4FU9A

Crystal structure of the urokinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu9A01
1UVPA 1SGCA 1EAXA 5DP6A 1KDQA 2VINA 1OYTH 2ANKH 1GCDA 5HGGA 4F4OC 1BQYA 2FYRA 1CBWB 1AB9C 1HAIH 4RKOB 1MAXA 3FVFB 1GGDB 1NY22 1P06A 1ZJKA 4AFZA 4CBNA 2W3KA 4X6NA 4IMZA 2ODQA 2BD2A 3F1SB 1SHYA 4XE4A 1GG6C 1HRTH 4K2YA 1C1TA 2OP9A 2HRVA 2D8WA 4GHTA 4IGDA 1CBWC 4FUFA 1UVUH 3S9BA 2BDCA 4WXIA 1A46H 2UUKB 1W0YH 3NK8A 4OS5A 2O9QA 1OSSA 5FCRA 1O2LA 1IQJA 3ZVBA 3SUDA 1XUHA 2FI5E 1FY3A 2OC7A 3S69A 1FN8A 2JH6D 2GV6A 2RG3A 5DGJA 1Q3XA 5PTPA 3NKKA 2HNTE 3T27A 1O3GA 1TA6A 1ZRBA 1TGTA 2A1DB 1ELCA 1DUEA 3PB1E 4I8HA 5DG6A 3LH1A 2VWLA 1Y3YA 4XBDA 1TIOA 1BCUH 4UFFH 1EPTC 3TJVA 5CMXH 1L1JA 2BHGA 2BM2A 1ZHPA 4HZHA 3H7OA 1ELTA 2A5KA 1DY9A 1GMDG 2GCHG 2P3FH 1J8AA 1JIMA 3MH5A 2ILNA 2QY0B 1HCGA 3TH3H 2ZFRH 2TRMA 3EA9A 1W14U 1P9SA 2CF9H 3CENA 5ETXA 2C8WB 1GBTA 3RU4T 5EGMA 3BTTE 4BAQB 4BTTB 1TLDA 4ZKNU 1ARBA 1YPJH 1O3OA 3RXJA 3TJNA 5A0AE 1XVMA 2A4OA 4KELA 3PM3A 2FI3E 4BAKB 4BANB 1FJSA 1MCTA 3RMNH 2BOKA 3PLKA 1O2SA 3RUOA 1KXFA 5GCHG 5F8ZA 4AYYB 5L30H 2BY5X 1GHZA 2J34A 1UMAH 3Q77A 1OP2A 2GZ8A 3V3MA 3BTGE 4NG9H 2CV3A 2BY6X 4UONA 1O3NA 4J1YA 1O2JA 2R2WU 4DCDA 1HAOH 5C2ZA 4K60A 2D2DA 2EA3A 2V3HH 3QTOH 1C4Y2 1O2TA 2VNTA 2BXTH 2FTLE 6ESTA 3GCHB 3OU0A 3QDZB 3UY9A 4MTBA 1N8OC 3H7TA 4VGCB 1KXAA 3BF6H 3LGUA 1O3EA 2A2QH 2P8OC 1G2MA 3TGIE 1CSOE 1TPSA 1GBAA 1ZHMA 1O38A 3VGCC 4DJZB 2VIQA 4ZHAA 2OLGA 3PTNA 3RM0H 4UFGH 2AMPA 1GDQA 1P2NA 3TVJB 3MO9A 3U8RH 5EQRA 1UTOA 1HV7A 2FS9A 1J16A 4ABBA 1D6WA 4DGJA 4Y71A 5DP5A 9ESTA 2C3SA 1TBZH 2SGQE 1RTKA 3UWJH 1LHFH 1H8DH 3KNXA 1TBRH 1V2OT 3ZZ5A 2AIQA 1V2RT 3QX5H 1FY4A 1OXGA 3RC5A 2WINI 1P3CA 2FEQH 1P3EA 7LPRA 3U1JB 1VJAU 3A7TA 3U8OH 3SQHE 1K1OA 1EAWA 3VXFH 2K1QA 5JB8S 1AU8A 3SJ8A 3A82A 2Z94A 4U2WA 3SGBE 2BX4A 2H9TH 2ZCLP 3IWMA 1GI9B 1GJ7B 1O2IA 2OC8A 1E36B 1SGPE 2FYQA 1C1UH 5FXLA 4A1VA 3OY5U 1GBLA 1NC6A 4DIIH 1YPKH 4AG2A 1C5XB 5GIBA 2Z3DA 1Z8IB 1YC0A 4BXWA 1UCYH 1Y5AT 1WSSH 3BEUA 3LJOA 2WPJS 2H6MA 1LDTT 4Q2KA 2GD4B 1D9IA 1TALA 4K3JA 1NRQH 3A8BA 1SGRE 4X2XA 3SNCA 4UD9H 1GHBF 1CGHA 2XBYA 3LH3A 1C1RA 3QLPH 2GMTC 1PPHE 1V2KT 2EI6A 3PLPA 2NU1E 2GVFA 4ZH8A 1YPEH 1OWKA 1BRCE 1SMFE 4GCHG 1GJ9B 1BJVA 2VIVA 6GCHG 2Y7XA 1ZMJA 1ZSKA 1KDQB 1QRWA 1YPHC 4AN7A 1GJ8B 1HBTH 5T6GA 2JETC 5C20A 2DE9A 1AZ8A 3VB7A 4DVAU 2IJOB 1MBQA 2QF3A 1FIZA 1SGDE 4H6SB 1SGEE 4AGKA 3K65B 4O03A 5ESTE 2BYAX 1YPHE 2ZHWH 2ULLA 2ZEBA 2F3CE 1TGSZ 1AI8H 4NSVA 3A88A 1TMBH 3D23A 1PQAA 2A0QB 3MNCA 2WPLS 1ABIH 4JK5A 4BAOB 3KIDU 1TB6H 4E05H 3P17H 1MU6B 2UWLA 1FXYA 2B5TB 1O0DH 4E06H 4FUDA 4NA9H 3FP6E 2BX3A 3M5LA 4X6MA 2ZECA 4CR5A 1IQKA 1LVOA 3SHAH 3P8GA 2FZZA 1GBBA 1O2GH 1O5GH 1XMNB 3S9AA 3URDA 3ZZ3A 1TNHA 1WU1A 4MPXA 4BTUB 1FAKH 1C5WB 2PKAB 4FU7A 2PLXA 1QBVH 1MBMA 1PPZA 1ZGVA 1BRBE 1EASA 1Z6EA 2WYGA 3PMBB 3TLOA 1C5UA 3ZVDA 1SLVB 1GHAG 1O3FA 3TU7H 2P95A 1EOLA 1TNGA 4UE7H 3GYMA 2BLWA 1YCPH 3GY4A 2XCNA 1SOTA 3E90B 1TGBA 4Y11E 1G2LA 1V2LT 2RA3A 5E0GA 3AASA 3RXQA 2Y82A 4MNXA 1ETSH 2ASUB 4MVNA 1LHEH 3TK5A 4B2BA 4TPIZ 2XC5A 4Y0YE 1BTWA 1ELVA 2P93A 1SG8B 2XRCA 3E1XB 3PLBA 4IN1A 3RXAA 4DOQA 4Y0ZE 1H9HE 1GGDC 1IQNA 4MNWA 2WYJA 1BBRK 1AMHA 3SV7A 4MQAA 1QA7A 3GDUA 1O3JA 1CGIE 3SUFA 1N8OB 1P57B 1GHWH 2YNBA 1T4VH 2KAIA 1HPGA 1CT4E 1RS0A 3BTKE 5EW1H 1TX8A 1C1MA 5ESBA 1O5FH 2HOBA 3BTWE 3P8OA 1NTPA 1DWDH 3BEIB 2FWWA 1UTLM 1YLCA 2PUQH 1MTVA 1P10A 3TIUA 4D9QA 1O5CB 1SBWA 5SGAE 1CE5A 5C5NA 2VIWA 2IOTA 1FUJA 2W7UA 3K6YA 4D7FA 4ABIA 1GBJA 5EXMA 1QGFA 1QBNA 3PROA 5DP3A 2C93B 1A3EH 1L1NA 2Y6TA 2Y5FA 2FI4E 2J92A 1GBIA 4H6TA 5EXNA 2GZ9A 3MNBA 1L2EA 2VJ1A 3A85A 1FIWA 2GCTC 1Z7KA 2XBVA 2GX4A 2BY7X 2H5CA 2FOAA 1Z8RA 2C8YB 2ZFQH 3SW2B 2HVXA 1O2WA 4I33A 1GVLA 1P2QA 1P01A 1GHXH 2F91A 3GYLB 5BRRE 5HXFA 5EOKA 2RCEA 4A6LA 5FAHA 3EA7A 3BTQE 4WWYA 3TGKE 1FMGA 1O3DA 1PFXC 2FTMA 3BSQA 3TK9A 3RXKA 1OWJA 2Q6DA 1S81A 4CRCA 3IG6B 5C5OA 2GDDA 1MTNC 1KIGH 3OX7U 1O3MA 2I6QA 1BOQA 1MTUA 3IITA 1GHYH 3DD2H 5FX5A 1O3LA 3VB6A 1FY5A 2ZC9H 2ZO3H 4O9VA 3RC4A 2D1JA 3RXFA 5JPMH 4NSYA 1GJCB 1O2RA 4LZ4B 5TCCA 1GDNA 1O2VA 5A8YA 1MQ5A 4BAHB 1GI4A 1ZOMA 1DICA 1D6RA 4ZKSU 3WY8A 3URCA 5T6DA 3RXOA 2BB4A 3A81A 1LTOA 4YTAA 3GISB 4B2AA 3KF2A 2ZFTA 1P8VC 1BT7A 1HXEH 2P94A 3M7UA 3BG8A 3H5CB 1GVZA 2BD8A 3MOCA 3UFAA 1DLKB 1GHBG 2BZ6H 3SZNA 2EI7A 3I77A 1W7XH 4BXSA 4I31A 3NCLA 1WOFA 2ZQ1A 3RDZA 5JDUB 2BZAA 2CN0H 2G55A 1P11E 1GI3A 2ZDAH 1DOJA 2AERH 1HYLA 4AFSA 2PWXA 2C8XB 1QL8A 3HKJB 1IQMA 1GI0A 3MNSA 2R0LA 1TGCA 2PUXB 3UNSA 6GCHF 4X8UH 5JB9S 4FU9A 1GI6A 4ABJA 2C8ZB 2BDIA 3RXHA 1GBFA 3VB5A 3B9FH 1DPOA 2A45B 3LPRA 1GBMA 1V2VT 4O3UA 2Y81A 1UCYE 3FZDA 4XOJA 3RXMA 4DURA 3I78A 1E38B 1S84A 2FDAA 2THFB 4B73A 1FLEE 1QCPA 1YYY1 1FONA 1ZSLA 4XFQA 1TNIA 1O5DH 1W8BH 3BV9B 4AGJA 2A4GA 1U6QA 3RP2A 1GI5A 4UFDH 1LVBA 2TBSA 4KKDA 4NA8A 1W2KH 1KTTB 1MZDA 1GL1A 2NWNA 5E2OA 4WMEA 1V2JT 2ZDKA 3ZV8A 1Y8TA 1SGFG 1HJAB 3F6UH 3STJA 3W94A 1MCVA 1EP5A 2CJIA 3ZZ7A 4YZUA 5L6NH 1BTYA 1C2LA 1L4ZA 2HPPH 1Y5UT 1ZTKA 1LKBA 1L1GA 2CHAB 1AE8H 3MU8A 