4FUFA

Crystal structure of the urokinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fufA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fufA01
1A2CH 3U1IB 3ZVAA 1GJ7B 1ELEE 1V2JT 1QA7A 5LH8A 1DY8A 2J2UA 2ZI2H 1V2UT 1TPOA 1YPMH 3AAVA 5GPIB 1TRYA 2OD3B 4WMDA 1O2JA 4A1XA 1DVAH 2WV5A 2UWPA 1SGYE 4K2YA 1O2VA 2Y82A 1SGRE 2K1QA 1HPGA 4AN7A 4LXBH 1DS2E 1C1OA 1MH0A 1NROH 2GKVE 1W12U 1OWHA 2SGEE 3MNBA 4BTIB 2B8OH 1C4V2 2ZGJA 5HXFA 1WBGB 3BF6H 3UNQA 1V2OT 1ZYOA 2C8YB 1T8OA 2GZ9A 8GCHG 1BHXF 1UVOA 2ULLA 2STBE 3U1JB 1JRSA 3Q3KA 1CO7E 3GY2A 5AHGH 1O2PA 2BLOA 5DP8A 3TU7H 1LVYA 1O30A 3FAOA 1BBRE 1A61H 4RKJB 2THFB 7KMEH 2FOHA 1MD8A 1K1PA 1O3BA 4K8BA 1D4PB 3KQCA 1HBTH 2ZNKH 2GVFA 3E16B 3ZZ6A 3ATIA 2ESTE 2GDDA 1AB9B 1VGCC 3FFGA 4K3JA 4WXVA 1L4DA 1ZHPA 3S9BA 3S7KB 2ZQ2A 1DSUA 1O3DA 1ZGIA 1TABE 2J4IA 1DFPA 2GT7A 3TJOA 2ZHQH 2BMGB 3A8CA 1J16A 2TBSA 1NESE 1BRAA 1NY22 1O35A 3KIDU 4Y71A 1TPAE 2EI6A 3RMOH 1O36A 1FZZA 3NUMA 1Z8JB 2AFQB 1CHGA 4AG2A 1SI5H 2DUCA 1SR5C 1YCPK 2ZGBH 1SLUB 1GI2A 4RKOB 3RXOA 3UWJH 4U32A 1O3AA 3MO9A 1GBDA 2QXJA 5TCCA 3SV6A 1HUTH 2OCVB 1F0RA 1KIGH 2BHGA 3M7QA 1IQGA 1RTFB 1BTZA 7LPRA 3TLOA 1A4WH 1W11U 2Z9IA 2OC8A 3ATLA 1ZR0A 2SGPE 1W13U 3A7ZA 1SQAA 3ATWA 1VITG 1WUNH 3RUOA 1AWFH 1DPOA 3O8RA 1C5XB 4BTTB 5A2MH 4F49A 4OS7A 1LHCH 1V2LT 2HALA 4AB9A 5G4BA 2D26C 5C20A 4DOQA 1YC0A 1UTOA 2IN2A 1MMJN 2VWOA 3GCOA 1QIXB 1KSNA 3RC5A 1IHTH 1OPHB 4NZQA 1QBNA 4CRBA 2WPIS 3CENA 1LQDB 3D65E 4X1SU 1GMHF 2ANKH 2PGQB 2ZU5A 1VGCB 1KLTA 4AORA 3RXGA 1YYY1 1WCZA 5IYTA 3WY8A 1O2KA 1ELCA 3MTYA 2RA3A 4NSVA 2A5AA 1INCA 2C93B 4THNH 4UFGH 2A45B 4GUXA 3ZZ4A 4IMQA 4SGAE 2GP9B 3ZZAA 4BAMB 1LQEA 3NPSA 1TA2A 1NC6A 3RXSA 5BPEA 5EOKA 4U01A 1C9PA 2O8MA 4I32A 2H9HA 4CR5A 2C8ZB 1GHVH 3DUXH 2PKAA 2H9TH 2H9EH 1LHGH 2VVVA 3PROA 5EU8A 1C4Y2 1GGDC 3MNCA 1W0YH 2BVXH 2GV6A 2PUQH 2R2MB 2FM2A 1A0HB 2GCTC 2C3SA 5E0GA 3H7OA 5K7RA 1IQNA 1GG6C 4ABHA 2QCYA 1P2NA 5DP9A 2ZFQH 1FPHH 4Q80A 1YLDA 2G5NA 2Y80A 1UTNA 2QYIA 4MG3A 3A84A 2ZU4A 1LO6A 1AUJA 1E34B 1HGTH 3PO1C 2OTVA 4UONA 1YPKH 1BOQA 4K8YA 1TBQH 1TX6A 4X8VH 5DP5A 4OGYA 1C1VH 1Z6EA 3ZZ7A 2CF9H 1NPMA 2AERH 4TPIZ 4NA8A 1N6XA 1Q31A 1B0FA 1LVBA 3M3VA 2BX3A 1TX7A 4ZROA 1GVKB 2VGCC 1O38A 2ZU1A 2HGTH 1FXYA 1AQ7A 4ISIH 2ZO3H 1P3EA 1ZTLA 2TRMA 1UVUH 1TWXB 3EA8A 4JMYA 1CHOF 3V3MA 1ZGVA 5J4SA 4FUBA 1DT2A 1OP8A 4GSOA 3IWMA 1G36A 1UK4A 2PUXB 2VIPA 5FBIA 1RTKA 1HAIH 5FPYA 5EXMA 1WAYB 5A8ZA 1YPEH 2ZGHA 2G5VA 3SJIA 2NU4E 2BDIA 3EAJA 3SU5A 2BY7X 4JK5A 5AVDA 1ZMLA 1JIMA 1C1MA 1GGDB 4BANB 1DSTA 2Z9LA 4BNRA 1ZPZA 3ZZ5A 2NU1E 4E7RG 2G52A 2QIQA 2BLVA 3UNRA 2GCTB 1GJ8B 1JXPA 1MBQA 3SO3A 1GG6B 5K0HA 3KQDA 2HPPH 2ZTYA 1XUFA 2PLXA 2G81E 3SN8A 1QTFA 1BB0B 2H1UA 4I8HA 1Y5UT 1EZXC 3QO6A 3QK1A 3QUMP 1SLVB 4K1TA 3LDXH 4ZKRU 1Y3YA 1ELAA 1AHTH 1D3TB 2ODQA 2O8WA 1DXWA 1FAKH 3BTQE 4GHQA 2CXVA 1PQAA 2FS9A 1BMMH 4B73A 1SGFG 2AIQA 3TGJE 2NU2E 2A32A 1TRNA 2VH0A 4Y7AA 4ABJA 1GI8B 5SGAE 1Q3XA 3SU6A 1HXEH 1GJ9B 1FY5A 1T4VH 2A7HA 3P8GA 4X1NU 3SV2H 1NTPA 3RXBA 2Q6FA 3M5MA 1QBOA 1ZOMA 1PPGE 1S82A 3SORA 1ELVA 2ALPA 4J2YB 4A5TS 2EI8A 1XX9A 4ZHAA 1TYNA 3DFLA 2FPZA 1OSSA 1H9IE 1MQ5A 2CMYA 3EE0B 4ABAA 3NXPA 1F5RA 1BCUH 4XBBA 4OS5A 2BD5A 1IQMA 1WYKA 1XUHA 1B0EA 3MH6A 4MLFB 2EA3A 5A09A 3RDZA 2C90B 4I8GA 4AYVB 1XUJA 2VIQA 3LOXA 1TAWA 2CGAA 1RIWC 1CGIE 4A7IB 1C2HA 3KEEA 3SI3H 1MU8B 1C2JA 1ESTA 2FYRA 4FUEA 2J38A 5C5OA 1O2RA 1CSOE 3U69H 1QL9A 5E0JA 4B74A 1FUJA 1FIZA 2G51A 5EW2H 4YZUA 1FN8A 4MNXA 1EAWA 2BZAA 3MU5A 1UK3A 5CHAC 3RXFA 2Y5FA 4FUGA 3LGVA 4DVAU 1S81A 1O3KA 5DKMA 1PQ7A 5I46H 1IQHA 1YM0A 4Q7XA 2HOBA 1DE7H 4JZDH 2FIRH 5JYIA 2UUKB 1ZPCA 2ZTXA 1CA0C 3QGNB 1SOZA 2CV3A 2GZ8A 1MZAA 3FP8E 3LKWA 2FWWA 1QQ4A 1ANCA 1FMGA 8KME2 1CVWH 1C5LH 1K9OE 2XC0A 3TJVA 3ZYDA 4LZ1H 2H2ZA 2PKSC 1YLCA 2BDGA 1F5KU 1BRCE 3PWCA 4B76A 3BTEE 4JZEH 1TOMH 1D6RA 3TJUA 1WV7H 1K2I1 1TGSZ 3W94A 1QB6A 2ZPRA 1DX5M 1YPHC 3A80A 1F7ZA 2V0BA 1O3GA 2ZQ1A 1A0LA 1AKSB 