4FTWA

Crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
IMTRKLTFGRRGAAPGEATSLVVFLHGYGADGADLLGLAEPLAPHLPGTAFVAPDAPEPCRACGFGFQWFPIPWLDGSSETAAAEGMAAAARDLDAFHDERLAEEGLPPEALALVGFSQGTMMALHVAPRRAEEIAGIVGFSGRLLAPERLAEEARSKPPVLLVHGDADPVVPFADMSLAGEALAEAGFTTYGHVMKGTGHGIAPDGLSVALAFLKERLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase/Carboxylesterase
publication title Enhanced enantioselectivity of a carboxyl esterase from Rhodobacter sphaeroides by directed evolution.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Hydrolase
total genus 71
structure length 220
sequence length 220
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ftwA00
7YASA 1SCKA 1XZKA 1MNAA 2H9YA 3BIWA 4L9AA 2WUGA 5HF5A 1YAJA 3G9TA 3H17A 2XQKA 1H2WA 1TIBA 4M0MA 4KYVA 5CXXA 1BEEA 1DX4A 4N8DA 1SC9A 3ZLUA 4FLMA 4P92A 3VVLA 3KXPA 5CRIA 5AIAA 4BP9A 4Y9SA 5JAOA 2DHCA 2YXPX 4ARBA 3WKCA 4DMFA 1AKNA 5ALXA 1WHSA 3PICA 5HF6A 3MGAA 2PKYX 3D4LA 1YCDA 4N8SA 3G9UA 1IUNA 1C7JA 3STYA 2VJAA 5LP1A 5AKZA 4XJVA 2RIPA 2WFLB 1YSCA 5LZ5A 4DNFA 5HF8A 1QIGA 5CH3A 3I2GA 5LZ9A 1CUWA 3EIOA 2XMDA 3H2HA 3R0VA 4M0EA 5ALNA 3HC7A 2ZYHA 3L1JA 1UOPA 4FBMA 3WQHA 2QZPA 4Y2SA 3RM3A 4N5IX 1G66A 4ETWA 5HKAA 2WU3A 3QPAA 2C5FA 1UKAA 2QJWA 3DCNA 5CT4A 4IH9A 3HYSA 4FLFA 1AUOA 4GW3A 5DNUA 1BN7A 3R3XA 4U2DA 3GFFA 1J2EA 5A71A 2XQGA 4IH4A 5K3CA 2X8BA 1F0NA 4X97A 3D0KA 5DLPA 2DQZA 1MT3A 5FRDA 2WLSA 2WUDA 2B4KA 3N0TA 1EB9A 5JZ9A 2XDWA 4BP8A 4EHBA 3HACA 3N2ZB 1AC5A 2Q0XA 1W1IA 3U0VA 3HSSA 1DTEA 1RP1A 2PL5A 4QDUA 4KE8A 2C5GA 1FFEA 1XZJA 3GA7A 4LKOA 2WKWA 4X00A 5JATA 3DYVA 4BVKA 5LZ2A 5IVDA 3OPMA 4NZZA 4KACA 1JT2A 4U2GA 2PSDA 3T4UA 4ZXFA 4RGYA 5ALQA 1UZAA 1DQZA 3O9VA 4UBJA 3IUMA 4BAZA 1HLGA 2G4LA 2CMFA 5AKXA 1XLUA 3WWEA 1F0PA 5AK6A 5JARA 4B0OA 2QTBA 3QMVA 3WWDA 3G9XA 1GKKA 2HA3A 4J3JA 4HVTA 4KAJA 1IZ7A 5AM5A 3O0DA 4J0HA 4AX4A 4DSZA 5E4TA 5JD4A 1OILA 4Y2PA 1UFOA 1AX9A 1QIFA 3JWEA 3C45A 5E4JA 2Y2UA 3IUJA 3WLAA 4JNCA 5HF9A 4JYMA 2C0PA 3VVMA 2O2GA 1HQDA 2VJBA 3AIKA 1IZ8A 1JJIA 5A7GA 4UHHA 1M33A 3DYIA 4UBNA 5LZ7A 2EDAA 2X5XA 2JGMA 1CIJA 1KU6A 3I2KA 1J1IA 2HA2A 5HQ3B 3D2AA 2QXUA 4OPMA 1HKHA 3WKDA 4UFOA 2Z8XA 1ACLA 5T4HA 4H7KA 3M81A 1CUSA 1U4NA 4G9GA 3WK9A 3D5EA 1WB4A 1XQXA 1CUJA 5AI6A 2WILA 1EDDA 1LLFA 3VJLA 2OCKA 3P2MA 4YPVA 4X95A 3H2IA 4EUSA 3TEJA 1TCAA 3V1LA 4C89A 5FP0A 5C8VA 4OD0A 3WKBA 1Y37A 2XUPA 3WK4A 4BATA 1QOZA 3ICVA 4OSEA 2Y1KA 1LPMA 2XUFA 4B9AA 1LPNA 3PFCA 4BC0A 2XUJA 2WU4A 1MAAA 1LGYA 5EI5A 5HK8A 1G5FA 1ZD2P 4PSUA 4L3WA 3FWHA 1XFDA 1THGA 3C70A 4LYEA 2ACKA 3QZUA 4B85A 2XUKA 3IURA 4L0CA 1N8SA 1IVYA 1C7IA 3D2CA 2J3QA 3PE6A 1MX1A 1JI3A 4G5XA 1XZDA 3D7RA 2HA7A 1XRLA 3WL7A 3FCYA 4QZVA 5ALOA 5FV4A 3R41A 4BCBA 2XB6A 3EQ9A 3G0DA 2HRQA 2G63A 4XIIA 2Y6UA 4ZGBA 4Y2QA 3DOHA 1NU6A 4UBIA 5AKGA 4TPKA 2BKLA 6YASA 3I1IA 3I2JA 3W06A 3WMRA 2QVBA 5ALYA 2BCEA 5HQ3A 4Y2TA 5AP9A 3D2BA 3EQ8A 1GPNA 4XWGA 4F0JA 3O4HA 2PM8A 1E8DA 2IX9A 5ALMA 4J03A 5BV7A 4FHZA 1UK9A 3DKKA 2D0DA 1ZJ5A 3C8DA 4CIAA 2QKYA 3KD2A 4FLEA 4C88A 3AJAA 5IKXA 1EHYA 4OB8A 3S8YA 2XQJA 5C8ZA 3WK5A 3IUQA 1UK6A 3ESCA 2XMZA 4CCYB 2EEPA 3HJUA 2WSLA 3RK4A 1FFBA 1CLEA 1RWQA 5CXUA 3C43A 1LPAB 3WIBA 1N5MA 5T4BA 2CJPA 1CUDA 4BDSA 3O9MA 4PNZA 3H04A 5AOBA 4H18A 1KEZA 2WUEA 4ROTA 3WK7A 1TAHA 5JANA 2BGNA 5DJ5A 3F97A 4HXEB 4QDZA 2XUHA 1JJFA 2QUAA 3UMJA 4AN1A 4P93A 4K6GA 5DYWA 4FDMA 2WTNA 1BEZA 2V9ZA 4BTVA 3OURA 3KWJA 1C4XA 1XQVA 4BE4A 4IQ4A 4FKBA 1VA4A 1W75A 3VXKA 1R9MA 3C5VA 1LBTA 3T52A 4TGLA 4DSAA 1DT5A 4WFIA 4CFSA 3A2NA 3BF7A 4GI1A 2PX6A 1CFJA 1W76A 3WJ2A 1PFQA 1XRNA 3M3DA 3JW8A 3SWWA 3ZWQA 4I4CA 2BFNA 4AO8A 4CG1A 1A8SA 2ZYSA 4B0PA 1XZCA 1VXOA 4WY5A 4MQLA 3FOBA 4N8EA 2H1IA 3WKEA 4BRZA 3BDIA 3DNMA 4C4YA 2XMQA 4OB6A 2V96A 1XROA 5JADA 5JAUA 2HU7A 1DWQA 5SYMA 3GZJA 1GPLA 5DYTA 1CUUA 3QM1A 2G5PA 5FDFA 5K3EA 4FBLA 4UHEA 2Y2VA 1IUPA 5AM0A 3H18A 2I78A 5DTIA 3ESDA 1YB6A 4J0IA 5JAPA 1YAHA 1MTZA 3PUHA 5CH8A 3MUOA 3B12A 4E15A 1J06A 3DL4A 4FTWA 3ICWA 1F8UA 3NUZA 1JJBA 1LPPA 2XUGA 2JGIA 4A23A 3HXKA 3WIOA 2WG0A 3K2IA 1QGED 4EY4A 1ODSA 4KRYA 3O95A 3G0IA 5AIBA 5AI9A 1O6GA 4P9NA 2CUTA 3FCXA 3BDVA 4W63A 5C8XA 2B9VA 4OU5A 2H7XA 2OGTA 2YH2A 4Q1VA 5KWIA 1GPKA 1MN6A 2VA9A 3W9UA 4AXBA 1MPXA 3C6BA 2VT7A 2QUBA 2QMQA 2JGJA 3ILSA 4UHBA 5AH0A 4JEIA 5AK5A 5JD5A 3HLKA 1CUFA 3F98A 4C01A 4C6HA 5IVIA 3WWPA 1XQYA 3ED1A 5I8PA 3FYUA 1Q0RA 5T4EA 4X6XA 2IIVA 4G8BA 4BB0A 4A5SA 3DL7A 5JYCA 3AIMA 2ROQA 3VJMA 5JZBA 2HM7A 1XZFA 3W2TA 1CV2A 4H7DA 2FUKA 2I03A 2WIJA 1L7RA 5D3ZA 3FVRA 3IA2A 4H77A 1AGYA 3F8SA 1UKCA 5ALGA 5CURA 2GYWA 3ZLVA 5JASA 1MAHA 1W52X 4HXGA 2JGEA 3FNBA 4H7JA 4QNNA 2QR5A 4M0FA 4MEBA 2PUJA 5AM3A 1AQLA 4G4JA 5ALFA 1R3DA 1ZOIA 3DJYA 3S2ZA 1E8MA 4BVJA 2WJ3A 4G8DA 1ZI9A 2WQZA 2OCIA 1SOMA 3BE8A 2RI6A 4OCZA 1JFRA 3SX4A 1ZI6A 5ALWA 5BWBA 3I2FA 1DQYA 4MEAA 3WZLA 3LP5A 1UT6A 4LYDA 2J3DA 2HFKA 5D6OA 4J7AA 1P0QA 4BBZA 1CUVA 4U2EA 2JIDA 1Q84A 1QLWA 3LS2A 5DNVA 3HABA 5CT9A 4E14A 2VQ6A 5AKIA 4ITVA 4K6KA 1F6WA 1XZLA 1DWOA 4GDMA 3VJKA 1ORVA 4FWBA 3STUA 4UBOA 4W1QA 1NX9A 5ALKA 1EA5A 4Y2YA 1BROA 3STTA 1QIMA 1SCQA 4DTCA 4L72A 