4FU4A

Human collagenase 3 (mmp-13) with peptide from pro-domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
b'YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHAFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4fu4A02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4fu4A01
3Q2GA 1S4BP 1CGFA 5LABA 1BIWA 1FM1A 2YB9A 1QJJA 3LKAA 966CA 1MMPA 3RTTA 4H30A 4H3XA 1MMQA 3K7LA 3LUNA 3LEAA 3TVCA 2KRJA 5JMYA 4IN9A 3LP9A 1SU3A 2SRTA 4I35A 1MMBA 5CZMA 1D7XA 3LJZA 1JH1A 3ZUKA 2POJA 2DW1A 1ND1A 1UMTA 830CA 4JPAA 1K7GA 2X3BA 1IACA 1R1HA 1ITVA 2MLSA 2OY4A 4GWMA 3WV2A 1PEXA 2JT6A 3UVCA 4PKWA 1KUFA 2OXZA 1C7KA 2D1NA 4ZR5A 2D1OA 2ERQA 4AIGA 4JA1A 2MZHA 4L63A 4PKTA 3F17A 1GKCA 1GE6A 1CK7A 2Y6DA 3HDBA 3GBOA 5BOTA 2OW2A 4HSDA 4EFSA 4ON1A 2WO8A 5D3CA 2XS3A 5D2BA 2CKIA 1EUBA 1AYKA 4RT6B 2YIGA 3ZVSA 1XFXA 3L0VA 1YCMA 2W13A 2HU6A 3NX7A 1AF0A 3V96B 1ZTQA 3KECA 2RJQA 1Y0VA 3AIGA 4PKVA 1ZXVA 1XURA 4L19A 3P24A 3LILA 1IADA 1QHUA 3EDGA 3VTGA 1D8MA 2OVZA 2OXUA 3KWVC 1HFCA 1PWWA 1YOUA 3BA0A 1B3DA 1SRPA 3LIKA 2MLRA 3KMCA 1ASTA 3F16A 3F19A 1QIBA 1EAKA 1Q3AA 1JKYA 5CXAA 1BUVM 3LIRA 5CUHA 3S18A 1XFZA 3KHIA 2JIHA 1JK3A 3I7IA 3P1VA 1OM8A 1C8TA 1IABA 1KUKA 4GWNA 4FXYP 3MA2A 1Y93A 1BUDA 4QKZA 3LGPA 1O0TA 4XM8A 1WNIA 3G5CA 1R55A 1SMPA 3N2UA 1D8FA 3TS4A 1GO8P 3KEJA 1JIZA 2OZRA 1L6JA 5B5PA 2X3CA 4WK7A 4J4MA 1A86A 3LQ0A 1OMJA 1JAOA 1Z3JA 1UTZA 1HOVA 2TCLA 1HFSA 3DNGA 2FV9A 2O36A 1I76A 1G05A 4JIJA 1ZP5A 4DV8A 5I4OA 3LE9A 4WKIA 4H1QA 1BM6A 4AUOA 4H84A 3EDHA 4H82A 3OHLA 3Q2HA 2OY2A 3LMCA 4XBHA 1HY7A 2AYKA 1IAEA 1IAAA 3ZXHA 3LJGA 1BKCI 1HXNA 2CLTA 3K7NA 2OI0A 4Q1LA 4A7BA 2PJTA 3B92A 5BPAA 1XUCA 1J7NA 1ZVXA 3G42A 1K7IA 1MMRA 1FBLA 3V6NA 1JIWP 4PKSA 2L0RA 3KRYA 2Y6CA 1USNA 1UEAA 5L7FA 4FU4A 3L0TA 1R1IA 2N8RA 1ROSA 4XM6A 2K9CA 2W12A 2OW1A 1PWVA 1BKCE 5L79A 2X3AA 5BOYA 1R54A 1FLSA 1QJSA 1JJ9A 3HBUP 4WKEA 4CTHA 1XFYA 4OEIA 3USNA 1QICA 1JAQA 2FV5A 4H2EA 1G9KA 1HV5A 4H49A 2WOAA 2O3EA 1PWPA 3E8RA 3DWBA 4H76A 3HY7A 1QJIA 4G0DA 1G4KA 4R3VA 1IAGA 5I3MA 2RJPA 2W14A 1XFUA 4PKUA 3DL1A 1G49A 1YQYA 1D5JA 4GR8A 2X7MA 4AYKA 1YP1A 1OS2A 3F15A 1QUAA 2WO9A 4GR0A 4DF9A 1H71P 1GENA 3VI1A 1CGLA 3OHOA 1DTHA 1I1IP 4HMAA 1CAQA 1O0QA 2Z2DA 2A8HA 2EROA 4YEHA 2DW0A 1AKLA 3B8ZA 2OVXA 1R1JA 1Y8JA 4LL2A 4DD8A 2JSDA 3N2VA 3KEKA 4WF6A 3F1AA 2J83A 2MZEA 4FXQA 1PWQA 1GE5A 1A85A 1B8YA 1ATLA 5I43A 1CGEA 1BQOA 1UTTA 3C7XA 1OM6A 1SATA 2DDYA 4AXQA 1BQQM 2DW2A 3O64A 2JXYA 1JANA 1MNCA 1XUDA 2E2DA 3TT4A 3LQBA 3DPFA 1GO7P 5H8XA 3DPEA 2I47A 1KUGA 4XM7A 3WV1A 1QIAA 3HDAP 1OM7A 1JAPA 4XCTA 1GXDA 1PWUA 2K2GA 2J0TA 4A3WA 2OW0A 3DSLA 456CA 3EDZA 1RTGA 1CQRA 1ZXCA 5I0LA 1GKDA 1EB6A 1G12A 2W15A 5D1UA 3CKIA 5D1SA 1BZSA 3OYOA 2OXWA 1BKCA 3TSKA 1KBCA 2JT5A 2ERPA 4JQGA 4WZVA 1OS9A 3LK8A 1OO9A 1RMZA 1UMSA 4GUYA 4PKRA 4GQLA 3EDIA 4L6TA 5D1TA 1XFVA 3EHYA 2OW9A 1CIZA 2E3XA 3O2XA 3AYUA 4I03A 1K7QA 3F18A 4G9LA 2V4BA 4IUWA 3HBVP 2MQSA 1C3IA 3ELMA 2USNA 3LJTA 4GR3A 1BSWA 5I2ZA 4HX3A 1HTDA 3SHIA 3U1RA 3RTSA 1DMTA 4IJOA 5B5OA 2JNPA 2AIGP 5I12A 5D7WA 2W0DA 3HB2P 1RM8A 3HYGA 1CXVA 2XS4A 3AYKA 3LUMA 3WV3A 4JP4A 3EHXA 1SLNA 2DDFA 3HY9A 1I73A 1ZS0A 1KUHA 3B2ZA 1KUIA 2MZIA 2QPJA 1SLMA 4FVLA 4GF1A 1KAPP 4ILWD 4DPEA 3EWJA 1XFWA 1GE7A 3KMEA 3I7GA 4PKQA