6LPRA 3TK5A 2QV1A 3V13A 3LH3A 2BQWB 5FBEA 1O3LA 1QRZA 1E38B 1RJXB 2VIWA 3GCHC 1AGJA 1NFYA 3R0FA 1XVOA 1HNEE 2GMTC 3SU4A 1EOJA 4FU7A 5C1XA 1SGQE 2SGDE 1P2MA 1O3NA 1SB1H 1C5WB 1MTNC 3Q77A 1DICA 1RIWB 2WPMS 3GDSA 3DA9B 1EXFA 1LHFH 2QC2A 1UTKA 1GHYH 3BTFE 4GLYA 1KXAA 3MOCA 1PPZA 3GY7A 3P95A 5FX6A 1ARCA 5DPAA 1P04A 5JBAS 5EGMA 3M61U 5DGJA 1O31A 1EJMA 2WPKS 3MFJA 1SHHB 3EGKH 5CHAB 1EX3A 1NO9H 4NWKA 3A7TA 3RXDA 3BTDE 1B5GH 3TGIE 1SOTA 3E8LA 3AW1A 1C1SA 2V35A 4GAWA 1O3JA 3RXIA 3BG8A 2H5CA 4OGXA 1A3EH 1AKSA 2BTCE 1WTGH 1ETSH 4OS4A 8GCHF 1QBVH 1CA0B 4OS2A 3RXJA 3H7TA 1DLKB 4UD9H 1GBJA 1JOUB 2YNBA 1EAIA 1EQ9A 2DE8A 1L2EA 4HI3A 4I7YH 3RU4D 1Y59T 3SU1A 4LZ4B 4IC6A 2PKSB 1TGCA 2XCNA 1GHAG 2WYJA 1O3EA 1ZJDA 1MAXA 3KQEA 4FUJA 2PHBA 1PFXC 4KP0A 2GCHG 7ESTE 1L1JA 1GBLA 3LH1A 5TJXA 5ETXA 1KXBA 3BEFB 4MPVA 3UR9A 2V3OH 3GISB 1IQIA 4K1SA 1V2MT 4I8LA 4KKDA 2FLRH 2BY6X 1BJVA 4MNVA 1SMFE 1W7XH 3RXQA 1O5DH 1FJSA 1C2LA 4YT7H 2GMTB 7GCHG 1BT7A 2ZGXH 4YM9A 1F2SE 2ZDKA 2G8TA 3P70B 1TQ7B 1MTNB 1QA0A 4JK6A 3RXRA 1QRWA 4Y8YA 2OC0A 1CT0E 1SGDE 2FP7B 4X2XA 1BMLA 1EPTB 5JDUB 2BB4A 1EASA 4NSYA 2SNWA 1SGNE 3UREA 1HAYB 2ZDMA 1ACBE 4ZAEA 2FS8A 5GDSH 4TYDA 4A92A 2VJ1A 2QXIA 2EI7A 1LMWB 1IQFA 1W0ZU 3GCTG 2WPJS 4J1YA 3O8BA 4JYVH 4YTAA 1V2KT 2VVUA 1HAVA 3KN2A 2C4FH 4DIHH 3T25A 1Y3XA 4GCHF 2UUYA 3W95A 1ANEA 1VITF 1GWAA 2I6SA 3S0NA 1WQVH 2ZHWH 1C5OH 1AUTC 4DG4A 1O3OA 5LGOA 3UOPA 5JB9S 2I6QA 1UTJA 2FOBA 1K1MA 5IDKA 1PPCE 4NA7A 3KQBA 2HNTE 3Q3XA 3RXKA 2AIPA 2PW8H 4RSPA 1VJ9U 1C1NA 2Z3CA 4BAHB 4O3TA 3BTTE 1E36B 3NK8A 3VFEA 3VB4A 1P9SA 2BD8A 1Z1IA 4NIXA 1NRQH 3P8NA 1J17T 1S5SA 3MO3A 1TGNA 5EXLA 2YOLA 1BMAA 5A0BA 5DP7A 3SI4H 4ISNA 4HFPB 1YF4A 1MKXH 5PTPA 3NKKA 3KGPA 8ESTE 1TMBH 1JMOH 2ZCHP 1THPB 4FUIA 1TMTH 1P10A 4K5ZA 1K1OA 3AW0A 2WPLS 2P16A 1P0SH 3BSQA 1P57B 3KCGH 3OTJE 1MZDA 3GY8A 1AO5A 1FAXA 1YGCH 1HIAB 1A46H 1H4WA 2FYQA 4BXWA 1AZ8A 1SSXA 4DCDA 4D9RA 1O2IA 3L33A 5A8YA 1P11E 2ZPSA 3FVFB 4Y0YE 4CREA 2HRVA 2A2QH 5EXNA 1GHBG 3MO6A 2Y7ZA 4Y6DA 2CN0H 1MCTA 2XBYA 3T5FH 1OWKA 5T6FA 1DWBH 2GX4A 3SBKA 1TGTA 1SLXB 1G32B 4CH2B 2AYWA 3LPRA 4X8SH 1E0FD 2BY9X 3E6PH 1GBKA 5C1UA 3SNCA 1WOFA 4I8JA 2IJOB 1GI4A 1E35B 4WMEA 1BDAA 1GDUA 1O34A 2F9VA 4WH6A 3Q3YA 2J9NA 1UTPA 2ANWA 1SBWA 1HIAA 1TNJA 1K22H 5JBBS 4I31A 1P02A 2BD7A 4WMFA 4PROA 3S9AA 4RN6A 3OY6U 1YP9A 1SL3A 3HK3B 3SV9A 4CRAA 4X0WU 1UMAH 1P06A 1NFWA 1TMUH 4BAOB 4Y79A 3TJNA 2ZHDA 3BTKE 4GVUA 2V6NA 2ZWLH 3ZV8A 3SUFA 2VNTA 4BAQB 1Y5BT 1GDQA 3D62A 1W7GH 1C5QA 1TLDA 1IAUA 5C2ZA 3RXUA 1BA8B 1HAHH 1O32A 4IGDA 2ZHEH 1DWEH 1G3EA 2A2XH 1SQTA 2PV9B 2ZCLP 1SVPA 5E0HA 2ZECA 3PMHB 3GICB 1GL1A 4AFZA 1A5IA 1NFXA 1AIXH 2VU8E 1PYTC 2Y5GA 2VH6A 1G37A 1NS3A 2EEKA 3OY5U 4CRCA 1UCYK 3M37A 2M5TA 3LIWA 3LGIA 1EB1H 2OINA 1C5PA 1HAGE 3QWCH 4NGAH 1HYLA 4D7FA 1EKBB 3JZ1B 1MBMA 3CS0A 3LT3A 1GL0E 1GJ5H 1GI9B 3VB5A 3PMBB 4A1TA 1ZZZA 3ODDA 1C1WH 1C2DA 6CHAC 1TOCB 2ZU2A 4GPGA 4ABIA 4UDWH 5GWZA 4KGAA 3UOUA 1S85A 1GMDG 4JCNA 2JH5D 1Z6JH 4VGCC 3TK9A 2Q6DA 5HM2A 1CU1A 2HWLB 3F9FA 1N1LA 4X1QU 4NA9H 1AVGH 1KTSB 3M5NA 1O0DH 2ZDVH 3PTNA 3LJOA 3N7OA 4JYUH 3SJ9A 1MKWK 5GCHF 1X7AC 3MWIU 3K6ZA 4X1RU 1RS0A 3A8DA 1H1BA 1G3BA 1P2KA 3EA7A 1E37B 1S84A 3QZRA 2BLQA 4DY7B 1S0QA 3MH7A 4Y11E 4UEHH 1FN6A 2PR3A 5EG4A 3RLWH 3FP6E 1C2IA 1GBTA 1VR1H 1GMCF 4O03A 1JRTA 5A8XA 1GHZA 1K1JA 2W3KA 1O5BB 1Q2WA 2TIOA 4TWWA 1H9HE 1IQJA 3B8JA 3SGQE 3U9AH 4B1TA 5GXPA 1PPHE 2VINA 3C1KA 2Z94A 2SGQE 1C5MD 1MTVA 2OC1A 4XSKU 3MYWA 1HAXB 5C67A 3SUGA 4I8KA 1KY9A 2OQUA 2BM2A 1UHBB 2FODA 2ZHFH 1EJAA 1KDQB 4FU8A 3SU0A 1EATA 1AU8A 4WF8A 3ZZDA 5DK1A 2Z9JA 2PSXA 3ZV9A 3T2NA 4X6PA 1Y8TA 3BIUH 4UFEH 3MI4A 3ELAH 4MNWA 4BOHA 1ANDA 3CP7A 4AGJA 1G9IE 1TB6H 1GCTC 3P92A 2BLWA 1Z8IB 3RP2A 3ZZ8A 4H4FA 4X8UH 4M7GA 6CHAB 1C9TA 2BD4A 4DURA 1TRMA 3V0XA 3BTHE 4FXGH 1P03A 2FI4E 5EQSA 1EB2A 5L2YH 1SPJA 3D23A 4VGCB 1DDJA 1MTWA 1O39A 3BV9B 2J92A 1L0ZA 1D6WA 3FANA 1FY8E 2ZU3A 3A85A 2QGRA 3RM2H 