5AI4A 5ALVA 5AM1A 2QRUA 3RARA 1MX9A 3CCCA 3DOIA 4YK7A 1H2ZA 1YB7A 5AKHA 4UBMA 1JKMA 1P0PA 4B9EA 1QTIA 1FJ2A 1DINA 4LXHA 4UUQA 1ZICA 1SFRA 4PF1A 2ONCA 2HA5A 3R3ZA 1LZKA 5HKBA 3I6MA 5FKJA 4X92A 3V48A 4DMCA 2XLBA 5EHZA 3B5EA 3VDXA 3DLTA 4QDXA 3NOXA 5AI5A 2XMBA 1IMJA 4PQEA 1AURA 1VA5A 2HL6A 1MJ5A 2ZJ6A 4CI9A 4GHWA 1CPYA 2HFJA 1R1DA 4INZA 3AINA 3ZV7A 4UFPA 4WDRA 4O08A 4NVRA 4J0DA 4QEKA 5ALLA 1DX6A 1R88A 3DKRA 1UK8A 2WIDA 4BYMA 2JBWA 2ORYA 2XMGA 2WFMA 3QMWA 4E46A 2HHAA 3WZMA 3HI4A 4K6HA 4DMHA 2OAEA 3PDCA 4FOLA 4EY6A 2GZRA 1WM1A 2GBFA 5CH5A 5FPPA 4AMZA 1E89A 1GKLA 1CUAA 4IH1A 4AB1A 5CMLA 5AKLA 5BOVA 1K8QA 4BVLA 5DYYA 2WG2A 1AZWA 1QJ4A 4AO7A 1QIKA 1LPBB 3BXPA 1QZ3A 4BCDA 4Q3OA 3STXA 1H23A 3TJMA 4EZIA 5ALHA 3F67A 1TCBA 1K6EA 3K9BA 2ZVDA 4BAGA 4B81A 4FNMA 4QA9A 1FSSA 2O7RA 4MQMA 3FLBA 4IO0A 4IHAA 4QDOA 4RE6A 2WUFA 2R8BA 2PPLA 4X7BA 4BRSA 3M83A 2GBIA 5EIHA 3EQ7A 1QFMA 1VE6A 3L1HA 1WOMA 3FAKA 5IVHA 1ZGCA 1W4LA 4XVCA 4G8CA 1Q83A 3ZPXA 5I9IA 1BN6A 3WL8A 4P08A 2J4FA 4Q3LA 1KU0A 2DSNA 5AKKA 2HA6A 4Q82A 1EXWA 4Y2XA 4JYPA 1ZD4A 1BRTA 1Z68A 3EBLA 5IVKA 5E2IA 2ZSIA 4UHFA 1B41A 3H2JA 3GROA 3KOOA 4HS9A 4BAUA 3WYDA 1MO2A 3V9AA 2CEKA 3AZQA 3CN9A 3H1AA 4CIBA 2VT6A 4KEAA 2HA4A 1K5PA 3A2MA 2VEOA 4WJLA 1ACJA 4FFVA 1VKHA 2H7YA 3STWA 1VJ5A 3WL5A 5JD6A 5AJHA 2NW6A 5ISMA 1EVEA 3KDAA 4MXDA 5CTAA 5D3KA 2VJDA 1A8QA 2E3JA 1QIEA 1QIIA 2VTVA 5AOCA 1AMNA 2O2HA 2ACEA 3FSGA 2DR0A 1VXRA 2ES4A 2WJ6A 2DFPA 1OCEA 3V1MA 1XRMA 4V2IA 1B6GA 3IUNA 4LIPD 4Q34A 4BZZA 2VJCA 3R3UA 1ZD5A 5CBKA 1ODCA 3G0GA 5A62A 5AICA 5LIPA 1LZLA 1HBJA 5DNWA 3HRHA 4UFNA 4H7FA 4PSDA 2V97A 4B80A 3MUNA 2Z3ZA 1TKRA 3G8YA 3DS8A 3C6YA 1LNSA 1ETHA 3IULA 1ISPA 1MU0A 3SK0A 4GEGA 1CR6A 2PU5A 4JH0A 2Y6VA 4J0GA 3UUEA 2ZJ7A 1E5TA 2RHTA 4QDTA 4E11A 2O2IA 3PUIA 2QS9A 2H7CA 2VAVA 2XMCA 3DQZA 4ZREA 5LKRA 2PU7A 2BAGA 2CKMA 3LLCA 1K63A 4UBLA 4EY5A 4WY8A 5EHNA 3FYUB 2FX5A 3IB3A 1R9NA 3OTQA 4H7IA 2YYSA 1D07A 4QWMA 4NS4A 3WA7A 4C4XA 3WL6A 1YR2A 5ALDA 5KBYA 4GBGA 4MJ3A 3QPCA 5BWCA 2WJ4A 3R3VA 2UZ0A 4AO6A 4KR0A 1YA4A 1H2YA 4D9JA 3FLAA 2ECFA 4B84A 1TRHA 3KSRA 4CG2A 5K3FB 4OB7A 1XZBA 2QOEA 4HRXA 2HU8A 2OG1A 2DHEA 3CCBA 4J0CA 4MYSA 2XE4A 4DYHA 3C8HA 2OPHA 3VISA 1QFSA 3RKSA 4GECA 2YASA 3BWXA 2I3ZA 4F60A 3PF8A 3WWOA 5HFNA 4ZWNA 2FJPA 3A70A 4WDQA 1EX9A 1ODTC 4I19A 5A6VA 3JYHA 4QWWA 3ESBA 1XRRA 4B6GA 5H3HA 4GWLA 1U65A 1WPXA 4W1PA 5LLSA 2AJDA 3ZI7A 1ZI8A 4QE3A 4Y2JA 4C87A 2PSJA 1JU4A 2G5TA 5ALJA 2PVSA 2R11A 5DWDA 1XLWA 5EFZA 5C81A 3DD5A 1Y7HA 3AZPA 1JU3A 1Q0ZA 5AK4A 2OXEA 1CEXA 3I6YA 3UUFA 4KAFA 3FVTA 4F21A 3FBWA 2HADA 1EINA 2GYVA 1UWCA 1A88A 2D5LA 2WHQA 4X6YA 1XZIA 3G0BA 1QONA 3BL8A 1ZIXA 1VE7A 1CUZA 1X2EA 1FFAA 4WFJA 5ALPA 5K5EA 4Y2RA 1CQWA 1S8OA 1VLQA 1EB8A 1L7QA 3AILA 3YASA 4UHCA 1GT6A 3WI7A 1G42A 1USWA 4H7HA 4MWTA 5ALRA 3FSGD 1XKLA 5ALEA 3G0CA 3NGMA 5K3DA 5K3FA 5AK3A 5K3BA 1X2BA 4FNGA 1MX5A 4DMKA 4C4ZA 3X3HA 3NWOA 4PSCA 1CUCA 5J3JA 4UBKA 4YX9A 5ALTA 4HAIA 4MYDA 2GYUA 1P0IA 3LIPA 2JEZA 1WB6A 3IVMA 4FFWA 3WK6A 1BCRA 2XUOA 4X93A 5CW2A 2O7VA 5EIEA 3R3WA 1E8NA 1QIJA 4Q3KA 1EK2A 1WPRA 4QLOA 1HDEA 5HCUA 3EF3A 2BUBA 4Y2VA 5CT5A 2XUDA 3IBTA 3HZOA 3O4JA 2W6CX 1BCSA 4GXNA 2VATA 1CRLA 3Q8WA 5K3AA 2GBGA 1IUOA 1J07A 4F5ZA 4ZV9A 4AMYA 3QH4A 2OQIA 2WHPA 1XZMA 3CN7A 1ORWA 3FYUC 3I2HA 2VSQA 3GBSA 1GZ7A 4J0JA 2HRRA 4BE9A 3H0CA 2FJ0A 4DIUA 2RAUA 4X90A 3R3YA 2DHDA 3E1GA 3L1IA 5AO9A 4H7EA 5T4FA 3O4GA 3I1YA 4G9EA 1GQSA 3E4DA 5JIBA 3A6ZA 1T2NA 1CUIA 5AI8A 1YA8A 5FOQA 4HXFB 1QIDA 1QO7A 3I6ZA 5E4YA 2RHWA 3BIXA 3BJRA 5YASA 2Z8ZA 3I28A 1CQZA 2DCMA 1GGVA 1CUGA 4U2CA 2IITA 4W1RA 2GBCA 1XLVA 3BF8A 1A7UA 3W05A 2J4CA 4DNQA 1UOOA 2OGSA 5IH7A 4G4GA 4HTAA 1CUXA 2WFLA 1BU8A 3QYJA 5DTJA 1BS9A 1U8EA 2P8SA 2BGRA 3HEAA 3H2GA 4Z49A 2QXTA 3ZLTA 4OYYA 4BDTA 1GQRA 1K4YA 1LPOA 4HRYA 4UPDA 1BE0A 4OYLA 5AOAA 2GZSA 1LPSA 4KRXA 1CUHA 1PJAA 4YASA 4EA6A 2LIPA 2WIFA 4X6UA 2Z5GA 2ZYRA 5AKEA 3TGLA 1TK3A 5FLKA 1WHTA 5AHXA 3W9BA 1HPLA 2AJBA 4J0KA 3V1KA 3WK8A 4DNPA 3VKFA 1E66A 4ZRDA 4JUIA 3LIIA 3IDAA 2XLCA 2CB9A 2PSHA 3OOSA 3V1NA 2AJLI 1WB5A 5KWJA 5A2GA 5FUMA 3OM8A 4S0XA 4AZ0A 4PV7A 5LYYA 3STVA 2EDCA 4G1FA 4RE5A 1N1MA 2XT0A 2WIKA 5D7BA 4U2FA 3AUKA 2OGZA 4RPCA 1U2EA 5EIAA 2HA0A 1O6FA 3PF9A 1EDBA 2B20A 5AI0A 1ZIYA 4ARAA 4XX1A 5ESRA 1Y7IA 4Q05A 3FYTA 1JMKC 5AM2A 3Q0TA 2WHRA 2XQFA 3M82A 5I7UA 1I6WA 4B83A 5C7YA 1QE3A 2XUQA 2Z3WA 1SCIA 5HK9A 2BUAA 4PO3X 4I3FA 4H35A 3AFIA 2QM0A 2JGFA 1XKTA 3H19A 3LCRA 4WFKA 4LXGA 3H1BA 4AQDA 5JAHA 2C7BA 1UK7A 3WKAA 2PSFA 5AKJA 4QLAA 3D59A 2HDWA 4WCVA 2DQYA 3QPDA 1WCYA 1QO9A 1XZGA 2AXEA 2PBLA 4CCWA 4G4IA 3OG9A 5LZ8A 1W6RA 4X91A 4N5HX 2C58A 5ALSA 2ZSHA 5JALA 1XRQA 3O4IA 3C87A 5EGNA 4Y7DA 3U1TA 2XUAA 2JGLA 1DT3A 1THTA 2AJCA 4X94A 2WFZA 3QVMA 5FPQA 2I3DA 3W04A 2CBGA 3GELA 5LZ4A 3E3AA 3F9CA 1XZAA 3A2LA 1EH5A 3ANTA 1X70A 1H22A 4EBBA 3B3QA 1XZEA 1ZGBA 1VZ2A 2XUIA 5A7HA 4ZV7A 1DU4A 4OUKX 4LXIA 2X76A 1R50A 3ESAA 4B82A 2WIGA 4ZI5A 4K5QA 5F4ZA 2HU5A 2PSEA 3TRDA 2VAXA 4W9RA 1EDEA 3G9ZA 1UXOA 4U2BA 2QJRA 1PV1A 4MWSA 4UHDA 1UKBA 4LHEA 4GLBA 2WG1A 4BZWA 1H2XA 1LBSA 3WYNA 1QTRA 4RNCA 