3P2MA 3R40A 4P08A 1T4MA 3G0IA 1W75A 1J1IA 3C6ZA 5DYYA 1A8UA 1BN7A 3DLTA 4BP8A 1UT6A 2WM2A 1MU0A 1BE0A 5HKAA 4C6HA 1DT3A 1Q0RA 2OGSA 3ZWQA 2WSLA 1JU4A 4DNQA 3NUZA 1CLEA 3G0DA 3BF7A 1FFEA 5C7YA 4GWLA 4Q82A 3C43A 2I03A 5BOVA 1XKTA 2PKYX 4GLBA 5ALVA 2PL5A 2VAXA 4EZIA 1EH5A 3FLEA 4U2GA 2ORYA 1L7RA 4ROTA 4X93A
chains in the Genus database with same CATH superfamily
3U31A 1NG9A 4GQAA 4B35A 4CG3A 5GTDA 3ZGZA 1IU9A 2GAJA 3TWOA 2G88A 2ZBUA 1IM8A 3DBHA 3QMPA 2OZPA 4HXFB 5IUNC 3GLIA 2GN1A 3ND9A 5CCXA 5HQTA 3CRRA 2WG1A 4DUGA 3U09A 2HR1A 3E1SA 3IT3A 3DMDA 4HNQA 4Q4LA 4IQ0A 2VO1A 4KXQA 4CIDA 1JHRA 1NX9A 2I0FA 4LV8B 4U6NA 2G9NA 3VR5D 2Z5GA 4EFLA 5BSGA 5LXTA 1AV7A 2C7BA 4EA6A 2H0RA 3PXGA 4EFNA 1E9VA 1QIKA 2OBNA 2E49A 1N9KA 5BMVB 4RPIA 4PE5B 2B4TO 3WRXC 2JGLA 2RHDA 2HF2A 3TOCA 1GZDA 1LSOA 2P3QA 2M6LA 3TNYA 5EUMA 2GA9A 2IW3A 3LPAA 4N01A 1TNDA 3UATA 2HSJA 3CZRA 1SCJA 2NACA 4R3UC 1N4DA 4DCTA 1P4JA 1K86A 1U0EA 1E8MA 2POCA 3B2QA 3DLAA 5FAKA 1PT7A 2Z83A 4G0XA 2EFHB 4MP6A 1PEAA 4WV3A 2PSFA 4H17A 3W5VA 1DRUA 4EABA 7GPBA 4ND6A 4P4UA 5DK6A 1VA4A 2WV7A 5E9JA 3EF1A 2O8CA 1AKUA 3CUSA 1PZGA 1YK0A 1XJQA 3HO1A 1X0VA 3CR8A 1BVHA 1YIDA 1XNJA 3VO8A 5JCOC 2BFWA 2WJYA 1OI2A 2Q0XA 1KA9H 2OB2A 1ORDA 4ZVMA 1ID8A 4FEAA 2AKEA 2WB2A 5ECGC 1LRLA 5FYDA 2NAFA 3AFOA 3I52A 1SVLA 3NTLA 4AFNA 1W5SA 1FFXA 5EZQA 1ZWKA 4RTNA 1LF0A 3GJ3A 3RHSA 3IPLA 3A0RB 2H07A 1QOZA 3DAYA 2BM9A 2ABWA 1ULZA 2CJFA 1BFKA 3ESCA 2HMVA 1LLCA 1EQ2A 3TOSA 1LPNA 2V7EA 4EOGA 4XLLA 2QUBA 1QSGA 2JI4A 4LWOA 4QUKA 5FBKA 3EG5A 2OCBA 3SDZA 3STVA 4XYMA 4O4IB 1AO3A 3KTAB 3EEIA 4PS1A 5B4TA 1XEXA 4MW7A 2BHLA 4IMIB 3GMSA 1S2MA 4QU0A 1HDGO 3MMSA 4UCWA 4AG6A 2YWBA 1BW9A 1Z0KA 2XWSA 2BZ1A 5JAQA 3EMDA 4OMCA 1V5WA 1UKCA 1W2WB 2P6MA 2YJ5A 3IOMA 4BNLA 4ENRA 3EZ2A 4BLRA 4PINA 2QTZA 4WXYB 3DB1A 3V80A 2AH5A 3SIRA 3K9QO 4IIBA 1ZGZA 1JSLA 2YYSA 4YUZA 1W9MA 3MQ4A 3H2YA 1E7RA 2FMKA 4P92A 3DZDA 4OQ4A 2QUKA 2HK7A 4NS1A 2C8JA 1QM5A 2JFYA 2BCJQ 3HB1A 5M7EA 1PLLA 4FW9A 4B75A 1NT2A 5ALSA 5F2NA 1RKQA 2Q4BA 1NVTA 3EAFA 1A9XA 2I4TA 3EH1A 1L4EA 3SBDA 1GUDA 3IUEA 1HZZC 2I1VB 5FWAA 4ZVLA 3WYFA 3K3PA 1E2UA 4TXHA 3IT0A 1NJ8A 1TM5E 2D1SA 3OO0A 4EB6A 3L01A 1QKIA 4D1YA 3TB4A 3NRJA 5IAAA 1N2ZA 3PQFA 2IF0A 1BJKA 3EZGA 4EGQA 2BRUC 2CUNA 1G21B 3MXOA 3MWGA 3A6LA 4NYJR 4TVKA 3AB3A 4CUZA 4J0HA 3T3DA 4YEDA 4D98A 3UK2A 2QZ9A 1C4XA 3QQPA 5FWDA 1HMYA 2WTUA 4HQ6A 2AYZA 4P86A 4OFBA 4MUHA 1NI4B 4NRDA 2EIHA 1QXSA 2XVXA 1RP7A 3M4ZA 4XUCA 2FRXA 5ILGA 3TW8B 4C30A 1R0YA 3DWFA 3ESQA 3PXDA 4QQNA 5K6RA 1TMYA 5D3KA 5HILA 4KPFC 1U04A 3SGLA 3PGA1 5LQSA 2HLPA 3BN3A 4JQYA 5FO0A 1ZRMA 4TKUB 3ZH9B 3PJFA 3UXYA 1T1GA 2IHVA 2K87A 4JYMA 2IK8A 2OHVA 5F33A 1E2BA 2OO7A 4RTPA 3C8DA 4CEIB 3JQAD 2NZJA 4HAXA 4HY3A 2DULA 1GDTA 4DLBA 1PGQA 1CRWG 3KHUA 2AZMA 4QYIB 4BWVA 4F4UA 1Q20A 3PDUA 4KSCA 1BH6A 3TL3A 5L95A 1IE3A 2WIGA 1T9DA 4TV8A 5I45A 4HYYA 3VPSA 2WUVA 5CX1B 4DUPA 1SCKA 4IMRA 5CH3A 4JBNA 2EJWA 4NVRA 4LG1A 4D9MA 1B8PA 1S3SA 2JFHA 3VKWA 5IU6A 4YRZA 3VUEA 1XQWA 4L15A 4E4RA 2I8LA 4CIYA 3VX3A 1G7CA 2V7PA 1E94E 1T5TA 3F6BX 1UQRA 5JPIA 2QVGA 2C2ZA 1EBBA 3LXUX 5I7UA 2B1QA 3DQZA 3OEHA 2D5IA 5I9MA 1NW3A 3KZ1E 3INNA 2H5LA 1XZMA 1LRJA 2WKPA 4HRXA 5JOQA 1ISRA 3DZ8A 4HUQA 2P3SA 4RZXA 4N39A 4TZTA 3T7RA 1LZKA 3EYWA 4JT8A 4QYSA 2A3NA 1LH0A 1U4SA 2A9RA 1JIVA 3HABA 3PENA 4NBWA 4WH0A 2P2LA 4BMNA 5BV0A 3S1AA 1SCIA 1L7EA 4PNPA 1R5JA 1L1FA 1CF2O 5TF0A 3B1FA 5AM3A 2M98A 2O1XA 5FPHA 4B2IA 4MAFA 5LA6B 5JUWA 2JI8A 3AETB 4OYLA 4PZ9A 4QT4A 5IZCC 2GWRA 1P3JA 3OLQA 2JCVA 3U6KA 4XTCS 5SY4A 4JLMA 2Z5LA 5H3HA 1P7VA 3ZIDA 5EGSA 3C6KA 3AEXA 2C1ZA 5CJ2A 2W2PA 5A04A 4XQGA 1N34B 2EJUA 1JFLA 5FI1B 2AJLI 4MUNA 4JUBA 3HSYA 2HHCA 2AMLA 3JQ7B 4LQ4A 5IAJA 2WYHA 3M5CA 4P83A 4UDOA 