2SFAA 2XRCA 3RXAA 4XFQA 2BXUH 1YCPH 4Q2KA 1KXEA 2BY8X 1TX8A 1WU1A 3SU2A 3E0PB 3MH5A 4IW4E 1O2NA 1T8NA 2ZDNA 1P2OA 1THRH 2FOMB 1OXGA 3HKJB 1V2QT 2FX6A 1KXCA 1LHDH 2PSYA 3OU0A 2GD4B 1TNGA 2NWNA 2XYAA 1KLIH 1QR3E 1P9UA 3VXFH 4ZKSU 3M7UA 4MNYA 3S7HB 1XKBC 3FP7E 2BYAX 5FX5A 3HK6B 4YOJA 1MU6B 3TIUA 3IG6B 4DT7B 3MH4A 4IN1A 4K1EA 2A5IA 3KHVA 1AY6H 2G4UA 3LGTA 5I25A 1TIOA 1GHWH 1IQLA 3ZVFA 2GV7A 3A87A 2B9LA 1J9CH 3MU4A 2R0KA 1QFKH 3GYMA 5C3NA 2A4RA 3TITA 2P93A 1BBRK 1EZQA 3TNTA 1CE5A 2TPIZ 4NG9H 3TPIZ 3GDUA 2Z9KA 1O3HA 3RC4A 1FIWA 1TPSA 2BQ6B 1F0UA 1HAZB 2XTTB 3I29A 2VVCA 3ATKA 1AE5A 2D8WA 3HGNA 1CGHA 1GI3A 3A81A 3M7TA 4WJG2 1CT2E 5FXLA 4NWLA 1GCTB 1FQ3A 1HCGA 5EPNA 2BVRH 5EODA 2XNIA 4K60A 2PTCE 1NT1A 3F9EA 1C5SA 2QXGA 3GY5A 5F03A 1QRXA 1FONA 4ISLA 4JZFH 1O5AB 1F0SA 2O9QA 2FX4A 1OKXA 2FESH 3ZZ9A 4U30A 1N8OC 4CHAC 3SU3A 4E05H 4AB8A 2GCHF 2ZFFH 3GY6A 2JH0D 4ISOA 1VJAU 2A0QB 1GI6A 1D9IA 1S6HA 1BIOA 4INHA 1DWCH 1OWJA 2B5TB 4WH8A 3L6PA 1PYTD 3SQHE 3PMAB 5DO4H 5FPTA 7GCHF 4CR9A 4FUHA 4ZUHA 1THSH 2A4QA 3S9CA 2FLBH 5EQRA 4AZ2B 1HAPH 2BDAA 4TY6A 2ANMH 1VCWA 1IHSH 3FZZA 5EW1H 2P94A 1ZTJA 4INLA 4O9VA 4UFFH 1W8BH 3V12A 1GJBB 4JYTA 3VB6A 6GCHF 1V3XA 1V2RT 1ZPBA 5FCKA 1QGFA 1FV9A 4I33A 3SV8A 2ZGCA 1HFDA 1O5GH 2FOAA 3E0NB 5A0AE 1GVLA 1A5GH 1K1LA 2WYGA 4QT8C 3S69A 1UVTH 1Y3UA 3RU4E 1EAUA 2OXSA 2R0LA 2SGAA 1XMNB 3TVJB 5HYOA 1PPFE 2SNVA 4X6OA 1EPTC 1ABIH 2ZZUH 1A7SA 4KTCA 2WPHS 4Y0ZE 3DD2H 4X2VA 4Y8XA 1NRPH 3NCLA 1C1UH 1OYTH 3P8FA 4Y8ZA 4SGBE 1CBWC 5T6GA 1EP5A 2A5KA 1T32A 2J94A 3QLPH 1SGFA 3ZVDA 2BOKA 1QCPA 4A1VA 1C5ZB 1MQ6A 1PPBH 4TPYA 4XBCA 2Y6TA 3SOSA 1K28D 1O2HA 1QB9A 1GDNA 1ELFA 1N8OB 1LVOA 1C4U2 1QY6A 2AMDA 4FU9A 4CHAB 1DLEA 1O2OA 2XBXA 4INKA 4O97A 1UTMA 2BDHA 1ZJKA 1GHXH 3P17H 2AGIX 1NU9A 2QY0B 1P2QA 1TNHA 1V2VT 1SQOA 3BTWE 2TGTA 2VIVA 2G00A 2ZKSA 1DY9A 3RMMH 1KTTB 1TNIA 1WSSH 1ESAA 2ILNA 5T3HA 4JZ1A 3UQOA 3K9XB 2ODYB 1EUFA 5L2ZH 1C2MA 2VWMA 3NZIA 2A7JA 1O2QA 1JWTA 1ESBA 1ETRH 3SJOA 1G2MA 1VZQH 1EAXA 4ZKOU 4ZXYH 1T8MA 1O33A 3SJKA 1QB1A 2BX4A 2A4OA 1ZSKA 1MD7A 2ZA5A 1C5NH 1NRNH 1H8IH 5E2PA 3PV4A 1LTOA 2F9UA 1P09A 1HRTH 3EYDA 4AGKA 2Z3EA 1L4ZA 1Y3VA 1T4UH 3GDVA 4XOJA 1RRKA 1A1RA 4K69A 1W10U 3GYLB 4WVPE 3ZZBA 2F3CE 1V6DA 1TBRH 1MUEB 1FI8A 2W7SA 1CBWB 3K6YA 3VGCC 4ABEA 1AN1E 1DUAA 4X2YA 1ETTH 5C5NA 1ID5H 2XC4A 3KL6A 1O2ZA 1DUEA 5AFYH 1UJ1A 1ZHMA 2UUFB 3SHCH 3RM0H 4YOGA 3IITA 3ZVCA 1C5VA 1KXFA 3TNSA 2FOEA 3DT0H 3E3TA 3C27B 3PMJA 2FTLE 4ZH8A 3RU4T 3SGAE 1AE8H 3BTGE 1GJ4H 4A6LA 4ZHLU 4UE7H 1P2IA 3TH3H 2BD3A 1SFIA 2STAE 1V2WT 3B23B 3BG4C 3ESTA 3STJA 3UR6A 4ZXXH 1O2LA 1F92A 2R3YA 3ITIA 5FCRA 2ZEBA 1H8DH 1ZLRA 2FI3E 2SGFE 3SQEE 3RLYH 1VCQA 1BTXA 1EPTA 5BRRE 1XUIA 1PPEE 5DP4A 1UO6A 2AGEX 4FUCA 1RTLA 3A7XA 2QAAA 2P95A 2IPHA 2P3UB 2RDLA 4KELA 2AS9A 2GGVB 4FVBA 1OX1A 1A5HA 2WINI 1A0JA 4DGJA 1TA6A 1GBEA 2FMJA 2JKHA 3QN7A 3L3TA 1RFNA 3MU8A 4Y7BA 1DM4B 1YPHE 2Z9GA 1HJ9A 2A7CA 3P6ZB 1LKAA 5FPSA 4H42U 2ZFPH 2FZZA 5JBCS 3ODFA 1K1IA 3O8DA 1WTHD 1OP2A 3TK6A 2BDCA 3A7WA 3FZDA 3MNSA 4Y10E 3SNDA 4D7GA 2VWNA 2WV4A 1BTUA 3VGCB 1Y3WA 4ABGA 1OWIA 3TH4H 1NN6A 2ZP0H 5L30H 2Q1JA 1EZUC 2O8UA 1C5YB 1ZHRA 2WUBA 4WY3A 1FY3A 1TALA 4YLUA 4X2WA 3SJ8A 1NZQH 4WXIA 1CQQA 2XBWA 5H4IB 4E06H 3T28A 4D9QA 2BDYA 1BTYA 2QF3A 1YPJH 1O5EH 2A4GA 4YESB 1AVXA 1OWDA 3MMGA 3U8RH 2Z3DA 1GMDF 1GBFA 2BOHB 2F9NA 2QF0A 3BEIB 3R3GB 4MDSA 8LPRA 2AH4X 3BG4B 3BTME 3M35A 3UTUH 2JETC 2BD2A 2H5DA 1GPZA 2GT8A 1XUKA 3BIVH 4CH8B 1GBIA 1AI8H 1CT4E 4ZKNU 2LNCA 1OYQA 1XKAC 4YO9A 4MQAA 2XXLA 2RG3A 3SZNA 4D8NA 1DWDH 4XE4A 2W3IA 1VCPA 3SNEA 3RXHA 1PQ8A 5TCAA 2ZFRH 1V2ST 1YBWA 1J8AA 1UK2A 4NIWA 2J95A 1FNIA 4H6SB 1XXDA 1GBBA 1YCPM 1J15A 4XDEA 4AFUA 1Z71A 1HB0B 1ZTKA 3BN9A 1SFQB 2PWXA 3LC3A 2CJIA 3RXPA 1TPPA 1V2NT 4GCHG 1NRRH 1TFXA 4Z6AH 1KXDA 4UFDH 1D3DB 1FPCH 2R2WU 1SGTA 2C8XB 1C1RA 2F9BH 5F8TA 1G30B 2FDAA 5FHTA 1LCYA 1KLJH 3D49H 4X1PU 2XBVA 2AMQA 4KTUA 1BRBE 4MPWA 3SGBE 4AFQA 