2BD3A 4Y10E 3BTHE 1DDJA 2VWOA 4K69A 5GJ4B 3N7OA 3Q00A 3DUXH 1O5BB 4FUHA 2P59A 4IN2A 5EODA 1GL0E 1ZTLA 2AGGX 5K7RA 1K1JA 2JH0D 4ZKRU 1O2KA 1NFWA 1BMNH 2W26A 1TOMH 1ZJDA 2NU2E 3QWCH 1L0ZA 1DWCH 1BMLA 1O36A 1A2CH 1GJ6A 1HFDA 1TWXB 4FXGH 1C2GA 1C4V2 1G36A 2WPIS 3HGNA 2JETB 4YT6H 4TWWA 1V2PT 3PYHA 4OS1A 3U1IB 1MTWA 4Q7XA 1UVSH 4JZ1A 1IAUA 4Y7AA 1J9CH 3RM2H 1PQ7A 2DUCA 3LIWA 1JRSA 1OS8A 4R8TB 4FVBA 4INKA 4X8VH 2AH4X 4K1EA 1GVKB 2SGPE 1XUJA 3SU3A 2KAIB 1KXEA 1ZGIA 3A89A 3UUZA 4AZ2B 2AS9A 3A8DA 3MU0A 2TGTA 1C2DA 3RMLH 3L3TA 1KY9A 2ZP0H 1HAVB 4ZAEA 4JYUH 1A0HB 1C5QA 1QHRB 1XM1A 1TNJA 3SNDA 1BA8B 3RXTA 4A7IB 3GY7A 2UUFB 2XBWA 1AE5A 1BTXA 4BTIB 1P2JA 1TGNA 4NZLA 1QNJA 3UIRA 1MKWK 4E7NA 2A7JA 1K1LA 1S82A 1PPBH 3LONA 2XW9A 1ANCA 1EJNA 1WYKA 2BVRH 3EDXB 1Q31A 3KQEA 4GLYA 1DSUA 2Y5GA 5DP8A 3LKWA 1C5VA 4JZDH 1V6DA 1JXPA 2G4TA 3M3TA 1TQ0B 2ZU3A 2P16A 1GI8B 5G4BA 1TAWA 3V13A 2OCVB 1ELDE 1DXPA 1PYTC 3HKIB 2RA0A 2FO9A 1VITF 1O3BA 2ZHEH 3A7YA 6CHAC 3MTYA 1WQSA 1DY8A 5CHAC 4FUBA 1FNIA 1ZYOA 1F92A 2ZPQA 1T7CA 3S9CA 1C5RA 2A4RA 3FFGA 1XXDA 5GXPA 5DO4H 1OWEA 1MH0A 1ZTJA 4JZEH 3LC3A 4UFEH 3T26A 4ISLA 3F9EA 2FOGA 2OD3B 2PW8H 3UNQA 1HLTH 1MKXK 1QIXB 2PR3A 3LDXH 2CXVA 2ZDNA 1QY6A 3U8TH 1GCTC 1PQ5A 1O2OA 3SV2H 8GCHF 2O8TA 1G30B 1IQHA 2O8LA 2R9PA 2FOBA 2SGEE 1TNKA 1DS2E 2HALA 3ATIA 1BIOA 2BQ6B 1OYQA 1WV7H 2UUYA 1EJMA 4MPUA 4YOIA 2ZCKP 1NM6A 1ZRKA 5F8TA 3A7XA 1RRKA 1VR1H 5HM2A 1BJUA 1G37A 1JIRA 1H9IE 2UWPA 2P3TB 1SGTA 2F9PA 3GCTG 4IMQA 4THNH 2AMDA 3ZVAA 5FX6A 1HAYB 3OY6U 5FPSA 1XUFA 1JBUH 1XUGA 2GZ7A 1NO9H 1SB1H 1AHTH 1K9OE 2PKAA 4A1XA 3ZZCA 1SGNE 1DVAH 2GCTB 4AOQA 4F49A 3QK1A 3SGAE 1BB0B 1SC8U 1A4WH 4ZHLU 2EI8A 3LGTA 4ZXXH 2Z9JA 1P09A 3ZVGA 1LQEA 3U98H 7GCHF 4XSKU 3VB4A 2R2MB 2XXLA 1ANDA 1FPCH 1HJ8A 3HK6B 2ZGBH 5HYOA 1V2UT 1SLWB 1PYTD 3QZQA 1AVGH 2GMTB 3RXGA 3FP7E 3SORA 1N6XA 3O8DA 1C2HA 1TBQH 4MPVA 4CRFA 1V3XA 2PKSB 1Z1IA 2NU3E 4DY7B 4IS5A 2FOMB 1YCPK 1LMWB 1QJ6B 1P9UA 3RXLA 1DX5M 1HAXB 2BLVA 4MNVA 4ABGA 5E2PA 2ANMH 2BDHA 3ZZBA 1VCPA 2H2ZA 3SUEA 3A8CA 5LGOA 1GDUA 2SGFE 1YPMH 2XBXA 5GDSH 1C5NH 1JOUB 4CH8B 1C2KA 3NPSA 2DE8A 1YPGH 1DFPA 2XNIA 3K9XB 3PMHB 1BRUP 3RXIA 5E8EH 3LOXA 4XBCA 3DA9B 2ZTXA 2Z3EA 4D7GA 1H8IH 4YM9A 1UO6A 4INHA 3SUGA 2Y7ZA 1YM0A 4TWYA 1EB1H 3V12A 1BZXE 3OTJE 1UCYK 4GCHF 3UTUH 4PROA 1G3BA 3KCGH 1TABE 1C5TA 5EPNA 5EQQA 1GBHA 3RXPA 5FHTA 5C1UA 1AFQC 2G8TA 1AY6H 4NIXA 4CRGA 1SLUB 5TCAA 4ABEA 1IQEA 3RXSA 3F9HA 3ATWA 1AUTC 3GDVA 1GHAF 2STAE 4CRDA 2PFEA 4MDSA 3O8RA 1SOZA 1SL3A 4ZMAH 1C5YB 1KYNA 1FV9A 3BN9A 1WTGH 4ESTE 4AB9A 1AD8H 1H4WA 3ITIA 1M9UA 1AKSB 1ANEA 3KQDA 2CF8H 4U30A 3BIVH 1LHCH 1SQAA 3GY2A 1LPGB 1SQOA 1MD7A 4A92A 1XXFA 5A2MH 2FOHA 3QN7A 3SU2A 1OX1A 2Z7FE 1OP0A 4WH6A 1DANH 3SQEE 2GKVE 1QB6A 1ZMLA 4NA7A 3DFJA 1GI1A 4I8KA 2FESH 1O5AB 1DWBH 1FAXA 1XX9A 1ORFA 1K1IA 2BVSH 3FP8E 3SU4A 1MMJN 1SSXA 3ZZ4A 1P03A 3Q76A 2ZFSA 3GY6A 1AWHB 1IOEA 1NU7B 3KQCA 1ZR0A 1O3PB 3AAUA 4DT7B 1MUEB 1C4U2 2ODPA 2VVUA 1O32A 3E8LA 3EAJA 3TH4H 2BTCE 3RLYH 1TRNA 4GHQA 2XTTB 3M37A 1GMCF 1QURH 1TOCB 4AG1A 4BNRA 3TGJE 1QRZA 2XC4A 2LNCA 5A8ZA 1JWTA 1GBKA 2ZF0H 1A0LA 3M5OA 3ODDA 2XWBI 2A7HA 1YKTA 4HFPB 4TPYA 1KSNA 2PKSC 2VB0A 2Y80A 1BHXB 1BBRE 9LPRA 2ANWA 2F9NA 3CS0A 1SLXB 1TRMA 4ISNA 2PSYA 1OKXA 3HATH 4ISHH 1AO5A 2AYWA 4YESB 3RXEA 3BG4B 5A0BA 5FCKA 3ZZAA 1DE7H 4HI3A 1D3DB 4TY7A 3SBKA 2FMJA 3OYPA 4FUIA 2ZTZA 3Q3XA 2B7DH 3MHWU 3U69H 2FIRH 3G01A 1BTHH 3MI4A 1ELBA 1THSH 4JZIA 4IBLH 3QGJA 1OPHB 1UTPA 4FUJA 4KTUA 1E37B 4CR9A 2W5EA 1O37A 4X1RU 1W10U 3ATKA 5J4QA 1GJBB 1Y3UA 3PWBA 3M35A 3RXCA 1TMUH 2ZNKH 1K28D 2ZG0H 1VZQH 1T4UH 4YT7H 4X2VA 4ABAA 2H9EH 3LGVA 1GHVH 3MNXA 1TPPA 3M7QA 2OBQA 1C5ZB 1H9LB 1PJPA 2J95A 2OXSA 5LH8A 4Y79A 1G3EA 1J17T 2F9VA 2VIDA 1GPZA 1B0EA 2GGVB 1ZPZA 1UK3A 3NUMA 4OGYA 4WVPE 1SGQE 1A61H 1WQVH 1GMDF 2ZQ2A 4X8TH 1CGJE 3V7TA 3E16B 3SO3A 2ZU4A 1GWAA 2YNAA 3UPEA 3Q3YA 5F03A 5IYTA 2C90B 4X2WA 5JBCS 1GMHG 3O8CA 2ZWLH 1T32A 1TYNA 1CA8B 1UTNA 2ZZUH 4JYVH 3P6ZB 4X8SH 4YLQH 2O8MA 3RU4E 1K1MA 2LPRA 1EAIA 1YF4A 5H4IB 1NFYA 1VCQA 1K2I1 1VITH 3DHKH 5I25A 1LKAA 2FX4A 2ALPA 5T6FA 3MH7A 2QC2A 1IQIA 1GJ5H 1EJAA 1C1NA 4GPGA 3NZIA 4ASHA 2ZDMA 2AGEX 5GCHF 3T5FH 2OQUA 2BDAA 5CE1A 4K1SA 3VPKA 1HAGE 2QYIA 1QJ1B 3SJOA 1Y3XA 2ODYB 3SN8A 3UREA 2XYAA 1QBOA 1SFQB 1EPTA 2IN2A 4R0IA 1SI5H 3GCHC 4ZKOU 3SJKA 1K22H 3KEEA 1QL9A 3KHVA 1Z6JH 4LK4A 1CT2E 1WBGB 1ZPCA 1YCPM 2VIPA 8KME2 1CHGA 2Z9IA 1C5MD 1ACBE 2O8UA 2BDYA 4Y7BA 2FP7B 3RXBA 4IC6A 2J38A 3QO6A 2BOHB 4IC5A 4Y8ZA 3MYWA 1T8NA 1KTSB 2G81E 7KMEH 1THPB 1ZSJA 2H9HA 2J9NA 2PTCE 1S0RA 2SGAA 1GJAB 1HJAC 5JBBS 4JCNA 2QF0A 4NZQA 1CHOF 2Z9KA 2UWOA 1WTHD 1BTUA 1NT1A 1S83A 2BDBA 3GY5A 1A0JA 1T8MA 1XUIA 3BG4C 1V2TT 5EW2H 2ZU5A 1FZZA 2AEIH 3K6ZA 1RIWC 2QXGA 5DJ7A 1SPJA 1EZSC 1BITA 4CREA 3ZYEA 3BTME 1W3CA 4FUGA 1T31A 4YLUA 5C3NA 4YOGA 1UHBB 1AFEH 1BMAA 1INCA 1VJ9U 2ZKSA 2A4QA 2ZCHP 2BVXH 3SU0A 5ABWA 2ZGHA 2GP9B 1AB9B 1UVTH 2YOLA 1NU9A 2QXIA 3R0FA 3L33A 1T8LA 5J4SA 1XVOA 4K8YA 4Z0KA 2GT8A 3UWIA 2QA9E 