2WM2A 3DDUA 1A8UA 2W22A 5CT6A 1RYYA 3RLIA 2OQVA 3G02A 2OCLA 2XMSA 3CXUA 1XQWA 3MVEA 1YS1X 2XQIA 4KAAA 3C5WP 4Y2UA 2XMRA 3I2IA 4A16A 3E0XA 3DEAA 4DM7A 4PW0A 5EHXA 4BC1A 4AN0A 2WTMA 1N5RA 1YS2X 5CT8A 4H0CA 1NU8A 2XI4A 4FMPA 4OU4A 1FFDA 2VF2A 5AM4A 2B61A 4KE9A 5ALIA 1GXSA 1CVLA 2OLEA 4X3CA 3AIOA 1CUEA 5JZSA 4EY8A 1L7AA 1VZ3A 2BUCA 3BJMA 3WJ1A 2OAGA 1XZHA 5ALUA 4KE6A 3QMMA 2AJ8A 2K2QB 2BJHA 1YASA 2RGUA 2C0QA 1JMYA 3QBJA 3IIIA 4HZGA 4DLNA 4X85A 3FLEA 1EVQA 2PUHA 3GUUA 4TVKA 4BCCA 1EK1A 4AZ3A 2C4HA 4CCYA 2ZYIA 5A7FA 4K2AA 3G7NA 1FFCA 3KWFA 5HFAA 4DNOA 1CUYA 2HIHA 2CZQA 5ALZA 4B7ZA 2RONA 3AZOA 5KREA 1CUBA 4KE7A 2ZJFA 3C6XA 3D3NA 5EHQA 1MNQA 5LKAA 3OC0A 3R40A 1HL7A 1OXMA 1TQHA 3K6KA 4DGQA 5FXMA 2QT9A 1TCCA 1DWPA 5AKYA 1ZJ4A 4KJXA 3QITA 3H2KA 1E3QA 1QIHA 2JGKA 1UOQA 4W1SA 2V98A 3C6ZA 5SYNA 1EI9A 1G4HA 4EB0A 1R4ZA 1T4MA 1P0MA 4NMWA 3PI6A 2JEYA 2JF0A 3WA6A 2OCGA 5HZGA 2WHPB 4X71A 1XRPA 3PFBA 4BTLA 1ZD3A 1VOTA 3SC2A 3F96A 3WWCA 4CG3A 4EY7A 3ANSA
chains in the Genus database with same CATH superfamily
1IQPA 2ZB2A 3NGXA 3AJ9A 1NP6A 7YASA 2PL9A 2C97A 4M60A 2Z43A 3QPUA 3SFVA 3TXAA 2AVNA 2H9YA 2OBYA 2QNIA 3GAMA 4QUIA 3RVLA 3MTJA 4GM0A 4K3UA 3OZ7A 2J1LA 4EO4A 1OV6A 3HCEA 3G9TA 2V6BA 3EH2A 3EWAA 4A10A 3AR2A 5A0VA 1JYFA 1H2WA 2AKEA 5FBWB 4M0MA 4BLOA 3HA2A 4KYVA 1NZDA 1P80A 5B7QA 3QIVA 4GMKA 1NOKA 5ESDA 1ZUNA 5AVZA 4AYTA 4IJWA 3ZLUA 4B75A 1QYCA 2E89A 4Y0NA 5J4VA 1XCLA 2A1TR 2HSJA 4K87A 2ZIAA 4GZ3A 4WN3A 5K2OA 2OO5C 2CCKA 1PYGA 2EV9A 3EC7A 3KOYA 3PDHA 4TM8A 4BMSA 3GARA 4Q4DA 3C97A 5DMXA 4OGFA 4Y9SA 3OESA 1SUCA 3ND8A 1MA3A 3LCUA 1R00A 4LHVA 2C1EA 5JAOA 2C4UA 1V4BA 2OZPA 2V9PA 4GAEA 5FCDA 5H80A 3CF2A 2X2OA 4IJKA 3LO8A 1R5NA 3HFRA 4Z7NB 5ALXA 2X6QA 1Q1NA 2F00A 3DVAB 4LFBB 3C5EA 5GJWC 3IKJA 2OCDA 1WIWA 4WN9B 1GN8A 2HI0A 3GRPA 1X86B 2OC9A 1RKVA 1W5TA 3E3NA 2YJZA 3OM9A 3D4LA 4KYTA 4Q01A 4DQKA 4MI6A 4UDYX 2C61A 2HSZA 1CR1A 1JVBA 1WCXA 4DR1B 4IUYA 3QFHA 3R74A 3AEXA 5CFZA 4C0HA 4B33A 1QV7A 16PKA 1VHLA 3QXXA 5H3LA 5HF8A 1BMDA 4ESVA 2PYDA 4CDMA 4TQGA 2PXCA 4JP2A 1ESNA 3AR8A 1DBQA 3AF1A 3HA3A 1WZ2A 1YBVA 3AO0B 3UH0A 5JJBA 2QTCA 4RKRA 1I3CA 4X41A 2DVMA 4L78A 1RZUA 3S2EA 1U3CA 1YJXA 5EKXA 3H2HA 1ENOA 4M0EA 2OORA 1ULHA 2M1ZA 4KLZA 2EQBA 5ALNA 1N5DA 4OVKA 5FPHA 5JC8A 5AJXA 2IELA 2YQ5A 1YRYE 1ZC3A 5BYJA 4C08A 1I14A 2GZDA 3DL2A 3ES9A 2PZMA 1NV9A 5JOQA 1EUZA 5KYYB 5M29A 2JLYA 1N78A 4HDMB 4MS4B 3WGIA 1KERA 3TK1A 1NLMA 1CCWA 3AESB 1VCIA 4JGIA 1NXTA 2BI7A 1S3GA 2CXQA 3KALA 4N4AA 4DC9A 1C7ZA 3N2EA 5IEBA 4BB6A 2WF6A 4NBTA 3UAXA 3L8GA 2GKOA 2GN2A 1Y80A 3LJKA 2WQ7A 4DR3B 2WMYA 1DCTA 4F06A 2Q0QA 1XRSB 1G66A 3IE0A 3RIEA 4ETWA 4H3SA 3F8TA 2ZXUA 3O1JC 2O8VA 3WGUA 2ZIXA 2OHOA 3MOSA 2REBA 2PT9A 2AI2A 1IIRA 4P4UA 1TW3A 5L7YA 3TQIA 2Z5VA 2JGRA 4TMTA 5JR3A 2GM4A 1O03A 3E82A 4M9RA 3SC3A 3PJRA 2WWGA 4W8OA 1KJNA 1T6XA 3FCAA 2ZSJA 3P52A 1K4MA 2I2BA 2VDLB 3BVPA 4IH9A 1KYXA 1WJGA 3ZDRA 1AUOA 2QTVA 3GAFA 3KUXA 4GW3A 4ZU3A 3R5HA 3V5NA 5L4NA 1U0OC 2RKWA 3ZDQA 1MF7A 4Z9FA 1JHPA 1W93A 3T1HB 3GFFA 1ZH4A 5KTYA 1SZCA 2XKKA 1IHUA 3CTMA 3LFTA 4TV9A 2BCGY 2HPAA 2OSVA 1UBMS 1F0NA 1QAOA 1V9CA 2XQGA 2YJ6A 1NJGA 3A4NA 2I5PO 3EGXA 5DLPA 2DQZA 1MT3A 1T34A 3DKIA 4RX1A 3DP9A 1RRMA 2HQ1A 3G8AA 3KQMA 2MINB 2PH1A 3H11B 3U39A 1A9XB 2XTMA 3I61A 4IRXA 3CUYA 2HZBA 1AMOA 2YYAA 4PNEA 5F7ZA 1LQTA 2EJVA 1OVGA 5JZ9A 5LOVB 1CS0B 2CE7A 4CN9A 4EHBA 1VI6A 3N2ZB 3FTEA 1BHSA 1KIAA 1RTKA 4C6RA 4YTEA 5B3KA 3PJFA 1E0DA 1QX4A 4LRWA 5CG1A 4N0DA 3ND5A 3U0VA 3KJXA 9LDBA 1AQYA 2AK2A 1DTEA 3ZGXA 1H5QA 1RP1A 2WZDA 2Y66A 3KQTA 4DLYA 4Z7OB 1RBYA 2XE6A 5TLSA 4KE8A 2C5GA 2ECKA 5D5QA 3BSFA 3K9NA 4YLYA 1FFEA 5EGSA 3NTVA 3TYXA 4HB2A 4ITRC 4X00A 3DYVA 4BVKA 2IHVA 4CKCA 4BQNA 2IUEA 3D5TA 2BH2A 1L5WA 5A03A 3WSTA 4F3YA 2XVYA 4U2GA 4R8KA 2Z83A 3JVEA 4JT4A 4URVR 1D0SA 1Q7RA 1QH8A 3TOCA 2E2WA 3I83A 3O8QB 1X74A 3E9RA 1UZAA 5ALQA 1DQZA 3UB2A 1UJ5A 3I5XA 3ZW9A 4U7PB 2V55B 1L4GA 2XRFA 1T9BA 1JXOA 3D1LA 1IN7A 2ZYAA 5KSOA 2ODNA 4Q16A 5IJZA 3C15C 2CMFA 3G8DA 1TIKA 2B1QA 4FN4A 2FPUA 2BD0A 1S2GA 2AGVA 4NL4H 3Q41A 4KO4S 5AHWA 5GV7A 1NQTA 1T9ZA 5FO0A 2AC4A 4D5GA 3PXUA 2ZU6A 3TSCA 2HK9A 5AK6A 3FB1A 1RCTE 5IX8A 3X2SA 5JUWA 3ZWNA 4GMFA 3QMVA 3MW8A 2RHLA 4H2DA 2X1VA 3ZUGA 5H4GA 4Y6LA 1JIUA 1VYVA 4YDRA 3HFSA 3M3PA 1GKKA 2FSIA 2JA2A 4LGCA 3T3GA 4ZU6X 4GBMA 4FR0A 4KN5A 4ZP1A 1JN0A 2NXEA 3PHGA 4HVTA 4J3JA 4L7QA 1COWD 4RL6A 4KAJA 2FZVA 3L0YA 1IZ7A 2GCGA 3QLUC 4DS3A 1M2FA 4MUIA 1J0EA 2R60A 3CQ9A 2IW1A 4UKDA 2AX3A 4XIGS 4TVBA 5A6SA 4FJ2A 1XTKA 4X8HA 5E4TA 2WY2D 4DSZA 4MP3A 4Y2PA 1PJQA 1UP6A 5M3BA 1GAXA 3DTVB 1LFAA 1QIFA 1LF5A 3I64A 4QODA 2CL5A 3CUWA 1NJ5A 4RJJA 2WRZA 3WLAA 3EMVA 1N7GA 4CM1A 4G0MA 1D0VA 1RABA 4JCOA 3K6SB 1G5RA 2IPNA 1KDTA 3QY0A 1QRDA 3VHRA 2O2GA 2PN1A 2VJBA 1TYEB 4BZXA 1F0KA 1U2GC 4E21A 3F3MA 4BN4A 4EI2A 3NHSA 1M33A 1W0KA 1ZXXA 4CEHA 2O8DB 2O2CA 2BP7B 2EDAA 2X5XA 1QNFA 4QTYA 1FU7A 4DB2A 1SN7A 2DPYA 2JGMA 2F1IA 2H0QA 2ONZA 3NJ8A 4YJHB 4LJ5A 2BMDA 4N7BA 4NNPA 4QAQA 2PEZA 4GXQA 4B4VA 3I2KA 1A9RA 1Q2XA 1J1IA 2LCIA 4ND8A 2HA2A 1SXJA 3P32A 5HQ3B 5I7FA 2WKQA 3ZHOA 4OPMA 2K5UA 