chains in the Genus database with same CATH superfamily
3Q2GA 1S4BP 1CGFA 5LABA 1BIWA 1FM1A 2YB9A 1QJJA 3LKAA 966CA 1MMPA 3RTTA 4H30A 4H3XA 1MMQA 3K7LA 3LUNA 3LEAA 3TVCA 2KRJA 5JMYA 4IN9A 3LP9A 1SU3A 2SRTA 1XAXA 4I35A 1MMBA 5CZMA 1D7XA 3LJZA 1JH1A 3ZUKA 2POJA 2DW1A 2YUFA 1ND1A 1UMTA 830CA 4JPAA 1K7GA 2X3BA 1IACA 1R1HA 1ITVA 2MLSA 2OY4A 4GWMA 3WV2A 1PEXA 2JT6A 3UVCA 4PKWA 1KUFA 2OXZA 1C7KA 2D1NA 4ZR5A 2D1OA 2ERQA 4AIGA 4JA1A 2MZHA 4L63A 4PKTA 3F17A 1GKCA 1GE6A 1CK7A 2Y6DA 3HDBA 3GBOA 5BOTA 2OW2A 4HSDA 4EFSA 4ON1A 2WO8A 5D3CA 2XS3A 5D2BA 2CKIA 1EUBA 1AYKA 4RT6B 2YIGA 3ZVSA 1XFXA 3L0VA 1YCMA 2W13A 2HU6A 3NX7A 1AF0A 3V96B 1ZTQA 3KECA 2RJQA 1Y0VA 3AIGA 4PKVA 1ZXVA 1XURA 4L19A 3P24A 3LILA 1IADA 1QHUA 3EDGA 3VTGA 1D8MA 2OVZA 2OXUA 3KWVC 1HFCA 1PWWA 1YOUA 3BA0A 1B3DA 1SRPA 3LIKA 2MLRA 3KMCA 1ASTA 3F16A 3F19A 1QIBA 1EAKA 1Q3AA 1JKYA 5CXAA 1BUVM 3LIRA 5CUHA 3S18A 1XFZA 3KHIA 2JIHA 1JK3A 3I7IA 3P1VA 1OM8A 1C8TA 1IABA 1KUKA 4GWNA 4FXYP 3MA2A 1Y93A 1BUDA 4QKZA 3LGPA 1O0TA 4XM8A 1WNIA 3G5CA 1R55A 1SMPA 3N2UA 1D8FA 3TS4A 1GO8P 3KEJA 1JIZA 2OZRA 1L6JA 5B5PA 2X3CA 4WK7A 4J4MA 1A86A 3LQ0A 1OMJA 1JAOA 3DTKA 1Z3JA 1UTZA 1HOVA 2TCLA 1HFSA 3DNGA 2FV9A 2O36A 1I76A 1G05A 4JIJA 1ZP5A 4DV8A 5I4OA 3LE9A 4WKIA 4H1QA 1BM6A 4AUOA 4H84A 3EDHA 4H82A 3OHLA 3Q2HA 2OY2A 3LMCA 4XBHA 1HY7A 2AYKA 1IAEA 1IAAA 3ZXHA 3LJGA 1BKCI 1HXNA 2CLTA 3K7NA 2OI0A 4Q1LA 4A7BA 2PJTA 3B92A 5BPAA 1XUCA 1J7NA 1ZVXA 3G42A 1K7IA 1MMRA 1FBLA 3V6NA 1JIWP 4PKSA 2L0RA 3KRYA 2Y6CA 1USNA 1UEAA 5L7FA 4FU4A 3L0TA 1R1IA 2N8RA 1ROSA 4XM6A 2K9CA 2W12A 2OW1A 1PWVA 1BKCE 5L79A 2X3AA 5BOYA 1R54A 1FLSA 1QJSA 1JJ9A 3HBUP 4WKEA 4CTHA 1XFYA 4OEIA 3USNA 1QICA 1JAQA 2FV5A 4H2EA 1G9KA 1HV5A 4H49A 2WOAA 2O3EA 1PWPA 3E8RA 3DWBA 4H76A 3HY7A 1QJIA 4G0DA 1G4KA 4R3VA 1TVIA 1IAGA 5I3MA 2RJPA 2W14A 1XFUA 4PKUA 3DL1A 1G49A 1YQYA 1D5JA 4GR8A 2X7MA 4AYKA 1YP1A 1OS2A 3F15A 1QUAA 2WO9A 4GR0A 4DF9A 1H71P 1GENA 3VI1A 1CGLA 3OHOA 1DTHA 1I1IP 4HMAA 1CAQA 1O0QA 2Z2DA 2A8HA 2EROA 4YEHA 2DW0A 1AKLA 3B8ZA 2OVXA 1R1JA 1Y8JA 4LL2A 4DD8A 2JSDA 3N2VA 3KEKA 4WF6A 3F1AA 1OZ9A 2J83A 2MZEA 4FXQA 1PWQA 1GE5A 1A85A 1B8YA 1ATLA 5I43A 1CGEA 1BQOA 1UTTA 3C7XA 1OM6A 1SATA 2DDYA 4AXQA 1BQQM 2DW2A 3O64A 2JXYA 1JANA 1MNCA 1XUDA 2E2DA 3TT4A 3LQBA 3DPFA 1GO7P 5H8XA 3DPEA 2I47A 1KUGA 4XM7A 3WV1A 1QIAA 3HDAP 1OM7A 1JAPA 4XCTA 1GXDA 1PWUA 2K2GA 2J0TA 4A3WA 2OW0A 3DSLA 456CA 3EDZA 1RTGA 1CQRA 1ZXCA 5I0LA 1GKDA 1EB6A 1G12A 2W15A 5D1UA 3CKIA 5D1SA 