1E34B 3RXDA 1VGCB 3TK6A 5AF9H 1NN6A 3NXPA 1O3CA 4KTCA 1O3KA 4Q7ZA 3ZVCA 2NU4E 2W3IA 5B6OA 3GDSA 3M61U 4WF8A 3S7HB 3F68H 4IW4E 1MU8B 1C1PA 1UJ1A 4HTCH 1D4PB 1ESTA 1O2ZA 3PO1B 5EG4A 1Z1JA 1THRH 4K8BA 1AVWA 1AKSA 4GSOA 1V2NT 4AORA 4FUEA 2HPQH 4K1TA 2TGDA 4A1TA 1C1QA 3U9AH 3L6PA 1WCZA 2D26C 3LU9B 2PGQB 1KXCA 1WUNH 5CHAB 3CS7A 1V2ST 4LXBH 1TMTH 3GCOA 1ANBA 4ABHA 1KLJH 3AVZA 2G4UA 1GBEA 1Z71A 1TPAE 2EC9H 3BEFB 2F9OA 4MG3A 4DIHH 1EB2A 3VGCB 1LVYA 3F9GA 3B8JA 1TA2A 1RFNA 2BD4A 3PMJA 4TYDA 3D62A 1ARCA 3M3VA 1UVOA 4OGXA 2XWAA 1PQ8A 4X2YA 1ID5H 1UK2A 3F9FA 1KLTA 1C2JA 3RMMH 1G3CA 3ZZ9A 3BIUH 3ENSB 3PTBA 1A7SA 3ZYDA 3TPIZ 2A31A 3SNEA 1NPMA 5BPEA 3ZV9A 3A7ZA 1HAPH 3SJ9A 2H5DA 1CT0E 3KGPA 3QUMP 5DP9A 4Y8XA 3AAVA 1O2HA 1C2FA 1YPLH 4DG4A 1NS3A 2AIPA 5A8XA 3OSYA 3MO3A 4JK6A 4O97A 2Z9GA 1C9TA 1D3TB 1CA0B 1HJ9A 4LZ1H 4I8GA 1WAYB 2ZTYA 1BTZA 3M5MA 1S0QA 3E3TA 3GICB 3MWIU 1O3AA 3SI4H 1A1RA 1CVWH 4OS4A 4CHAB 1O2YA 4ISOA 2H1UA 4AX9H 2UUJB 5DP7A 3SNAA 2A5IA 2WPMS 4OS7A 2ANYA 3SOSA 2HGTH 3E0PB 3A87A 3RU4D 5LPFA 4ABDA 1DT2A 2FX6A 3LGYA 4WY3A 4A5TS 1ZMNA 5AFZH 1O30A 1LHDH 4H42U 2BQ7B 2ZFPH 3HPTB 1ELGA 2OC0A 2HWLB 5DPAA 1PPGE 3UQOA 2BD9A 1O31A 3VB3A 1UHBA 1NRNH 3TJUA 1P05A 3VFEA 4Y6DA 4NIYA 1O34A 1ETRH 3ATMA 7GCHG 2BY8X 4KP0A 4AFQA 1KXBA 3M5NA 2QIQA 1O2QA 1CU1A 4Y8YA 2OINA 3FANA 4KGAA 3C1KA 3LC5A 1EZUC 2SNWA 1NZQH 1O35A 2A2XH 1FY1A 1QB1A 5IDKA 2QN5T 5JYIA 3AW0A 2GV7A 3CP7A 5E0HA 1A5IA 2ZHDA 2R0KA 1AIXH 2IPHA 1XKBC 2WUBA 1EZQA 3TNSA 4WXVA 1C1WH 1GBCA 2M5TA 1HAVA 1OP8A 1QTFA 2NU0E 1F0SA 3TH2H 1L4DA 7ESTE 1O2NA 1LO6A 1HIAA 5LPEA 4I8JA 1EP6A 1MTNB 2BQWB 2FPZA 3SV9A 1QQUA 3A80A 3E0NB 4NFEA 2ZU2A 4OS2A 1C2MA 2QAAA 1F5LA 1HNEE 2B9LA 1G32B 3GCNA 4NFFA 1SGYE 1Y3WA 2Q6FA 2VU8E 4D9RA 1MTSA 1TNLA 4NCYA 3E6PH 3M36A 3RMOH 4ZHMU 4X1NU 1F2SE 1H1BA 1NRSH 2AFQB 2WPHS 1W13U 1A3BH 1IHTH 3A7VA 2BLQA 3P95A 3QZRA 4Q7YA 1XUKA 2ZA5A 1E35B 3D65E 4K5ZA 1C5OH 2WV4A 1QJ7B 4B74A 4X1SU 3JZ2B 3R3GB 4GUXA 1C2IA 1BTPA 1YGCH 3GY8A 3BTEE 1ABJH 1CA0C 5GWZA 3TITA 4E7RG 2G5NA 1SGIB 2QXJA 3E91A 1G9IE 3RXVA 1O2UA 4GVUA 4MNYA 1QRXA 4CH2B 4I32A 1GI2A 3RC6A 2ZHFH 1N6YA 1EZXC 1O3IA 3D49H 1BMMH 5AFYH 2G52A 1EX3A 3MU1A 1LQDB 3S0NA 1S5SA 1C5PA 1HXFH 4JZFH 1C9PA 1GJ4H 1C1OA 1GCTB 6CHAB 4X1PU 1ELAA 5EU8A 4Y76A 3A84A 5EPYA 4XBBA 4VGCC 5DK1A 4I8LA 1MAYA 3ZZDA 2ZDLA 1BHXF 1DLEA 1P12E 3KN2A 4CHAC 5K0HA 2FXRA 1XKAC 1C1VH 2PSXA 5HMAA 1RXPA 2OUAA 1Y59T 1D3PB 4O3TA 2AMQA 1JMOH 1TQ7B 3B23B 3MU5A 2VH0A 3QTVH 1C1SA 5GPIB 4AB8A 1ZHRA 1E0FD 2ZFFH 6LPRA 3ZVEA 1EKBB 8ESTE 2PV9B 1UTKA 1QR3E 1J14A 4BAMB 4Z6AH 1N1LA 2BXUH 2V3OH 4SGAE 3T29A 4GAWA 3PMAB 3O8BA 2QGRA 4LOYH 4NWKA 1UTMA 1ZLRA 4UEHH 2FOFA 1GBDA 1P04A 3DFLA 3EGKH 5F8XA 5I46H 2GTBA 1DSTA 2VIOA 3ESTA 1GG6B 2V0BA 1GI7B 4NIVA 1SFIA 2FOCA 1B5GH 1FDPA 1AGJA 1RTFB 1TX7A 3KQBA 4MPWA 3GY3A 1O2XA 1EUFA 1W12U 3T28A 3UQVA 4CBOA 1IQFA 2A7CA 3LJJA 4ABFA 1LHGH 4NWLA 4ZROA 3SNBA 1SQTA 4WJG2 1BRAA 3GOVB 3DT0H 1C5SA 3EE0B 1Y5BT 3PO1C 2Z3CA 8LPRA 2ZHQH 1AFQB 2HNTC 1A5GH 2WPKS 1C5LH 1FN6A 1MD8A 3SU1A 5E0JA 4FU8A 1TX6A 1QQ4A 2F9BH 3M3SA 1V2MT 3UOUA 1KXDA 2WUCA 2FLRH 2R3YA 1PPEE 4AYVB 2HNTF 4X6PA 3UNRA 1OWDA 1QA0A 1SR5C 2J94A 4SGBE 2VH6A 2I6SA 3MFJA 1DWEH 1NRRH 4ZUHA 4M7GA 1YBWA 1HAZB 5FPYA 1J15A 1VITG 2PHBA 1O2MA 1TPOA 1VGCC 2SNVA 2ZGXH 5A0CA 1GMHF 2G51A 1IHSH 3MMGA 4X0WU 1O5EH 3P70B 1UTJA 3MH4A 2AGIX 2EEKA 3ZZ6A 2J4IA 2XCFA 1CQQA 3HGPA 1X7AC 5DKMA 3BTDE 4WMDA 5JBAS 2ZDVH 1O2PA 2OC1A 4RSPA 1MZAA 1W0ZU 1RGQA 1FPHH 3SGQE 1W11U 2VGCC 4D76A 4YO9A 3I29A 2HLCA 2Z9LA 2BY9X 4FVDA 1PPFE 4DW2U 1P0SH 2F83A 4U32A 1BBRH 3AW1A 4WH8A 2TGPZ 1B0FA 1O39A 1OWHA 3SV8A 1A5HA 5L2ZH 2RDLA 4KTSA 1MKXH 3HK3B 3P92A 3SU5A 5FBIA 5EQSA 4B76A 3FZZA 2W7SA 1UTQA 2CMYA 3UR9A 5AHGH 4X1QU 1K21H 2Q6GA 3SHCH 1SGFA 1B7XB 2CGAA 3ODFA 3RLWH 1HDTH 1QFKH 1S6FA 3QGNB 3V0XA 1EXFA 4RN6A 1F7ZA 3ATLA 3PV4A 1TFXA 2SGDE 3GCTF 4HGCA 2O8WA 1F0UA 5FPTA 4TY6A 1ELFA 3SU6A 3ZZ8A 1ZPBA 1IQLA 3Q3KA 1P02A 4I7YH 1EOJA 1P2IA 2GCHF 1CHOG 2VVCA 2C4FH 1UK4A 2G00A 2ZPRA 1GJDB 1DUAA 4YOJA 3W95A 2ZI2H 3FAOA 3MH6A 1T8OA 2B8OH 4Q80A 1JRTA 2PGBB 1EQ9A 1TE0A 3UR6A 2TGAA 4U01A 4B2CA 4X6OA 1FQ3A 4FUCA 8GCHG 2CHAC 4JMYA 3P8FA 1D3QB 1V2WT 2V35A 1NESE 2BLOA 2ZGJA 1V2QT 2OTVA 4D8NA 1RIWB 3ELAH 2XC0A 3PWCA 2GDEH 4MLFB 1FI8A 1ESBA 1O33A 2TIOA 2OBOA 2ZU1A 5TJXA 4B71A 1YLDA 1RJXB 2JH5D 3P8NA 3TJOA 2Q1JA 1DM4B 2BDGA 2FM2A 2ZPSA 3A7WA 3K2UA 3EA8A 5LPRA 1F0TA 2FODA 2GT7A 3VEQB 1AWFH 3BTFE 4B75A 4ZXYH 4J2YB 3C27B 5AVDA 2WV5A 2Y5HA 1OWIA 4WMFA 2ZIQH 2SFAA 4RKJB 2OQ5A 1Q2WA 4AFUA 1AZZA 1NROH 2FLBH 3SV6A 1F5KU 1AUJA 1K1PA 1P2OA 2FOEA 2ALVA 1QB9A 1VCWA 1CO7E 3NWUA 3SJIA 1LVMA 1Y3VA 3M7TA 3T25A 1EATA 1ELEE 5T3HA 2G5VA 4UDWH 4INLA 4OS6A 2Z6BD 1TRYA 3VXEH 5JBTA 1RD3B 2ZGCA 1BUIA 3TNTA 2P3UB 1AQ7A 2B0FA 1EPTB 3STIA 1ZZZA 4CRBA 1HUTH 1NFUA 3LGWA 5F6MA 1LPKB 2BMGB 3ZVFA 3MO6A 2P8OB 2J2UA 1G3DA 5C1YA 1AN1E 1W7GH 3SI3H 1K1NA 2A32A 1NRPH 1S6HA 2BD5A 4JYTA 1HIAB 1RTLA 2ESTE 4XDEA 1KLIH 3RXUA 2A5AA 1AVXA 4NIWA 2R3UA 5A09A 3EQ0H 2VWMA 1P2KA 1HAHH 1S85A 4NGAH 1YP9A 5L2YH 3KL6A 2JKHA 4H4FA 1MKWH 1F5RA 1QL7A 3T2NA 5HM9A 1BDAA 1TONA 4BOHA 2F9UA 2FS8A 3A8AA 2VVVA 4CRAA 1MQ6A 1EAUA 2STBE 3LT3A 1HGTH 1LPZB 1HB0B 3A83A 1OOKB 4B1TA 2PTNA 1FY8E 3UOPA 3A86A 1P2MA 1SVPA 2QCYA 1NFXA 4ISIH 5C1XA 5C67A 1DXWA 3LGIA 3RXRA 3S7KB 1SHHB 2V6NA 2QXHA 3EYDA 5EXLA 1PPCE 1Z8JB 2VWNA 1F0RA 1DITH 3T62A 1ESAA 1GMCG 3MU4A 5DP4A 1C2EA 4QT8C 1Z8GA 1ETTH 1IQGA 2TPIZ 2VGCB 1LCYA 2QV1A 2BD7A 1O3HA 5FBEA 3JZ1B