3KJFA 4HAWA 4B6OA 1U4OA 1HKHA 3IR7A 3G6KA 2QAIA 4UFOA 1QQ6A 3L6OO 4HDQB 5JNUA 3HB7A 4BEVA 4AKTA 5DHQA 3RVRA 3AVUA 1HORA 1U90A 4PS0A 4MB0A 5CLLA 5AESA 1U9IC 4BZPA 2Q4EA 2ZUCA 4G9GA 4DQVA 5CYGA 5HM8A 3UWSA 1DQSA 3RG2A 1VIVA 4JB8A 1CUJA 5AI6A 3UYLA 3MFYA 1XTIA 2VK8A 4H4CA 1WMSA 2WD7B 2ZS9A 3M9XA 3PGJA 4K9MA 1S2LA 4TXJA 2QP4A 3MXOA 3ICPA 3CIOA 2VJMA 2OCKA 4RDIA 4AKEA 2ACVA 2Z09A 2Q6IA 4XEHA 4YPVA 2WQ6A 4OKSA 3A6KA 1UMDA 3K30A 4EUSA 3PDIB 4D9GA 1LA2A 1ZKMA 2Q21A 3QGMA 1WULS 5K9ZA 2VZ9A 4JQCA 3R9IA 3VR3A 3GFBA 3AYXB 3ENQA 3NR2A 1G98A 2QWXA 3S29A 1MRNA 1EJ2A 2DRIA 4OD0A 4PLGA 3D7KA 1KP3A 3P9YA 4PTZA 5FP0A 3WKBA 1GQQA 3T1OA 1P4AA 4ZYZA 3S2FA 4WZAA 3M6XA 2JLQA 4RANA 5EMHA 3OZWA 1BXZA 1JSRA 3RT9A 3EBOA 4W99A 1J0DA 3ICVA 5C1BA 5ADHA 5BQXA 1RACA 4O59O 4B9AA 1Q74A 1O8CA 1XVVA 2AOTA 3WNBA 1JEOA 3KZVA 2HRZA 2BH9A 1T2FA 1VHJA 3A9WA 3B8HA 1D2AA 2ZRQA 4HF7A 8LDHA 3TUZC 2YW9A 4DR7B 4PSUA 4DSTA 2C5HA 1RI2A 1JTEA 1P62B 3QZUA 2G9ZA 2VSYA 3UICA 3RAFC 4N5DA 2QROA 1H1LB 2H4WA 3IUBA 2JFGA 4TS9A 3RRZA 3PE6A 3RYTC 4DM3A 1EZZA 3BWDD 1E7RA 2ZJ8A 1O1YA 3E35A 4DZTA 5BWLA 1E7QA 2XUZA 3CINA 3NC4A 4OXNA 1A4RA 4RCYA 2XYHA 4BQOA 4G86A 1E9RA 4BX2A 4GKVA 2DFLA 4PEVA 2HA7A 3AW8A 3I58A 4YWHA 2C3OA 3ECCA 3OOYA 1K0FA 5BUCA 4TMZA 1G21E 2OAQ1 2B3DA 2QR3A 2GFHA 4QZVA 2VHTA 3AY0A 4RTJA 3KETA 2P27A 2P7IA 4BCBA 1VSQA 1IK4A 1E20A 3T7KA 3PENA 3W78A 2R8ZA 1NATA 2XSZA 4HZUB 1GZSA 1IBCA 4C06A 4RL4A 1KEWA 4WNCA 1H8EA 1OXUA 2G63A 4XIIA 3RTEA 2IU0A 3T94A 4Y2QA 1HE8B 1SKAA 1T5SA 1NU6A 2F9LA 3DOHA 3JQBC 3LA6A 1S4MA 4JBNA 1U1EA 2GJ8A 4MV9A 4R9NA 4B34A 3PWSA 2AYYA 6YASA 3WSWA 3BGDA 5ICMA 1R15A 4DAOA 3TSAA 4N6NA 1HF3A 4YRDA 4BMOB 1ZEJA 2OD7A 3RS3A 2TMDA 1JBQA 1T6BY 5AP9A 1P2UA 4XX0B 3D2BA 5BSGA 5DLEA 5AVYA 1OTYA 4UUAA 3EQ8A 1GPNA 4G5GA 4WUTA 4GXRA 4XWGA 3S27A 4F0JA 4UXJA 4OY3A 4RM2A 1KVTA 1WETA 1FLNA 4Q47A 3PUYA 5A4JA 2FPPB 5AVKA 1OREA 1Z12A 2QRVA 4J03A 3ZBQA 2MSCB 1YMVA 1DCMA 1M7BA 2BKUA 3A25A 3COYA 4J1TC 4NENB 5AW9A 3ASVA 1E59A 1Z4KA 2X9QA 3OP4A 1ZJ5A 4CIAA 2VCHA 2QKYA 5EINA 1A2OA 1M2NA 2VK2A 3AFGA 1L4LA 2IXFA 3IHLA 3OE1A 4NS1A 3VRHA 1PJCA 3DQQA 1NDQA 3S3TA 3NV9A 3GLVA 3T3PB 2QAGA 4FK8A 4BLVA 4WLUA 3WK5A 3NX4A 2DFKB 1ISGA 4FFLA 4UASA 3WXMA 4OAOA 4Q4AB 5DKFA 4RXUA 4Z4GA 1KZ4A 1EBUA 2OOSA 4BJ1A 2QN2A 1A4UA 1DHTA 1UK6A 5THXA 4CCYB 4PCVA 2MYNA 2ZWOA 5K3CA 1YD7A 4OHKA 1E61A 2HLDA 1USGA 1KZ6A 3VOAA 2Z58A 3I12A 3VI4B 3HJUA 4YYEA 4PAGA 2GA8A 3UPUA 1G8SA 2RGGA 4HQFA 2PMBA 4RQTA 1HYBA 5IYZA 3A6EA 3N2LA 2JFVA 4UAJA 1OGIA 2PMKA 1ZM3A 3C43A 3GPLA 4NWIA 1DEHA 1Y3AA 4TMYA 5T4BA 3WIBA 2PFSA 4KQJA 2DPGA 4G41A 3ZWPA 2JH8A 3AY7A 3OY7A 3RVOA 2PS3A 3V7YA 1A27A 2YJ3A 1U63A 3TI9A 5JMTA 5AHRA 2H48A 5G41A 4PNZA 1ADYA 3Q7TA 4RZUA 4Y6OA 3ZS9A 3FWKA 4EKGA 1R4AA 1EXMA 1A9QA 221PA 3GT7A 1YK1A 2UZAA 5FBQB 5ICGA 4JXXA 5IPFA 3W2FA 1TAHA 5A3SA 5K8VA 4C9BA 2Q4RA 2BGNA 4D9IA 1Y6QA 2BN4A 4E5VA 2HJWA 1W87A 4HXEB 2ZZKA 1C30A 1VKOA 2IW3A 2O3SA 3O1IC 3THOA 4X1IB 3OT1B 5SZJA 4CMGA 3L4JA 1NNEA 1YGPA 1Y9JA 1IZ9A 4WV3A 3RYIB 2Y8EA 1GTG1 1DMRA 2QRGA 3QU4A 1CYEA 3H6KA 1RWOA 5HYVA 5J4LA 2X0KA 2V7XA 3MJFA 4R2WA 2OOKA 1YO6A 2BVNA 3KE8A 4IAOA 2WTNA 4NV3A 4P5DA 3WGMA 1P3Y1 2V9ZA 3V4LA 5ITZB 2I2AA 4G0XA 3HSKA 1KO1A 1U7ZA 3KCNA 3KQQA 3TQSA 1UPBA 3P0RA 4XD7D 5TT0A 3I5AA 4MWOA 4E3ZA 4EJ6A 1YNSA 3AYZB 3AQ4A 1A5SB 3DZBA 1YUMA 4IQ4A 4MZXA 3ZV4A 1NMYA 3FGZA 4URUR 2WKRA 3I39X 1L5RA 1SMKA 1VA4A 2VJQA 3FUTA 3IT2A 4DMMA 1Y6GA 4IGFA 3MFQA 3EA0A 1I80A 4YRBA 1P73A 2NUPA 3BAFA 3ZBPA 2PV7A 4J2HA 2RIRA 2JD0A 4EHDA 3T52A 3KBBA 3SBEA 3RNLA 4GLLA 2VPPA 2NZUG 1K7CA 4QXRA 1CLUA 1L7DA 4AMBA 4DCPA 3L79A 3OMXA 4W6ZA 1Q12A 3RIGA 1X19A 2W6JD 1JVSA 3A2NA 4FE7A 3HDTA 1ETUA 2Y0CA 3R3SA 3HEBA 1L1EA 4JUCA 3O3NB 1RJWA 2FHPA 1Y98A 4KQGA 3KSMA 3SQMA 3O93A 4ZQFA 4LOKA 4UNRA 1AA6A 1P0FA 4F45A 3B1XA 3I0NA 3M3DA 4EKEA 3DCYA 3IEKA 4LYFA 1PV2A 1V0JA 2YFQA 4B7AA 2FRVA 2WWFA 3W5IA 4XLZA 3Q7IA 2EFYA 2IIQA 3KXKA 3DTNA 1TI7A 2BFNA 3RUHA 2D0PB 3QU7A 3ZWQA 1WP4A 2XNDA 3T41A 3V4PB 5HILA 3LAWA 3MWLA 1MO3A 4QDKA 4U1RA 3S1LA 4GXTA 1OE0A 4QJ3A 5GTDA 2AR9A 3N74A 2EKBA 2ZYSA 1XZCA 3VC1A 1U2QA 5H4HA 3VM6A 4C4TA 3Q5EA 5K6AC 3KX2A 4XYMA 1ZIPA 1NMXA 4ALKA 4OFXA 1EE1A 5GOTA 3WKEA 1LBIA 1F8GA 4E03A 1FSFA 4INAA 2PA0A 4FQ5A 2JD2A 3FX2A 2XMQA 3AEZA 4OB6A 3UV7A 2HU7A 1H8HA 1X80A 1USKA 1Z7BA 1DWQA 3VVBA 5IJ9A 5B2EA 5GZ6A 3VPDA 5B6PA 1PFVA 3ICQB 1D03A 1WUJS 1GPLA 4LJ4A 1CZNA 4XQCA 2KM1A 4KQHA 5TS2A 2Z56A 3OWHA 1EG7A 3QM1A 2G1AA 3VR4H 1EUQA 1OUMA 1T9CA 2G5PA 2BM0A 2OTCA 1G2OA 2JCGA 1DBWA 1WHSB 2HPZA 3JD0A 4MPPA 2RGAA 3D7NA 4GP9A 2NV0A 4Z7QB 3OZBA 3NETA 4X5OA 1JG3A 5LB4A 3A3NA 1EP1B 2OUIA 3WAJA 3KUUA 1QQBA 4WNIA 1SCUA 1LK5A 3BB4A 2I78A 1PN3A 1QFJA 2D06A 5DTIA 3X43A 4CUJA 2V0CA 3A1WA 1P1CA 1XTZA 4YBZA 4Z7JA 4MVJA 4JP1A 3BH7A 2P9TA 3AMVA 3IP7A 1T9GS 1QV9A 4MUFA 5FTKA 2R8EA 3C3PA 3VSBA 4K2HA 5FPYA 2Q41A 1T0PA 3UW3A 3D54D 5CB4F 1AGNA 4M7OA 2H5LA 3LI2A 3IERA 4RD1A 3F7TA 1NJ8A 3KKZA 1PWYE 1TFUA 3WLFA 4C5BA 5KOJA 5CB8A 4FTWA 3ITNA 4ZO6A 3V4FA 1EE2A 5DEIA 3NUZA 4FP9A 4LCEA 1SXIA 3M6LA 4YP1A 4Y9RA 4DM4A 3DWEX 4B8YA 5C1DA 1NQOA 