1BZSA 3OYOA 2OXWA 1BKCA 3TSKA 1KBCA 2JT5A 2ERPA 4JQGA 4WZVA 1OS9A 3LK8A 1OO9A 1XM5A 4L7AA 1RMZA 1UMSA 4GUYA 4PKRA 4GQLA 3EDIA 4L6TA 5D1TA 1XFVA 3EHYA 2OW9A 1CIZA 2E3XA 3O2XA 3AYUA 3DTIA 1K7QA 3F18A 4I03A 4G9LA 2V4BA 4IUWA 3HBVP 2MQSA 1C3IA 3ELMA 2USNA 3LJTA 3DTEA 4GR3A 1BSWA 5I2ZA 4HX3A 1HTDA 3SHIA 3U1RA 3RTSA 1DMTA 4IJOA 5B5OA 2JNPA 2AIGP 5I12A 5D7WA 2W0DA 3HB2P 1RM8A 1CXVA 2XS4A 3HYGA 3AYKA 3LUMA 3WV3A 4JP4A 3EHXA 1SLNA 2DDFA 3HY9A 1I73A 1ZS0A 1KUHA 3B2ZA 1KUIA 2MZIA 2QPJA 1SLMA 4FVLA 4GF1A 1KAPP 4ILWD 4DPEA 3EWJA 1XFWA 1GE7A 3KMEA 3I7GA 4PKQA
chains in the Genus database with same CATH topology
3Q2GA 1S4BP 1CGFA 5LABA 1BIWA 1FM1A 2YB9A 1QJJA 3LKAA 966CA 1MMPA 3RTTA 4H30A 4H3XA 1MMQA 3K7LA 3LUNA 3LEAA 3TVCA 2KRJA 5JMYA 4IN9A 3LP9A 1SU3A 2SRTA 4I35A 1MMBA 5CZMA 1D7XA 3LJZA 1JH1A 3ZUKA 2POJA 2DW1A 2YUFA 1ND1A 1UMTA 830CA 4JPAA 1K7GA 2X3BA 1IACA 1R1HA 1ITVA 2MLSA 2OY4A 4GWMA 3WV2A 1PEXA 2JT6A 3UVCA 4PKWA 1KUFA 2OXZA 1C7KA 2D1NA 4ZR5A 2D1OA 2ERQA 4AIGA 4JA1A 2MZHA 4L63A 4PKTA 3F17A 1GKCA 1GE6A 1CK7A 2Y6DA 3HDBA 3GBOA 5BOTA 2OW2A 4HSDA 4EFSA 4ON1A 2WO8A 5D3CA 2XS3A 5D2BA 2CKIA 1EUBA 1AYKA 4RT6B 2YIGA 3ZVSA 1XFXA 3L0VA 1YCMA 2W13A 2HU6A 3NX7A 1AF0A 3V96B 1ZTQA 3KECA 2RJQA 1Y0VA 3AIGA 4PKVA 1ZXVA 1XURA 4L19A 3P24A 3LILA 1IADA 1QHUA 3EDGA 3VTGA 1D8MA 2OVZA 2OXUA 3KWVC 1HFCA 1PWWA 1YOUA 3BA0A 1B3DA 1SRPA 3LIKA 2MLRA 3KMCA 1ASTA 3F16A 3F19A 1QIBA 1EAKA 1Q3AA 1JKYA 5CXAA 1BUVM 3LIRA 5CUHA 3S18A 1XFZA 3KHIA 2JIHA 1JK3A 3I7IA 3P1VA 1OM8A 1C8TA 1IABA 1KUKA 4GWNA 4FXYP 3MA2A 1Y93A 1BUDA 4QKZA 3LGPA 1O0TA 4XM8A 1WNIA 3G5CA 1R55A 1SMPA 3N2UA 1D8FA 3TS4A 1GO8P 3KEJA 1JIZA 2OZRA 1L6JA 5B5PA 2X3CA 4WK7A 4J4MA 1A86A 3LQ0A 1OMJA 1JAOA 3DTKA 1Z3JA 1UTZA 1HOVA 2TCLA 1HFSA 3DNGA 2FV9A 2O36A 1I76A 1G05A 4JIJA 1ZP5A 4DV8A 5I4OA 3LE9A 4WKIA 4H1QA 1BM6A 4AUOA 4H84A 3EDHA 4H82A 3OHLA 3Q2HA 2OY2A 3LMCA 4XBHA 1HY7A 2AYKA 1IAEA 1IAAA 3ZXHA 3LJGA 1BKCI 1HXNA 2CLTA 3K7NA 2OI0A 4Q1LA 4A7BA 2PJTA 3B92A 5BPAA 1XUCA 1J7NA 1ZVXA 3G42A 1K7IA 1MMRA 1FBLA 3V6NA 1JIWP 4PKSA 2L0RA 3KRYA 2Y6CA 1USNA 1UEAA 5L7FA 4FU4A 3L0TA 1R1IA 2N8RA 1ROSA 4XM6A 2K9CA 2W12A 2OW1A 1PWVA 1BKCE 5L79A 2X3AA 5BOYA 1R54A 1FLSA 1QJSA 1JJ9A 3HBUP 4WKEA 4CTHA 1XFYA 4OEIA 3USNA 1QICA 1JAQA 2FV5A 4H2EA 1G9KA 1HV5A 4H49A 2WOAA 2O3EA 1PWPA 3E8RA 3DWBA 4H76A 3HY7A 1QJIA 4G0DA 1G4KA 4R3VA 1IAGA 5I3MA 2RJPA 2W14A 1XFUA 4PKUA 3DL1A 1G49A 1YQYA 1D5JA 4GR8A 2X7MA 4AYKA 1YP1A 1OS2A 3F15A 1QUAA 2WO9A 4GR0A 4DF9A 1H71P 1GENA 3VI1A 1CGLA 3OHOA 1DTHA 1I1IP 4HMAA 1CAQA 1O0QA 2Z2DA 2A8HA 2EROA 4YEHA 2DW0A 1AKLA 3B8ZA 2OVXA 1R1JA 1Y8JA 4LL2A 4DD8A 2JSDA 3N2VA 3KEKA 4WF6A 3F1AA 2J83A 2MZEA 4FXQA 1PWQA 1GE5A 1A85A 1B8YA 1ATLA 5I43A 1CGEA 1BQOA 1UTTA 3C7XA 1OM6A 1SATA 2DDYA 4AXQA 1BQQM 2DW2A 3O64A 2JXYA 1JANA 1MNCA 1XUDA 2E2DA 3TT4A 3LQBA 3DPFA 1GO7P 5H8XA 3DPEA 2I47A 1KUGA 