chains in the Genus database with same CATH superfamily
1UVPA 1SGCA 1EAXA 5DP6A 1KDQA 2EQNA 2VINA 1OYTH 2ANKH 1GCDA 5HGGA 4F4OC 1BQYA 2FYRA 1CBWB 1AB9C 1HAIH 4RKOB 1MAXA 3FVFB 1GGDB 1NY22 1P06A 1ZJKA 4AFZA 4CBNA 2W3KA 4X6NA 4IMZA 5DN6D 2ODQA 2BD2A 3F1SB 1SHYA 3KYGA 4XE4A 1GG6C 1HRTH 4K2YA 1C1TA 2OP9A 2HRVA 2D8WA 4GHTA 4IGDA 1CBWC 4FUFA 1UVUH 3S9BA 2BDCA 4WXIA 1A46H 2UUKB 1W0YH 3NK8A 4OS5A 2O9QA 1OSSA 5FCRA 1O2LA 1IQJA 3ZVBA 3SUDA 1XUHA 2FI5E 1FY3A 2OC7A 3S69A 1FN8A 2JH6D 2GV6A 2RG3A 5DGJA 1Q3XA 5PTPA 3NKKA 2HNTE 3T27A 1O3GA 1TA6A 1ZRBA 1TGTA 2A1DB 1ELCA 1DUEA 3PB1E 4I8HA 5DG6A 3LH1A 2VWLA 1Y3YA 2K0QA 4XBDA 1TIOA 1BCUH 4UFFH 1EPTC 3TJVA 5CMXH 1L1JA 5IK2D 2BHGA 2BM2A 1ZHPA 4HZHA 3H7OA 1ELTA 2A5KA 1DY9A 1GMDG 2KCYA 2GCHG 2P3FH 1J8AA 1JIMA 3MH5A 2ILNA 2QY0B 1HCGA 3TH3H 2ZFRH 4DT4A 2TRMA 3EA9A 1W14U 1P9SA 2CF9H 3CENA 1WXRA 5ETXA 2C8WB 1GBTA 3RU4T 5EGMA 3BTTE 4BAQB 4BTTB 1TLDA 4ZKNU 1ARBA 1YPJH 1O3OA 3RXJA 3TJNA 5A0AE 1XVMA 2A4OA 4KELA 3PM3A 2FI3E 4BAKB 4BANB 1FJSA 1MCTA 3RMNH 2BOKA 3PLKA 1O2SA 3RUOA 1KXFA 5GCHG 5F8ZA 4AYYB 5L30H 3MQKC 2BY5X 1GHZA 2J34A 5HIZA 1UMAH 3Q77A 1OP2A 2GZ8A 3V3MA 5B6LA 3BTGE 4NG9H 2CV3A 2BY6X 4UONA 1O3NA 4J1YA 1O2JA 2R2WU 4DCDA 1HAOH 5C2ZA 4K60A 2D2DA 2EA3A 2V3HH 3QTOH 1C4Y2 1O2TA 2VNTA 2BXTH 2FTLE 6ESTA 1VKYA 2F4LA 3GCHB 3OU0A 3QDZB 3UY9A 4MTBA 1N8OC 3H7TA 4VGCB 1KXAA 3BF6H 3OFND 3DCLA 3LGUA 1O3EA 2A2QH 2P8OC 1G2MA 3TGIE 1CSOE 1TPSA 1GBAA 1ZHMA 1O38A 3VGCC 4DJZB 1UW7A 2VIQA 4ZHAA 2OLGA 3PTNA 3RM0H 4UFGH 2AMPA 1GDQA 1P2NA 3TVJB 3MO9A 3U8RH 5EQRA 1UTOA 1HV7A 2FS9A 1J16A 4ABBA 1D6WA 4DGJA 4Y71A 5DP5A 9ESTA 2C3SA 1TBZH 2SGQE 1RTKA 3N7EA 3UWJH 1LHFH 1H8DH 3KNXA 1TBRH 1V2OT 3ZZ5A 2AIQA 1V2RT 3QX5H 1FY4A 1OXGA 2JJ2D 3RC5A 2WINI 1P3CA 2FEQH 1P3EA 7LPRA 3U1JB 1VJAU 3A7TA 3U8OH 3SQHE 1K1OA 1EAWA 3VXFH 2K1QA 4YXWD 5JB8S 1AU8A 3SJ8A 3A82A 2Z94A 4U2WA 3SGBE 2BX4A 2H9TH 2ZCLP 3IWMA 1GI9B 1GJ7B 1O2IA 2OC8A 1E36B 1SGPE 2FYQA 1C1UH 5FXLA 4A1VA 3OY5U 1GBLA 1NC6A 1W0KD 4DIIH 1YPKH 4AG2A 1C5XB 2KCPA 5GIBA 2Z3DA 1Z8IB 1YC0A 4BXWA 1UCYH 5CHBA 1Y5AT 1WSSH 3BEUA 3LJOA 2WPJS 2H6MA 1LDTT 1E1RD 4Q2KA 5KEDA 2GD4B 1D9IA 1TALA 4K3JA 1NRQH 3A8BA 1SGRE 4X2XA 2J98A 3SNCA 4UD9H 1GHBF 1CGHA 2XBYA 3LH3A 2KFWA 1C1RA 3QLPH 2GMTC 1PPHE 1V2KT 2EI6A 3PLPA 2NU1E 2GVFA 4ZH8A 5KGOA 1YPEH 1OWKA 1BRCE 1W0JD 1SMFE 4GCHG 1GJ9B 1BJVA 2VIVA 6GCHG 2QF5A 1ZMJA 1ZSKA 2Y7XA 1KDQB 1QRWA 1YPHC 4AN7A 1GJ8B 1HBTH 5T6GA 2JETC 5C20A 2DE9A 1AZ8A 3VB7A 3ZIAD 4DVAU 2IJOB 1MBQA 2QF3A 1FIZA 1SGDE 4H6SB 1SGEE 4AGKA 3K65B 4O03A 5ESTE 3SYJA 2BYAX 1YPHE 2ZHWH 2ULLA 2ZEBA 2F3CE 1TGSZ 1AI8H 4NSVA 3A88A 5T1VA 1TMBH 3D23A 1PQAA 2A0QB 3MNCA 2WPLS 1ABIH 4JK5A 4BAOB 3KIDU 1TB6H 4E05H 3P17H 1MU6B 2UWLA 1FXYA 2B5TB 1O0DH 4E06H 4FUDA 4NA9H 3FP6E 2BX3A 3M5LA 4X6MA 2ZECA 4CR5A 1IQKA 1LVOA 3SHAH 3P8GA 3AK5A 2FZZA 1GBBA 1O2GH 1FX0B 1O5GH 1XMNB 3S9AA 3URDA 3ZZ3A 1TNHA 1WU1A 5HIYA 4MPXA 4BTUB 1FAKH 1C5WB 2PKAB 4FU7A 4ASUD 2PLXA 1QBVH 1MBMA 1PPZA 1ZGVA 1BRBE 1EASA 1Z6EA 2WYGA 3PMBB 3TLOA 3FOAA 1C5UA 3ZVDA 1SLVB 1GHAG 1O3FA 3TU7H 2P95A 1EOLA 1TNGA 4UE7H 3GYMA 2BLWA 4OM9A 1YCPH 3GY4A 2XCNA 1SOTA 3E90B 1TGBA 4Y11E 1G2LA 1V2LT 2RA3A 5E0GA 3AASA 3RXQA 3PV5A 2Y82A 4MNXA 1ETSH 2ASUB 4MVNA 1LHEH 3TK5A 4B2BA 4TPIZ 2XC5A 4Y0YE 1BTWA 1ELVA 2P93A 1SG8B 2XRCA 3E1XB 3PLBA 4IN1A 3RXAA 4DOQA 4Y0ZE 1H9HE 1GGDC 3PRBA 4FETA 1IQNA 4MNWA 2WYJA 1BBRK 1AMHA 3SV7A 4MQAA 1QA7A 3GDUA 1O3JA 1CGIE 3SUFA 1N8OB 1P57B 1GHWH 2YNBA 1T4VH 2KAIA 1HPGA 1CT4E 1RS0A 3BTKE 5EW1H 1TX8A 3F3BA 1C1MA 3GS9A 5ESBA 1O5FH 2HOBA 3BTWE 3P8OA 1NTPA 1DWDH 2M2AA 3BEIB 2FWWA 1UTLM 1YLCA 2PUQH 1MTVA 1P10A 4FOUC 1SKYE 3TIUA 4D9QA 1O5CB 1SBWA 5SGAE 3EE7A 1CE5A 5C5NA 2VIWA 2IOTA 1FUJA 2W7UA 3K6YA 4D7FA 4ABIA 1GBJA 5EXMA 1QZ8A 1QGFA 1QBNA 3PROA 5DP3A 2C93B 1A3EH 1L1NA 2Y6TA 2Y5FA 2FI4E 2J92A 1GBIA 4H6TA 5EXNA 2GZ9A 3MNBA 1L2EA 2VJ1A 3A85A 2J5UA 1FIWA 2GCTC 1Z7KA 2XBVA 2GX4A 2BY7X 2H5CA 2FOAA 1Z8RA 2C8YB 2ZFQH 3SW2B 2HVXA 5CDFE 1O2WA 4I33A 1GVLA 1P2QA 1P01A 1GHXH 2F91A 2WV9A 3GYLB 5BRRE 5HXFA 5EOKA 2RCEA 4A6LA 5FAHA 3EA7A 3BTQE 4WWYA 3TGKE 1FMGA 1O3DA 1PFXC 2FTMA 3BSQA 3TK9A 3RXKA 1OWJA 2Q6DA 1S81A 4CRCA 3IG6B 5C5OA 2F43B 2GDDA 1MTNC 1KIGH 3OX7U 1O3MA 2I6QA 1BOQA 1MTUA 3IITA 4XD7D 1GHYH 3DD2H 5FX5A 1O3LA 3VB6A 1FY5A 2ZC9H 2ZO3H 4O9VA 3RC4A 2D1JA 3RXFA 5JPMH 4NSYA 1GJCB 1O2RA 4LZ4B 5TCCA 1GDNA 1O2VA 2KCAA 5A8YA 1MQ5A 4BAHB 1GI4A 1ZOMA 1DICA 1D6RA 4ZKSU 3F2FA 3WY8A 3URCA 5T6DA 3RXOA 2BB4A 3A81A 1LTOA 4YTAA 3FKSD 3GISB 4B2AA 3KF2A 2ZFTA 1P8VC 1BT7A 1HXEH 2P94A 3M7UA 