3SJCA 3F0TA 2IU3A 1GL3A 2CY0A 1NIPA 2YMLA 1M8FA 4NE7A 4WZZA 2AG0A 4BFYA 3TUIC 4I19A 1L8AA 1F2UB 3JWIA 5D5HA 1U0RA 3NTVA 4A1FA 1QCCA 2JIBA 1J33A 3C6YA 1GLVA 2XB4A 1EP1B 1KMHB 4K9RA 3ZZTA 4EPWA 5BQXA 1HLFA 2E5FA 3F96A 4FBGA 3L8MA 1DWUA 1TCVA 2VHXA 1DX6A 1IFXA 4KO3S 4RCZA 3O38A 2Q4EA 2YXDA 2ZBDA 2RGNC 4IDHA 3OJWA 4M9UA 2IC5A 1U8XX 3MUNA 4Y3UA 5LWHA 3EIHA 1AE1A 5A6SA 3I39X 5F7OA 5DYWA 4JELA 4TLBA 3M49A 4H7EA 4B3JA 3T4PA 1MEOA 3C74A 3DO5A 4ZALA 3AYXB 2RC5A 3MJVA 1EFTA 1KNQA 2D7CA 2XV1A 1WWKA 1Y8AA 3P26A 5LB4A 5K2MA 5SYNA 5DWDA 3T0GA 1P1KA 3VV3A 2NSLA 4YLYA 5CH5A 3I5XA 4D4HA 1R6AA 1SD1A 1H1DA 2B8JA 2HPAA 4LQDA 4D8VA 1U2DC 1GPH1 1RWNA 1OAKA 3FTPA 3OQIA 2VRWA 5TEWA 4CKBA 2XZLA 2XTZA 2ANBA 4LXQA 4DXDA 4BO2A 5LQJA 1YMQA 5AHOA 4OU4A 4KO4S 4F96A 2DUNA 1OC4A 3G59A 5H9VA 2ZSKA 1JL3A 2AUTA 3SLGA 4EARA 3PDHA 2QIPA 4HSEA 2Z8ZA 4JVMA 2GEUA 2H4HA 3JAKB 3AP2A 5DCUA 5LLDA 1WUKS 3BH7A 2X4LA 1W0JD 2QNIA 4TQGA 1CP3A 3CWQA 4CKCA 1I94B 4MVYA 3UJDA 4RA9A 5JC1A 3X1XA 3I3SR 2B9EA 4JX8A 4EA8A 1EVLA 4RMJA 2D4AA 2WYUA 3GL9A 4X85A 1M54A 2UXBB 1RWMA 3K1YA 3ORYA 4BLUA 4EHHA 4BN5A 3I62A 1QF7A 2JLWA 1MORA 1X86B 4U5XA 1YVDA 3B9QA 3E15A 3E3NA 4NBSA 4OB8A 5F5LA 3EX7C 4D0SA 5SZKB 2JFQA 2QLBA 2VBCA 4Y9UA 5AQEA 5JSQA 4ZTUB 3DAOA 1Z8DA 2HBRA 1E32A 1W96A 4HMPA 1DINA 3UAOA 1BH2A 4YXWD 3AFNA 3R2JA 4UBNA 4JVSB 4XSVA 3ZE1B 1RHJA 5DYIA 4A8HA 5I9SA 1GVNB 5EFOA 5HTOA 3R8XA 2EEZA 1T8YA 3W6NA 2DFKB 3K2QA 1YULA 3ZE2B 2QMZA 2X2PA 1EK0A 1EE2A 1L4LA 1T9BA 2LNDA 4Q93A 5I5GA 5JAZA 2A94A 2JJ8A 3VR3A 3U7RA 4CDMA 3T7SA 4KKVA 3DZHA 4TZ6A 2Y2VA 3B82A 4U0KA 3WK9A 5KAPA 2VTBB 3B9PA 2JLYA 3KBOA 2W6MA 2WHRA 3P5BA 4G67A 1W35A 4I4IA 4MV9A 1R10A 3F67A 4PZDA 1UBHS 1DKPA 1KPGA 4WBNB 2WU1A 3VDNB 4K6HA 5A0TA 1FQJA 4DIDA 4FFRA 8ABPA 3BRWA 2HRQA 1AY0A 4EGJA 1MO5A 3WQQA 3DAPA 1V95A 2ZB4A 3GLIE 1AUVA 3DDOA 3ETEA 3L7AA 1G5QA 1JXOA 1K92A 1GUFA 1UUFA 1RLUA 2GSDA 2ODBA 2ZAMA 3STWA 4J07A 1KWKA 3HKDA 4TMKA 2BYTA 1KPHA 1RE1A 1TRHA 2ZCUA 1CUCA 2HY7A 2IUEA 3TLMA 3W8FA 1O5IA 1F20A 1OXSC 3HKBA 1V7ZA 1J4AA 3AW9A 3R6TA 4H15A 3JVUA 2BFOA 3F5MA 1FTGA 2ZJZA 4YAEA 3O31A 4Z1OA 2LCQA 1YU9A 1NUPA 1SM4A 1MQAA 3D8HA 1QB7A 3BRWD 5K0CA 4JMLA 4G97A 1SO8A 2BHNA 4MW9A 2Q8QA 2HDWA 3ID6C 3L9XA 2WJ3A 2JB9A 5A4KA 5KCZA 4TLDA 2D2FA 3CEMA 4R1OA 4YAUA 5DPMA 3UKJA 4PWZA 4YREA 3WC4A 4HC4A 4Q00A 1DE0A 4AQ7A 3TVDA 3IR5A 1QP7A 1T8RA 1DAHA 1P3DA 4RFLA 5KJ1A 1TUBA 1QV6A 4Y0NA 4JVLA 2XMGA 1C7EA 4G0QA 4O2AF 5FEMA 4UDXX 1YZFA 2E82A 2ECQA 2Y2UA 3OAAD 2GJ9A 1B8OA 2YRXA 5GP1A 5E38A 2OV8A 1E2MA 1SN7A 2I33A 4KYUA 3AY6A 4MARA 3RASA 1FNMA 5CDGA 1EQAA 1MT3A 2W6JA 5LVAA 1E3JA 1TZBA 2RHMA 1VIYA 5F73A 4BX8A 4DAEA 1SUBA 3CZ9A 3G9TA 3LDHA 2GOYA 2QD5A 5IARA 3NHJA 2MHCA 4CR8A 3V1LA 3BIJA 5CCEA 2B3DA 4MQEA 1OB5A 1WIWA 3FWYA 2XRMA 2O3UA 4L5IA 1RRCA 4D6PA 1XRNA 3DGEC 3L8FA 3WAJA 4BVGA 3EEBA 3FOBA 4Q1CA 3C3MA 5AKZA 4C5BA 5KNCD 5KHAA 1N9GB 1U8ZA 1O9BA 4WK4B 2BI7A 3UQZA 2ZLBA 2GGSA 1OBOA 1KO4A 2V98A 1IEWA 4UXJA 1M0TA 1VM6A 4ENQA 4CM1A 2Z9DA 4XOIA 4DY6A 4EY7A 3MEQA 2XBMA 2J6IA 5FT9A 2AX3A 2B4AA 1F60A 4MVJG 3BTOA 3EZFA 2FN4A 1D7OA 3SNKA 4RVUA 1W6UA 4K8RB 2Z3ZA 1YCGA 4BPRA 2R5FA 2W2LD 3EGCA 2QMUA 1FFHA 2DPLA 2V7GA 5T4HA 1YB4A 2VAWA 5GONF 5TPZD 5TARA 1TTTA 4D4KA 5AT1A 2QVYX 4E11A 2V7QD 4LNHA 2Y3IA 3CVOA 3D7NA 2VZLA 1Z0IA 4IICA 3NCTA 3OX4A 2IZ0A 1WA5A 2WT8A 4NCHA 1BJTA 3RHTA 5BPHA 1U2ZA 4G1CA 4XW2A 1I3MA 2ERXA 3IHLA 4D9NA 5EZYF 2J4CA 3IXLA 1C7IA 3CRQA 5AUOB 5KQRA 3ZWKA 1REQA 1XQVA 3VPXA 4DB4A 1DTWA 4FYXA 4C6TA 4OHKA 1E0AA 4YR7A 3G2HA 4ETNA 3RS0A 2PJDA 4TL9A 4RKRA 1XK7A 3P4UA 1EDEA 1KZYC 3COSA 4Y8VA 5J9FA 4ZODA 3HXMA 3JD3A 3PK0A 4DW8A 3FPLA 3PC8C 3QY9A 3G0BA 5IXJA 1CEQA 5CT8A 4ICIA 2FMFA 1A0OA 4N5MA 4RIGA 1JJIA 3VPDA 2P0YA 2W8BA 