5AVSA 2CHUA 1YDGA 3DJFA 4IF4A 3KB1A 3GH3A 4Z1MA 4D2IA 4NARA 1CJCA 2JGIA 4JFRA 3QXSA 3OQNA 2D5BA 1VECA 2QN1A 3T35A 3VC7A 2QG4A 5A9SB 3NJ4A 5FI1B 5I5GA 5JI3E 3OIDA 3WIOA 3CNLA 4DRXB 4QUGA 3HQ4O 4LZOA 4L7VA 2C4VA 5A06A 3AU9A 4J6EA 4QIHA 4FEAA 3LDGA 4P7FA 4CLHA 3JD2A 3N9IA 4ZO8A 4BWVA 4XWKA 4HDRB 5KJEA 2P2NA 1ODSA 3T6KA 2VYVA 4KRYA 3MHTA 1V11A 3O95A 4ZQBA 1V2GA 1RYHA 4EA9A 5EJ8A 3ETEA 5FWAA 2J7KA 3IMKA 2OHXA 2B7LA 4XA8A 1XF1A 1WAMA 2HX1A 1EJ0A 3AEKA 3BCUA 3L0SA 4G5YA 3FZQA 4LQCA 3RW9A 5AI9A 1ZONA 2R79A 4K8RB 5EIOA 3UJ7A 5JNSA 5IASA 2PRZA 2FEXA 1RQRA 1U8YA 3LLMA 4MRMB 3KJGA 4ZVRA 3MTEA 3SSNA 3V8VA 4DRYA 2MSLA 3BDVA 4W63A 1T4CA 4XCQA 3KTAA 3SXUA 5L3VA 4AROA 5CITA 1BGVA 2B9VA 4NHEA 2ZIEA 4OX9B 2GPAA 4R9RA 1CXZA 1F6BA 2V6GA 4YJ2F 4YAEA 2O5RA 4EW6A 5KWIA 3AGPA 3SZ3A 4UC0A 1KAEA 4ND1A 3IKVA 4OAPA 4BFYA 5B55A 1W59A 1MX3A 1KY4A 3RSZA 2DB3A 3JAWB 1GPJA 5U9CA 2GN0A 3MUFA 3TW8B 4DVJA 2GKSA 4PHFA 3U5ZB 3CR7A 3B2EA 1H2HA 5B6IA 4MYUA 4EGJA 1UBEA 2WLTA 2FSPA 3RYHB 4DCVA 1YGYA 2A6PA 2FW9A 4J4TA 3O3OB 2SICE 3WVNA 2C92A 2V3CC 5AHOA 1Y3FE 2PH7A 2W90A 4UHBA 3RYFB 3AHDA 4JEIA 4UJ5A 1UMCB 3OLWA 4HI0E 5AK5A 1FBNA 4JJZA 4MTCA 5H3CA 4YQEA 5JD5A 2UYHA 2H1OA 2NZJA 3F98A 1F2UB 4C01A 3ANXA 3DUFA 2QJOA 3EJ6A 1V37A 4GG1A 1XQYA 5DXFA 1E6KA 4AJOA 4D9BA 1QXSA 4QBKA 2FF7A 2V6MA 5I8PA 3A1DA 3NPMA 1NTOA 1QSGA 1EFPA 4YJ3B 2OYRA 3K20A 5IZ4A 5T4EA 5T6MA 5HUJA 2BGUA 2PIAA 5DGDA 2CV2A 1UM9B 1U1DA 1COZA 5FUBA 4BASA 2Q50A 5CFMA 3SEZA 3G85A 5EKTA 4LN1A 3NBKA 1XDBA 5BNTA 1LWOA 2A84A 2ROQA 3N8DA 1KQOA 5DGTA 3EEIA 4WE3A 1VLZA 4Q3BA 4IVRA 4RU1A 4B6SA 1ULSA 2H11A 4UOQA 2OYCA 1TJ4A 3D3EA 3NRJA 2WABA 4AMGA 1D2RA 3IBYA 5TVKA 2A3NA 5JYDA 2O1XA 2FUKA 1IEQA 3AUJB 4YC7A 4DZRA 1Z7WA 4I6EA 4OAQA 1MRSA 4IOMA 3RC1A 4O2BA 1WL8A 3OIYA 3FPCA 3Q7RA 2CK3D 5SZHB 4D56A 1NXWA 1XA0A 5DULA 2Q2VA 2VQEB 4H77A 3P26A 1AGYA 3CZ4A 3OE7A 2ZRKA 4OK5A 4S1WA 4JYZA 4ZYWA 4KBFA 4QARA 3BBPA 2GYWA 1GZ6A 1TJ3A 4KQ9A 4ABTA 3K09C 4YJDA 4Z9AA 2AG1A 2ZRFA 3LKVA 1ZO8A 2O2SA 4ALNA 2JFWA 3BMQB 4PGHA 2R84A 1UCFA 2IU3A 2XZPA 3Q6IA 2P2DA 4FHFA 3SSOA 5B1HA 3CLTD 5C8YB 4O4IF 2B4RO 3SOZA 2WJGA 1P7VA 4M9QA 5JVDB 2PVCA 4G4JA 5CA0F 4B17A 5JEDA 3W6ZA 4JT2A 1AZLA 3A04A 3ZCUA 1R3DA 1E3EA 1HY3A 1ZOIA 1Z56C 3ED5A 3GDHA 2P6UA 1PVDA 5F2KA 1MJGA 1RJ9B 3P9XA 4GEKA 4XR4A 4E0BA 4F1WA 3HYCA 3VZPA 1VFPA 4EJ2A 2OCIA 2YFKA 2B30A 4EFLA 2ZYGA 2BMWA 2VH2A 1G7RA 1SOMA 5EKUA 2GK7A 3VU8A 4LAFA 4LE2A 3TSOA 4LGMA 2PS1A 1B6SA 3LY7A 3LYAA 4XWAA 3KLMX 2J9FA 2ZROA 3KZCA 4LQLA 4OCZA 4TUYF 3UJAA 3UUGA 2XQVA 5CVCA 4P1ZA 3W2GA 2ZRIA 1PKEA 4YO8A 4CMAA 1PJRA 2R3SA 3SX4A 4ZI7B 3RC7A 2ECPA 1BHJA 3HXPA 4H31A 3INYA 4Y1GA 5EIBD 3DDZX 3VKUA 5K0SA 3GC6A 3AVYA 3OECA 3TGPA 3CPJB 5G0VA 4IQFA 5BWBA 3I2FA 4JSYA 5JS2A 1SUDA 4UUNA 2FMHA 2PXHA 1P6QA 2QMUA 3COZA 1R4NA 3H0EA 1GGHA 3AERA 3EAFA 5JDCA 5GVSA 2WWRA 1KK1A 3EGOA 4YMIA 1QTQA 2H57A 4N54A 4HX5A 1E92A 4LZPA 2VCYA 3K1TA 2FX2A 4D44A 2I7TA 4PYRA 2UYOA 3RVMA 1QKKA 5EN4A 3DZ8A 2M6KA 2QRLA 1U8XX 3HJNA 4G0NA 4JQYA 4XVRA 1KK3A 4E4TA 5KX5F 3RWMB 3I04M 1OH7A 4F4HA 2VNHA 1J2RA 4RZSA 2ADMA 3DOCA 4QU0A 2XNSA 1JPUA 2WKPA 2ZJ1A 1KYTA 1RQLA 3I2YX 3OICA 3P2JA 1WVIA 4H3VA 2JK0A 2ZS8A 2ZT6A 3HUEA 2P9YA 2QSZA 4I4TA 4CM8B 4NZYA 1GNRA 4BJ5A 2AJTA 3EZYA 2IYQA 2ERCA 2F8MA 1HG1A 5AJUA 1TM4E 2R48A 1G41A 1ONOA 5EJ7A 1JDZA 1B1CA 1ZS9A 2VHEA 3BZUA 2H0RA 5A9TA 3RIXA 4EF5A 4TZ6A 2AG5A 2JIOA 1XLTA 4XJSA 1DEKA 1KHHA 3NDIA 5CT9A 4CEIB 1T15A 2HDHA 1KQ3A 1H8HD 3BPSA 2PAAA 2YBEA 4K6KA 1VPVA 5TMDA 4UNIA 4PTYA 3OIVA 3S2IA 3UW1A 1Z4JA 4M0KA 2XTZA 2ZWVA 4FWBA 4ZT2A 3STUA 4TTSA 5TJHA 2AOUB 5JSYA 5PGMA 4RZXA 1KZ1A 1VL2A 2C20A 2HHCA 4KJZA 1NUPA 2ZI6A 7AT1A 2ZRCA 4R01A 1J7JA 5CP8A 2VHUA 2XZTA 5DSTA 1T3GA 3LUDA 3RU9A 4HWSA 4PZEA 4B4UA 2OHGA 3KB2A 2GHTA 4NPCA 4UE2A 1GYQA 2XGOA 4GOJA 1B43A 1MX9A 4KO3S 1G0NA 2Y93A 1CVRA 5GM2A 4CM4B 1C0LA 4FYHA 4KIJA 5E1MA 2OORC 1XPRA 2QSYA 2W00A 2H1FA 2Z3VA 4GP6A 3LC0A 1FVXA 1N5OX 3EVFA 4QFCA 5G1PA 4AICA 5KTKA 1IB6A 2DHRA 3GCGA 2MR5A 3BTVA 3GLFB 3MTIA 4C7MA 3T4XA 1Y6JA 5REQB 5AW2A 5JSHA 2H52A 4YO7A 4MHOA 1KOGA 2JIRA 2X9NA 3SM9A 5IJ0A 2IYEA 1AQJA 3LPDA 1N3IA 1I7DA 2J30A 3UEOA 3UBMA 3H1EA 4OHUA 1JKMA 1ZXBA 5K05A 3ZZTA 2J31A 3LF2A 1G7CA 4IDOA 1X8JA 1QTIA 3TGWA 4ND3A 2DM6A 3VU3A 1P1IA 2CWWA 3FETA 2C78A 2WF7A 3H86A 4YI3A 4LXHA 2IWHA 2FTKE 3SLKA 4CV2A 3AH8A 5B7NA 1YBHA 3DOEA 1ZICA 2VXYA 5F2OA 2HA5A 3K1AB 2B1RA 4E1AA 1GARA 4M89A 4OYHA 4QICA 1LK0A 4HQ0A 4GH5A 2FFQA 4Y1FA 4XPIB 2PUBA 3EN0A 1HNWB 4X92A 2PV0A 2VF7A 2XA9A 3V48A 2ST1A 2PUEA 4CXMA 2OXIA 1A7KA 3E84A 1OX6A 2A88A 1ZK3A 3DLTA 4Y6SA 3VDXA 5TF4A 3VZCA 4Z4HA 5LJIA 3H2ZA 2AOVA 5AI5A 3HZHA 2JK1A 4QOSA 1JZQA 4R98A 1IMJA 3JQAA 3OX2A 1XZPA 3IQHX 5WRFA 1IQRA 3WFJA 4EHLA 4DLKA 1CRWG 2F48A 2W6OA 3LKBA 4AJ9A 1USVA 2UUCB 4IGAA 1JHDA 4INZA 3PFFA 4RVNA 2DE0X 4WLNA 1IXKA 2H1VA 4RHEA 5LDHA 5FT9A 1J5PA 4UFPA 3AXSA 1QC5B 3IV9A 4X20B 4WDRA 3LKDA 3U48A 3GLGE 1HNZB 4GZ6A 1GAWA 1CNFA 3UUWA 2X5OA 3D7SA 2VSOA 3FROA 4YYZA 5I8WA 1C1DA 1M1NA 1Z3CA 4RTMA 4EG7A 4GPEA 1H9BA 1TMGE 1G5PA 1U2RA 3ACCA 4INJA 3ZDDA 1B73A 1EEXB 1KL7A 2VNAA 