3I77A 5JBTA 4NFFA 3ZZ3A 2PKAB 3OYPA 4D76A 1MTUA 4ZMAH 1QJ6B 2GZ7A 1O3CA 2R3UA 4TWYA 1O2SA 2PFEA 5JB8S 1TNLA 2AEIH 1GBCA 1O2WA 5HM9A 3U8OH 3MU1A 4R0IA 2ZTZA 3MU0A 2KAIB 3LONA 4BTUB 2GDEH 3A82A 1NFUA 1SGEE 4IBLH 2JETB 3UY9A 1B7XB 3F1SB 1SHYA 3AVZA 2FTMA 1GI7B 1MTSA 4YLQH 4NIVA 1DANH 2TGPZ 3PLPA 1W3CA 2BD9A 1EOLA 4HZHA 1AMHA 3O8CA 4B75A 1ZMNA 1O2UA 1AFQC 2B7DH 1C5TA 1NM6A 5E8EH 2OP9A 1RGQA 1GI0A 3VB3A 1LHEH 1AFEH 2TGAA 3JZ2B 5LPEA 2W7UA 1C2EA 2V3HH 1SGIB 4AX9H 1LPGB 2D1JA 1BJUA 2ZCKP 1GBHA 3RXTA 2FOFA 1OS8A 1N6YA 2ZC9H 1D3QB 2KAIA 2ZG0H 1LDTT 1HLTH 2CHAC 2CF8H 3ATMA 3PYHA 2FO9A 1C2GA 3K2UA 3LJJA 2VIDA 1CGJE 1XXFA 2ASUB 3LGYA 3PLBA 2BDBA 1LPKB 4Q7YA 2ZDLA 4MVNA 2BXTH 1EP6A 3UWIA 1MCVA 2QN5T 3Q00A 1GJCB 4NCYA 2AGGX 2ZFSA 5EQQA 1LKBA 1QHRB 4DJZB 4AG1A 1T8LA 4B2CA 3URDA 2W26A 3RXVA 1L1NA 3VEQB 3VXEH 1GBMA 5A0CA 2TGDA 1VITH 1DOJA 4AFSA 2Y81A 5CMXH 1HDTH 1QL8A 1S83A 1AVWA 2F91A 1GBAA 2XC5A 1S6FA 2A31A 2Y7XA 3QGJA 2YNAA 1C1TA 3URCA 3SHAH 3M5LA 1HXFH 5LPFA 2W5EA 1LVMA 2FEQH 1BHXB 3M5OA 1FY4A 2F9PA 1D3PB 4NFEA 4Z0KA 1GMHG 2LPRA 1LPZB 2HNTF 2ZPQA 1GI1A 1YKTA 1AFQB 1Z8RA 2OBOA 4U2WA 3U8TH 3OX7U 2PTNA 3Q76A 4CBOA 2AMPA 1F5LA 1O2XA 1W14U 1BZXE 1O5CB 1GJDB 3UFAA 3LGWA 3ZYEA 1UTLM 1O5FH 1OP0A 1TBZH 1XM1A 5L6NH 1O3PB 3PLKA 2Q6GA 1HV7A 3VB7A 2F83A 3ZVBA 2VWLA 2Z6BD 1O2TA 1BTPA 1HJ8A 4R8TB 2Y5HA 2NU0E 1G3DA 1A3BH 1V2PT 2BY5X 1AWHB 3VPKA 5EPYA 1UHBA 2CHAB 1KDQA 2OUAA 3PO1B 2ZDAH 3STIA 3PTBA 3T62A 3RXEA 1IQEA 1QJ1B 1ORFA 1GI5A 5T6DA 1C5UA 2OBQA 3A7VA 3H5CB 4H6TA 2JH6D 4WWYA 3RXLA 3TH2H 2P8OC 1C1PA 2Z7FE 3ZVGA 1P3CA 1ZRKA 2ZFTA 1W2KH 3A88A 1P01A 4JZIA 4CRDA 2VGCB 3CS7A 1BTWA 3KF2A 3QTOH 3QZQA 2IOTA 1JIRA 1P05A 3A8BA 1OWEA 3RMNH 3NWUA 2FXRA 3P8OA 5ESBA 4ASHA 4F4OC 1AD8H 4GHTA 4MTBA 5LPRA 1O3IA 4IS5A 5GIBA 5GCHG 3GOVB 1CA8B 4NZLA 3UPEA 1FLEE 2OLGA 1AZZA 5F8XA 2BVSH 2O8TA 5ABWA 3HGPA 2H6MA 3AASA 3QDZB 2UWOA 2QA9E 3RMLH 1U6QA 1BUIA 1GJAB 5ESTE 3V7TA 1GMCG 2EC9H 3ENSB 1GCDA 3F68H 3PB1E 2P3TB 4X8TH 1CHOG 4DW2U 3HKIB 4ABBA 1GHAF 4B71A 1UCYH 2NU3E 3DFJA 1ARBA 1PQ5A 4YOIA 1C2FA 2B0FA 3A86A 1UVSH 2ODPA 3HATH 3E91A 2G55A 1PJPA 2O8LA 3E90B 1JBUH 1GVZA 1Y5AT 5FAHA 1UTQA 4ABFA 3RXCA 5F6MA 1ZRBA 5J4QA 3T29A 4LK4A 1G2LA 1ABJH 1C5RA 3SW2B 4FUFA 1G3CA 2HNTC 1MKXK 1RD3B 2P8OB 3UUZA 1O3FA 3T27A 3E1XB 5HMAA 5JPMH 1YPGH 4Y76A 1F0TA 1O2GH 2DE9A 1HAOH 1FY1A 2A1DB 1BITA 6ESTA 2RCEA 4AOQA 1GJ6A 3A83A 4ISHH 3GY3A 1RXPA 1DITH 4NIYA 3A89A 2C8WB 3F9HA 2XWBI 1KYNA 3QTVH 1MKWH 5CE1A 2XWAA 1EZSC 2ZIQH 3GCTF 4XBDA 1P12E 1BMNH 4AYYB 3F9GA 3RXMA 1SGCA 2OQ5A 4DIIH 1YPLH 3PWBA 1T31A 3K65B 4ZHMU 2ZF0H 4ABDA 1P2JA 3UQVA 5B6OA 2FOGA 4CRFA 1UCYE 2P59A 3LC5A 5HGGA 2HVXA 3MHWU 1K1NA 3I78A 4YT6H 3EDXB 1HJAC 1MAYA 1Z1JA 4OS1A 3M3SA 5E2OA 3M3TA 1Z8GA 4HTCH 5DP3A 1ZSJA 4MPXA 1FDPA 3GCNA 1T7CA 3G01A 3SV7A 1SG8B 1M9UA 1L1GA 4X6NA 5GJ4B 4KTSA 3DHKH 2FOCA 2OC7A 1C1QA 3F6UH 2F9OA 1BRUP 3OSYA 5DJ7A 3PM3A 3TGKE 1ZMJA 1IOEA 1J14A 2BZ6H 3EQ0H 3MNXA 1OOKB 3AAUA 2WUCA 2D2DA 1TE0A 1C2KA 1TGBA 3U98H 4CRGA 1ANBA 3B9FH 4HGCA 1ZSLA 4BXSA 2XCFA 1Z7KA 4MPUA 3UNSA 1IQKA 4Q7ZA 9LPRA 3RC6A 4E7NA 3SUDA 2GTBA 3KNXA 1ELDE 3HPTB 4LOYH 1O3MA 4FVDA 5AF9H 3A8AA 1O37A 4FUDA 3SUEA 2PGBB 3LU9B 4IMZA 3EA9A 2HLCA 3T26A 4X6MA 3BEUA 3ZZCA 2BQ7B 3M36A 1XVMA 1SC8U 4BAKB 1K21H 2RA0A 1HAVB 1SGPE 3GY4A 3UIRA 1QL7A 1GHBF 2UUJB 1WQSA 2ANYA 1XUGA 1P8VC 1O2YA 1QURH 4B2AA 3GCHB 3ZVEA 1UVPA 2R9PA 1V2TT 3SNAA 2HPQH 3QX5H 1NU7B 4IN2A 2G4TA 4O3UA 2FI5E 5DP6A 5F8ZA 1BQYA 4TY7A 2J34A 1HJAB 9ESTA 1TONA 1ELGA 2XW9A 1O2MA 1SLWB 2ALVA 4ESTE 1QQUA 1TNKA 3LGUA 4OS6A 4CBNA 1AB9C 1BTHH 2VB0A 1ELTA 4B2BA 1EJNA 1QNJA 1BBRH 3SNBA 1QJ7B 2UWLA 2VIOA 2QXHA 6GCHG 1S0RA 1ELBA 4IC5A 1TQ0B 1DXPA 1H9LB 5AFZH 2P3FH 1NRSH 5C1YA 5DG6A 3A7YA
chains in the Genus database with same CATH superfamily