4KFUA 3T1VA 1ZKMA 4R51A 3TZBA 3QG5A 2GPYA 3F74A 3A4MA 1LDYA 1K8YB 1UJBA 4EVSA 2ATIA 4GIBA 5FL7A 4ZXPA 1P2GA 2WF5A 4YRNA 1FUYB 1YFJA 4J0EA 3H84A 1T29A 4BCBA 2C7VA 1M2GA 3EISA 2PH1A 1UBFA 3WLOA 2YYYA 3RG2A 5FPTA 2DCMA 4HDNA 3T15A 3LXXA 2FMTA 3MIZA 5K0NA 1ONBA 1N3YA 3I2GA 4EBBA 3DL7A 2YFYA 4H35A 2R66A 3AKYA 2VTDA 2RIPA 3IPCA 3KWLA 1G2QA 3RBAA 2WJWA 4CDNA 3TZCA 4KAJA 3ANXA 4HAIA 3E8XA 4BRZA 3ZXXA 5HPYB 5IT9A 5IM4A 4RO0A 3QLVC 4RHCA 3D59A 1D6JA 3RLIA 1KTVA 3KOWA 1YQWA 4BMPB 3SZUA 1ZUD1 4D79A 2ZWPA 1EFLA 2CNLA 2JKYA 2QUAA 3B7GA 3L7CA 1YI0A 3AY0A 3M4NA 1X38A 1CLUA 1JR3A 1XL0A 1N6OA 4P3NA 2CMKA 2PH7A 4KGXA 3THXB 4B3BA 5ELXA 1T4BA 4ND8A 2IUTA 5LBUA 3N75A 1WW8A 5ETJA 1VLVA 3E1GA 4YRJA 2VNJA 2XMRA 3UUGA 4GZMA 4WNIA 4YYEA 2W2LA 4LTDA 2RHCA 3DC2A 4I2NA 1X1BA 3NBZC 5BRNA 1VHDA 3V8QA 4LYEA 4B3FX 4W7SA 2QN1A 3KT0A 3WGVA 5BUSA 2J3DA 3NNDA 4B44A 1H93A 3OOJA 4BGVA 4FMPA 3SPXA 4DIMA 1N5MA 3QMMA 2Z9BA 3QWBA 1GTG1 4HXEB 4L9RA 3EW7A 3MFQA 4P82A 3HFJA 4A2QA 2EARA 4G0NA 2RIRA 2N0SA 4ZT6A 4DJAA 1AH2A 4HB2A 4CQMA 2QSZA 2VJCA 1C9NA 1E99A 5HZGA 5HEKA 1C4OA 3IBSA 4QFDA 2R86A 3BD7A 4AXXA 4HI0E 1V5GA 1ZZEA 4MWSA 4LGYA 3RRNA 5JZSA 1NQXA 5KMGB 2J41A 4M7WA 4OHZA 4UNIA 1ORTA 3FSGD 4BOYA 3KBBA 4WK6A 3NTQA 3VPGA 2GNPA 1EDOA 2D2XA 1BEZA 1GGKA 5EP4A 2AMYA 1USGA 2X5XA 4H0FA 2P9BA 2JIZA 3O4VA 4YPFA 4LCJA 2VCYA 3U4CA 3D5EA 1KDPA 3D7SA 4AM8A 4AY2A 4TQ9A 3R0IA 3QOXA 2BSXA 2ASEA 4V3CA 5F4BA 4M2LA 4U2CA 1SUSA 4B9EA 4EB3A 1W5TA 3BGIA 2WJHA 1U2SA 3C3KA 2ZI3A 4DLPA 3LZDA 1K7EB 3PJEA 1I0ZA 3LHFA 4UHHA 1BXRA 1HDXA 1QGYA 1N2CA 1UBCA 2NOAA 3GZNA 4J43A 4P22A 3IKLA 3EVEA 1XPUA 4ZOEA 1R15A 4ZANA 5K7SA 1FPQA 1H6AA 3F6YA 2II6A 3E58A 3UAGA 2FEWB 3WIVA 1TM3E 5HKKD 1K6MA 2TMYA 3MTEA 4HNUA 3KJXA 2IELA 5AW3A 1SUCA 3H5NA 2NZVG 3FNBA 4JJ7A 2ZK7A 3V9AA 1OASA 1T3LA 3Q8XB 5KQMA 2G6BA 3THWA 2AJ8A 4C7JA 2XNHA 5KSWB 3OWHA 3W90A 3W2HA 3U7JA 4ZCRA 1PO7A 4IGIA 1HE3A 3Q1LA 4ZEXA 4N03A 2C7QA 1XLVA 3TM4A 4DMMA 3VAZA 5DN6D 1IUPA 3JS5A 1W30A 1OOEA 4JASB 4RAOA 2I3AA 3KIPA 1B3RA 2GFQA 3WNBA 4C5AA 5MN5A 2PCJA 4PSUA 3R4VA 1YFKA 2POQX 5THXA 4M0KA 1IY2A 1FTNA 2F9MA 1A5SB 3ADBA 3ZD6A 3N2IA 1XMQB 3RIYA 1MB3A 4EK9A 3LBNA 2OAQ1 1Y1RA 4L2IA 2ZWOA 5F7ZA 1Z5VA 1FZQA 2IBMA 2ZWVA 1R0SA 5JYBA 3IAFA 4IJWA 3HNOA 2BM8A 5SICE 3VV2A 1UMBA 4FYKA 1F7UA 3ZDZB 4UMDA 5D6NA 4JLPA 2AXEA 1F14A 5FOQA 4YRQA 2HH9A 1E20A 2IX9A 3MGGA 3F71A 1Z4PX 3GLQA 3KJZA 5AP9A 4ZFNA 4DJ5X 2X3FA 4KQIA 4XASA 3M5WA 3PYLA 5CNJA 1KAGA 2PS0A 3ZTYA 5JH7A 3DVAB 5JDIC 3RU9A 3OT1A 2CL0X 4DREA 1JSXA 1LS6A 4RVCA 3RS9A 4LX0A 3OKPA 2QG6A 4Q03A 5AR1A 2QNRA 3R9IA 5CB4B 2C95A 3O9VA 1I32A 3MBIA 1K08A 2Z8XA 4N0PA 3G8AA 3M6UA 1BDJA 1ZIXA 2BGNA 4O4HA 3T94A 2BMVA 2AA3A 4LF6B 1YBHA 4ZT4A 1OROA 5LUAA 2GTPA 4Q7LA 4Z53A 6LDHA 3KUCA 4D3YA 4PFKA 4P0TA 4OXIA 3TZKA 1DQPA 2OCXA 5CVTA 2CVQA 4EKGA 1AS0A 3EXEA 4L0QA 5EUCA 2NTVA 1OIWA 1VBMA 4N82A 2VTKA 4URUR 4V39A 4AJKA 4B6SA 4NU8X 2VA9A 5IEJA 1SVMA 2Q3MA 2I6FA 2KBEA 2AOXA 3C8UA 3S2EA 1LTQA 1KI1A 4QXQA 1C8LA 1Z18A 4LE1A 4WKCA 1KFEB 3VTKA 1T5SA 1XKQA 1DKRA 3GBPA 3JYPA 4DIKA 1E4EB 5K45A 1Y98A 3C2QA 3BVPA 3ZUGA 2J87A 5D1NA 5BUCA 5LQMA 1Q17A 4MKGA 5FLYA 4CW7A 1RZVA 1VHTA 1XZGA 2LBPA 3AESB 5DYGA 3M9XA 4M1SA 2ZYDA 4F1JA 3VPBA 1L9XA 2IGBA 2WM9B 1ZEMA 1KY5A 2ZB8A 3MSCA 4OBBA 1NU8A 3G79A 4P33A 4UD2A 5JSYA 3KQKA 3G8YA 3H6KA 3KSRA 1D2EA 1UJ5A 2JZNA 1DIRA 1DIGA 1OPRA 2P78A 3L40A 3OJ0A 4NDNE 4UXIA 1N2OA 1SUFA 2CUTA 4HK4A 4BN4A 2A30A 2GFIA 4W1SA 3MCWA 4NOJA 5LZ4A 3TTWA 3N1UA 3QFHA 4CUKA 3AVTA 1KZ6A 5J2TB 4KODA 3P0IA 4ZO7A 4X6XA 3BZBA 3NKLA 3EUAA 4F8JA 2HEGA 5C3UA 1QRDA 3CMMA 3C3AA 4MQMA 5CEJA 1JNYA 3FYUA 5DOVA 2UUCB 4FC6A 5ALXA 5LP6F 1LCIA 1J09A 5JECA 2R2AA 4D5EA 2XOKD 4Q3OA 2RE8A 2ZVPX 5KHLB 1BMDA 