4XM7A 3WV1A 1QIAA 3HDAP 1OM7A 1JAPA 4XCTA 1GXDA 1PWUA 2K2GA 2J0TA 4A3WA 2OW0A 3DSLA 456CA 3EDZA 1RTGA 1CQRA 1ZXCA 5I0LA 1GKDA 1EB6A 1G12A 2W15A 5D1UA 3CKIA 5D1SA 1BZSA 3OYOA 2OXWA 1BKCA 3TSKA 1KBCA 2JT5A 2ERPA 4JQGA 4WZVA 1OS9A 3LK8A 1OO9A 4L7AA 1RMZA 1UMSA 4GUYA 4PKRA 4GQLA 3EDIA 4L6TA 5D1TA 1XFVA 3EHYA 2OW9A 1CIZA 2E3XA 3O2XA 3AYUA 3DTIA 1K7QA 3F18A 4I03A 4G9LA 2V4BA 4IUWA 3HBVP 2MQSA 1C3IA 3ELMA 2USNA 3LJTA 3DTEA 4GR3A 1BSWA 5I2ZA 4HX3A 1HTDA 3SHIA 3U1RA 3RTSA 1DMTA 4IJOA 5B5OA 2JNPA 2AIGP 5I12A 5D7WA 2W0DA 3HB2P 1RM8A 3HYGA 1CXVA 2XS4A 3AYKA 3LUMA 3WV3A 4JP4A 3EHXA 1SLNA 2DDFA 3HY9A 1I73A 1ZS0A 1KUHA 3B2ZA 1KUIA 2MZIA 2QPJA 1SLMA 4FVLA 4GF1A 1KAPP 4ILWD 4DPEA 3EWJA 1XFWA 1GE7A 3KMEA 3I7GA 4PKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2G A;  1S4B P;  1CGF A;  5LAB A;  1BIW A;  1FM1 A;  2YB9 A;  1QJJ A;  3LKA A;  966C A;  1MMP A;  3RTT A;  4H30 A;  4H3X A;  1MMQ A;  3K7L A;  3LUN A;  3LEA A;  3TVC A;  2KRJ A;  5JMY A;  4IN9 A;  3LP9 A;  1SU3 A;  2SRT A;  4I35 A;  1MMB A;  5CZM A;  1D7X A;  3LJZ A;  1JH1 A;  3ZUK A;  2POJ A;  2DW1 A;  1ND1 A;  1UMT A;  830C A;  4JPA A;  1K7G A;  2X3B A;  1IAC A;  1R1H A;  1ITV A;  2MLS A;  2OY4 A;  4GWM A;  3WV2 A;  1PEX A;  2JT6 A;  3UVC A;  4PKW A;  1KUF A;  2OXZ A;  1C7K A;  2D1N A;  4ZR5 A;  2D1O A;  2ERQ A;  4AIG A;  4JA1 A;  2MZH A;  4L63 A;  4PKT A;  3F17 A;  1GKC A;  1GE6 A;  1CK7 A;  2Y6D A;  3HDB A;  3GBO A;  5BOT A;  2OW2 A;  4HSD A;  4EFS A;  4ON1 A;  2WO8 A;  5D3C A;  2XS3 A;  5D2B A;  2CKI A;  1EUB A;  1AYK A;  4RT6 B;  2YIG A;  3ZVS A;  1XFX A;  3L0V A;  1YCM A;  2W13 A;  2HU6 A;  3NX7 A;  1AF0 A;  3V96 B;  1ZTQ A;  3KEC A;  2RJQ A;  1Y0V A;  3AIG A;  4PKV A;  1ZXV A;  1XUR A;  4L19 A;  3P24 A;  3LIL A;  1IAD A;  1QHU A;  3EDG A;  3VTG A;  1D8M A;  2OVZ A;  2OXU A;  3KWV C;  1HFC A;  1PWW A;  1YOU A;  3BA0 A;  1B3D A;  1SRP A;  3LIK A;  2MLR A;  3KMC A;  1AST A;  3F16 A;  3F19 A;  1QIB A;  1EAK A;  1Q3A A;  1JKY A;  5CXA A;  1BUV M;  3LIR A;  5CUH A;  3S18 A;  1XFZ A;  3KHI A;  2JIH A;  1JK3 A;  3I7I A;  3P1V A;  1OM8 A;  1C8T A;  1IAB A;  1KUK A;  4GWN A;  4FXY P;  3MA2 A;  1Y93 A;  1BUD A;  4QKZ A;  3LGP A;  1O0T A;  4XM8 A;  1WNI A;  3G5C A;  1R55 A;  1SMP A;  3N2U A;  1D8F A;  3TS4 A;  1GO8 P;  3KEJ A;  1JIZ A;  2OZR A;  1L6J A;  5B5P A;  2X3C A;  4WK7 A;  4J4M A;  1A86 A;  3LQ0 A;  1OMJ A;  1JAO A;  1Z3J A;  1UTZ A;  1HOV A;  2TCL A;  1HFS A;  3DNG A;  2FV9 A;  2O36 A;  1I76 A;  1G05 A;  4JIJ A;  1ZP5 A;  4DV8 A;  5I4O A;  3LE9 A;  4WKI A;  4H1Q A;  1BM6 A;  4AUO A;  4H84 A;  3EDH A;  4H82 A;  3OHL A;  3Q2H A;  2OY2 A;  3LMC A;  4XBH A;  1HY7 A;  2AYK A;  1IAE A;  1IAA A;  3ZXH A;  3LJG A;  1BKC I;  1HXN A;  2CLT A;  3K7N A;  2OI0 A;  4Q1L A;  4A7B A;  2PJT A;  3B92 A;  5BPA A;  1XUC A;  1J7N A;  1ZVX A;  3G42 A;  1K7I A;  