1A2CH 3U1IB 3ZVAA 1GJ7B 1ELEE 1V2JT 1QA7A 5LH8A 1DY8A 2J2UA 2ZI2H 3N7DA 1V2UT 1TPOA 1YPMH 3AAVA 5GPIB 1TRYA 2OD3B 4WMDA 1O2JA 3PV2A 4A1XA 1DVAH 2WV5A 2UWPA 1SGYE 4K2YA 1O2VA 2Y82A 1SGRE 2K1QA 1HPGA 3W1EA 4AN7A 4LXBH 1DS2E 1C1OA 1MH0A 1NROH 2GKVE 1W12U 1OWHA 2SGEE 3MNBA 4BTIB 2B8OH 1C4V2 2ZGJA 5HXFA 1WBGB 3BF6H 3UNQA 1V2OT 1ZYOA 2C8YB 1T8OA 2GZ9A 8GCHG 1BHXF 1UVOA 2ULLA 2STBE 3U1JB 1JRSA 3Q3KA 1CO7E 3GY2A 5AHGH 1O2PA 2BLOA 5CDFE 5DP8A 3TU7H 1LVYA 1KMHB 1O30A 3FAOA 1BBRE 1A61H 4RKJB 2THFB 7KMEH 2FOHA 3DSOA 1MD8A 1K1PA 1O3BA 4K8BA 1D4PB 3KQCA 4XD7D 1E1RD 1HBTH 2ZNKH 2GVFA 3E16B 3ZZ6A 3ATIA 2ESTE 2GDDA 1AB9B 1VGCC 3FFGA 4K3JA 4WXVA 1L4DA 1ZHPA 3S9BA 2L74A 3S7KB 2ZQ2A 1DSUA 1O3DA 1ZGIA 1TABE 2J4IA 1DFPA 2GT7A 3TJOA 2ZHQH 2IJD1 2BMGB 3A8CA 1J16A 2TBSA 1NESE 1BRAA 1NY22 1O35A 3KIDU 4Y71A 1TPAE 2EI6A 3RMOH 1O36A 1FZZA 3NUMA 1Z8JB 2AFQB 1CHGA 4AG2A 1SI5H 2DUCA 1SR5C 1YCPK 2ZGBH 1SLUB 1GI2A 4RKOB 3RXOA 3UWJH 4U32A 1O3AA 3MO9A 1GBDA 2QXJA 5TCCA 3SV6A 1HUTH 1F0RA 1KIGH 2OCVB 2BHGA 3M7QA 1IQGA 1RTFB 1BTZA 7LPRA 3TLOA 1A4WH 1W11U 2Z9IA 2OC8A 3ATLA 1ZR0A 1WDIA 2SGPE 1W13U 3A7ZA 1SQAA 3ATWA 1VITG 1WUNH 3RUOA 1AWFH 1WXRA 1DPOA 3O8RA 1C5XB 4BTTB 5A2MH 4F49A 3KYGA 4OS7A 1LHCH 1V2LT 2HALA 4AB9A 3ZIAD 5G4BA 2D26C 5C20A 4DOQA 1YC0A 1UTOA 5EJZA 2IN2A 1MMJN 2VWOA 4FOUC 3GCOA 1QIXB 3DCLA 1KSNA 3RC5A 1IHTH 1OPHB 4NZQA 1QBNA 4CRBA 2WPIS 3CENA 3VG8A 3OE7D 1LQDB 3D65E 4X1SU 1GMHF 2ANKH 2PGQB 2ZU5A 1VGCB 1KLTA 3DSPA 4AORA 3RXGA 1YYY1 1WCZA 5IYTA 3WY8A 1O2KA 1ELCA 3MTYA 2RA3A 4NSVA 2A5AA 1INCA 1E1QD 2C93B 4THNH 4UFGH 2A45B 4GUXA 3ZZ4A 4IMQA 4SGAE 2GP9B 3ZZAA 4BAMB 1LQEA 3NPSA 1TA2A 1NC6A 3RXSA 5BPEA 5EOKA 4U01A 1C9PA 2O8MA 4I32A 2H9HA 4CR5A 2C8ZB 1GHVH 3DUXH 2H9TH 2PKAA 2H9EH 1LHGH 2VVVA 3PROA 5EU8A 1C4Y2 1GGDC 3MNCA 1W0YH 2BVXH 2GV6A 2PUQH 2R2MB 2FM2A 1A0HB 2GCTC 2C3SA 5E0GA 3H7OA 5IK2D 1IQNA 1GG6C 4ABHA 5K7RA 2QCYA 1P2NA 5DP9A 2ZFQH 1FPHH 4Q80A 1E79D 1YLDA 4F55A 2G5NA 2Y80A 1UTNA 2QYIA 5HKKD 4MG3A 3A84A 2ZU4A 1LO6A 1AUJA 1E34B 1HGTH 3PO1C 2OTVA 4UONA 1YPKH 1BOQA 4K8YA 1TBQH 1TX6A 4X8VH 5DP5A 4OGYA 1C1VH 1Z6EA 3ZZ7A 2CF9H 2PP6A 1NPMA 2AERH 4TPIZ 4NA8A 1N6XA 1Q31A 1B0FA 1LVBA 3M3VA 2BX3A 1TX7A 4ZROA 1GVKB 2YMSC 2VGCC 1O38A 5EJLA 2ZU1A 2HGTH 4XRNA 1FXYA 1AQ7A 4ISIH 2ZO3H 1P3EA 1ZTLA 2TRMA 1UVUH 1TWXB 3EA8A 4JMYA 1CHOF 3V3MA 1ZGVA 5J4SA 4FUBA 1DT2A 1OP8A 4GSOA 3IWMA 1G36A 1UK4A 2PUXB 2VIPA 5FBIA 1RTKA 1HAIH 5FPYA 5EXMA 1WAYB 5A8ZA 1YPEH 2ZGHA 2G5VA 3SJIA 2NU4E 5HIZA 2BDIA 3EAJA 3SU5A 2BY7X 4JK5A 5AVDA 1ZMLA 1JIMA 1C1MA 1GGDB 4BANB 1DSTA 2Z9LA 4BNRA 1ZPZA 3ZZ5A 2NU1E 4E7RG 2G52A 2QIQA 2BLVA 3UNRA 2GCTB 1GJ8B 1JXPA 1MBQA 3SO3A 1GG6B 5K0HA 3KQDA 2HPPH 2ZTYA 1XUFA 2PLXA 2G81E 3SN8A 1QTFA 3N7EA 1BB0B 2GJGA 2H1UA 4I8HA 1Y5UT 1EZXC 3QO6A 3QK1A 3QUMP 1SLVB 4K1TA 3LDXH 4ZKRU 1Y3YA 1ELAA 1AHTH 1D3TB 2ODQA 2O8WA 2KZ4A 1DXWA 1FAKH 3BTQE 4GHQA 2CXVA 1PQAA 2FS9A 1BMMH 4B73A 1SGFG 2AIQA 3F2HA 3TGJE 2NU2E 5KGOA 2A32A 1TRNA 2VH0A 4Y7AA 4ABJA 1GI8B 5SGAE 1Q3XA 2YMSB 3SU6A 1HXEH 1GJ9B 1FY5A 1T4VH 2A7HA 3P8GA 4X1NU 3F2FA 3SV2H 1NTPA 3RXBA 2Q6FA 3M5MA 1QBOA 1ZOMA 1PPGE 1S82A 3SORA 5KECA 1ELVA 2ALPA 4J2YB 4A5TS 2EI8A 1XX9A 4ZHAA 1TYNA 3DFLA 1VKYA 2FPZA 1OSSA 1H9IE 1MQ5A 2CMYA 3EE0B 4ABAA 3NXPA 1F5RA 1BCUH 4XBBA 4OS5A 2BD5A 1IQMA 1WYKA 1XUHA 1B0EA 3MH6A 4MLFB 2EA3A 5A09A 3RDZA 2C90B 4I8GA 4AYVB 1XUJA 2VIQA 3LOXA 1TAWA 2CGAA 1RIWC 1CGIE 4A7IB 1C2HA 3KEEA 3SI3H 1MU8B 1C2JA 1ESTA 2FYRA 4FUEA 2J38A 5C5OA 1O2RA 1CSOE 3U69H 1QL9A 5E0JA 4B74A 2AHME 1FUJA 1EFRD 1FIZA 2G51A 5EW2H 4YZUA 3AK5A 1FN8A 4MNXA 1MABB 1EAWA 2BZAA 3MU5A 1UK3A 5CHAC 3RXFA 2Y5FA 4FUGA 3LGVA 4DVAU 1S81A 1O3KA 2WZQA 1PQ7A 5DKMA 5I46H 1IQHA 1YM0A 4Q7XA 2HOBA 1DE7H 4JZDH 2FIRH 5JYIA 2UUKB 1ZPCA 1QZ8A 2ZTXA 1CA0C 3QGNB 1SOZA 2CV3A 2GZ8A 1MZAA 3FP8E 3LKWA 2FWWA 1QQ4A 1ANCA 1FMGA 8KME2 1CVWH 1C5LH 1K9OE 2XC0A 3TJVA 3ZYDA 4LZ1H 2H2ZA 1BMFD 2PKSC 1YLCA 2BDGA 1F5KU 1BRCE 3PWCA 4Z1MD 4ZCNA 4B76A 3BTEE 4JZEH 1TOMH 1D6RA 3TJUA 1WV7H 1K2I1 1TGSZ 3W94A 1QB6A 2ZPRA 1DX5M 1YPHC 3A80A 1F7ZA 2V0BA 1O3GA 2JJ1D 2ZQ1A 