3JQCA 1XQXA 4BY9E 4QAQA 1T9CA 1CRPA 1F0PA 1T3ZA 2IXDA 3D1JA 2OXTA 4BUJA 1UBUS 3DO8A 1U9CA 1RCFA 3IKTA 1Y1QA 3LNCA 4PG8A 1GUYA 1VPLA 1BTOA 2AOTA 2OO5C 4JQZA 4C5CA 2GRAA 3SFTA 3DBRB 3EQ2A 3FYTA 4IIJF 4KLZA 2QSYA 5DE3A 3WTBA 3DDUA 3UW3A 4BE7B 1O6GA 1PR4A 3OCZA 4WCFA 1Z5OA 1ZBQA 2QD3A 4MB6A 5JLJA 4GSKA 4Q6BA 1LNSA 3KL4A 3OCXA 1BS9A 3WLHA 3D1LA 2GDZA 4FGLA 4X3PA 3VR3D 4P6VF 1PR5A 2PZMA 3HDTA 1F5SA 2XMDA 3Q1KA 1R0CA 5FHQA 3RHFA 4AY5A 1V1JA 3GDGA 1JKXA 5I8PA 4QREA 2OUIA 4NV1A 3I9OA 1ZM7A 1CJSA 5EKSA 1PVOA 3CZCA 3VSBA 1T0UA 5BWMA 5GV7A 4MLCA 2F6RA 1SVKA 4NR0A 3VHRA 5JALA 4L51A 3S5JA 2AW3A 1PX0A 1Q11A 5TJHA 2FW8A 1W9HA 4BLQA 3IMEA 1IN6A 1GZHB 3AEQA 2B0JA 4TYPA 1P9LA 2PM8A 3HKEA 2XDYA 2QMHA 4IQFA 1L5WA 4JP1A 1WHSB 3C6MA 4RDCA 5DGIA 4D9JA 1TC1A 3PPWA 1Z4NA 5EOVA 3VR6H 3LZCA 3MGCA 3VYWA 3LKBA 4Q7EA 2VPPA 4HDNB 3MWDA 5AJTA 1JPNA 3KR2A 4WY8A 1C7QA 1PFGA 2F8MA 3USCS 5LD2C 4N5NA 4R9SA 4QWWA 4FJ1A 4EY4A 3HSSA 1SR8A 2ZULA 3S44A 2OTCA 1PF7E 3ROTA 3RVKA 3IQGX 2I6UA 5I8WA 2W6PA 1R0WA 4MMZB 2FZGA 1W76A 1P31A 2IXTA 2NQTA 4Q4HA 1U6JA 3GGSA 3PQ7A 5BSWA 4RKWA 2O23A 3AJAA 1IY8A 1SOMA 4BE9A 2D2VA 4QBKA 5B3AA 3RLFA 4QXPA 3A32A 3RDPA 4CU5A 2P0AA 3EDOA 4B4DA 4KWCA 1TCCA 3C8HA 2C7RA 2Y76A 3CWCA 1CUHA 3EFOA 3UUWA 5BNIA 2AG1A 4KX5A 3UMFA 3CN7A 3BWMA 4V0OA 4M3NA 4GPTA 5BMOA 4DR1B 3F9CA 1L2TA 3GEGA 4EY3A 4CFZA 3DMYA 2QN2A 1E66A 2WBLC 1QGED 1T26A 2X1HA 2FUNB 3UGJA 2FPWA 2OEPA 4CMHA 2HRZA 1NVKA 3FD8A 1SVSA 4ZT2A 1FQKA 2GM3A 3T95A 3VUFA 2O8NA 4YUYA 3C4JA 1EU1A 4EUFA 1IHDA 2QRPA 5J43A 1NHGA 3LLCA 3ZX4A 2O8VA 3HYLA 1BG6A 1DDOA 1NJ5A 4KQKA 1JALA 2ZBFA 1TAQA 2LVBA 2W7TA 4IH4A 2BLLA 3JRNA 5EQFA 1CRLA 4D46A 5B36A 5E1OA 1AO0A 3ITDA 4K26A 3TR6A 2JKZA 4LJ6A 4PTLA 2XCOA 1YHNA 5AJXA 3ZW9A 3CX7A 4C3VA 4LJSA 5DCYA 4AKEA 2I1QA 4C6RA 4DLAA 4DMLA 3GGDA 4YMWA 4H1WA 2B6NA 1ZW1A 4O0LA 5THQA 3WX0A 3I4CA 2VNKA 4J7AA 3NTRA 4OP2A 1X19A 5ANRB 1PNOA 2KPOA 1JDBB 1KYYA 1M2OB 3REQB 4B4UA 1KIFA 1NR5A 4IX1A 4Y98A 3NYIA 1LF5A 1ZN7A 3GCZA 1GU7A 1BDHA 5ALWA 3H5LA 3ENWA 3TQHA 1G5IA 3OOWA 3EA5A 1Q83A 1SQGA 2MSEB 3M1IA 4G81A 4UMEA 5HBGA 3TCXB 4OMUA 5EXTA 4ENUA 3SX4A 3W04A 2WA2A 4B3SB 3AFIA 2UVPA 2QRJA 3SYKA 2PKCA 4FT4A 1ZD2P 1W4RA 3L04A 5IM5A 5U4QA 3P52A 3U16A 3VH1A 3A36A 2HIMA 4UU1A 1FMTA 1CVIA 3ZV3A 3DMPA 2XGGA 3IEPA 3AEKA 4BVKA 3QP9A 5DHFA 4IMPA 1I4EB 2DE0X 3NZEA 3LYLA 4BQRA 1D04A 1V9CA 2QP9X 3I04M 3KV1A 5AJVB 1T5IA 3L8YA 4J76A 3ADDA 2NXEA 2AKYA 3EXHC 5B1HA 5B53A 2GHRA 3MCTA 2YWEA 3P9KA 4N9QA 4RVOA 3HJCA 1L3BA 5IJ0A 1JEQB 2ZIVB 4H16A 4R8SA 3VU0A 4B17A 1E96A 3GEPA 4IQ4A 1KK3A 1CFJA 2IH4A 3F7OA 4I3HA 3HJGA 1Z39A 1P4RA 3C3JA 3PFGA 3ZDQA 2RCYA 3A05A 5CA0F 3GJ0A 1YDWA 2EF1A 3ZDXB 2I4NA 2VJBA 1U6KA 3IAHA 3IOYA 1OH7A 4PFQA 10MHA 4INOA 2XLBA 4R1TA 5CVCA 5FRDA 1FSGA 1N6IA 3TGWA 2WJAA 2VHWA 5BMVA 2ATVA 2PD6A 3GROA 5DNWA 3W7AA 3JWEA 5ULLA 2IZ6A 3GLVA 5D3ZA 4A6PA 1GPDG 3AQIA 1SHKA 3CYFA 3NDBB 4KDCA 3H2ZA 1XXLA 2BF4A 3HHPA 3JPWA 4GO1A 4V3BA 5AOVA 3QVLA 1X87A 4HH4A 1LSUA 4YP7A 2HCRA 5G4KB 5HGXA 2M9MA 5CFNA 3PTAA 3IR6A 1JQLB 5KYYB 1FJHA 2QE7A 3VAYA 5E0OA 1XCGB 1ULHA 1Z25A 2X1VA 5BVGB 4EJ6A 3SP1A 1CQXA 1W0KA 2RHLA 4OIFA 2WFZA 5I9NA 2ZSIA 2IYNA 3IQIX 2IYVA 3LVQE 3R09A 4G3XA 3SR3A 4C0LA 2C31A 5I51A 1X1DA 4MDYA 5KDDA 1E2DA 2FSVA 1Q92A 2XOKA 4TOIA 4G9BA 4N5LA 3GRCA 4F2GA 3ER6A 2XQJA 3BORA 4ZHSA 2P2YA 3PFIA 4CF4A 3VNVA 2Z2JA 3FPGA 1U6IA 4Q01A 1YDGA 4PXYA 1ILEA 4OL0A 3TMKA 3NOOA 2BDTA 2A1IA 4N8SA 4F45A 1EDBA 4HS4A 1ZGAA 1ZWLA 3CX6A 2BGUA 2WUWE 4DILA 5L3SB 3CNQS 3RF6A 2I54A 3S4YA 2ODTX 3PLRA 4ZJYA 3ORQA 1GM5A 3D0QA 3I92A 2X6QA 2XT6A 2E48A 1WCV1 3TTTA 5DX0A 4HNTA 3GA7A 5KNDA 2Q3CA 2O5EA 5IT5A 1YB6A 2BLNA 2YY6A 3FSEA 3LVFO 2VQEB 1XDSA 5DDIP 4AKSA 3RC9A 2YY5A 2ZVDA 2AWOA 2VRCA 