1MMR A;  1FBL A;  3V6N A;  1JIW P;  4PKS A;  2L0R A;  3KRY A;  2Y6C A;  1USN A;  1UEA A;  5L7F A;  4FU4 A;  3L0T A;  1R1I A;  2N8R A;  1ROS A;  4XM6 A;  2K9C A;  2W12 A;  2OW1 A;  1PWV A;  1BKC E;  5L79 A;  2X3A A;  5BOY A;  1R54 A;  1FLS A;  1QJS A;  1JJ9 A;  3HBU P;  4WKE A;  4CTH A;  1XFY A;  4OEI A;  3USN A;  1QIC A;  1JAQ A;  2FV5 A;  4H2E A;  1G9K A;  1HV5 A;  4H49 A;  2WOA A;  2O3E A;  1PWP A;  3E8R A;  3DWB A;  4H76 A;  3HY7 A;  1QJI A;  4G0D A;  1G4K A;  4R3V A;  1IAG A;  5I3M A;  2RJP A;  2W14 A;  1XFU A;  4PKU A;  3DL1 A;  1G49 A;  1YQY A;  1D5J A;  4GR8 A;  2X7M A;  4AYK A;  1YP1 A;  1OS2 A;  3F15 A;  1QUA A;  2WO9 A;  4GR0 A;  4DF9 A;  1H71 P;  1GEN A;  3VI1 A;  1CGL A;  3OHO A;  1DTH A;  1I1I P;  4HMA A;  1CAQ A;  1O0Q A;  2Z2D A;  2A8H A;  2ERO A;  4YEH A;  2DW0 A;  1AKL A;  3B8Z A;  2OVX A;  1R1J A;  1Y8J A;  4LL2 A;  4DD8 A;  2JSD A;  3N2V A;  3KEK A;  4WF6 A;  3F1A A;  2J83 A;  2MZE A;  4FXQ A;  1PWQ A;  1GE5 A;  1A85 A;  1B8Y A;  1ATL A;  5I43 A;  1CGE A;  1BQO A;  1UTT A;  3C7X A;  1OM6 A;  1SAT A;  2DDY A;  4AXQ A;  1BQQ M;  2DW2 A;  3O64 A;  2JXY A;  1JAN A;  1MNC A;  1XUD A;  2E2D A;  3TT4 A;  3LQB A;  3DPF A;  1GO7 P;  5H8X A;  3DPE A;  2I47 A;  1KUG A;  4XM7 A;  3WV1 A;  1QIA A;  3HDA P;  1OM7 A;  1JAP A;  4XCT A;  1GXD A;  1PWU A;  2K2G A;  2J0T A;  4A3W A;  2OW0 A;  3DSL A;  456C A;  3EDZ A;  1RTG A;  1CQR A;  1ZXC A;  5I0L A;  1GKD A;  1EB6 A;  1G12 A;  2W15 A;  5D1U A;  3CKI A;  5D1S A;  1BZS A;  3OYO A;  2OXW A;  1BKC A;  3TSK A;  1KBC A;  2JT5 A;  2ERP A;  4JQG A;  4WZV A;  1OS9 A;  3LK8 A;  1OO9 A;  1RMZ A;  1UMS A;  4GUY A;  4PKR A;  4GQL A;  3EDI A;  4L6T A;  5D1T A;  1XFV A;  3EHY A;  2OW9 A;  1CIZ A;  2E3X A;  3O2X A;  3AYU A;  4I03 A;  1K7Q A;  3F18 A;  4G9L A;  2V4B A;  4IUW A;  3HBV P;  2MQS A;  1C3I A;  3ELM A;  2USN A;  3LJT A;  4GR3 A;  1BSW A;  5I2Z A;  4HX3 A;  1HTD A;  3SHI A;  3U1R A;  3RTS A;  1DMT A;  4IJO A;  5B5O A;  2JNP A;  2AIG P;  5I12 A;  5D7W A;  2W0D A;  3HB2 P;  1RM8 A;  3HYG A;  1CXV A;  2XS4 A;  3AYK A;  3LUM A;  3WV3 A;  4JP4 A;  3EHX A;  1SLN A;  2DDF A;  3HY9 A;  1I73 A;  1ZS0 A;  1KUH A;  3B2Z A;  1KUI A;  2MZI A;  2QPJ A;  1SLM A;  4FVL A;  4GF1 A;  1KAP P;  4ILW D;  4DPE A;  3EWJ A;  1XFW A;  1GE7 A;  3KME A;  3I7G A;  4PKQ A; 
#chains in the Genus database with same CATH topology
 3Q2G A;  1S4B P;  1CGF A;  5LAB A;  1BIW A;  1FM1 A;  2YB9 A;  1QJJ A;  3LKA A;  966C A;  1MMP A;  3RTT A;  4H30 A;  4H3X A;  1MMQ A;  3K7L A;  3LUN A;  3LEA A;  3TVC A;  2KRJ A;  5JMY A;  4IN9 A;  3LP9 A;  1SU3 A;  2SRT A;  1XAX A;  4I35 A;  1MMB A;  5CZM A;  1D7X A;  3LJZ A;  1JH1 A;  3ZUK A;  2POJ A;  2DW1 A;  2YUF A;  1ND1 A;  1UMT A;  830C A;  4JPA A;  1K7G A;  2X3B A;  1IAC A;  1R1H A;  1ITV A;  2MLS A;  2OY4 A;  4GWM A;  3WV2 A;  1PEX A;  