1A0LA 1AKSB 6LPRA 3TK5A 2QV1A 3V13A 3LH3A 2BQWB 5FBEA 1O3LA 1QRZA 1E38B 1RJXB 2VIWA 3GCHC 1AGJA 1NFYA 3R0FA 1XVOA 1HNEE 2GMTC 3SU4A 1EOJA 4FU7A 5C1XA 1SGQE 2SGDE 1P2MA 1O3NA 1SB1H 1C5WB 1MTNC 5DN6D 3Q77A 2XNDD 1DICA 1RIWB 2WPMS 2WSSD 3GDSA 3DA9B 5C0TA 1EXFA 1LHFH 2QC2A 1UTKA 1GHYH 3BTFE 4GLYA 1KXAA 3MOCA 1PPZA 3GY7A 2HLDD 3P95A 5FX6A 1ARCA 5DPAA 1P04A 5JBAS 5EGMA 3M61U 5DGJA 1O31A 1EJMA 2WPKS 3MFJA 1SHHB 3EGKH 5CHAB 1EX3A 1NO9H 4NWKA 3A7TA 3RXDA 3BTDE 1B5GH 3TGIE 1SOTA 3E8LA 3AW1A 1C1SA 2V35A 4GAWA 1O3JA 3RXIA 3BG8A 2H5CA 2KX4A 4OGXA 2OK5A 1A3EH 1AKSA 2BTCE 1WTGH 1ETSH 4OS4A 8GCHF 1QBVH 1CA0B 4OS2A 3RXJA 3H7TA 1DLKB 4UD9H 1GBJA 1JOUB 2YNBA 1EAIA 1EQ9A 2DE8A 1L2EA 4HI3A 4I7YH 3RU4D 1Y59T 3SU1A 4LZ4B 4IC6A 2PKSB 1TGCA 2XCNA 1GHAG 2WYJA 1O3EA 1ZJDA 1MAXA 3KQEA 4FUJA 2PHBA 1PFXC 4KP0A 2GCHG 7ESTE 2RDEA 1L1JA 1GBLA 3LH1A 5KEDA 5TJXA 5ETXA 1KXBA 3BEFB 4MPVA 3UR9A 2V3OH 3GISB 1IQIA 3FOAA 4K1SA 1V2MT 4I8LA 4KKDA 2FLRH 2BY6X 1BJVA 4MNVA 1SMFE 1W7XH 3RXQA 1O5DH 1FJSA 1C2LA 4YT7H 2GMTB 7GCHG 1BT7A 2ZGXH 4YM9A 1F2SE 2ZDKA 4DT4A 2G8TA 3P70B 1TQ7B 1MTNB 1QA0A 3F2GA 4JK6A 3RXRA 1QRWA 2KCPA 4Y8YA 2OC0A 1CT0E 1SGDE 2FP7B 4X2XA 1BMLA 1EPTB 5JDUB 2BB4A 1EASA 4NSYA 2SNWA 1SGNE 3UREA 1HAYB 2ZDMA 1ACBE 4ZAEA 2FS8A 5GDSH 4TYDA 4A92A 2VJ1A 2QXIA 2EI7A 1LMWB 1IQFA 1W0ZU 3GCTG 2WPJS 4J1YA 3O8BA 4JYVH 4YTAA 1V2KT 1NBMD 2VVUA 1HAVA 3KN2A 2C4FH 4DIHH 3T25A 1Y3XA 4GCHF 2UUYA 3OEHD 1ANEA 1VITF 3W95A 1GWAA 2I6SA 3S0NA 1WQVH 2ZHWH 1C5OH 1AUTC 4DG4A 1O3OA 5LGOA 3UOPA 5JB9S 2I6QA 1UTJA 2FOBA 1K1MA 5IDKA 1PPCE 4NA7A 3KQBA 2HNTE 3Q3XA 3RXKA 2AIPA 2PW8H 4RSPA 1VJ9U 1C1NA 2Z3CA 4BAHB 4O3TA 3BTTE 1E36B 4RI0A 3NK8A 3VFEA 3VB4A 1P9SA 2BD8A 1Z1IA 4NIXA 1NRQH 3P8NA 1J17T 1S5SA 3MO3A 1TGNA 5EXLA 2YOLA 1BMAA 5A0BA 5DP7A 3SI4H 4ISNA 4HFPB 1YF4A 5T1VA 1MKXH 5PTPA 3NKKA 3KGPA 8ESTE 1TMBH 1JMOH 2ZCHP 1THPB 4FUIA 1TMTH 1P10A 4K5ZA 1K1OA 3AW0A 2WPLS 2P16A 3OAAD 1P0SH 3BSQA 1P57B 3KCGH 3OTJE 1MZDA 3GY8A 1AO5A 1FAXA 1YGCH 1HIAB 1A46H 1H4WA 2FYQA 4BXWA 1AZ8A 1SSXA 4DCDA 4D9RA 1O2IA 3L33A 5A8YA 1P11E 2ZPSA 3FVFB 4Y0YE 4CREA 2HRVA 2KM0A 2A2QH 5EXNA 1GHBG 3MO6A 2Y7ZA 4Y6DA 2CN0H 1MCTA 2XBYA 3T5FH 1OWKA 5T6FA 1DWBH 2GX4A 3SBKA 1TGTA 1SLXB 1G32B 4CH2B 1H8ED 2AYWA 3LPRA 4X8SH 1E0FD 2BY9X 3E6PH 1GBKA 5C1UA 3SNCA 1WOFA 4I8JA 2IJOB 1GI4A 1E35B 1YLNA 4WMEA 1BDAA 1GDUA 1O34A 2F9VA 4WH6A 3Q3YA 2J9NA 1UTPA 2ANWA 1SBWA 1HIAA 1TNJA 1K22H 5JBBS 4I31A 1P02A 2BD7A 4WMFA 4PROA 3S9AA 4RN6A 1UW7A 3OY6U 4Q4LA 1YP9A 1SL3A 3HK3B 3SV9A 4CRAA 4X0WU 1UMAH 1P06A 1NFWA 1TMUH 4BAOB 2EY4C 4Q63A 4Y79A 3TJNA 2ZHDA 3BTKE 3U28C 4GVUA 2V6NA 2ZWLH 3ZV8A 3SUFA 2VNTA 4BAQB 1Y5BT 1GDQA 3D62A 1W7GH 1C5QA 1TLDA 1IAUA 5C2ZA 3RXUA 1BA8B 1HAHH 1O32A 4IGDA 2ZHEH 1DWEH 1G3EA 2A2XH 1SQTA 2PV9B 2ZCLP 1SVPA 5E0HA 2ZECA 3PMHB 3WWFA 3GICB 1GL1A 4AFZA 1A5IA 1NFXA 1AIXH 2VU8E 1PYTC 2Y5GA 2VH6A 1G37A 1NS3A 2EEKA 3OY5U 4CRCA 1UCYK 5C17A 3M37A 4F48B 2M5TA 3LIWA 3LGIA 1EB1H 2OINA 1C5PA 1HAGE 3QWCH 4NGAH 1HYLA 4D7FA 1EKBB 3JZ1B 1MBMA 3CS0A 3LT3A 1GL0E 1GJ5H 1GI9B 3VB5A 3PMBB 4A1TA 1ZZZA 3ODDA 1C1WH 1C2DA 3SYJA 6CHAC 1TOCB 2ZU2A 4GPGA 3OEED 4UDWH 4ABIA 4KGAA 5GWZA 3UOUA 1S85A 1GMDG 4JCNA 2JH5D 1Z6JH 4VGCC 3TK9A 2Q6DA 5HM2A 1CU1A 2HWLB 3F9FA 1N1LA 4X1QU 4NA9H 1AVGH 1KTSB 3M5NA 1O0DH 2ZDVH 3PTNA 3H09A 3LJOA 3N7OA 4JYUH 3SJ9A 1MKWK 5GCHF 1X7AC 3MWIU 3K6ZA 4X1RU 1RS0A 3A8DA 2K0QA 1H1BA 1G3BA 1P2KA 3EA7A 1E37B 1S84A 3QZRA 2BLQA 4DY7B 1S0QA 3MH7A 4Y11E 4UEHH 1FN6A 2WV9A 2PR3A 5EG4A 3RLWH 3FP6E 1C2IA 1GBTA 1VR1H 1GMCF 4O03A 1JRTA 5A8XA 1GHZA 1K1JA 2W3KA 1O5BB 1Q2WA 2TIOA 4TWWA 1H9HE 1IQJA 3B8JA 3SGQE 3U9AH 4B1TA 5GXPA 1PPHE 2VINA 3C1KA 2Z94A 2SGQE 1C5MD 1MTVA 2OC1A 4XSKU 3MYWA 1HAXB 5C67A 3SUGA 4I8KA 1KY9A 2OQUA 2BM2A 1UHBB 2FODA 2JJ2D 2ZHFH 1EJAA 1KDQB 4FU8A 3SU0A 1EATA 1AU8A 4WF8A 3ZZDA 5DK1A 2Z9JA 2PSXA 3ZV9A 3T2NA 4X6PA 1Y8TA 2KFWA 3BIUH 4UFEH 3MI4A 3ELAH 4MNWA 4BOHA 1ANDA 3CP7A 4AGJA 1G9IE 1TB6H 