2CHQA 3GW8A 4C3UA 3WDMA 3L4BC 3AVPA 1OGIA 5CM9C 1D0SA 1Z33A 3ENQA 1LDEA 2V6MA 4QU8A 1Q95A 1H5QA 4R9NA 5GZ3A 1S9HA 2HRCA 2JASA 3L82B 4EG8A 1RHUA 5FDFA 4HXYA 5KC8A 4G4SP 2A7QA 5JYDA 3ADOA 1BE6A 1TD9A 2ROQA 5U4XA 4IDCA 3G5AA 5ESDA 1YR3A 2WM3A 3DEFA 4PQFA 2ZETA 4DIEA 4MPRA 2A0FA 3RBXA 1IXZA 1A9XB 4M6WA 2CUZA 1S8NA 3LRPA 3RYFA 1HNZB 4DJFC 2RKOA 1MR3F 4C3ZA 4J9VA 2RKWA 1JF8A 1J8FA 3IMGA 3SXJA 5IKMA 4KHPB 1TT7A 2QEQA 2QTTA 4YCAA 2FI1A 1JIXA 3SMVA 3TBFA 4WESB 1I7PA 2IU4A 2J5KA 1SOAA 1Z17A 1D4AA 2JFUA 1JEJA 2ZITA 2Z4TA 4N5DA 5IXYA 2IYEA 3PR3A 3G85A 5MGBA 5L9AA 2BDEA 2C07A 1YFZA 4ZMBA 1EFPB 3LC7O 3UMSA 4J1TA 3FPEA 4AURA 1ONOA 3OU7A 5DP1A 2Z3WA 1EGMB 3B6MA 3GN2A 4ZAXA 2EQBA 2YV5A 4NARA 4D9CA 2JA2A 3G1WA 5JIBA 2CDCA 5FR2A 4DNPA 5C2JB 4MR7B 4AECA 3NWPA 2WG2A 4YDRA 2UXDB 4BKRA 3JYOA 1CUXA 2CC2A 3LUKA 1RM4A 4RZQA 1EEHA 2IUUA 4PQEA 3UMGA 3A4LA 4ALLA 1Q15A 3DZIA 1DXYA 5B3KA 1TYAE 1DBWA 3OETA 1KL7A 2C2KA 2COEA 5JJLA 4KHZA 2DUUA 3RV4A 3FBGA 1G6Q1 3U4QA 3K9LA 3PDWA 5LZ9A 3PRHA 3OE1A 1IOLA 1C30B 4NFHA 2J33A 4RCVA 1J24A 4G5SA 3V4OA 5ES4B 5IKXA 3IMFA 4NK4A 3V46A 3GWGA 2BGJA 1NC1A 1PZHA 1I4TD 4RYLA 3N2GB 3TQCA 4BYMA 3EGXB 1MZPA 1W85B 1I2MA 2F7SA 1Q0ZA 3SHQA 4ENPA 4MW2A 1CUDA 1ISFA 2H16A 3UMRA 2EG5A 3QVGB 1CJCA 1FXSA 4J0IA 4P8RA 4X7RA 1EB8A 3A27A 4QUHA 2PXAA 3DL0A 2NMVA 1NM5C 3WVNA 4BQOA 3KPUA 4QUJA 2M6KA 1WXFA 2W8ZA 2NO7A 4CV2A 2W4IA 4S1VA 1C0LA 4BDTA 2XYVA 3ADKA 3PNYA 2JFBA 4BRUA 4DGQA 2I7XA 2FWJA 5JFGA 4CQNA 4R71A 1XK6A 1LEHA 1DTWB 1VIDA 3OT5A 1OGYA 4L76A 3I2JA 5CDSA 3E27A 5HJ5A 1K9VF 2BTOA 1G19A 4OHCA 1WU8A 1QV9A 2QR5A 4I1PA 3S27A 5EJ8A 2FPLA 1J06A 3HVKA 3T7JA 4GGOA 5LNK1 4DTIA 4BC1A 1YJQA 1LLDA 2Q2QA 4BEVA 2YYAA 2XVAA 2ZATA 3LO5A 3K0EA 3C3YA 3USES 2HOQA 1D3AA 4FU0A 5H7XA 3RS8A 5I7WA 4ESEA 4PAGA 1LFDB 1NOIA 1P7CA 4MCAA 1E1LA 3HO6A 4DGSA 3BK2A 3CG4A 5FADA 1CY8A 4ENVA 2GXQA 1F06A 1W5FA 5KBYA 1KZ9A 3U1TA 1M33A 2HJGA 4M0CA 1W19A 1U80A 2Q6LA 2ZCVA 1RBQA 3EVGA 3MD0A 5IKOA 4PSAA 3SLRA 5CT6A 5A62A 4P34A 1ZJ6A 4FSXA 1JB1A 3IS3A 1N1DA 4GOMD 4CQMD 1K3UB 1CJBA 1O4WA 2W0MA 3NAQA 4F7DA 5HYVA 1EE1A 3KNZA 4B32A 2PJUA 1Z63A 3UHPA 1KI4A 1KZ1A 2ENWA 3WO0A 2P9GA 3TBKA 2PFGA 1KO1A 1SOVA 3PC7A 5LZ5A 1ST3A 1ZN2A 3E4CA 2LIPA 4AJPA 4Z6KA 4BWYA 2FH5B 4BGEA 4MOWA 3ERCA 4BP1A 4YAOA 3L06A 5DIZA 1FS4A 4AYTA 4MB2A 4HVLA 2R48A 4DWJA 3ILYA 3DP7A 3BJRA 1TMGE 4WSOA 3F6PA 2P7IA 2V7VA 2A57A 3EZYA 4XZ3A 3WDLA 2FQXA 3WQRA 2FWIA 2XBUA 3AM3A 4Y9RA 3QJ5A 2A4MA 3WYAA 1WJGA 3H2HA 4B3TB 2WNSA 1EWYA 3UK1A 1JVSA 2C9BA 4QVIA 4WOBA 1DJOA 1M74A 1XFAA 2NSYA 1P2FA 1QZZA 2JCBA 3OCYA 1G8YA 3H8SA 4MA4A 4WN3A 5KINB 3DXYA 4JBYA 3CIOA 2FY8A 4XI9A 5H16A 4HJXA 1GQYA 4P4LA 2BEVA 3PT9A 3K73O 2VT7A 3WJ2A 3M34A 4XX1A 2OQRA 3H42B 3FUXA 3RVRA 3JAKA 1G6HA 4JJFA 2JLUA 1KI2A 4EEKA 2HHJA 3HVIA 1GFZA 2QTWB 1HLGA 3LV8A 2ZUVA 2DTXA 4MI6A 4RY9A 1VPDA 3PQ6A 1PFYA 1ZVJA 4P81A 1FW8A 5BW8A 4C0JA 3JD4A 1YVPA 2BR5A 3B7WA 3KDAA 1P0FA 2B7BA 3ZOZA 3A1WA 2DQ4A 3WMEA 4V38A 1SXJB 2IYQA 1M1YB 3O2JA 5EJAA 1REQB 4KR0A 2NO0A 5CD9A 3NWBA 2D00A 1OH6A 4YTEA 4F5YA 5F5XA 3SWWA 4R8KA 1XWFA 13PKA 1CDEA 1RPNA 3HBJA 4DCVA 1J5PA 4MR8B 1Y42X 3KM0A 1JQ3A 2E55A 2OR3A 3AK4A 5BYBA 4A8JA 2NVWA 4MKIA 3T06B 4TTQA 2J0EA 5KTRA 4MDFA 1N6LA 4NZYA 2BJHA 4GXNA 1SU4A 4BLSA 1MAVA 4JBHA 2H65A 1E5TA 4FOOA 1PVVA 3K72B 3OPYI 3AIOA 2I2FA 4QUEA 4DANA 2C4UA 4DEYA 2PVSA 5KO2A 1GKLA 2V5AA 1GGMA 3ANYB 1CP2A 1GA4A 4EENA 3DFFA 4ZI7B 1TK9A 4W7HA 1CEYA 9MHTA 4ZO4A 3WL8A 5AKGA 1YMUA 1SIOA 2LKDA 1RXVA 5AI8A 2D1RA 2V3CC 1E5XA 4WZ6A 5JZVA 1AKMA 3H19A 1WPRA 3W8RA 4OK6A 3HYTA 4YP9A 1N1MA 3UYKA 4M7PA 3TNLA 2H18A 3UAZA 1XEWX 1QB8A 2Q50A 4GOJA 4O02B 1N57A 1Y7LA 4TLCA 3RVDA 1DAOA 2ZT7A 1BZYA 3ZIUA 5LKRA 4IZIA 3WO1A 4L4YA 3L8EA 4L7VA 