2JT6 A;  3UVC A;  4PKW A;  1KUF A;  2OXZ A;  1C7K A;  2D1N A;  4ZR5 A;  2D1O A;  2ERQ A;  4AIG A;  4JA1 A;  2MZH A;  4L63 A;  4PKT A;  3F17 A;  1GKC A;  1GE6 A;  1CK7 A;  2Y6D A;  3HDB A;  3GBO A;  5BOT A;  2OW2 A;  4HSD A;  4EFS A;  4ON1 A;  2WO8 A;  5D3C A;  2XS3 A;  5D2B A;  2CKI A;  1EUB A;  1AYK A;  4RT6 B;  2YIG A;  3ZVS A;  1XFX A;  3L0V A;  1YCM A;  2W13 A;  2HU6 A;  3NX7 A;  1AF0 A;  3V96 B;  1ZTQ A;  3KEC A;  2RJQ A;  1Y0V A;  3AIG A;  4PKV A;  1ZXV A;  1XUR A;  4L19 A;  3P24 A;  3LIL A;  1IAD A;  1QHU A;  3EDG A;  3VTG A;  1D8M A;  2OVZ A;  2OXU A;  3KWV C;  1HFC A;  1PWW A;  1YOU A;  3BA0 A;  1B3D A;  1SRP A;  3LIK A;  2MLR A;  3KMC A;  1AST A;  3F16 A;  3F19 A;  1QIB A;  1EAK A;  1Q3A A;  1JKY A;  5CXA A;  1BUV M;  3LIR A;  5CUH A;  3S18 A;  1XFZ A;  3KHI A;  2JIH A;  1JK3 A;  3I7I A;  3P1V A;  1OM8 A;  1C8T A;  1IAB A;  1KUK A;  4GWN A;  4FXY P;  3MA2 A;  1Y93 A;  1BUD A;  4QKZ A;  3LGP A;  1O0T A;  4XM8 A;  1WNI A;  3G5C A;  1R55 A;  1SMP A;  3N2U A;  1D8F A;  3TS4 A;  1GO8 P;  3KEJ A;  1JIZ A;  2OZR A;  1L6J A;  5B5P A;  2X3C A;  4WK7 A;  4J4M A;  1A86 A;  3LQ0 A;  1OMJ A;  1JAO A;  3DTK A;  1Z3J A;  1UTZ A;  1HOV A;  2TCL A;  1HFS A;  3DNG A;  2FV9 A;  2O36 A;  1I76 A;  1G05 A;  4JIJ A;  1ZP5 A;  4DV8 A;  5I4O A;  3LE9 A;  4WKI A;  4H1Q A;  1BM6 A;  4AUO A;  4H84 A;  3EDH A;  4H82 A;  3OHL A;  3Q2H A;  2OY2 A;  3LMC A;  4XBH A;  1HY7 A;  2AYK A;  1IAE A;  1IAA A;  3ZXH A;  3LJG A;  1BKC I;  1HXN A;  2CLT A;  3K7N A;  2OI0 A;  4Q1L A;  4A7B A;  2PJT A;  3B92 A;  5BPA A;  1XUC A;  1J7N A;  1ZVX A;  3G42 A;  1K7I A;  1MMR A;  1FBL A;  3V6N A;  1JIW P;  4PKS A;  2L0R A;  3KRY A;  2Y6C A;  1USN A;  1UEA A;  5L7F A;  4FU4 A;  3L0T A;  1R1I A;  2N8R A;  1ROS A;  4XM6 A;  2K9C A;  2W12 A;  2OW1 A;  1PWV A;  1BKC E;  5L79 A;  2X3A A;  5BOY A;  1R54 A;  1FLS A;  1QJS A;  1JJ9 A;  3HBU P;  4WKE A;  4CTH A;  1XFY A;  4OEI A;  3USN A;  1QIC A;  1JAQ A;  2FV5 A;  4H2E A;  1G9K A;  1HV5 A;  4H49 A;  2WOA A;  2O3E A;  1PWP A;  3E8R A;  3DWB A;  4H76 A;  3HY7 A;  1QJI A;  4G0D A;  1G4K A;  4R3V A;  1TVI A;  1IAG A;  5I3M A;  2RJP A;  2W14 A;  1XFU A;  4PKU A;  3DL1 A;  1G49 A;  1YQY A;  1D5J A;  4GR8 A;  2X7M A;  4AYK A;  1YP1 A;  1OS2 A;  3F15 A;  1QUA A;  2WO9 A;  4GR0 A;  4DF9 A;  1H71 P;  1GEN A;  3VI1 A;  1CGL A;  3OHO A;  1DTH A;  1I1I P;  4HMA A;  1CAQ A;  1O0Q A;  2Z2D A;  2A8H A;  2ERO A;  4YEH A;  2DW0 A;  1AKL A;  3B8Z A;  2OVX A;  1R1J A;  1Y8J A;  4LL2 A;  4DD8 A;  2JSD A;  3N2V A;  3KEK A;  4WF6 A;  3F1A A;  1OZ9 A;  2J83 A;  2MZE A;  4FXQ A;  1PWQ A;  1GE5 A;  1A85 A;  1B8Y A;  1ATL A;  5I43 A;  1CGE A;  1BQO A;  1UTT A;  3C7X A;  1OM6 A;  1SAT A;  2DDY A;  4AXQ A;  1BQQ M;  2DW2 A;  3O64 A;  2JXY A;  1JAN A;  1MNC A;  1XUD A;  2E2D A;  3TT4 A;  3LQB A;  3DPF A;  1GO7 P;  