3KYFA 1GCTC 3P92A 2BLWA 1Z8IB 3RP2A 3ZZ8A 4H4FA 4X8UH 4M7GA 6CHAB 1C9TA 2BD4A 4DURA 1TRMA 3V0XA 3BTHE 4FXGH 1P03A 2FI4E 5EQSA 1EB2A 5L2YH 1SPJA 3UB0A 3D23A 4VGCB 1DDJA 1MTWA 1O39A 3BV9B 2J92A 1L0ZA 1D6WA 3OTPA 3FANA 1FY8E 2ZU3A 3A85A 2QGRA 3RM2H 2SFAA 2XRCA 3RXAA 4XFQA 2BXUH 1YCPH 4Q2KA 1KXEA 2BY8X 1TX8A 1WU1A 3SU2A 3E0PB 3MH5A 4IW4E 1O2NA 1T8NA 2ZDNA 2VBCA 1P2OA 1THRH 2FOMB 1OXGA 3HKJB 1V2QT 2FX6A 1KXCA 1LHDH 2PSYA 3OU0A 2GD4B 1TNGA 2NWNA 2XYAA 1KLIH 1QR3E 1P9UA 3VXFH 4ZKSU 3M7UA 4MNYA 3S7HB 1XKBC 3FP7E 2BYAX 5FX5A 3HK6B 4YOJA 1MU6B 3TIUA 3IG6B 4DT7B 3MH4A 4IN1A 4K1EA 2A5IA 3KHVA 1AY6H 2G4UA 3LGTA 5I25A 1TIOA 1GHWH 1IQLA 3ZVFA 2GV7A 3A87A 2B9LA 1J9CH 3MU4A 2R0KA 1QFKH 3GYMA 2EQNA 5C3NA 2M2AA 2A4RA 3TITA 2P93A 1BBRK 5DSFA 1EZQA 3TNTA 1CE5A 2TPIZ 4NG9H 3TPIZ 3GDUA 2Z9KA 1O3HA 3RC4A 1FIWA 1TPSA 2BQ6B 1F0UA 5C94A 1HAZB 2XTTB 3I29A 2VVCA 3ATKA 1AE5A 2D8WA 3HGNA 3N99A 1CGHA 1GI3A 3A81A 3M7TA 4WJG2 1CT2E 2J97A 5FXLA 4NWLA 4ACBA 1GCTB 1FQ3A 1HCGA 5EPNA 2BVRH 2XOKD 5EODA 2XNIA 4K60A 2PTCE 1NT1A 3F9EA 3GS9A 1C5SA 2QXGA 3GY5A 5F03A 1QRXA 1FONA 4ISLA 4JZFH 1O5AB 1F0SA 2O9QA 2FX4A 1OKXA 2FESH 3ZZ9A 2LELA 4U30A 1N8OC 2WPDD 4CHAC 3SU3A 4E05H 4AB8A 2GCHF 2ZFFH 3PRDA 3GY6A 2JH0D 4ISOA 1VJAU 2A0QB 1GI6A 1D9IA 1S6HA 1BIOA 4INHA 1DWCH 1OWJA 2B5TB 4WH8A 4FETA 3L6PA 1PYTD 3SQHE 3PMAB 5DO4H 5FPTA 7GCHF 4CR9A 4FUHA 4ZUHA 1THSH 2A4QA 3S9CA 2FLBH 5EQRA 3PRBA 4AZ2B 1HAPH 2BDAA 4TY6A 2ANMH 1VCWA 1IHSH 3FZZA 5EW1H 2P94A 1ZTJA 4INLA 4O9VA 4UFFH 1W8BH 3V12A 1GJBB 4JYTA 3VB6A 6GCHF 1V3XA 1V2RT 1ZPBA 5FCKA 1QGFA 1FV9A 4I33A 3SV8A 2ZGCA 1HFDA 1O5GH 2FOAA 3E0NB 5A0AE 1GVLA 1A5GH 1K1LA 2WYGA 1W0JD 5F53A 4QT8C 3S69A 1UVTH 1Y3UA 3RU4E 1EAUA 2OXSA 2R0LA 1W0KD 2SGAA 1XMNB 3TVJB 5HYOA 1PPFE 2SNVA 4X6OA 1EPTC 1ABIH 2ZZUH 1A7SA 4KTCA 2WPHS 4Y0ZE 3DD2H 4X2VA 4Y8XA 1YWUA 1NRPH 3NCLA 2RFKC 1C1UH 1OYTH 3P8FA 4Y8ZA 4SGBE 1CBWC 5T6GA 1EP5A 2A5KA 1T32A 2J94A 3QLPH 1SGFA 3ZVDA 2BOKA 1QCPA 4A1VA 1C5ZB 3PV5A 1MQ6A 1PPBH 4TPYA 4XBCA 2Y6TA 2YMSD 3SOSA 1K28D 1O2HA 1QB9A 1GDNA 1ELFA 1N8OB 1LVOA 1C4U2 1QY6A 2AMDA 4FU9A 4CHAB 1DLEA 1O2OA 2XBXA 4INKA 4O97A 1UTMA 2BDHA 1ZJKA 1GHXH 3P17H 2AGIX 1NU9A 4AC9A 2QY0B 1P2QA 1TNHA 1V2VT 1SQOA 3BTWE 2TGTA 2VIVA 2G00A 2ZKSA 1DY9A 3RMMH 1KTTB 1TNIA 1WSSH 1ESAA 2ILNA 5T3HA 4JZ1A 3UQOA 3K9XB 2ODYB 1EUFA 5L2ZH 1C2MA 2VWMA 3NZIA 2A7JA 1O2QA 1JWTA 1ESBA 1ETRH 3SJOA 1G2MA 1VZQH 1EAXA 4ZKOU 4ZXYH 3WW7A 1NBME 1T8MA 1O33A 3SJKA 1QB1A 2BX4A 2A4OA 1ZSKA 1MD7A 2ZA5A 1C5NH 1NRNH 1H8IH 5E2PA 3PV4A 1LTOA 2F9UA 1P09A 1HRTH 3EYDA 2QF5A 4AGKA 2Z3EA 1L4ZA 1Y3VA 1T4UH 3GDVA 4XOJA 1RRKA 1A1RA 4K69A 1W10U 3KQ5A 3SZEA 3GYLB 4WVPE 3ZZBA 2F3CE 1V6DA 1TBRH 4HG6A 3FN8A 5FL7D 1MUEB 1FI8A 2W7SA 1CBWB 3K6YA 3VGCC 4ABEA 1AN1E 1DUAA 4X2YA 1ETTH 5C5NA 1ID5H 2XC4A 3KL6A 1O2ZA 1DUEA 5AFYH 1UJ1A 1ZHMA 2UUFB 3SHCH 3RM0H 2KR7A 3IITA 4YOGA 3ZVCA 1C5VA 1KXFA 2J98B 2FOEA 3DT0H 3E3TA 3TNSA 3C27B 3PMJA 2FTLE 4ZH8A 3RU4T 3SGAE 1FX0B 1AE8H 3BTGE 1GJ4H 4A6LA 4ZHLU 4UE7H 3DSGA 4P02A 1P2IA 3TH3H 2BD3A 2JDID 1SFIA 2STAE 1V2WT 3B23B 3BG4C 4P00A 4OM9A 3ESTA 3STJA 3UR6A 4ZXXH 1O2LA 1F92A 2R3YA 3ITIA 5FCRA 2ZEBA 1H8DH 1ZLRA 2FI3E 2SGFE 3SQEE 3RLYH 1VCQA 1BTXA 1EPTA 5BRRE 2WHXA 1XUIA 1PPEE 5DP4A 1UO6A 2AGEX 4FUCA 1RTLA 3A7XA 2QAAA 2P95A 2IPHA 2P3UB 2RDLA 4KELA 2AS9A 2GGVB 4FVBA 1OX1A 1A5HA 2WINI 1A0JA 4DGJA 1TA6A 1GBEA 2FMJA 2JKHA 3QN7A 3L3TA 1RFNA 3MU8A 4Y7BA 1DM4B 1YPHE 2J98A 2Z9GA 1HJ9A 2A7CA 3P6ZB 1LKAA 5FPSA 4H42U 2W6ID 2ZFPH 2FZZA 5JBCS 4B6EA 3ODFA 1K1IA 3O8DA 1WTHD 4ACAA 1OP2A 3TK6A 5GNDA 2BDCA 3A7WA 3FZDA 3MNSA 4Y10E 3SNDA 4D7GA 2VWNA 2WV4A 1BTUA 3VGCB 1Y3WA 4ABGA 1OWIA 3TH4H 5EIYA 1NN6A 2ZP0H 5L30H 2Q1JA 1EZUC 2O8UA 3F3BA 1C5YB 1ZHRA 2WUBA 4WY3A 1OHHD 1FY3A 1TALA 4YLUA 4X2WA 3SJ8A 5HIYA 1NZQH 4WXIA 1CQQA 2IPQX 2XBWA 5H4IB 4E06H 3T28A 4D9QA 2BDYA 1BTYA 2QF3A 1YPJH 1O5EH 2A4GA 4YESB 1AVXA 1OWDA 3MMGA 3U8RH 2Z3DA 1GMDF 1GBFA 2BOHB 2F9NA 2QF0A 