3WHLA 1VKZA 4QXMA 5MFZA 1E3LA 1N0WA 1RI5A 2JH3A 2OZLA 1O94C 3KZNA 3TLKA 4OP3A 1KQGA 5EJGA 1L3CA 3JR3A 5IN4A 1OU4A 5KSOA 3BKWA 5JVDF 5EXXA 2ZFUA 1D5WA 4OD0A 3WLNA 2RAPA 4PBRA 4A27A 4EGCB 5ARCA 3M6AA 3KSAC 1FBNA 4GVXA 1VIAA 2VHJA 4J0CA 3UAVA 1GEEA 1QGOA 3KOUA 1RTKA 2C78A 3NBUA 3AILA 3COPA 2PJRA 1K6EA 3L7MA 1E4YA 4QJIA 4CTOA 3BMNB 2D7DA 3KK0A 3HNRA 4KLAA 4KXVA 4C08A 4INPA 3SBEA 2CYAA 2ZJ4A 4OGWA 4HPJB 1EESA 1UC9A 3PWTA 2RAVA 4CKYA 4BEWA 2I6XA 3ICVA 3KSMA 4WN9B 2R7AA 2ZJ3A 3WIBA 3G0OA 2QQ0A 5BSUA 1X8KA 4ZEOA 4DM4A 5KQLA 1UANA 1IZ8A 4TUYA 1MENA 5L4NA 3IA7A 2HBQA 3BA1A 5B6IA 1RQPA 1H8ED 5CB6A 1HEUA 1O96B 1PNQA 4S24A 4HWPA 4XKJA 5FFMA 3NBQA 1U4OA 3ZWVA 4EY6A 2FRVA 2IY9A 2A84A 3Q5DA 4BNGA 2SKDA 2WJ6A 5AM1A 2RGUA 2RC6A 3VPFA 4X71A 4HCJA 2UZ1A 4LXXA 3JCZA 1NSTA 1WKCA 1XQ9A 3I5UA 4KK4A 3JZIA 3IT1A 3V1YA 5B4VA 5A4AA 3I0MA 2C2HA 3P9IA 4H7IA 4HPXB 3QHAA 4LK3A 4YJ3B 3MQ2A 3UANA 4YPVA 1ZNYA 3AUUA 2O8FB 1LC3A 1NX6A 4I9FA 5AVOA 1X7XB 2C97A 1I2BA 3JVDA 4FK8A 3TJZA 2A0YA 1A1VA 1Y7IA 1BXRB 5AHRA 4FXOA 4CI9A 1VOTA 2YJZA 3ZHUA 4OHXA 4OSOA 2Y1LA 3BXOA 1UJMA 2R7LA 3M6LA 4V0QA 1BX3A 2NUTB 2P2ZA 4ACAA 4NMXB 4D81A 4KQCA 3W8EA 1QPBA 3NNSA 2BONA 3TINA 1NUSA 1XD2B 2AC4A 2QNBA 3BDVA 4XGIA 1B7GO 5K0LA 4AD8A 2HZBA 2IXFA 3W5CA 4GBMA 4CIWA 2G1PA 5B58T 2B2CA 1FRNA 2VDRB 2W6JD 2WDZA 4TKUA 5A05A 5TVKA 1TW2A 1H8HD 3CVJA 3KQOA 2NXWA 2ZI5A 4HDSA 1XG5A 4Y1RB 2DKNA 1AKWA 3CH6A 3SC2A 5H4GA 1G64A 4YMTA 3KJGA 2DU8A 4CLXA 5A2GA 5HF5A 2BSQA 1TU0A 3IAXA 2A5YB 2YZNA 3V55A 3RAEC 3W2GA 1UDWA 4D6YA 5BSKA 2Z6UA 2B4YA 2UDPA 3E7FA 2O3SA 2WTXA 3V4RA 3Q9LA 2WTEA 4YRBA 2GRJA 2IYPA 4KAXA 5DI3A 1R0XA 3G2JA 3LQ1A 1AHIA 5B58C 4PC1A 5HXAA 4P98A 1XDDA 4JJ8A 3N0TA 5IBQA 4B71A 4EI9A 3G2IA 3G2NA 4Y9DA 1HR0B 3OJEA 1BXKA 4ZOBA 3NBKA 4P36A 2VF2A 1Q50A 1NXTA 2J9ZB 1T0BA 4JB3A 5H68A 2WY2D 5JMOA 4OHUA 3EQZA 3ZWBA 1KOFA 3EHDA 3KLBA 1NPDA 3KQYA 4J7CA 1QX4A 4Y6RA 3FIJA 1NYQA 2XJ9A 5HE8A 1IVSA 4N6OA 4CM8A 4UTZA 5JS7A 1GTL1 2Q1SA 3VVCA 3VR6A 2YVUA 3DXXA 4L3OA 4M54A 3W1VA 1V1RB 3LHDA 1GPYA 3UENA 3X1KA 4F9GA 1WMSA 4TROA 4WUVA 5K99A 5LPNA 2PMEA 4PZZA 2G80A 3QYPA 4U7TB 5CFQA 4Y7CA 4IBOA 4LTNA 3KV3O 2PKEA 4N7RA 3W2TA 3BREA 2HU7A 1IJEA 1BDBA 2BFCB 4MRMB 4OGLA 2X76A 4E1AA 2P9YA 1UT8A 4HJRA 3KVOA 1EBFA 4KAAA 1LBHA 3F90A 1ZM4A 3HEAA 4HQKA 5BWOA 5AW4A 4EF6A 1UP6A 2ZZNA 2XMQA 2GAOA 3COZA 1SWVA 5LA6F 2IV2X 3W3ZB 2GTIA 3BTSA 5BYKA 4WQMA 1NY6A 3PXAA 3RRBA 3C24A 1MOSA 4WXRA 3FA2A 3TNFA 5KTOA 1S3IA 3KALA 3HTXA 4EUKA 2W2KB 4UHBA 1BYIA 2Z1DA 4H7KA 5D01A 1X7HA 3PFHA 4PEVA 4ZARA 2VAVA 5FXMA 3UV6A 3WOVA 1TTHA 3W4KA 3IIJA 3C6XA 5AVYA 3CVYA 1PQ4A 1UMDA 3RIHA 5HS4A 3VC1A 2EKBA 2J3QA 4WIAA 4IDBA 3PQ8A 1ULTA 4GKVA 4ND1A 3PHLA 4H60A 3O3MB 2JAHA 4DLNA 1M73E 3C5VA 3CB4A 2WT4A 2CHUA 2AJBA 2QW8A 2D0IA 1MH9A 5AXCA 2G28A 1O5OA 3W6OA 3GUHA 5J2TA 4JCCA 2OFFA 4ZYYA 1B6SA 3CU5A 3L1HA 4GC5A 4WCVA 4PCLA 3STXA 4CYMA 1W0JA 3IQZA 1IBLB 2PGOA 3TH5A 2VDQB 1T13A 4PCVA 4G0WA 1QBKC 1LPAB 3IQXA 1P80A 2CT8A 1JIIA 3GUUA 3M4JA 3S1AB 1N2XA 3K31A 3IEVA 1JHDA 1J7JA 1U8TA 3ND7A 4HYTA 1MVLA 2WSSD 4Q3DA 2WWWA 1MV5A 2H0AA 2Q3HA 1GRQA 2HMWA 2VSYA 4N7JA 1PJCA 4Y6LA 3TLGB 4FOPA 4BNYA 2BEVB 1N6RA 2ZVQX 1IPEA 3D31A 4UEQA 1U0JA 2OXCA 1XRQA 4E5DA 1OLOA 2H1LA 3KYJB 2ZGVA 3FYUC 3H8WA 5HCIA 4AJHA 5KTYA 3KTOA 1TYDE 3IJRA 4FS3A 3A3OA 4OV6B 1PS8A 2Z04A 3B9RA 2JFFA 1FQOA 3LL4A 5I48A 1V4BA 1RTTA 3E5RA 3GMDA 1S7CA 2GX6A 1P81A 2V6JA 3FRJA 1L8LA 3MS2A 2YIVX 1G18A 3OKAA 4HMQA 4LDNA 5JCOA 4WCFB 1WMDA 2TSYB 2YQZA 3O8QA 4HLUC 3RNOA 3ZQ6A 4EG1A 2JLXA 1B3BA 4O4JF 3BTUA 3SXPA 3NHZA 1QAQA 4X1KA 5CB8A 5HVNA 1ZR2A 1KFJB 2J9FB 1YJ5A 4KI7A 3H8JA 4MDHA 8ATCA 5C4MA 3G0HA 1UXIA 1NYTA 4MVJI 5EWMA 1OAAA 4LRXA 4RPGA 4XGQA 1AK1A 1VCHA 5BQ5A 3U9LA 3VZPA 