3BG8A 3H5CB 1GVZA 2BD8A 3MOCA 3UFAA 1DLKB 1GHBG 2BZ6H 3SZNA 2EI7A 3I77A 1W7XH 4BXSA 4I31A 3NCLA 1WOFA 2ZQ1A 3RDZA 5JDUB 2BZAA 2CN0H 2G55A 1P11E 1GI3A 2ZDAH 1DOJA 2AERH 1HYLA 4AFSA 2PWXA 2C8XB 1QL8A 2LP6A 1IQMA 1GI0A 3HKJB 3MNSA 2R0LA 1TGCA 2PUXB 3UNSA 6GCHF 4X8UH 5JB9S 4FU9A 1GI6A 4ABJA 2C8ZB 2BDIA 3RXHA 1GBFA 3VB5A 3B9FH 1DPOA 2A45B 3LPRA 1GBMA 1V2VT 4O3UA 2Y81A 1UCYE 3FZDA 4XOJA 3RXMA 4DURA 3I78A 1E38B 1S84A 2FDAA 2THFB 4B73A 1FLEE 1QCPA 3UAIC 1YYY1 1FONA 1ZSLA 4XFQA 1TNIA 1O5DH 1W8BH 3DSPA 3BV9B 4P00A 4AGJA 2A4GA 1U6QA 3RP2A 1GI5A 4UFDH 1LVBA 2TBSA 3FN8A 4KKDA 4NA8A 1W2KH 1KTTB 1MZDA 1GL1A 2NWNA 5E2OA 5GNDA 4WMEA 1V2JT 5F53A 2ZDKA 3ZV8A 1Y8TA 1SGFG 1HJAB 3F6UH 3STJA 3W94A 1MCVA 1EP5A 2CJIA 3ZZ7A 4YZUA 5L6NH 2GJGA 1BTYA 1C2LA 1L4ZA 2HPPH 1Y5UT 1ZTKA 1LKBA 1L1GA 2CHAB 1AE8H 3MU8A 2BD3A 4Y10E 3BTHE 1DDJA 2VWOA 4K69A 5GJ4B 3N7OA 3Q00A 3DUXH 1O5BB 4FUHA 2P59A 4IN2A 5EODA 1GL0E 1ZTLA 2AGGX 5K7RA 1K1JA 2JH0D 4ZKRU 1O2KA 1NFWA 1BMNH 2W26A 1TOMH 1ZJDA 2NU2E 3QWCH 1L0ZA 1DWCH 1BMLA 1O36A 1A2CH 1GJ6A 1HFDA 1TWXB 4FXGH 1C2GA 1C4V2 1G36A 2WPIS 3HGNA 1NBME 2JETB 4XRNA 4YT6H 4TWWA 1V2PT 3PYHA 4OS1A 3U1IB 1MTWA 4Q7XA 4RT1A 1UVSH 4JZ1A 1IAUA 4Y7AA 1J9CH 3RM2H 1PQ7A 2DUCA 3LIWA 1JRSA 1OS8A 4R8TB 4FVBA 4INKA 4X8VH 2AH4X 4K1EA 1GVKB 2SGPE 1XUJA 3VG8A 3SU3A 2KAIB 1KXEA 1ZGIA 3A89A 3UUZA 4AZ2B 2AS9A 3A8DA 3MU0A 2TGTA 1C2DA 3RMLH 3L3TA 1KY9A 2ZP0H 1HAVB 2KR7A 4JYUH 4ZAEA 1A0HB 1C5QA 1QHRB 2L74A 1XM1A 1TNJA 3SNDA 1BA8B 3RXTA 4A7IB 3GY7A 2UUFB 2XBWA 1AE5A 1BTXA 4BTIB 1P2JA 1TGNA 4NZLA 1QNJA 3UIRA 1MKWK 4E7NA 2A7JA 1K1LA 1S82A 5C17A 1PPBH 3LONA 2XW9A 1ANCA 3KQ5A 1EJNA 1WYKA 2BVRH 3EDXB 1Q31A 3KQEA 4GLYA 1DSUA 2Y5GA 5DP8A 3LKWA 1C5VA 4JZDH 1V6DA 1JXPA 2G4TA 3M3TA 1TQ0B 2ZU3A 2P16A 1GI8B 2JDID 1TAWA 5G4BA 3V13A 2OCVB 1ELDE 1DXPA 1PYTC 3HKIB 2RA0A 2FO9A 1VITF 1O3BA 2ZHEH 3A7YA 6CHAC 1COWD 3MTYA 1WQSA 1DY8A 5C0TA 5CHAC 4FUBA 1FNIA 1ZYOA 1F92A 2ZPQA 1T7CA 3S9CA 1C5RA 2A4RA 3FFGA 1XXDA 5GXPA 5DO4H 1K0HA 1OWEA 1MH0A 1ZTJA 4JZEH 3LC3A 4UFEH 3T26A 4ISLA 3F9EA 2FOGA 2OD3B 2PW8H 4Q63A 3UNQA 1HLTH 2PR3A 1MKXK 1QIXB 3LDXH 2CXVA 2ZDNA 1QY6A 3U8TH 1GCTC 1PQ5A 1O2OA 3SV2H 8GCHF 2O8TA 1G30B 1IQHA 2O8LA 2R9PA 2FOBA 2SGEE 1TNKA 1DS2E 2HALA 3ATIA 1BIOA 2BQ6B 1OYQA 1WV7H 2UUYA 1EJMA 4MPUA 4YOIA 2ZCKP 1NM6A 1ZRKA 5F8TA 3A7XA 1RRKA 1VR1H 5HM2A 1BJUA 1G37A 1JIRA 1H9IE 2UWPA 2P3TB 4TSFD 1SGTA 2F9PA 3GCTG 4IMQA 4THNH 2AMDA 3ZVAA 5FX6A 1HAYB 3OY6U 5FPSA 1XUFA 1JBUH 1XUGA 2GZ7A 1NO9H 1SB1H 1AHTH 1K9OE 2PKAA 4A1XA 3ZZCA 4HG6A 1SGNE 1DVAH 2GCTB 4AOQA 4F49A 3QK1A 3SGAE 1BB0B 1SC8U 1A4WH 4ZHLU 2EI8A 3LGTA 4ZXXH 2Z9JA 1P09A 3ZVGA 1LQEA 3U98H 7GCHF 4XSKU 3VB4A 2R2MB 1ANDA 2XXLA 1FPCH 1HJ8A 3HK6B 2ZGBH 5HYOA 1V2UT 1SLWB 1PYTD 3QZQA 1AVGH 3F2GA 2GMTB 3RXGA 3FP7E 2JJ1D 1N6XA 3SORA 3O8DA 1C2HA 1TBQH 4MPVA 4CRFA 1V3XA 2PKSB 1Z1IA 2NU3E 4DY7B 4IS5A 2FOMB 1YCPK 1LMWB 1QJ6B 1P9UA 3RXLA 1DX5M 1HAXB 2BLVA 4MNVA 4ABGA 3PV2A 5E2PA 2ANMH 2BDHA 3ZZBA 1VCPA 2H2ZA 3SUEA 3A8CA 5LGOA 1GDUA 1OHHD 2SGFE 1E1QD 1YPMH 2XBXA 5GDSH 1C5NH 1JOUB 1KMHB 3SZEA 3WW7A 4CH8B 1C2KA 3NPSA 2DE8A 1NBMD 1YPGH 1DFPA 2XNIA 3K9XB 2WHXA 3PMHB 1BRUP 3RXIA 5E8EH 3LOXA 4M9FA 3DA9B 4XBCA 2ZTXA 2Z3EA 4D7GA 1H8IH 2WZQA 4YM9A 1UO6A 4INHA 3SUGA 2Y7ZA 1YM0A 4TWYA 1EB1H 2VBCA 3V12A 1BZXE 3OTJE 1UCYK 4GCHF 3UTUH 4PROA 1G3BA 3KCGH 1TABE 1C5TA 1WDIA 5EPNA 5EQQA 1GBHA 3RXPA 4F55A 5FHTA 5C1UA 1AFQC 2G8TA 1AY6H 4NIXA 4CRGA 1SLUB 5TCAA 2K8IA 4ABEA 1IQEA 3RXSA 3F9HA 3ATWA 1AUTC 3GDVA 1GHAF 2STAE 4CRDA 2PFEA 4MDSA 3O8RA 1SOZA 1SL3A 4ZMAH 2RDEA 1C5YB 1KYNA 1FV9A 3BN9A 1WTGH 4ESTE 4AB9A 1AD8H 1H4WA 3ITIA 1M9UA 1AKSB 1ANEA 3KQDA 2CF8H 4U30A 3BIVH 1LHCH 1SQAA 3GY2A 1LPGB 1SQOA 1MD7A 4A92A 1XXFA 5A2MH 2FOHA 3QN7A 3SU2A 1OX1A 2Z7FE 1OP0A 4WH6A 1DANH 3SQEE 2GKVE 1QB6A 1ZMLA 2CK3D 4NA7A 3DFJA 1GI1A 4I8KA 2FESH 1O5AB 1DWBH 1FAXA 3KYFA 1XX9A 1ORFA 1K1IA 2BVSH 3FP8E 3W1EA 3SU4A 1MMJN 1SSXA 3ZZ4A 1P03A 3Q76A 4AC9A 2ZFSA 3GY6A 1AWHB 1IOEA 1NU7B 3KQCA 1ZR0A 1O3PB 3AAUA 4DT7B 1MUEB 1C4U2 2ODPA 2VVUA 1O32A 3E8LA 3EAJA 3TH4H 2J97A 2BTCE 3RLYH 1TRNA 3F2HA 4GHQA 2XTTB 3M37A 4TT3D 1GMCF 1QURH 2XOKD 1TOCB 4AG1A 4BNRA 3TGJE 1QRZA 2L6OA 2XC4A 2LNCA 5A8ZA 1JWTA 1GBKA 2ZF0H 1A0LA 3M5OA 3ODDA 2XWBI 2A7HA 1YKTA 4HFPB 4TPYA 1KSNA 2PKSC 2VB0A 2Y80A 1BHXB 1BBRE 9LPRA 2ANWA 2F9NA 3CS0A 1SLXB 1TRMA 4ISNA 2PSYA 1OKXA 3HATH 4ISHH 1AO5A 2AYWA 4YESB 3N99A 3RXEA 2W6ID 3BG4B 5A0BA 5FCKA 3ZZAA 1DE7H 4HI3A 1D3DB 4TY7A 3SBKA 2FMJA 3OYPA 4FUIA 2ZTZA 3Q3XA 2B7DH 3MHWU 3U69H 2FIRH 4ACBA 3G01A 1BTHH 3MI4A 1ELBA 1THSH 4JZIA 4IBLH 3QGJA 1OPHB 1UTPA 4FUJA 4KTUA 1E37B 4CR9A 5KECA 2W5EA 1O37A 4X1RU 1W10U 3ATKA 5J4QA 1GJBB 1Y3UA 3PWBA 3M35A 3RXCA 1TMUH 3OAAD 2ZNKH 1K28D 2ZG0H 1VZQH 1T4UH 4YT7H 4X2VA 1E79D 4ABAA 2H9EH 3LGVA 1GHVH 3MNXA 1TPPA 4ACAA 3M7QA 2OBQA 1C5ZB 1H9LB 1PJPA 2J95A 2OXSA 5LH8A 4Y79A 1G3EA 1J17T 2F9VA 2PP6A 2VIDA 1YWUA 1GPZA 1B0EA 2GGVB 2KM0A 1ZPZA 1UK3A 3NUMA 4RT0A 4OGYA 4WVPE 1SGQE 1A61H 1WQVH 1GMDF 2ZQ2A 4X8TH 1CGJE 3V7TA 