4L3OA 1I2DA 1O9HA 1QFXA 2BELA 2FUEA 2P5SA 3ABZA 4JN6B 3ZY4A 3HI4A 2GQ0A 3ZEIA 4UCQA 5DH9A 5B1SA 4DMHA 3Q7QA 5FNVF 1G4AE 2DZDA 3PDCA 3SR4A 5J59A 3IVRA 4X61A 3N70A 4EPYA 2KBFA 4FOLA 4B71A 4BFZA 2GZRA 4YXFA 1FFXA 1WM1A 2XT9A 4JMLA 4PICA 4PGGA 1ZGZA 4IEEA 4IV5A 4AMZA 4HFJA 1E89A 2ZSKA 1ZZEA 3R5JA 4YALA 4A8JA 4COKA 2IQ5A 4DXHA 2WF5A 5K20A 5L6LB 1CUAA 1L4KA 3VU9B 4IH1A 4AB1A 3QLJA 1Y34E 1AD2A 3WISA 1YFKA 2NYUA 3BH6A 1PL0A 4BVLA 3WIEA 3OA0A 3CVUA 3M6FA 4PCAA 1ODLA 1JA0A 1V7CA 3TW0A 1Y8ZA 2VRCD 5I4BA 1M6NA 2OBLA 1QJ4A 2PBFA 4N3AA 1WXQA 3BXPA 1QZ3A 3HB1A 4JA2A 1NYTA 3QELB 1RLMA 1SB9A 4IIJB 1JAIA 1U8UA 2XZOA 2EX4A 2EU8A 4LHSA 1JH8A 3TX6A 4EDHA 3TJMA 4KVFA 5ALHA 1VKJA 3F67A 5C18A 1PR9A 3F6SA 3NUGA 3MAAC 3LX6A 4GOKA 4O2AA 4RV9A 5BVGA 2NQ2C 4ZV4A 1FBTA 1NXSA 2I2CA 4AG6A 3RFCA 3ELDA 1YBAA 4B81A 4F3CA 4YJGA 1NN0A 2H4XA 4B6RA 2R00A 4QA9A 2N0SA 1H6AA 4Z2YA 1ITZA 1ZM2A 4UE6A 1YI8A 2VDUE 4EG8A 1ODJA 4XDHA 3FLBA 1DAMA 2W71A 4IO0A 2YOHA 1JIXA 1X15A 4XARA 4WEQA 3IRVA 1E9DA 3WGOA 4KFCA 1WMFA 2WR8A 4QDOA 3AEUB 2WUFA 3NAZA 2PPLA 1E58A 4KN8A 2FPGB 4WKPA 5HJ7A 1UJ4A 3Q40A 3LLSA 4QHTA 2GBIA 5HDQA 1K98A 3SXJA 2A35A 1T3LA 3M8KA 1Z6ZA 3H5VA 4IGIA 2DTXA 1Z0ZA 3L1HA 1Z47A 4JSRA 2ZBRA 2OB2A 2NGRA 2V7EA 3HBNA 3M7IA 4KTTE 1K3FA 3EGCA 5E8RA 4LYHA 5B53A 1JDJA 3AM5A 1W4LA 1WUTA 4N03A 4X1YA 1OJLA 5BR4A 4D41A 3N5CA 5HIMA 2PX8A 4Q3LA 2J4FA 3RAPR 3RUDA 2A7XA 2QYHA 2DSNA 5L53A 2YHIA 3CRMA 2HA6A 1RPNA 4EQ6B 5K8UA 1ZKDA 2D7CA 4G1EB 2R1ZA 4JYPA 4B76A 1V7PC 5FUYA 1SXJC 2NXWA 1DZ3A 4EL0A 3EXEB 4DLLA 2ZIZA 4A3SA 1Z68A 1OGJA 1USUA 1EWYA 3EBLA 3PD1A 2ZSIA 3IXLA 1H85A 1W9MA 2D1FA 3AF5A 1C29B 4OHWA 2F8LA 4CE6A 1B41A 4DKJA 1O94D 3KOOA 1P7PA 2AOXA 4HHEA 4BVGA 2G25A 4BQEA 3RSFA 2BFPA 5GGXA 3F6RA 2DOKA 1DELA 3I5UA 2QJFA 2YV2A 3GH1A 4EPTA 5JDIA 3TKYA 4AYWA 3FWNA 3ZJYA 4PHCA 4QXAA 1C1YA 1T1IA 2WE7A 3KJHA 2J85A 2Q3BA 3GAAA 3AY6A 1AKTA 2VT6A 3BICA 2IE0A 1J22A 1QG0A 1N8KA 2P2CA 5TV2A 4KEAA 2G83A 1Y5RA 1PD0A 1TQ8A 3ENZA 4JJAA 4RWEA 4Z4FA 3A2MA 4WJLA 4TKVA 4LUCA 2JHFA 1TAGA 1YJCA 5G4KA 3RHFA 3VKWA 1Y4DE 4MX8A 4CQLB 3I6BA 3H8VA 1IN8A 4MWEA 3N59A 4MKGA 1TCUA 3HKBA 5IXJA 2NVWA 3KB8A 2ATEA 3MQ4A 1ZYUA 2LNDA 1IONA 2GVZC 2MJLA 4DLUA 4MRNA 1DC8A 4V0RA 3TAUA 1JW9B 4KG7A 1FLVA 3IBSA 5JO9A 2I3GA 3KXDA 3SR0A 3FNRA 3IFSA 3GG2A 3K0AB 2RGEA 4P53A 1U9YA 5FUXA 1WPQA 1O6ZA 4DHWA 1VHWA 2NO0A 4DREA 3EPJA 3BSSA 3JD4A 4PGFA 4HUTA 3N53A 3S1AA 3GOHA 1EVEA 3GUCA 3JQ7A 3J7AC 3T8YA 3SX2A 1E99A 1GILA 1ZINA 1ZM4A 5CVUA 1A8QA 5LN1A 3RANA 1FYFA 1NUQA 1RD4A 4M1EA 1QIEA 3UQZA 1ESEA 1M72A 2G70A 2VTVA 4N9QA 4ZO7A 1ZPDA 2ACEA 2EF1A 4FN5A 2NO1A 4UM8B 4JKOA 4DSNA 4AX8A 3CUSA 4ZVLA 2NV2B 1VXRA 5LBUA 3QF7A 4LSGA 4DL9A 3VU0A 3DOUA 3IYLW 5GAJA 2PKWA 3QVGA 3T7CA 2GJ9A 1V35A 2I6SA 3GLQA 3W34A 1B6TA 1ESDA 2OG2A 2GK4A 3B6IA 4XRRA 4XEUA 7REQB 1PFYA 1JFTA 4MR8A 1T4BA 4V2IA 2WJYA 2WYHA 3EF0A 1UL1X 1GU0A 2OXFA 3D7MA 5MN5A 4BZZA 2VJCA 1Z3IX 3R3UA 1D9XA 3DFZA 3GJRA 1SVNA 3FSEA 1RAEA 4XR9A 3ZYCA 4LE0A 4NCKA 3DYBA 1AIPA 5LIPA 2NZ2A 3K35A 3KVYA 1ZXLA 1UPCA 5IT4A 3U4HA 1KEEA 4DA0A 1KWGA 1HBJA 3HTXA 2VXBA 4UFNA 3CNBA 5EYPA 2E21A 1V4NA 1TLTA 2H7VA 4QG7A 2JIQA 3UA3A 3NBUA 1PFUA 4KVAA 5DBEX 1JWAB 4QYWA 3CH6A 5JCPA 1SUAA 4PSDA 4JZYA 5HKKA 4AZWA 1O4WA 2Q46A 4OL0A 5LUBA 4B80A 4BKUA 4F8YA 4LGYA 3C41J 1AKMA 2HJ9A 4YAFA 4IWXA 3RODA 3TCNA 4JIMA 2FPOA 5F78A 4XRGA 3DS8A 2Y1CA 4TMKA 1TO2E 2M32A 2Y1GA 1ZOPA 1TYDE 4LECA 4OREX 2GUGA 3GCWA 4ZOLB 3W4KA 4QYMA 2HTFA 1L1RA 2DUJA 3FZNA 3ON5A 3EXAA 5DP1A 5T6BA 1MU0A 2J9XB 2Q4DA 4GEGA 4RWZA 1NC1A 3QVJA 2I6UA 3A3YA 1J39A 4GUDA 3N0VA 4JK3A 4XYGA 3VR6D 1OZFA 2JASA 3M2TA 1FUUA 3FGPA 3JQAD 4L9RA 3VX3A 3OQHA 3VDNB 3Q10A 4LTNA 3AVOA 3NHYA 4MUNA 3W8RA 1WQ4A 4EI8A 5CNIA 2XE8A 1E2LA 1V16B 3KUKA 4I1VA 5B7GA 2F7SA 4LZAA 3E9ZA 3RC3A 5KVVA 1E5TA 4D57A 5EMLA 3TLYA 1OLSA 1L5ZA 5KMGA 3D3WA 3OHSX 4BFCA 2O2IA 4RETA 1C8KA 5BN3A 3A6HA 3LUPA 3DAPA 2P79A 1XN1A 4G9BA 3VZBA 2FN3A 2QAGC 4JHLA 1SVUA 3G5UA 2XMCA 5ELLA 3DQZA 1S96A 1YR6A 4MH0R 1JUDA 4CQMA 2B1JA 2CD9A 2QM7A 2PU7A 1SUEA 1SUWA 5DTEA 3RRFA 2HU2A 2C1ZA 2A1UB 4LZNA 4OP1A 4OQLA 3LLCA 4A9AA 4J43A 4UBLA 3TBHA 2YVAA 1D09A 1BX1A 5DGHA 3DTTA 4O1HA 4EY5A 3GZTB 2CMHA 2Q2QA 4WY8A 1Z4QA 4RAOA 3GT3A 3FPBA 4UCWA 1KDYA 1H2AS 3BGWA 4MVJM 4B5KA 3UATA 4PQGA 2XBUA 5INTA 4QO7A 3GVCA 2EP5A 4JC0A 4B3JA 2E9SA 3QKWA 3AY3A 5FYDA 2LXNA 3KKPA 2X19A 4MUKA 1MOZA 1OI4A 4C4XA 1NM5A 4QYIA 2VO1A 1XPUA 1A2QA 3R8CA 4BO2A 1ISHA 1HYGA 1ZCFA 3BKXA 3L0PA 4BNGA 1XD9A 1QDLB 3CFYA 3QPCA 4MJ3A 5DX8A 3UHPA 1WZUA 5BWCA 5KEIA 3T5PA 2R6HA 4Q9LA 4K0KB 1UPXA 4DA9A 3QEMB 2QP9X 3OQ6A 1L5OA 3R3VA 4QDJA 3CX6A 4FDTA 1W36C 3O03A 5HCIA 1ISSA 4KR0A 1JBKA 3FYHA 4KWTA 3FLAA 4CQNA 4B84A 2AMVA 5J2TA 5F1YA 3C8ZA 2FP3A 3IPRA 4LJ7A 4CG2A 3W5SA 3R8FA 4NY1A 1FTWA 4FWTA 2QUZA 4HDKB 1RRKA 1QZZA 3TRFA 4CVNA 5KCZA 2H3EA 1XZBA 3I73A 4OB7A 5LQJA 2XXAB 4GICA 1M2EA 4A6PA 1E4EA 3GYGA 4M8KA 5BUZA 1TZ2A 3GIWA 4RELA 4HRXA 1ECFA 1K8ZB 2ALJA 2EF0A 1JIQA 3HVIA 3UCXA 5CB6A 1JS1X 2C5BA 2DHEA 5EHZA 2F55A 2XHZA 5FPKA 3CCBA 5CFPA 5HHTA 4RC9A 2AFRA 3EFHA 1NRJB 3UBTA 2B21A 3MCZA 4CF4A 