1OB2A 5JU6A 3DOFA 4CIBA 3UJPA 5KVCA 1CVRA 3NYQA 3PCXA 3WR5A 3WKEA 3U4MA 1SA0A 4NU0A 1WPXA 4YECA 3B6IA 3OQNA 3CO0S 4BFUA 3THWB 2PWYA 5GZ6A 1S01A 1Q2XA 3C1UA 3GP5A 5KPJA 1S3GA 2GN4A 2PBLA 5AVZA 4M9SA 1PL6A 5HTKA 4H6VA 2DPYA 4RADA 3NIWA 1X2EA 1N7HA 4TS4A 2WVAA 4FNOA 2ZT6A 2EW1A 2XNSA 3AFHA 3U39A 2I76A 5FWNA 1OH5A 1U7DA 3QPDA 1SCAA 2CZQA 1Y9DA 2WFLB 3JQAA 3NX4A 4P4GA 4Y2PA 4XSHA 3T7CA 5J2UF 2B2NA 2HBYA 2J4FA 4YYZA 1M1YE 1NBOA 2GJKA 3BF8A 2F9FA 4L2IB 4O3MA 4IKOA 2I87A 5CK4A 5EHGA 2ISSD 4FWBA 5EJIA 2DLDA 1HWYA 4L22A 3VBCA 4CRWB 1H6CA 3SHVA 1E1RA 1C5KA 2Z9CA 2B94A 2C9ZA 1A5ZA 3KKNA 1Z45A 3K94A 4IDFA 3LNTA 2HI0A 4D9GA 2F9LA 3K70C 1UFQA 3QFRA 1LBEA 4NOMA 3AF1A 5CFLA 1PT5A 3NC0C 2ATCA 3G2MA 2BELA 1WL8A 2GPTA 2R8BA 2DAPA 1XD9A 2CHEA 3PXBA 1P62B 4OTZA 1T5HX 5D00A 2HT1A 2DKOA 4O4HB 5L7WA 4NCNA 1GGEA 1VLMA 4L27A 1FCJA 2H08A 2MT9A 4X1OA 5AKKA 2R6CA 5DHUA 4X20A 2F67A 2AT1A 3EFOB 2Q9UA 3IODA 1N78A 3E2PA 4N1AA 4IV8A 5JD6A 2H11A 3ZHRA 4UUNA 2VQFB 3U80A 2RJ3A 1L7DA 3IL2A 1PHRA 4QECA 3TG8A 5HIIA 1XPJA 3ZEIA 1EWQA 4XWOA 5KJ6A 1DAGA 5ER9A 4RHXA 4DA8A 1XAGA 1UCFA 1M1NA 4R2LA 1XLTC 1P33A 5ALEA 2O14A 5EWJB 6ABPA 4A26A 3P9XA 5HUJA 4DSTA 1UK7A 3KC2A 1OW3B 1LSSA 3Q4GA 1WRBA 4PLTA 5AK3A 1JVNA 1P5HA 3D2LA 1YACA 2EYUA 3KXIA 3WICA 2QVXX 3HU5A 4DBLC 3I1YA 4X6LA 3KQLA 3QUTA 4NNJA 4GHWA 3RH0A 3RUIA 3AQ4A 4JQCA 1FFAA 5CT4A 1DKNA 2HLNA 3T5DA 3JQGA 1YQDA 3B6KA 2DERA 2WK1A 4R41A 3L05A 3S68A 1ZI9A 5L6LB 4JT4A 2G25A 4K6MA 4BVHA 2WM8A 2VQ3A 5IHXA 4WY5A 1R0LA 3MT7A 1MLDA 5KSPA 1TVEA 2OBXA 1PWHA 4RY0A 1A72A 2IY7A 3WBFA 5KNLA 2JJ2A 3GJ4A 3L8GA 4PYIA 1EK2A 2J9RA 2PU5A 3ASVA 1UDAA 1XVTA 3B1YA 1IIRA 5CP8A 2VJPA 2W9XA 2FR8A 3VZBA 4RVFA 4FQ8A 2SKEA 1DC3A 2VTEA 4IUDS 3REOA 1XZAA 3T34A 3CVWA 1H23A 1W93A 3EVBA 1LW6E 5BPFA 1TJ4A 1Z7BA 3TG2A 3K2EA 2G5GX 2FMHA 1M6NA 3EE6A 2Q0SA 3FJYA 3GG9A 3IJ5A 4O8CA 5AM4A 3EZNA 5KX5F 2GCOA 5BXQC 1MF7A 3W9UA 1RHKA 1CKEA 2YHIB 4NECA 1BWRA 4GWGA 4GYKA 1TM7E 4R5HA 2VHUA 1DV2A 1ESMA 1CUZA 4IFIA 5CX4A 3MWFA 4XM2A 4BQEA 4XIIA 2EJBA 4IDOA 4EVIA 1EYZA 1T5LA 4XR9A 4KIUA 4YCMA 3OJCA 1OX4B 1JR3E 1PBTA 4K9QA 1X13A 4YC7A 1MIOB 5DGTA 2NP6A 1MQ9A 1U9ZA 2B83A 4F4IA 4EKEA 1X9GA 2ZUEA 2OV3A 1L5YA 1FYVA 3AINA 1Q0PA 1JAYA 4NAUA 2B37A 1Z56C 3GPIA 3H3JA 4W6ZA 3VJMA 3FTNA 4KYTA 4YUAA 1G5FA 3M5DA 1H8EA 3OQPA 4HYEA 4OQFA 4RGYA 1OA1A 1X8XA 2H48A 4JAVC 4JN6B 5MFPA 2FRDA 2O2JA 1RRPA 1RVV1 1Z7GA 1OTXA 4KBYA 4E6PA 4YI3A 5M2QA 3T1HB 5EZYB 5AXBA 3H17A 3W5IA 4B81A 4OHRA 4TMTA 3UWMA 4DM7A 3EFBA 5IASA 3AF2A 4GS5A 2Q6TA 1MB9A 1NHWA 2QZJA 1EP2B 3F47A 2Q8NA 3AOGA 1E3WA 2E5WA 1XSEA 1B0ZA 3FFTA 4LXIA 4A91A 2YWXA 4OXYA 1B6GA 3O95A 4MTLA 1WPGA 3BWCA 1ZHFA 3E5HA 3JYQA 4HNGA 3ONFA 2A1UA 1AXEA 3EEFA 5B5SA 1B14A 5JPDA 1HLPA 1QG0A 2J9XB 2ZBRA 3L1IA 1WBDA 4S35A 1J70A 3Q7TA 1HYHA 2IPLA 3ORHA 4EITA 5KNBH 2DHRA 3RTBA 3WL4A 3IPXA 4KO1S 3WLMA 4E1VA 4QWMA 3FUUA 4HGYA 1CR0A 3AF5A 3FIUA 4ROSA 4YRLA 3WGOA 1UADA 3C15C 3H9JA 3SSNA 3S2GA 4C04A 3WAGA 4LYYA 4UZSA 4YONB 4WK2B 5A1JA 3ROZA 4GMKA 1A5AB 1P2TA 4HWSA 4B6RA 2C8VA 1MB2A 1PR2A 5CGZA 5LQUA 1LXCA 5FA5A 1VP3A 1C1DB 2PXCA 3DZFA 1HKUA 1ZJ5A 4UVEA 4MKFA 2B25A 521PA 1KJ9A 3S40A 1P91A 5CB0A 4E2YA 1AD2A 2EFYA 4ZQFA 2BE9A 3K0HA 2FPGA 3GGPA 2QL7A 4BP3A 4O6VA 1LJ8A 4FMDB 3W06A 4DA0A 4JBWA 3KR0A 2QB5A 3VZQA 1BE1A 2JGFA 3E22B 2IPAB 3LG2A 4MEAA 3ABZA 3MAAC 4YWHA 2QUHA 1A98A 4RS4A 4D2IA 4KTVE 2GKGA 3NOXA 1DQNA 1KDYA 1Z6GA 3LQ2A 2GZMA 4XD7D 2CLFB 2N42A 3FPCA 3C0KA 3CEJA 5L3RA 4NTZA 3ZWOA 2A4KA 1YZUA 4CLOA 5JJ5A 2D6FA 3QLJA 1HF3A 4CMAA 4YN3A 5A0FA 1HT0A 2XF2A 4L5JA 4YP5A 1ODSA 3RIEA 4DLZA 1RC8A 5I7RA 5CTAA 1N9ZA 1SKYE 1WCIB 2Q1YA 4FZRA 4MX8A 4S0XA 5CLIA 3VPAA 5B7PA 2IODA 5AKHA 5HWSA 1S8AA 2QY6A 2D1TA 2DFVA 4WJLA 1QZTA 