3E16B 3SO3A 2ZU4A 1GWAA 2YNAA 3UPEA 3Q3YA 5F03A 5IYTA 2C90B 4X2WA 5JBCS 1GMHG 3O8CA 2ZWLH 1T32A 1TYNA 1CA8B 1UTNA 2ZZUH 4JYVH 3P6ZB 4X8SH 4YLQH 2O8MA 3RU4E 1K1MA 2LPRA 1EAIA 1YF4A 5H4IB 1NFYA 1VCQA 1K2I1 1VITH 3DHKH 5I25A 1LKAA 2FX4A 2ALPA 5T6FA 3MH7A 2QC2A 1IQIA 5C0UA 1GJ5H 5EIYA 2WSSD 1EJAA 1C1NA 4GPGA 3NZIA 4ASHA 2ZDMA 2AGEX 5GCHF 3T5FH 2OQUA 2BDAA 5CE1A 4K1SA 3VPKA 1HAGE 2QYIA 1QJ1B 3SJOA 1Y3XA 2ODYB 3SN8A 3UREA 2XYAA 1QBOA 1SFQB 1EPTA 2IN2A 4R0IA 1SI5H 3GCHC 4ZKOU 3SJKA 1K22H 3KEEA 1QL9A 3KHVA 1Z6JH 4LK4A 1CT2E 1WBGB 1ZPCA 1YCPM 2VIPA 8KME2 1CHGA 2Z9IA 1C5MD 1ACBE 2O8UA 2BDYA 4Y7BA 2RFKC 2FP7B 3RXBA 4IC6A 2J38A 3QO6A 2BOHB 4IC5A 5DSFA 4Y8ZA 3MYWA 1T8NA 1KTSB 2G81E 7KMEH 1THPB 1ZSJA 2H9HA 2J9NA 2PTCE 1S0RA 2SGAA 1GJAB 1HJAC 5JBBS 4JCNA 2QF0A 4NZQA 1CHOF 2Z9KA 2UWOA 1WTHD 1BTUA 1NT1A 1S83A 2BDBA 2KZ4A 3WWFA 3GY5A 1H8ED 1YLNA 1A0JA 1T8MA 1XUIA 4F48B 3BG4C 1V2TT 5EW2H 2ZU5A 1FZZA 2AEIH 3K6ZA 1RIWC 2QXGA 5DJ7A 1SPJA 1EZSC 1BITA 3UB0A 4CREA 3ZYEA 3BTME 1W3CA 4FUGA 1T31A 4YLUA 5C3NA 4YOGA 1UHBB 1AFEH 5FL7D 1BMAA 1INCA 1VJ9U 2ZKSA 2A4QA 2ZCHP 2BVXH 3SU0A 5ABWA 1EFRD 2ZGHA 2GP9B 1AB9B 1UVTH 2YOLA 4B6EA 1NU9A 2QXIA 3R0FA 3L33A 4Z1MD 1T8LA 5J4SA 1XVOA 4K8YA 4Z0KA 2GT8A 3UWIA 2QA9E 1E34B 3RXDA 1VGCB 3TK6A 5AF9H 1NN6A 3NXPA 1O3CA 4KTCA 1O3KA 4Q7ZA 3ZVCA 2NU4E 2W3IA 5B6OA 3GDSA 3M61U 4WF8A 3S7HB 3F68H 4IW4E 1MU8B 1C1PA 1UJ1A 4HTCH 1D4PB 1ESTA 1O2ZA 3PO1B 5EG4A 1Z1JA 1THRH 4K8BA 1AVWA 1AKSA 4GSOA 1V2NT 4AORA 4FUEA 2HPQH 4K1TA 2TGDA 4A1TA 1C1QA 4RI0A 3U9AH 3L6PA 1WCZA 2D26C 3LU9B 2PGQB 1KXCA 1WUNH 5CHAB 3CS7A 1V2ST 4LXBH 1TMTH 3GCOA 1ANBA 4ABHA 1KLJH 3AVZA 2G4UA 1GBEA 1Z71A 1TPAE 2EC9H 2J98B 3BEFB 2F9OA 4MG3A 4DIHH 1EB2A 3VGCB 1LVYA 3F9GA 3B8JA 1TA2A 1RFNA 2BD4A 3PMJA 4TYDA 3D62A 1ARCA 3M3VA 1UVOA 4OGXA 2XWAA 1PQ8A 4X2YA 1ID5H 1UK2A 3F9FA 1KLTA 1C2JA 3RMMH 1G3CA 3ZZ9A 3BIUH 3ENSB 3PTBA 1A7SA 3ZYDA 3TPIZ 2A31A 3SNEA 1NPMA 5BPEA 3ZV9A 3A7ZA 1HAPH 3SJ9A 2H5DA 5HKKD 1CT0E 3KGPA 3QUMP 5DP9A 4Y8XA 3AAVA 1O2HA 1C2FA 1YPLH 4DG4A 1NS3A 2AIPA 5A8XA 3OSYA 3MO3A 4JK6A 4O97A 2Z9GA 1C9TA 1D3TB 1CA0B 2EY4C 1HJ9A 4LZ1H 4I8GA 3N7DA 1WAYB 2ZTYA 1BTZA 3M5MA 1S0QA 2HVYB 3E3TA 3GICB 3MWIU 1O3AA 3SI4H 1A1RA 1CVWH 4OS4A 4CHAB 1O2YA 4ISOA 2H1UA 4AX9H 2UUJB 5DP7A 3SNAA 2A5IA 2WPMS 3OEED 4OS7A 2ANYA 3SOSA 2HGTH 3E0PB 3A87A 3RU4D 5LPFA 4ABDA 1DT2A 2FX6A 3LGYA 4WY3A 4A5TS 1ZMNA 5AFZH 1O30A 1LHDH 4H42U 2BQ7B 2ZFPH 3HPTB 1ELGA 2OC0A 2HWLB 5DPAA 1PPGE 3OEHD 2BD9A 1O31A 3UQOA 3VB3A 1UHBA 1NRNH 3TJUA 1P05A 3PRDA 3VFEA 4Y6DA 4NIYA 2WPDD 1O34A 1ETRH 3ATMA 7GCHG 2BY8X 4KP0A 4AFQA 1KXBA 3M5NA 2QIQA 1O2QA 1YY3A 1CU1A 4Y8YA 2OINA 3FANA 4KGAA 3C1KA 3LC5A 1EZUC 2SNWA 1NZQH 1O35A 2A2XH 1FY1A 1QB1A 5IDKA 2QN5T 5JYIA 3AW0A 2GV7A 3CP7A 2IPQX 5E0HA 2KCOA 1A5IA 2ZHDA 2R0KA 1AIXH 2XNDD 2IPHA 1XKBC 2HLDD 2WUBA 1EZQA 3TNSA 4WXVA 1C1WH 1GBCA 2M5TA 1HAVA 1OP8A 1QTFA 2NU0E 1F0SA 3TH2H 1L4DA 7ESTE 1O2NA 1LO6A 1HIAA 5LPEA 4I8JA 1EP6A 1MTNB 4B6FA 2BQWB 2FPZA 3SV9A 1QQUA 3A80A 3E0NB 4NFEA 2ZU2A 4OS2A 1C2MA 2QAAA 1F5LA 1HNEE 2B9LA 1G32B 3GCNA 1S6LA 4NFFA 1SGYE 1Y3WA 2Q6FA 2VU8E 4D9RA 1MTSA 1TNLA 4NCYA 3E6PH 3M36A 3RMOH 4ZHMU 4X1NU 1F2SE 1H1BA 1NRSH 2AFQB 2WPHS 1W13U 1A3BH 1IHTH 3A7VA 2BLQA 3P95A 3QZRA 4Q7YA 1XUKA 2ZA5A 1E35B 3D65E 4K5ZA 1C5OH 2WV4A 1QJ7B 4B74A 4X1SU 3JZ2B 3R3GB 4GUXA 1C2IA 1BTPA 1YGCH 3GY8A 3BTEE 1ABJH 1CA0C 5EJ1A 5GWZA 3TITA 4E7RG 2G5NA 1SGIB 2QXJA 3E91A 1G9IE 3RXVA 1O2UA 4GVUA 4MNYA 2AHME 1QRXA 4CH2B 4I32A 1GI2A 3DSGA 3RC6A 2ZHFH 1N6YA 5C94A 1EZXC 1O3IA 3D49H 1BMMH 5AFYH 2G52A 1EX3A 3MU1A 1LQDB 3S0NA 1S5SA 1C5PA 1HXFH 4JZFH 1C9PA 1GJ4H 1C1OA 1GCTB 6CHAB 2YMSC 4X1PU 1ELAA 5EU8A 4Y76A 3A84A 5EPYA 4XBBA 4VGCC 5DK1A 4I8LA 1MAYA 3ZZDA 2ZDLA 1BHXF 1DLEA 1P12E 3KN2A 4CHAC 5K0HA 2FXRA 1XKAC 1C1VH 2PSXA 5HMAA 1RXPA 2OUAA 1Y59T 1D3PB 4O3TA 2AMQA 1JMOH 1TQ7B 3B23B 3MU5A 2VH0A 3QTVH 1C1SA 5GPIB 4AB8A 1ZHRA 1E0FD 2ZFFH 5EJZA 6LPRA 3ZVEA 1EKBB 8ESTE 2PV9B 1UTKA 1QR3E 1J14A 4BAMB 4Z6AH 1N1LA 2BXUH 2V3OH 4SGAE 3T29A 4GAWA 3PMAB 3O8BA 2QGRA 4LOYH 4NWKA 1UTMA 4I86A 1ZLRA 4UEHH 2FOFA 1GBDA 1P04A 3DFLA 3EGKH 5F8XA 5I46H 3CNRA 2GTBA 1H8HD 1DSTA 2VIOA 3ESTA 1GG6B 2V0BA 1GI7B 4NIVA 1SFIA 2FOCA 1B5GH 1FDPA 1AGJA 1RTFB 1TX7A 3KQBA 4MPWA 3GY3A 1O2XA 1EUFA 3DSOA 1W12U 3T28A 3UQVA 4CBOA 1IQFA 2A7CA 4ZCNA 2YMSD 3LJJA 4ABFA 1LHGH 4NWLA 4ZROA 3SNBA 1SQTA 4WJG2 1BRAA 3GOVB 3DT0H 1C5SA 3EE0B 1Y5BT 3PO1C 2Z3CA 8LPRA 3OTPA 2ZHQH 1AFQB 2HNTC 1A5GH 2WPKS 1C5LH 1FN6A 1MD8A 3SU1A 5E0JA 4FU8A 1TX6A 1MABB 1QQ4A 2F9BH 3M3SA 1V2MT 3UOUA 1KXDA 2WUCA 2FLRH 2R3YA 1PPEE 4AYVB 2HNTF 4X6PA 3UNRA 1OWDA 1QA0A 1SR5C 2J94A 4SGBE 2VH6A 2I6SA 3MFJA 1DWEH 1NRRH 4ZUHA 4M7GA 1YBWA 1HAZB 5FPYA 1J15A 1VITG 2PHBA 1O2MA 1TPOA 1VGCC 2SNVA 2ZGXH 5A0CA 5EJLA 1GMHF 2G51A 1IHSH 3MMGA 4X0WU 1O5EH 3P70B 3OE7D 3WWBA 1UTJA 3MH4A 2AGIX 2EEKA 3ZZ6A 2J4IA 2XCFA 1CQQA 3HGPA 1X7AC 5DKMA 3BTDE 4WMDA 5JBAS 2ZDVH 1O2PA 2OC1A 4RSPA 1MZAA 1W0ZU 4Q4LA 1RGQA 1FPHH 3SGQE 1W11U 2VGCC 4D76A 4YO9A 3I29A 2HLCA 2Z9LA 