5H8X A;  3DPE A;  2I47 A;  1KUG A;  4XM7 A;  3WV1 A;  1QIA A;  3HDA P;  1OM7 A;  1JAP A;  4XCT A;  1GXD A;  1PWU A;  2K2G A;  2J0T A;  4A3W A;  2OW0 A;  3DSL A;  456C A;  3EDZ A;  1RTG A;  1CQR A;  1ZXC A;  5I0L A;  1GKD A;  1EB6 A;  1G12 A;  2W15 A;  5D1U A;  3CKI A;  5D1S A;  1BZS A;  3OYO A;  2OXW A;  1BKC A;  3TSK A;  1KBC A;  2JT5 A;  2ERP A;  4JQG A;  4WZV A;  1OS9 A;  3LK8 A;  1OO9 A;  1XM5 A;  4L7A A;  1RMZ A;  1UMS A;  4GUY A;  4PKR A;  4GQL A;  3EDI A;  4L6T A;  5D1T A;  1XFV A;  3EHY A;  2OW9 A;  1CIZ A;  2E3X A;  3O2X A;  3AYU A;  3DTI A;  1K7Q A;  3F18 A;  4I03 A;  4G9L A;  2V4B A;  4IUW A;  3HBV P;  2MQS A;  1C3I A;  3ELM A;  2USN A;  3LJT A;  3DTE A;  4GR3 A;  1BSW A;  5I2Z A;  4HX3 A;  1HTD A;  3SHI A;  3U1R A;  3RTS A;  1DMT A;  4IJO A;  5B5O A;  2JNP A;  2AIG P;  5I12 A;  5D7W A;  2W0D A;  3HB2 P;  1RM8 A;  1CXV A;  2XS4 A;  3HYG A;  3AYK A;  3LUM A;  3WV3 A;  4JP4 A;  3EHX A;  1SLN A;  2DDF A;  3HY9 A;  1I73 A;  1ZS0 A;  1KUH A;  3B2Z A;  1KUI A;  2MZI A;  2QPJ A;  1SLM A;  4FVL A;  4GF1 A;  1KAP P;  4ILW D;  4DPE A;  3EWJ A;  1XFW A;  1GE7 A;  3KME A;  3I7G A;  4PKQ A; 
#chains in the Genus database with same CATH homology
 3Q2G A;  1S4B P;  1CGF A;  5LAB A;  1BIW A;  1FM1 A;  2YB9 A;  1QJJ A;  3LKA A;  966C A;  1MMP A;  3RTT A;  4H30 A;  4H3X A;  1MMQ A;  3K7L A;  3LUN A;  3LEA A;  3TVC A;  2KRJ A;  5JMY A;  4IN9 A;  3LP9 A;  1SU3 A;  2SRT A;  4I35 A;  1MMB A;  5CZM A;  1D7X A;  3LJZ A;  1JH1 A;  3ZUK A;  2POJ A;  2DW1 A;  2YUF A;  1ND1 A;  1UMT A;  830C A;  4JPA A;  1K7G A;  2X3B A;  1IAC A;  1R1H A;  1ITV A;  2MLS A;  2OY4 A;  4GWM A;  3WV2 A;  1PEX A;  2JT6 A;  3UVC A;  4PKW A;  1KUF A;  2OXZ A;  1C7K A;  2D1N A;  4ZR5 A;  2D1O A;  2ERQ A;  4AIG A;  4JA1 A;  2MZH A;  4L63 A;  4PKT A;  3F17 A;  1GKC A;  1GE6 A;  1CK7 A;  2Y6D A;  3HDB A;  3GBO A;  5BOT A;  2OW2 A;  4HSD A;  4EFS A;  4ON1 A;  2WO8 A;  5D3C A;  2XS3 A;  5D2B A;  2CKI A;  1EUB A;  1AYK A;  4RT6 B;  2YIG A;  3ZVS A;  1XFX A;  3L0V A;  1YCM A;  2W13 A;  2HU6 A;  3NX7 A;  1AF0 A;  3V96 B;  1ZTQ A;  3KEC A;  2RJQ A;  1Y0V A;  3AIG A;  4PKV A;  1ZXV A;  1XUR A;  4L19 A;  3P24 A;  3LIL A;  1IAD A;  1QHU A;  3EDG A;  3VTG A;  1D8M A;  2OVZ A;  2OXU A;  3KWV C;  1HFC A;  1PWW A;  1YOU A;  3BA0 A;  1B3D A;  1SRP A;  3LIK A;  2MLR A;  3KMC A;  1AST A;  3F16 A;  3F19 A;  1QIB A;  1EAK A;  1Q3A A;  1JKY A;  5CXA A;  1BUV M;  3LIR A;  5CUH A;  3S18 A;  1XFZ A;  3KHI A;  2JIH A;  1JK3 A;  3I7I A;  3P1V A;  1OM8 A;  1C8T A;  1IAB A;  1KUK A;  4GWN A;  4FXY P;  3MA2 A;  1Y93 A;  1BUD A;  4QKZ A;  3LGP A;  1O0T A;  4XM8 A;  1WNI A;  3G5C A;  1R55 A;  1SMP A;  3N2U A;  1D8F A;  3TS4 A;  1GO8 P;  3KEJ A;  1JIZ A;  2OZR A;  1L6J A;  5B5P A;  2X3C A;  4WK7 A;  4J4M A;  1A86 A;  3LQ0 A;  1OMJ A;  1JAO A;  3DTK A;  1Z3J