5AVWA 3AUXA 3DMNA 4KUEA 1EDDA 4LS3A 3WGTA 1GU1A 2WVHA 2WU8A 2IDJA 3CTMA 4XDZA 4A6DA 4HF7A 4GKAA 2EDCA 2QXUA 4CVNA 1VYHA 2BHTA 1TKBA 1JXQA 2YS7A 3PC3A 5LU8A 1Q77A 5LD2B 4QTTB 2BC9A 2EBWA 3CEHA 1HNWB 2E7ZA 1CV2A 1IBRA 2W6IA 1RE0A 3DVLA 3FCSB 3KYIB 1IXRC 1NSYA 1F8YA 1JZTA 4CF7A 1F7VA 4YRAA 2QTGA 2XE8A 1CIVA 2HEIA 4YV7A 3W5AA 1M2VB 1SQ0A 1ESDA 3PEEA 4C2UA 2AZDA 2E85A 3QNMA 3TAXA 3FPFA 3ZNOA 4EG5A 5TMEA 3DXFA 3RUAA 4R0NA 1TFUA 2EIXA 4RVGA 4KXFB 3C5WP 4BFCA 9LDBA 2Q5HA 3VU1A 4OGFA 4KIJA 4B45A 5I5EA 2GBFA 1SZJG 2G7MC 4K86A 5IT0A 1LBIA 3CE6A 4X97A 1SUDA 4X54A 1ADCA 2GBIA 3RB8A 1RZRD 3KB1A 5E9WA 4XA8A 5I7AA 2VFAA 1R6VA 3L1UA 2AKAB 4V1CA 4L28A 5IXSA 1A4XA 5L7YA 5IAOA 3R76A 2RH9B 2O05A 1UXKA 1CUYA 2DHEA 2WC1A 2XIJA 1C1YA 3GQVA 3I6IA 4LSGA 2VNAA 1WF3A 4W4TA 4X1IA 3EOZA 2BGLA 1KARA 3VDQA 3W79A 3CHYA 2H6EA 2HO5A 2V3WA 2GN0A 3LFHA 1IG0A 4J7UA 3COJA 2LPMA 2Q1XA 5FTKA 1GZ3A 4NAHA 4AZ0B 5JS1A 1ZD8A 2X3UA 3BB1A 2V7WA 1YHYA 3GJ8A 3MTBA 3DA8A 4RF4A 1FQWA 1YHZA 3BQ9A 4P80A 4MYTA 1T9ZA 2ATXA 4RABA 5FO1A 3SEQA 3IQHX 3O8RA 4BE4A 3QMVA 1L5NA 4JOCA 1OXVA 5DSXA 1Y81A 2CMGA 4JQSA 4MPDA 1P77A 2ISCA 3MJHA 1ML4A 2RHRA 4FB4A 4DV1B 1AM4D 2EGGA 2PMFA 3IP6A 1OFHA 2FQWA 2RHGB 3CF0A 1K3TA 1E6CA 1NP6A 4K81B 3TAHA 1H2HA 2VK2A 4C4TA 4YXFA 3BXFA 3L0PA 1PLJA 4B3IA 1QCYA 4GICA 1JLLB 1TK2A 1CB7A 1XTTA 3HEBA 1NLYA 4MR9B 3SM9A 3DFZA 2VT2A 3ZJ5A 4HTFA 1QU3A 4RTRA 2DQZA 4G26A 5CYOA 2DYKA 2JGJA 4F6RA 1PVDA 3AVUA 1ZK3A 4TSFA 3MLAA 1F6DA 3WJ7A 3WLJA 2CVZA 3U9TA 3R20A 5J4YA 5TVGA 1BD3A 1M8KA 2HGSA 3RIMA 1DUSA 5BNTA 1QS0B 4CEJA 2D06A 3GVPA 3UJHA 3Q8MA 3FHTA 4PV7A 3BSSA 4L1KA 4KRXA 1G9SA 2F17A 2YFQA 1OLUA 3DBLA 5DCWA 2IP4A 3G0CA 1ENYA 4FONA 1T91A 1VG1A 2B8NA 1QU2A 4NF2A 1TX4B 1G3UA 1KHHA 1E3EA 1E2PA 1JI3A 1JN0A 2PX8A 2PX3A 1KAMA 1Z8NA 2ONYA 4RJTA 1D2CA 2VP3A 2V55B 4ZAWA 3N9IA 3TMYA 4Q47A 4OJQA 1PJQA 5CIQA 5DM1A 4YMGA 4WOCA 3DONA 4JYCA 4X44A 2RGAA 3ZVKA 2WSMA 1IB0A 2X15A 3ESYA 4QICA 1H85A 2EL9A 3D3EA 1L5HB 3IQDB 4HNAB 4RHYA 4MUFA 2I6GA 2O57A 3MYYA 5LXTB 3STTA 5ADUS 4EAAA 1RR6A 4K9DA 3AHIA 2VH1A 3EGVA 3RTAA 4C06A 3ZWPA 5JASA 4LZZA 1E2QA 2OC9A 1TQ8A 3I83A 3MTJA 1W4AA 3HXPA 4YQEA 4B3HA 3IJPA 4YCNA 1FB5A 1CPYA 1HZJA 2BR3A 4XWGA 1L5ZA 1C0KA 2HM7A 3K20A 2CE2X 1QVWA 3DCNA 1JHOA 5EYPB 1Z74A 1U3WA 1W34A 2ZUUA 1Z2EA 3FTQA 4TV9B 4EG0A 2QTLA 1G8PA 5K51A 3II6X 3WB2A 1WMFA 1I33A 1NUUA 4PANA 1JAIA 1ONSA 5ECDA 2PQ6A 5DWQA 5B7GA 5KX5B 4MIYA 2F8SA 1H22A 3GJRA 5AVXA 1CB0A 2QT0A 3IHKA 5EQDA 4NG4A 3J81k 2YJTD 1IUNA 3H1EA 5ERXA 4A7PA 4JX9A 2Q3LA 2GJAA 3P2YA 5FOVA 4UOQA 4EG3A 1IEQA 1X7YB 3F7NA 5DNUA 4KNVA 4C0KA 1C9EA 3Q5EA 3I01M 4XIGS 3C1TA 4M99A 1NR7A 2KE5A 1RAFA 4J0KA 1NVWQ 3M6XA 1YS7A 1C2YA 3IUJA 2F3PA 2BF7A 1YIAA 1E1QD 1E7YA 1CY1A 1V8ZA 4QU9A 4UPVA 1XRSB 3OEWA 4EO7A 5CFZA 2F1JA 4XUDA 3CNEA 3OZRA 4DFDA 3QPUA 3RVSA 1Z5NA 3SDBA 4X65B 2V4ZA 3P0HA 1NRWA 1KGDA 3DMFA 1JFSA 1M8GA 3KCQA 2NVUB 1M2JA 3RV3A 3EA0A 4MW0A 4HV4A 4JT9A 4EX7A 4RJKA 3FVTA 5AI0A 1ST2A 3AJRA 3I42A 2RK6A 3STHA 1Z0SA 4JJ6A 3EC7A 3W8NA 4WN9A 1W49A 4ZEMA 1JIUA 1UPCA 2FZLA 2M6RA 4BAUA 3NBAA 3CSSA 5CCBA 2X2OA 5HE9A 4NATA 3N86A 4FVTA 4PNEA 2O8EA 4KFCA 3QX7A 4WZBB 4D97A 4LYAA 3FMGA 1P0CA 2QUZA 4UZEA 1O6BA 1RWXA 2CEAA 2KX7A 3QI7A 4E51A 1XN4A 2B1GA 1EM6A 1ODTC 4MR7A 4P54A 1V0JA 1YGPA 5CBKA 2YNMD 1N7GA 3TEJA 4BNUA 1KEEB 2UZ1B 3ZCRA 1NF3A 2RBKA 5IJ9A 4AO6A 4LZAA 5EMMA 4LFCB 4F56A 3DZGA 1UT5A 4JU8A 5HZKA 4N3BA 5DEOA 4BB0A 3NC4A 3TIIA 4F8YA 5JMWA 5AKYA 5YASA 3O8OA 1KEKA 2XUHA 5DO9A 2C4TA 2BOVA 1K97A 3G6KA 1GWNA 4RKQA 3TZLA 3LQ4A 1EVJA 2NU7A 4NS4A 4Z54A 3DQPA 2ZM5A 3TD6A 4QO8A 5AQ1A 2HCFA 3ZDBA 5EE3A 1G7SA 2QAJA 1DC8A 3OE7A 1A8IA 1P4GA 1RMYA 3HN7A 4HFMA 1SU8A 4MLZA 2XITA 3NHPA 2AEFA 1NI4A 1XD2A 1G8FA 2OMK