2BY9X 4FVDA 1PPFE 3FO8D 4DW2U 1P0SH 2F83A 4U32A 1BBRH 3AW1A 2W6JD 4WH8A 2TGPZ 1B0FA 1O39A 1OWHA 3SV8A 1A5HA 5L2ZH 2RDLA 4KTSA 1MKXH 3H09A 3HK3B 3P92A 3SU5A 2QE7D 5FBIA 5EQSA 4B76A 3FZZA 2W7SA 1UTQA 2CMYA 2V3MA 3UR9A 5AHGH 4X1QU 1K21H 2Q6GA 3SHCH 1SGFA 1B7XB 2CGAA 3ODFA 3RLWH 1BMFD 1HDTH 1QFKH 1S6FA 3QGNB 3V0XA 1EXFA 4P02A 4RN6A 1F7ZA 3ATLA 3PV4A 1TFXA 2SGDE 3GCTF 4HGCA 2O8WA 1F0UA 5FPTA 4TY6A 1ELFA 3SU6A 3ZZ8A 1ZPBA 1IQLA 3Q3KA 1P02A 4I7YH 1EOJA 1P2IA 2GCHF 1CHOG 2VVCA 2C4FH 1UK4A 2G00A 2ZPRA 1GJDB 1DUAA 4YOJA 3W95A 2ZI2H 3FAOA 3MH6A 1T8OA 2B8OH 4Q80A 1JRTA 3NRLA 2PGBB 1EQ9A 1TE0A 3UR6A 2TGAA 4U01A 4B2CA 4X6OA 1FQ3A 4FUCA 8GCHG 2CHAC 4JMYA 3P8FA 1D3QB 1V2WT 2V35A 1NESE 2BLOA 2ZGJA 1V2QT 2OTVA 4D8NA 1RIWB 3ELAH 2XC0A 3PWCA 2GDEH 4MLFB 1FI8A 1ESBA 2LELA 1O33A 2TIOA 2OBOA 2ZU1A 5TJXA 4B71A 1YLDA 1RJXB 2JH5D 3P8NA 3TJOA 2Q1JA 1DM4B 2BDGA 2IJD1 2KX4A 2FM2A 2ZPSA 3A7WA 3K2UA 3EA8A 5LPRA 1F0TA 2FODA 2GT7A 3VEQB 1AWFH 3BTFE 4B75A 4ZXYH 4J2YB 3C27B 5AVDA 2WV5A 2Y5HA 1OWIA 4WMFA 2ZIQH 2SFAA 4RKJB 2OQ5A 3F0PA 1Q2WA 4AFUA 1AZZA 1NROH 2FLBH 3SV6A 1F5KU 1AUJA 1K1PA 1P2OA 2FOEA 2ALVA 1QB9A 1VCWA 1CO7E 3NWUA 3SJIA 1LVMA 1Y3VA 3M7TA 3T25A 1EATA 1ELEE 5T3HA 2G5VA 4UDWH 4INLA 4OS6A 2Z6BD 1TRYA 3VXEH 5JBTA 1RD3B 2ZGCA 1BUIA 3TNTA 2P3UB 1AQ7A 2B0FA 1EPTB 3STIA 1ZZZA 4CRBA 1HUTH 1NFUA 3LGWA 5F6MA 1LPKB 2BMGB 3ZVFA 2V7QD 3MO6A 2P8OB 2J2UA 1G3DA 5C1YA 2JIZD 1AN1E 1W7GH 3SI3H 1K1NA 2A32A 1NRPH 1S6HA 2BD5A 4JYTA 1HIAB 1RTLA 2ESTE 4XDEA 1KLIH 3F0OA 3U28C 3RXUA 2A5AA 1AVXA 4NIWA 2R3UA 5A09A 3EQ0H 2VWMA 1P2KA 1HAHH 1S85A 4NGAH 1YP9A 2QF4A 5L2YH 3KL6A 2JKHA 4H4FA 1MKWH 1F5RA 1QL7A 1SQRA 3T2NA 5HM9A 1BDAA 1TONA 4BOHA 2F9UA 2FS8A 3A8AA 2VVVA 4CRAA 1MQ6A 1EAUA 2STBE 3LT3A 1HGTH 1LPZB 1HB0B 3A83A 1OOKB 4B1TA 2PTNA 1FY8E 3UOPA 3A86A 1P2MA 1SVPA 2QCYA 1NFXA 4ISIH 5C1XA 5C67A 1DXWA 3LGIA 3RXRA 3S7KB 1SHHB 2V6NA 2QXHA 3EYDA 5EXLA 2YMSB 1PPCE 2OK5A 1Z8JB 2VWNA 1F0RA 1DITH 3T62A 1ESAA 1GMCG 3MU4A 5DP4A 1C2EA 4QT8C 1Z8GA 1ETTH 1IQGA 2TPIZ 2VGCB 1LCYA 2QV1A 2BD7A 1O3HA 5FBEA 3JZ1B
chains in the Genus database with same CATH topology
1UVPA 1SGCA 1EAXA 5DP6A 1KDQA 2VINA 1OYTH 2ANKH 1GCDA 5HGGA 4F4OC 1BQYA 2FYRA 1CBWB 1AB9C 1HAIH 4RKOB 1MAXA 3FVFB 1GGDB 1NY22 1P06A 1ZJKA 4AFZA 4CBNA 2W3KA 4X6NA 4IMZA 2ODQA 2BD2A 3F1SB 1SHYA 4XE4A 1GG6C 1HRTH 4K2YA 1C1TA 2OP9A 2HRVA 2D8WA 4GHTA 4IGDA 1CBWC 4FUFA 1UVUH 3S9BA 2BDCA 4WXIA 1A46H 2UUKB 1W0YH 3NK8A 4OS5A 2O9QA 1OSSA 5FCRA 1O2LA 1IQJA 3ZVBA 3SUDA 1XUHA 2FI5E 1FY3A 2OC7A 3S69A 1FN8A 2JH6D 2GV6A 2RG3A 5DGJA 1Q3XA 5PTPA 3NKKA 2HNTE 3T27A 1O3GA 1TA6A 1ZRBA 1TGTA 2A1DB 1ELCA 1DUEA 3PB1E 4I8HA 5DG6A 3LH1A 2VWLA 1Y3YA 4XBDA 1TIOA 1BCUH 4UFFH 1EPTC 3TJVA 5CMXH 1L1JA 2BHGA 2BM2A 1ZHPA 4HZHA 3H7OA 1ELTA 2A5KA 1DY9A 1GMDG 2GCHG 2P3FH 1J8AA 1JIMA 3MH5A 2ILNA 2QY0B 1HCGA 3TH3H 2ZFRH 2TRMA 3EA9A 1W14U 1P9SA 2CF9H 3CENA 5ETXA 2C8WB 1GBTA 3RU4T 5EGMA 3BTTE 4BAQB 4BTTB 1TLDA 4ZKNU 1ARBA 1YPJH 1O3OA 3RXJA 3TJNA 5A0AE 1XVMA 2A4OA 4KELA 3PM3A 2FI3E 4BAKB 4BANB 1FJSA 1MCTA 3RMNH 2BOKA 3PLKA 1O2SA 3RUOA 1KXFA 5GCHG 5F8ZA 4AYYB 5L30H 2BY5X 1GHZA 2J34A 1UMAH 3Q77A 1OP2A 2GZ8A 3V3MA 3BTGE 4NG9H 2CV3A 2BY6X 4UONA 1O3NA 4J1YA 1O2JA 2R2WU 4DCDA 1HAOH 5C2ZA 4K60A 2D2DA 2EA3A 2V3HH 3QTOH 1C4Y2 1O2TA 2VNTA 2BXTH 2FTLE 6ESTA 3GCHB 3OU0A 3QDZB 3UY9A 4MTBA 1N8OC 3H7TA 4VGCB 1KXAA 3BF6H 3LGUA 1O3EA 2A2QH 2P8OC 1G2MA 3TGIE 1CSOE 1TPSA 1GBAA 1ZHMA 1O38A 3VGCC 4DJZB 2VIQA 4ZHAA 2OLGA 3PTNA 3RM0H 4UFGH 2AMPA 1GDQA 1P2NA 3TVJB 3MO9A 3U8RH 5EQRA 1UTOA 1HV7A 2FS9A 1J16A 4ABBA 1D6WA 4DGJA 4Y71A 5DP5A 9ESTA 2C3SA 1TBZH 2SGQE 1RTKA 3UWJH 1LHFH 1H8DH 3KNXA 1TBRH 1V2OT 3ZZ5A 2AIQA 1V2RT 3QX5H 1FY4A 1OXGA 3RC5A 2WINI 1P3CA 2FEQH 1P3EA 7LPRA 3U1JB 1VJAU 3A7TA 3U8OH 3SQHE 1K1OA 1EAWA 3VXFH 2K1QA 5JB8S 1AU8A 3SJ8A 3A82A 2Z94A 4U2WA 3SGBE 2BX4A 2H9TH 2ZCLP 3IWMA 1GI9B 1GJ7B 1O2IA 2OC8A 1E36B 1SGPE 2FYQA 1C1UH 5FXLA 4A1VA 3OY5U 1GBLA 1NC6A 4DIIH 1YPKH 4AG2A 1C5XB 5GIBA 2Z3DA 1Z8IB 1YC0A 4BXWA 1UCYH 1Y5AT 1WSSH 3BEUA 3LJOA 2WPJS 2H6MA 1LDTT 4Q2KA 2GD4B 1D9IA 1TALA 4K3JA 1NRQH 3A8BA 1SGRE 4X2XA 3SNCA 4UD9H 1GHBF 1CGHA 2XBYA 3LH3A 1C1RA 3QLPH 2GMTC 1PPHE 1V2KT 2EI6A 3PLPA 2NU1E 2GVFA 4ZH8A 1YPEH 1OWKA 1BRCE 1SMFE 4GCHG 1GJ9B 1BJVA 2VIVA 6GCHG 2Y7XA 1ZMJA 1ZSKA 1KDQB 1QRWA 1YPHC 4AN7A 1GJ8B 1HBTH 5T6GA 2JETC 5C20A 2DE9A 1AZ8A 3VB7A 4DVAU 2IJOB 1MBQA 2QF3A 1FIZA 1SGDE 4H6SB 1SGEE 4AGKA 3K65B 4O03A 5ESTE 2BYAX 1YPHE 2ZHWH 2ULLA 2ZEBA 2F3CE 1TGSZ 1AI8H 4NSVA 3A88A 1TMBH 3D23A 1PQAA 2A0QB 3MNCA 2WPLS 1ABIH 4JK5A 4BAOB 3KIDU 1TB6H 4E05H 3P17H 1MU6B 2UWLA 1FXYA 2B5TB 1O0DH 4E06H 4FUDA 4NA9H 3FP6E 2BX3A 3M5LA 4X6MA 2ZECA 4CR5A 1IQKA 1LVOA 3SHAH 3P8GA 2FZZA 1GBBA 1O2GH 1O5GH 1XMNB 3S9AA 3URDA 3ZZ3A 1TNHA 1WU1A 4MPXA 4BTUB 1FAKH 1C5WB 2PKAB 4FU7A 2PLXA 1QBVH 1MBMA 1PPZA 1ZGVA 1BRBE 1EASA 1Z6EA 2WYGA 3PMBB 3TLOA 1C5UA 3ZVDA 1SLVB 1GHAG 1O3FA 3TU7H 2P95A 1EOLA 1TNGA 4UE7H 3GYMA 2BLWA 1YCPH 3GY4A 2XCNA 1SOTA 3E90B 1TGBA 4Y11E 1G2LA 1V2LT 2RA3A 5E0GA 