A;  1UTZ A;  1HOV A;  2TCL A;  1HFS A;  3DNG A;  2FV9 A;  2O36 A;  1I76 A;  1G05 A;  4JIJ A;  1ZP5 A;  4DV8 A;  5I4O A;  3LE9 A;  4WKI A;  4H1Q A;  1BM6 A;  4AUO A;  4H84 A;  3EDH A;  4H82 A;  3OHL A;  3Q2H A;  2OY2 A;  3LMC A;  4XBH A;  1HY7 A;  2AYK A;  1IAE A;  1IAA A;  3ZXH A;  3LJG A;  1BKC I;  1HXN A;  2CLT A;  3K7N A;  2OI0 A;  4Q1L A;  4A7B A;  2PJT A;  3B92 A;  5BPA A;  1XUC A;  1J7N A;  1ZVX A;  3G42 A;  1K7I A;  1MMR A;  1FBL A;  3V6N A;  1JIW P;  4PKS A;  2L0R A;  3KRY A;  2Y6C A;  1USN A;  1UEA A;  5L7F A;  4FU4 A;  3L0T A;  1R1I A;  2N8R A;  1ROS A;  4XM6 A;  2K9C A;  2W12 A;  2OW1 A;  1PWV A;  1BKC E;  5L79 A;  2X3A A;  5BOY A;  1R54 A;  1FLS A;  1QJS A;  1JJ9 A;  3HBU P;  4WKE A;  4CTH A;  1XFY A;  4OEI A;  3USN A;  1QIC A;  1JAQ A;  2FV5 A;  4H2E A;  1G9K A;  1HV5 A;  4H49 A;  2WOA A;  2O3E A;  1PWP A;  3E8R A;  3DWB A;  4H76 A;  3HY7 A;  1QJI A;  4G0D A;  1G4K A;  4R3V A;  1IAG A;  5I3M A;  2RJP A;  2W14 A;  1XFU A;  4PKU A;  3DL1 A;  1G49 A;  1YQY A;  1D5J A;  4GR8 A;  2X7M A;  4AYK A;  1YP1 A;  1OS2 A;  3F15 A;  1QUA A;  2WO9 A;  4GR0 A;  4DF9 A;  1H71 P;  1GEN A;  3VI1 A;  1CGL A;  3OHO A;  1DTH A;  1I1I P;  4HMA A;  1CAQ A;  1O0Q A;  2Z2D A;  2A8H A;  2ERO A;  4YEH A;  2DW0 A;  1AKL A;  3B8Z A;  2OVX A;  1R1J A;  1Y8J A;  4LL2 A;  4DD8 A;  2JSD A;  3N2V A;  3KEK A;  4WF6 A;  3F1A A;  2J83 A;  2MZE A;  4FXQ A;  1PWQ A;  1GE5 A;  1A85 A;  1B8Y A;  1ATL A;  5I43 A;  1CGE A;  1BQO A;  1UTT A;  3C7X A;  1OM6 A;  1SAT A;  2DDY A;  4AXQ A;  1BQQ M;  2DW2 A;  3O64 A;  2JXY A;  1JAN A;  1MNC A;  1XUD A;  2E2D A;  3TT4 A;  3LQB A;  3DPF A;  1GO7 P;  5H8X A;  3DPE A;  2I47 A;  1KUG A;  4XM7 A;  3WV1 A;  1QIA A;  3HDA P;  1OM7 A;  1JAP A;  4XCT A;  1GXD A;  1PWU A;  2K2G A;  2J0T A;  4A3W A;  2OW0 A;  3DSL A;  456C A;  3EDZ A;  1RTG A;  1CQR A;  1ZXC A;  5I0L A;  1GKD A;  1EB6 A;  1G12 A;  2W15 A;  5D1U A;  3CKI A;  5D1S A;  1BZS A;  3OYO A;  2OXW A;  1BKC A;  3TSK A;  1KBC A;  2JT5 A;  2ERP A;  4JQG A;  4WZV A;  1OS9 A;  3LK8 A;  1OO9 A;  4L7A A;  1RMZ A;  1UMS A;  4GUY A;  4PKR A;  4GQL A;  3EDI A;  4L6T A;  5D1T A;  1XFV A;  3EHY A;  2OW9 A;  1CIZ A;  2E3X A;  3O2X A;  3AYU A;  3DTI A;  1K7Q A;  3F18 A;  4I03 A;  4G9L A;  2V4B A;  4IUW A;  3HBV P;  2MQS A;  1C3I A;  3ELM A;  2USN A;  3LJT A;  3DTE A;  4GR3 A;  1BSW A;  5I2Z A;  4HX3 A;  1HTD A;  3SHI A;  3U1R A;  3RTS A;  1DMT A;  4IJO A;  5B5O A;  2JNP A;  2AIG P;  5I12 A;  5D7W A;  2W0D A;  3HB2 P;  1RM8 A;  3HYG A;  1CXV A;  2XS4 A;  3AYK A;  3LUM A;  3WV3 A;  4JP4 A;  3EHX A;  1SLN A;  2DDF A;  3HY9 A;  1I73 A;  1ZS0 A;  1KUH A;  3B2Z A;  1KUI A;  2MZI A;  2QPJ A;  1SLM A;  4FVL A;  4GF1 A;  1KAP P;  4ILW D;  4DPE A;  3EWJ A;  1XFW A;  1GE7 A;  3KME A;  3I7G A;  4PKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...