2ARKA 3GD5A 1YE8A 3QE4A 1LNQA 4OHRA 1OW3B 2OPHA 2AKAB 5EG5A 1ZSYA 1KETA 1LRJA 2I3ZA 4F60A 2TMGA 4M49A 3WWOA 4V24A 1CYDA 3FCEA 4ZWNA 1JQBA 2FE4A 4GO1A 3QVOA 4TXLA 3O21A 3WLEA 4ATNA 4BO5A 5K99A 1VP9A 2P0AA 3F1LA 3KFLA 5FWYA 3EIUA 3KZ1E 3LPLA 4MR7A 2VHZA 1KARA 4QWWA 5A6VA 3OZDA 4MROA 1XRRA 3PDWA 2Q3DA 3V4OA 3DC7A 4V1CB 4JEUA 4Z86A 3I76A 4NCXA 3WRWA 2IS4A 2C83A 1JEJA 3ZHTA 3GEGA 1A0OA 1QCYA 2V7VA 1NVFA 3BE4A 3HWWA 3O8OB 4ARVA 1PQUA 1Y4UA 2B92A 1AJEA 4IXTA 3NHWA 3DBHB 3HWX1 4TV9F 3SGLA 5AW4A 2O06A 1CFZA 2J8ZA 1OFIA 4W1PA 3KJNA 3TD6A 3U1VA 1B16A 3FCSB 3QBVA 1DSSG 2PSJA 3FDFA 3Q2KA 4PRLA 1MCZA 4QUHA 1QJCA 1RTTA 4ZT6A 4QL3A 2LBPA 3ZGLA 1GNLA 1G7SA 2G1KA 3BKWA 2WWHA 3OT5A 2IRWA 3LA8A 3LUAA 4XOUA 1VCHA 1YZUA 2KE5A 1XTPA 3HKCA 2X0FA 2VYFA 3TWOA 4TLDA 3BFKA 1LTKA 4D3FA 2PANA 4NCNA 5BW5A 5K45A 2PL3A 4UNNA 5FHQA 3K32A 2ORED 5HX7A 4C4OA 3SE0A 1Z5VA 3AZPA 1XB2A 4LVUA 1Z2DA 3L06A 4UPVA 3KUCA 2G3YA 5LMUB 1RWNA 4L8WB 2DTDA 4KAFA 3UUFA 4GVXA 3ZDBA 3LT4A 3BJZA 2JNWA 4DCCA 5CDSA 3NWBA 1VBKA 2ZSFA 3RK0A 4ZHQB 1EINA 2LW7A 4BGEA 2YJNA 5C37A 2OILA 1U5BA 1XKQA 2WVJA 3NTRA 4MV0A 1P72A 4B5LA 2WHQA 4X6YA 4DNOA 3S40A 4P58A 1D7OA 4QUEA 3N8KA 2H1WA 2ZRGA 4F7WA 1ZIXA 3A3OA 4RKYA 2IZ6A 1X2EA 2QV7A 3A27A 4YRNA 2RGCA 3TFQA 5HGXA 3VPBA 4ANFA 4R83A 2KBEA 2ZBEA 5K5EA 1K75A 1UT5A 1U3DA 5CM8B 1EB8A 1MB9A 2WUWE 3AILA 1MW9X 3OQJA 2F1KA 4QUAA 4RPJA 4B6EA 1RVV1 3IHTA 3QIAA 3TO5A 4ESEA 4F6CA 3KKEA 4UHCA 3C16C 4YV0A 1Z36A 1B2RA 1G42A 3KWMA 3QX9A 5CIWA 4I1IA 4D0RA 2XJ4A 1RJGA 1UBKS 3Q87B 1EAYA 3EIQA 2G17A 1I0IA 5ALEA 4PLFA 2YIVX 5E9QA 3IQDB 4MVJI 3RRBA 1J2TA 2FOIA 5AK3A 1ZH6A 5LYJB 4GQBA 1P18A 2BEVB 3LQYA 5K3BA 3RTDA 3DF9A 3U7JA 3ZE9A 1NOIA 2RHBA 4GLJA 2A9KA 1MJGM 4ZVMA 3ZVKA 2X6RA 4R8SA 3K0FA 3X3HA 1E4OA 5CBPA 3NWOA 4PSCA 3G2JA 1RNLA 1BKSB 1SHLA 2F62A 1IY9A 3KFVA 3W4IA 1YQQA 2R65A 1I9GA 4D7AA 5HZMA 3X1DA 5GADl 2ODEA 4WOKA 5G1NA 3GLRA 2C4NA 2VP5A 3AU8A 4NR0A 3VR0A 5LQRA 4BWGA 1ICIA 3IRUA 4FX2A 3QVTA 4UEQA 3G2PA 3LIPA 2VDWB 2XAAA 3ABQB 5FTMA 4F9EA 4GKJB 2GHQA 3AJDA 3J80A 2RBGA 3ET5A 2C88A 3NEAA 1S6YA 3KKOA 1R0BA 1V1MB 4HFRA 4FFWA 4L8FA 2UZIR 3G8CA 3WK6A 4A5OA 2I2XB 3I4FA 3CNHA 5BORA 5KNLA 2Q9BA 1DKLA 3PRYA 3T99A 2VFAA 4K6MA 5CCXA 1LWNA 3R7LA 1DB3A 2GAFA 1IEXA 2I87A 3ZHXA 3E2IA 3C7KA 4HD8A 4FYPA 4NE2A 1SEPA 5CXSA 4C0WA 5C51B 1A04A 5JY6A 1OB2A 2PJUA 5J63A 3IJRA 5FORA 5A5GA 1KXJA 1M5TA 3VTZA 2L0XA 3F49S 3AVTA 4MQ5A 3F2VA 5HCUA 1GNTA 1TUBB 1YVUA 3KT6A 4OQQA 4TN1A 5JYEA 1C4KA 1NQVA 5TEWA 3Q7SA 3EF3A 3FMFA 4O4HB 4OQFA 1E2NA 1TA4A 2FMXA 3IBCA 4R31A 3WLIA 4RKEA 4AG3A 1IAVA 2XRYA 2XMPA 3N2NA 3UJ3X 2W6CX 3OCJA 3AHCA 5HIAA 1FMFA 3JYLA 4DIKA 1CRLA 2QRKA 4MLPA 3FHJA 1M1YA 3LOPA 2XDQA 5D3QA 4BOYA 4QOJA 3OBBA 2CVZA 1ZL0A 4DPLA 1M6VA 1DI0A 2QU8A 1CK4A 2QN6A 3OZEA 4F5ZA 2FR1A 3E15A 2Q7OE 3WRXC 1R18A 2OV8A 2QTTA 3LFUA 4DDKA 1LDGA 1CJSA 1I6LA 4NSNA 1RRGA 3KG2A 3F73A 5HKLA 3CN7A 4XQEA 5K0BA 2SNIE 1AQUA 1ORWA 3PC6A 1MC4A 2C9BA 1GG8A 2FPKA 2VDNB 3JWHA 4PANA 5DYGA 4AJIA 2XWBF 3L18A 5AVVA 4OGKA 5EZYF 2QD5A 2KWIA 1T25A 1FTYA 1UDWA 1I33A 3COSA 1U02A 1FTSA 3E7FA 3H0CA 3HEMA 3CO5A 4ECEA 5B4TA 2FJ0A 2GESA 3KR1A 2Z57A 4OFWA 4MJLA 5TARA 3IAM6 5CNMA 3U17A 4OO3A 3UAWA 5KC9A 2PMCA 1LI5A 2RAUA 4FM9A 2GRJA 1VIDA 4CMCA 2IYPA 4DCJA 3ONWA 3DE2X 5AO9A 3A37A 1YR8A 2HJHA 3EZGA 1KI9A 5LQSA 3T3EA 3ZCPA 3I1YA 3KZKA 1IZYA 1E3IA 3IVAA 4MW0A 2Z1NA 5JIBA 2D0OB 2RGWA 1M74A 1T2NA 4IJUA 5AI8A 1BWPA 3SZGA 1CQIB 1YA8A 3U37A 4ERXA 5FOQA 1SZPA 1CZRA 2YWJA 3MJHA 4KXLA 2GI4A 1KE2A 1OMOA 1IOLA 4AK9A 4WAUA 3NOQA 3EXHA 5YASA 5JAZA 1VE9A 1YZTA 2PKQO 2DBZA 3NKVA 2XEXA 4KK4A 1CUGA 2DPHA 4Y9DA 4GR4A 3RD5A 4UOEA 3AJ8A 2B25A 1E9CA 2F3UA 4U2CA 5IDQA 1OHHA 2GBCA 4HYEA 2GD1O 3DVAA 3UMRA 2AFHB 2VDMB 1JQKA 4KLNA 3W8EA 3F3YA 3CUVA 4WN9A 3V80A 1A5BB 4A36A 5FI3A 1RQ7A 1P19A 3QQ5A 4JKYA 5FLYA 5D01A 4D79A 4TWJA 5DHPA 2FB9A 4DNQA 2GO7A 2HUNA 1UOOA 2WNHA 2XNJA 1RRPA 4HH4A 5JXHA 1T36B 3AGQA 1ADCA 3SS9X 4ILKA 2IPLA 3LVFO 5L51A 2P6OA 4HTAA 5LP6F 2P6RA 4XQ9A 3DOOA 1Z6XA 5LBTA 1AT1A 1N9GB 1BU8A 1O97D 3PNYA 4LKRA 3WG9A 1VIAA 3H9QA 1VP3A 2QRHA 3IA7A 4II7A 5EEGA 3RS0A 3KSBC 3L5KA 4LXUA 4Z49A 2QXTA 5DM1A 4Z2AA 3ZLTA 3W2IA 2CVPA 3BMXA 1T9HA 2RCNA 3AR6A 1ZL2A 3E7WA 1HYEA 4GLOA 4ZQIA 4XB1A 4OHZA 3RBAA 3ZQUA 4EH1A 5HUQA 5LQMA 2P4EA 2GASA 2O0LA 2R7AA 4HRYA 2EJWA 3ILYA 4OP2A 5FQNA 3O75A 5KSYA 1Y6RA 2YFHA 4B79A 3CPHA 5TJ9A 4PGMA 2Q99A 3O4VA 2NADA 4W4TA 1UQRA 1A71A 3VGJA 2FRXA 4KPUA 5KYYA 3IR5A 1LPSA 4INPA 5KHAA 1CUHA 1NW8A 4EUNA 2NYRA 1E18A 2ZWPA 1F20A 4C0AC 4ZI3A 3UGTA 4Q7QA 5EWMB 2W98A 3KZNA 2Y67A 4OBWA 5JDCC 2BR5A 4LCBA 4ND4A 1J9ZA 4U7FA 2QAJA 4WESA 1TK3A 2CV1A 5FLKA 3FDIA 3U40A 4ZYLA 2ODQA 1YACA 1WHTA 1KOFA 1OAAA 5CW1A 1M0EA 4XASA 5HZHA 3CHYA 4MQEB 3V6LA 2AZ4A 5IKOA 1KOJA 1YFZA 3K5PA 4W7SA 3MJSA 2HV9A 3E58A 1B0PA 1AV6A 5BYAA 1YU6A 2Q2OA 4MJ7A 4TVSA 4WADA 4R1SA 3WK8A 1NW7A 5BY2A 1U0TA 3VKFA 3ANMA 1NF9A 1B0AA 2J32A 2BFEB 1GKIA 3C7AA 5D86A 4YRAA 4B3XA 1X9IA 5GM1A 4MICA 3EDYA 2PGNA 1VL1A 1WKVA 1XLTC 4RADA 3IDAA 2X5NA 4O4LB 3LQRA 2IP1A 2C96A 3ADPA 4JBHA 4MP6A 3H11A 3B85A 2GCIA 1A9XA 2AJLI 