3AASA 3RXQA 2Y82A 4MNXA 1ETSH 2ASUB 4MVNA 1LHEH 3TK5A 4B2BA 4TPIZ 2XC5A 4Y0YE 1BTWA 1ELVA 2P93A 1SG8B 2XRCA 3E1XB 3PLBA 4IN1A 3RXAA 4DOQA 4Y0ZE 1H9HE 1GGDC 1IQNA 4MNWA 2WYJA 1BBRK 1AMHA 3SV7A 4MQAA 1QA7A 3GDUA 1O3JA 1CGIE 3SUFA 1N8OB 1P57B 1GHWH 2YNBA 1T4VH 2KAIA 1HPGA 1CT4E 1RS0A 3BTKE 5EW1H 1TX8A 1C1MA 5ESBA 1O5FH 2HOBA 3BTWE 3P8OA 1NTPA 1DWDH 3BEIB 2FWWA 1UTLM 1YLCA 2PUQH 1MTVA 1P10A 3TIUA 4D9QA 1O5CB 1SBWA 5SGAE 1CE5A 5C5NA 2VIWA 2IOTA 1FUJA 2W7UA 3K6YA 4D7FA 4ABIA 1GBJA 5EXMA 1QGFA 1QBNA 3PROA 5DP3A 2C93B 1A3EH 1L1NA 2Y6TA 2Y5FA 2FI4E 2J92A 1GBIA 4H6TA 5EXNA 2GZ9A 3MNBA 1L2EA 2VJ1A 3A85A 1FIWA 2GCTC 1Z7KA 2XBVA 2GX4A 2BY7X 2H5CA 2FOAA 1Z8RA 2C8YB 2ZFQH 3SW2B 2HVXA 1O2WA 4I33A 1GVLA 1P2QA 1P01A 1GHXH 2F91A 3GYLB 5BRRE 5HXFA 5EOKA 2RCEA 4A6LA 5FAHA 3EA7A 3BTQE 4WWYA 3TGKE 1FMGA 1O3DA 1PFXC 2FTMA 3BSQA 3TK9A 3RXKA 1OWJA 2Q6DA 1S81A 4CRCA 3IG6B 5C5OA 2GDDA 1MTNC 1KIGH 3OX7U 1O3MA 2I6QA 1BOQA 1MTUA 3IITA 1GHYH 3DD2H 5FX5A 1O3LA 3VB6A 1FY5A 2ZC9H 2ZO3H 4O9VA 3RC4A 2D1JA 3RXFA 5JPMH 4NSYA 1GJCB 1O2RA 4LZ4B 5TCCA 1GDNA 1O2VA 5A8YA 1MQ5A 4BAHB 1GI4A 1ZOMA 1DICA 1D6RA 4ZKSU 3WY8A 3URCA 5T6DA 3RXOA 2BB4A 3A81A 1LTOA 4YTAA 3GISB 4B2AA 3KF2A 2ZFTA 1P8VC 1BT7A 1HXEH 2P94A 3M7UA 3BG8A 3H5CB 1GVZA 2BD8A 3MOCA 3UFAA 1DLKB 1GHBG 2BZ6H 3SZNA 2EI7A 3I77A 1W7XH 4BXSA 4I31A 3NCLA 1WOFA 2ZQ1A 3RDZA 5JDUB 2BZAA 2CN0H 2G55A 1P11E 1GI3A 2ZDAH 1DOJA 2AERH 1HYLA 4AFSA 2PWXA 2C8XB 1QL8A 3HKJB 1IQMA 1GI0A 3MNSA 2R0LA 1TGCA 2PUXB 3UNSA 6GCHF 4X8UH 5JB9S 4FU9A 1GI6A 4ABJA 2C8ZB 2BDIA 3RXHA 1GBFA 3VB5A 3B9FH 1DPOA 2A45B 3LPRA 1GBMA 1V2VT 4O3UA 2Y81A 1UCYE 3FZDA 4XOJA 3RXMA 4DURA 3I78A 1E38B 1S84A 2FDAA 2THFB 4B73A 1FLEE 1QCPA 1YYY1 1FONA 1ZSLA 4XFQA 1TNIA 1O5DH 1W8BH 3BV9B 4AGJA 2A4GA 1U6QA 3RP2A 1GI5A 4UFDH 1LVBA 2TBSA 4KKDA 4NA8A 1W2KH 1KTTB 1MZDA 1GL1A 2NWNA 5E2OA 4WMEA 1V2JT 2ZDKA 3ZV8A 1Y8TA 1SGFG 1HJAB 3F6UH 3STJA 3W94A 1MCVA 1EP5A 2CJIA 3ZZ7A 4YZUA 5L6NH 1BTYA 1C2LA 1L4ZA 2HPPH 1Y5UT 1ZTKA 1LKBA 1L1GA 2CHAB 1AE8H 3MU8A 2BD3A 4Y10E 3BTHE 1DDJA 2VWOA 4K69A 5GJ4B 3N7OA 3Q00A 3DUXH 1O5BB 4FUHA 2P59A 4IN2A 5EODA 1GL0E 1ZTLA 2AGGX 5K7RA 1K1JA 2JH0D 4ZKRU 1O2KA 1NFWA 1BMNH 2W26A 1TOMH 1ZJDA 2NU2E 3QWCH 1L0ZA 1DWCH 1BMLA 1O36A 1A2CH 1GJ6A 1HFDA 1TWXB 4FXGH 1C2GA 1C4V2 1G36A 2WPIS 3HGNA 2JETB 4YT6H 4TWWA 1V2PT 3PYHA 4OS1A 3U1IB 1MTWA 4Q7XA 1UVSH 4JZ1A 1IAUA 4Y7AA 1J9CH 3RM2H 1PQ7A 2DUCA 3LIWA 1JRSA 1OS8A 4R8TB 4FVBA 4INKA 4X8VH 2AH4X 4K1EA 1GVKB 2SGPE 1XUJA 3SU3A 2KAIB 1KXEA 1ZGIA 3A89A 3UUZA 4AZ2B 2AS9A 3A8DA 3MU0A 2TGTA 1C2DA 3RMLH 3L3TA 1KY9A 2ZP0H 1HAVB 4ZAEA 4JYUH 1A0HB 1C5QA 1QHRB 1XM1A 1TNJA 3SNDA 1BA8B 3RXTA 4A7IB 3GY7A 2UUFB 2XBWA 1AE5A 1BTXA 4BTIB 1P2JA 1TGNA 4NZLA 1QNJA 3UIRA 1MKWK 4E7NA 2A7JA 1K1LA 1S82A 1PPBH 3LONA 2XW9A 1ANCA 1EJNA 1WYKA 2BVRH 3EDXB 1Q31A 3KQEA 4GLYA 1DSUA 2Y5GA 5DP8A 3LKWA 1C5VA 4JZDH 1V6DA 1JXPA 2G4TA 3M3TA 1TQ0B 2ZU3A 2P16A 1GI8B 5G4BA 1TAWA 3V13A 2OCVB 1ELDE 1DXPA 1PYTC 3HKIB 2RA0A 2FO9A 1VITF 1O3BA 2ZHEH 3A7YA 6CHAC 3MTYA 1WQSA 1DY8A 5CHAC 4FUBA 1FNIA 1ZYOA 1F92A 2ZPQA 1T7CA 3S9CA 1C5RA 2A4RA 3FFGA 1XXDA 5GXPA 5DO4H 1OWEA 1MH0A 1ZTJA 4JZEH 3LC3A 4UFEH 3T26A 4ISLA 3F9EA 2FOGA 2OD3B 2PW8H 3UNQA 1HLTH 1MKXK 1QIXB 2PR3A 3LDXH 2CXVA 2ZDNA 1QY6A 3U8TH 1GCTC 1PQ5A 1O2OA 3SV2H 8GCHF 2O8TA 1G30B 1IQHA 2O8LA 2R9PA 2FOBA 2SGEE 1TNKA 1DS2E 2HALA 3ATIA 1BIOA 2BQ6B 1OYQA 1WV7H 2UUYA 1EJMA 4MPUA 4YOIA 2ZCKP 1NM6A 1ZRKA 5F8TA 3A7XA 1RRKA 1VR1H 5HM2A 1BJUA 1G37A 1JIRA 1H9IE 2UWPA 2P3TB 1SGTA 2F9PA 3GCTG 4IMQA 4THNH 2AMDA 3ZVAA 5FX6A 1HAYB 3OY6U 5FPSA 1XUFA 1JBUH 1XUGA 2GZ7A 1NO9H 1SB1H 1AHTH 1K9OE 2PKAA 4A1XA 3ZZCA 1SGNE 1DVAH 2GCTB 4AOQA 4F49A 3QK1A 3SGAE 1BB0B 1SC8U 1A4WH 4ZHLU 2EI8A 3LGTA 4ZXXH 2Z9JA 1P09A 3ZVGA 1LQEA 3U98H 7GCHF 4XSKU 3VB4A 2R2MB 2XXLA 1ANDA 1FPCH 1HJ8A 3HK6B 2ZGBH 5HYOA 1V2UT 1SLWB 1PYTD 3QZQA 1AVGH 2GMTB 3RXGA 3FP7E 3SORA 1N6XA 3O8DA 1C2HA 1TBQH 4MPVA 4CRFA 1V3XA 2PKSB 1Z1IA 2NU3E 4DY7B 4IS5A 2FOMB 1YCPK 1LMWB 1QJ6B 1P9UA 3RXLA 1DX5M 1HAXB 2BLVA 4MNVA 4ABGA 5E2PA 2ANMH 2BDHA 3ZZBA 1VCPA 2H2ZA 3SUEA 3A8CA 5LGOA 1GDUA 2SGFE 1YPMH 2XBXA 5GDSH 1C5NH 1JOUB 4CH8B 1C2KA 3NPSA 2DE8A 1YPGH 1DFPA 2XNIA 3K9XB 3PMHB 1BRUP 3RXIA 5E8EH 3LOXA 4XBCA 3DA9B 2ZTXA 2Z3EA 4D7GA 1H8IH 4YM9A 1UO6A 4INHA 3SUGA 2Y7ZA 1YM0A 4TWYA 1EB1H 3V12A 1BZXE 3OTJE 1UCYK 4GCHF 3UTUH 4PROA 1G3BA 3KCGH 1TABE 1C5TA 5EPNA 5EQQA 1GBHA 3RXPA 5FHTA 5C1UA 1AFQC 2G8TA 1AY6H 4NIXA 4CRGA 1SLUB 5TCAA 4ABEA 1IQEA 3RXSA 3F9HA 3ATWA 1AUTC 3GDVA 1GHAF 2STAE 4CRDA 2PFEA 4MDSA 3O8RA 1SOZA 1SL3A 4ZMAH 1C5YB 1KYNA 1FV9A 3BN9A 1WTGH 4ESTE 4AB9A 1AD8H 1H4WA 3ITIA 1M9UA 1AKSB 1ANEA 3KQDA 2CF8H 4U30A 3BIVH 1LHCH 1SQAA 3GY2A 1LPGB 1SQOA 1MD7A 4A92A 1XXFA 5A2MH 2FOHA 3QN7A 3SU2A 1OX1A 2Z7FE 1OP0A 4WH6A 1DANH 3SQEE 2GKVE 1QB6A 1ZMLA 4NA7A 3DFJA 1GI1A 4I8KA 2FESH 1O5AB 1DWBH 1FAXA 1XX9A 1ORFA 1K1IA 2BVSH 3FP8E 3SU4A 1MMJN 1SSXA 3ZZ4A 1P03A 3Q76A 2ZFSA 3GY6A 1AWHB 1IOEA 1NU7B 3KQCA 1ZR0A 1O3PB 3AAUA 4DT7B 1MUEB 1C4U2 2ODPA 2VVUA 1O32<