1Q1GA 1H0RA 2Y9MB 3L7CA 1H3NA 1GAJA 4K9NA 5A2GA 2WPNA 4DBVO 5A02A 2O7QA 1BG6A 1WDMA 3AFOA 5IJXA 5EWJA 1ZVKA 3WNCA 1C7EA 2CW5A 4EFNA 2E1RA 4G1UC 4GE3A 1MB3A 3EOBI 4IZHA 2BBOA 2I7CA 4RE5A 5J2UF 2MT9A 1BX0A 5JV5A 3U60B 4FYYA 3F6PA 1UXIA 1I5RA 5D3MB 5LB2A 1KVQA 1ZP6A 1OBOA 1F7VA 1H0SA 1E1KA 3ZWYA 4ARSA 1S2IA 2EXXA 3P2EA 3HJBA 4M9CA 2AN5A 2INGX 4DWWA 1PSDA 3RS7A 1E0KA 1B23P 1Z34A 4JITA 3AL0C 1O6FA 1H6CA 2V3WA 2JFNA 2D8MA 3R7AA 1KSJA 4A92A 1QVVA 3NTOA 1JB9A 5HW0A 3CKKA 2W2LA 3EY9A 1G9XA 1B0ZA 2WD9A 2ZU0C 5DIZA 2X42A 4IJ5A 4MUEA 1P9RA 4EZEA 1EJ6A 4XM1A 3O8QA 3UXHA 4B87A 1AY0A 4WKGA 3L7DA 3OT4A 3ZK7A 2PJZA 3T0IA 2A8YA 4RSHA 1M6EX 3EGEA 4F91B 3BULA 3CLUC 2PWZA 3AL2A 4MI3A 1FEZA 2COKA 4PO8A 5FI5A 5AM2A 2YOGA 1LJUA 1K5GA 2PLWA 4HH3C 3KWLA 1RHQA 1UWLA 5DGXA 4UU7A 5I7UA 5SY9A 2CMKA 2D1YA 3TL3A 4TTVA 4WBXC 1TU3A 1CQXA 1FZQA 2VPXA 1CE8B 3DT8A 2AZDA 3DXFA 3GRZA 3IVGA 2FPIB 3I3SR 3W3AA 1SCIA 3P0HA 4Y98A 1RKQA 1TJPB 1J99A 2NYVA 1O3YA 1Y7LA 3CZ9A 5HK9A 5JSQA 4PO3X 5KYUB 1DRKA 2DCUA 1OKKA 1NTRA 4NLLA 2M1XA 2IDMA 3UHFA 1M2WA 4DUGD 3FTFA 1YDMA 5FTLA 4RCZA 1XKTA 1L5QA 2J07A 4TRMA 3ZDFA 5K8CA 4ZOBA 4MP8A 4OKIA 1VYUA 1UDCA 1GU7A 3D8NA 3PEVA 2XCSB 1SRRA 1BGXT 3OM1A 1ADFA 1LV8A 1R5BA 1UF9A 3F7NA 4KSCA 1GTMA 3V32A 4BV8A 2AFIB 2C7BA 1V7ZA 1UK7A 4WCFB 5JAHA 3MWYW 1WBJB 1J8FA 1GGNA 3DTVA 3SPXA 3KD3A 4BPBA 2NXNA 4JJKA 1TAUA 1UXJA 4OA5A 2CNLA 5FAXA 3IMGA 4DR4B 2HT6A 1V6AA 2FW0A 5CDHA 1XJQA 3K6SA 4NCHA 3U4IA 3FF1A 5DF1A 5DEOA 4CMHA 5JJCA 1IJBA 3QKSB 2ZITA 3TDMA 4GRIA 2CVHA 3BMNB 3L2OB 3MLEA 2AXPA 4HFNA 2QMOA 4NV1A 4YHBA 3ZY2A 4CCWA 2WUVA 4ZCQA 2PAFA 4G4IA 4N48A 2O8DA 1IXYA 1U3UA 3OG9A 1QPZA 4YJHA 2ODPA 4WMLA 4Z8YA 1KPGA 4QASA 1GKUB 2VIIA 2QZSA 2DMRA 4PC2A 2QI9C 3A9SA 3HN6A 4D6PA 2VTDA 2H4FA 1JAZA 4WBSA 3Q8MA 1IVSA 2JAUA 5ALSA 2A9JA 3UFXB 1GPBA 3C4VA 2B2CA 2PZ8A 4CLXA 2JHGA 3O4IA 4EBFA 2RAPA 4YQYA 3C87A 3N6RA 4E5MA 4A8JC 1T6ZA 1JXMA 1XEWY 3U1TA 1IQUA 2BHNA 3F8WA 1YHZA 3C3CA 4M6WB 4TQ9A 1MBZA 5TPZD 1Z0IA 4IUDS 1KI4A 4KCGA 1RJEA 3QI7A 1E4YA 4Z8XA 3TZQA 4KO8A 5JQGF 1C9YA 3DMTA 1KR5A 4RYDA 3T15A 2ZFUA 3RF6A 2CJWB 2WOOA 2NIPA 4P35A 1PT6A 5EJMA 3W04A 3GELA 4ZT3A 5JQWA 5LZ4A 3O8CA 1ATIA 3H3XA 4TRRA 4BQFA 4IGEA 5H16A 4A2WA 1G5IA 3F6BX 3FCCA 5ADVA 1XK7A 2ICAA 1XZAA 1N2XA 5FLXA 1L8OA 4PG8A 3P97A 5FOVA 2RK6A 4YRSA 1ZMRA 4MVJF 1KFEB 4QFDA 4EBBA 3PDIA 4WJKB 4FSDA 1AB6A 3GJXC 2XYQA 5F73A 1UOEA 1XZEA 5DSXA 4RA9B 1GUAA 1Y81A 3OJFA 2R00C 3MWDA 4RS3A 3VOBA 2B6HA 3CURA 3HBFA 1I51A 2NUTA 3ZWAA 4HJRA 3CZQA 5C7OO 5B1YA 3CVJA 3GJ5A 2ZBDA 4RVDA 3SU8A 3DMRA 1M8FA 1J8MF 3JQCA 4NBVA 2L18A 1WE2A 2JGDB 4UCXA 5DM0A 4FINA 5GJVC 3WO1A 4KREA 2IYRA 4CM6A 1OHHD 2EQAA 1HR0B 1PJ8A 3JQRA 3ZE6A 4C6TB 1GG5A 3JQGB 4K86A 1AG9A 3ZHVA 3G9ZA 4FZVA 5CEJA 1S2DA 1UXOA 2CGEA 2NTNA 4EVIA 4P81A 4Y18A 2DHQA 4G26A 4NCAA 3R7BA 4HB3A 3U4GA 1EE9A 1PV1A 5SV2A 3AVPA 4YS6A 1LDYA 4N40A 4BO8A 1UKBA 4ZJPA 4PVCA 5HNKA 1L8QA 2Q8QA 1AS2A 3AKYA 3EZ2A 1UBRS 4RFSB 4NXMB 2WG1A 1ECCA 4M3NA 4CYMA 2FF5A 2V4ZA 3HBAA 5KYVA 3SJCA 1RM4A 2LRHA 3WYNA 3I37X 1XDSA 3E2PA 3CKLA 4RNCA 2ZJ0A 1YKGA 3OF5A 4PM4A 1H1LA 3BQ9A 3D64A 2JLBA 3TNLA 2Y1EA 4HRAA 1MFPA 2WOJA 2I8AA 2BGLA 4C20A 1A8UA 2W22A 1MEJA 4RK0A 4IP0A 4EVQA 3RLIA 3LWZA 3NZEA 5LWHA 3O1LA 4K28A 1HG0A 2OCLA 2CE2X 4JNKA 2P3SA 3I30X 1JFVA 3MVEA 2C54A 3BORA 3HYRA 5KKCA 4E2YA 1R5OA 2XQIA 1UJBA 4M0UA 1TUEA 3C3WA 4D3YA 3I2IA 3PNBA 5TB5A 4YREA 4A16A 4D8TA 2P1RA 1NBMA 1SU6A 2VCEA 2A33A 1KVSA 2B82A 4KGZA 5EXTA 1JDUA 1UJ2A 2Y1LA 4J0EA 1ILEA 3SHQA 4IIHA 5JDIC 2WTBA 4CU5A 4LDZA 1TM7E 1U1IA 2C2ZA 4HZUA 5BW4A 3SYKA 4MGEA 3RJ5A 6CHYA 1NBOA 3PXXA 2V65A 4XB6B 1K66A 3MXTA 1VTKA 1WG8A 4L16A 2YVLA 3LDHA 4YUAA 1XNRB 2R6JA 1SEVA 2IUFA 3HB5X 1Y82A 3HV2A 5EPEA 4FMPA 1OIVA 1G60A 4HH1A 3QUSA 4ZYUA 3TS1A 4QBHA 3G6WA 1P0CA 2CLIB 2GCOB 2YMMA 3FRJA 3ILXA 4JQZA 5AM4A 3TB4A 4WOCA 5JTTA 5C52B 1T43A 4C1BA 4YMSA 3VR1A 5ALIA 4XX0A 2RJNA 1OBVA 1CVLA 4DV7B 4HL6A 4Q4JA 4XI9A 2AZTA 4QBIA 4CL2A 4DV2B 3D2LA 1Y9EA 1B8NA 4IY1A 1GYRA 1HFJA 3E8XA 1YDFA 4LYGA 5LA6F 1F38A 2GN6A 2WA1A 2FPPA 3BDAA 2BUCA 2P90A 4GLFA 1RYZA 1V1RA 1XC7A 4I1UA 3WJ1A 1S01A 4LY6A 2N1MA 2PZBA 3C85A 3RHZA 1CZLA 4HKTA 2EP8A 4AFNA 3W5UA 2PR7A 1B8UA 4MWDA 3OZIA 2FK8A 4FS8A 2BJHA 4FEGA 1RQNA 4ODIA 3H7AA 3T5DA 1YASA 3SYRA 1YVEI 1GUBA 1A5AB 1M8GA 2A5YB 4HZGA 3T34A 1TEHA 3KQOA 4PYQA 4NMXB 3LRTA 1K8YB 5TNXA 3FLEA 2DTEA 1L4BA 1EVQA 2PCJA 1Z15A 4HMQA 1DKNA 2WMDA 2PUHA 4Q4AA 1P9NA 2EL7A 3ETDA 2BFAA 1W25A 4B6PA 2AE2A 2IPOA 4DOMA 3OETA 4PAMA 1CEQA 1OA1A 4O2BF 1POXA 4WERA 3VR5A 2QGNA 4HEQA 1U3GA 1NSYA 5FBKA 4AZ3A 4CCYA 1PBTA 4V3BA 1OYVA 4EEZA 1TTTA 3PNVA 1A50B 3HSYA 4WZAE 1E1CA 2P68A 3NBZC 4GI3A 4ECAA 4YXWA 4F5WA 1QMGA 5A7FA 5KWSA 1Y1TA 2FN7A 2QPTA 2XIJA 5G4LA 4Y1EA 4CLDA 1CUYA 1OZHA 1WA5A 4KQ2A 3B6KA 1QHEA 2HIHA 3HGTA 4HWRA 5HBRA 4QVGA 2ZYWX 2YV3A 2XRZA 3ET4A 1V3UA 2XWJI 2ZT5A 3PQDA 3S6JA 3QXHA 4IMPA 1OSNA 3OLCX 2H2HA 3H13A 4KE7A 3CH4B 4EJ0A 3GY0A 4U5XA 4OLAA 3C6XA 3D3NA 1X39A 5EHQA 1U0RA 3VOTA 3UJ9A 1DUIA 2YNMA 3OC0A 2B8TA 2P6NA 1OXMA 3VO9A 1I94B 2UUAB 1TQHA 3UT5A 2Y68A 3WLKX 2PMEA 3I4LA