3BEIB 3R3GB 4MDSA 8LPRA 2AH4X 3BG4B 3BTME 3M35A 3UTUH 2JETC 2BD2A 2K8IA 2H5DA 1GPZA 2GT8A 1XUKA 3BIVH 4CH8B 1GBIA 1AI8H 1CT4E 4ZKNU 2LNCA 1OYQA 1XKAC 4YO9A 3FKSD 1YY3A 4MQAA 2XXLA 2RG3A 3SZNA 4D8NA 1DWDH 4XE4A 2W3IA 1VCPA 3SNEA 3RXHA 1PQ8A 5TCAA 2ZFRH 1V2ST 1YBWA 1J8AA 1UK2A 4NIWA 2J95A 1FNIA 4H6SB 1XXDA 1GBBA 1YCPM 1J15A 4XDEA 4AFUA 1Z71A 1HB0B 4TT3D 1ZTKA 3BN9A 1SFQB 2PWXA 3LC3A 2CJIA 3RXPA 1TPPA 1V2NT 4GCHG 1NRRH 1TFXA 4Z6AH 1KXDA 4UFDH 1D3DB 1FPCH 2R2WU 1SGTA 2C8XB 1C1RA 2F9BH 5F8TA 1G30B 2FDAA 5FHTA 1LCYA 1KLJH 3D49H 4X1PU 2XBVA 2AMQA 4KTUA 1BRBE 4MPWA 3SGBE 4AFQA 3I77A 3UAIC 5JBTA 4NFFA 3ZZ3A 2PKAB 3OYPA 4D76A 1MTUA 4ZMAH 1QJ6B 2GZ7A 1O3CA 4YXWD 2R3UA 4TWYA 1O2SA 2PFEA 5JB8S 1TNLA 2AEIH 1GBCA 1O2WA 5HM9A 3U8OH 3MU1A 4R0IA 2ZTZA 3MU0A 2KAIB 3LONA 4BTUB 2GDEH 3A82A 2QF4A 1NFUA 1SGEE 4IBLH 2JETB 3UY9A 1B7XB 3F1SB 1SHYA 3AVZA 2FTMA 1GI7B 1MTSA 4YLQH 1SKYE 4NIVA 1DANH 2TGPZ 3PLPA 1W3CA 2BD9A 1COWD 1EOLA 4HZHA 1AMHA 3O8CA 4B75A 1ZMNA 5EJ1A 1O2UA 1AFQC 2B7DH 1C5TA 1NM6A 5E8EH 2OP9A 1RGQA 1GI0A 3VB3A 1LHEH 4TSFD 1AFEH 2TGAA 3JZ2B 5LPEA 2W7UA 1C2EA 2V3HH 1SGIB 4AX9H 1LPGB 2D1JA 1BJUA 2ZCKP 1GBHA 3RXTA 2FOFA 1OS8A 1N6YA 2ZC9H 1D3QB 2KAIA 2ZG0H 1LDTT 1HLTH 2CHAC 2CF8H 3ATMA 3PYHA 2FO9A 1C2GA 3K2UA 3LJJA 2VIDA 1CGJE 2LP6A 1XXFA 2ASUB 3LGYA 3PLBA 2BDBA 1LPKB 4Q7YA 2ZDLA 4MVNA 2BXTH 1EP6A 3UWIA 1MCVA 2QN5T 3Q00A 1GJCB 4NCYA 2AGGX 2ZFSA 5EQQA 1LKBA 4ASUD 1QHRB 4DJZB 4AG1A 1T8LA 4B2CA 3URDA 2W26A 3RXVA 1L1NA 3VEQB 3VXEH 1GBMA 5A0CA 2TGDA 1VITH 1DOJA 2J5UA 4AFSA 2Y81A 4RT1A 5CMXH 1HDTH 1QL8A 1S83A 1AVWA 2F91A 1GBAA 2XC5A 1S6FA 2A31A 2Y7XA 3QGJA 2YNAA 1C1TA 3URCA 3SHAH 3M5LA 1HXFH 5LPFA 2W5EA 1LVMA 2FEQH 1BHXB 3M5OA 1FY4A 2F9PA 1D3PB 4NFEA 4Z0KA 1GMHG 2LPRA 1LPZB 2HNTF 2ZPQA 1GI1A 1YKTA 1AFQB 1Z8RA 2OBOA 4U2WA 3U8TH 3OX7U 2PTNA 3Q76A 4CBOA 2AMPA 1F5LA 1O2XA 1W14U 2KCOA 1BZXE 1O5CB 1GJDB 3UFAA 3LGWA 3ZYEA 1UTLM 1O5FH 1OP0A 1TBZH 1XM1A 5L6NH 1O3PB 3PLKA 2Q6GA 1HV7A 3VB7A 2F83A 3ZVBA 2VWLA 2Z6BD 1O2TA 1BTPA 2HVYB 1HJ8A 4R8TB 2Y5HA 2NU0E 1G3DA 1A3BH 1V2PT 2BY5X 1AWHB 3VPKA 5EPYA 1UHBA 2CHAB 1KDQA 2OUAA 3PO1B 2ZDAH 3STIA 3PTBA 3T62A 3RXEA 2KCAA 1IQEA 1QJ1B 1ORFA 4M9FA 1GI5A 5T6DA 1C5UA 2OBQA 3A7VA 3H5CB 4H6TA 2JH6D 4WWYA 3RXLA 3TH2H 2P8OC 2L6OA 1C1PA 2Z7FE 3ZVGA 1P3CA 1ZRKA 2ZFTA 1W2KH 3A88A 1P01A 4JZIA 1SQRA 4CRDA 2VGCB 3CS7A 1BTWA 3KF2A 3QTOH 3QZQA 2IOTA 1JIRA 1P05A 3A8BA 1OWEA 3RMNH 3NWUA 2FXRA 3FO8D 3P8OA 2JIZD 5ESBA 4ASHA 4F4OC 1AD8H 3F0OA 4GHTA 2KCYA 4MTBA 5LPRA 1O3IA 4IS5A 5GIBA 5GCHG 3GOVB 3F0PA 1CA8B 4NZLA 3UPEA 1FLEE 2OLGA 1AZZA 5F8XA 2BVSH 2O8TA 5ABWA 3HGPA 2H6MA 3AASA 3WWBA 3QDZB 2UWOA 2QA9E 3RMLH 1U6QA 1BUIA 1GJAB 5ESTE 3V7TA 1GMCG 2EC9H 3ENSB 1GCDA 3F68H 3PB1E 2P3TB 4X8TH 1CHOG 4DW2U 3HKIB 4ABBA 1GHAF 4B71A 1UCYH 2NU3E 3DFJA 1ARBA 1PQ5A 4YOIA 1C2FA 2B0FA 3A86A 1UVSH 2ODPA 3HATH 3E91A 2G55A 1PJPA 2O8LA 3E90B 1JBUH 1GVZA 1Y5AT 5FAHA 1UTQA 4I86A 4ABFA 3RXCA 5F6MA 1ZRBA 1K0HA 5J4QA 3T29A 4LK4A 5CHBA 1G2LA 1ABJH 1C5RA 3SW2B 4FUFA 1G3CA 2HNTC 1MKXK 1RD3B 2W6JD 2P8OB 3UUZA 1O3FA 3OFND 3T27A 3E1XB 5HMAA 5JPMH 1YPGH 4Y76A 1F0TA 1O2GH 2DE9A 2CK3D 1HAOH 1FY1A 2A1DB 1BITA 6ESTA 2RCEA 4AOQA 1GJ6A 3A83A 4ISHH 3GY3A 1RXPA 1DITH 4NIYA 3A89A 2C8WB 3F9HA 2V3MA 2XWBI 1KYNA 3QTVH 1MKWH 5CE1A 2XWAA 1EZSC 2ZIQH 3GCTF 4XBDA 1P12E 1BMNH 4AYYB 3F9GA 5B6LA 3RXMA 1SGCA 2OQ5A 1S6LA 4DIIH 1YPLH 3PWBA 1T31A 3K65B 4ZHMU 2ZF0H 4ABDA 1P2JA 3UQVA 5B6OA 2FOGA 3MQKC 4CRFA 1UCYE 2P59A 3CNRA 3LC5A 5HGGA 3NRLA 2HVXA 3MHWU 1K1NA 3I78A 4YT6H 3EDXB 1HJAC 1MAYA 2V7QD 1Z1JA 4OS1A 3M3SA 5E2OA 3M3TA 1Z8GA 5C0UA 4HTCH 3EE7A 5DP3A 1ZSJA 4MPXA 1FDPA 3GCNA 1T7CA 3G01A 3SV7A 1SG8B 1M9UA 1L1GA 4X6NA 5GJ4B 4KTSA 3DHKH 2FOCA 2OC7A 1C1QA 3F6UH 2F9OA 1BRUP 3OSYA 2QE7D 5DJ7A 3PM3A 3TGKE 1ZMJA 1IOEA 1J14A 2BZ6H 3EQ0H 3MNXA 1OOKB 2F43B 3AAUA 2WUCA 2D2DA 1TE0A 1C2KA 1TGBA 3U98H 4CRGA 1ANBA 3B9FH 4HGCA 1ZSLA 4BXSA 2XCFA 1Z7KA 4MPUA 3UNSA 1IQKA 4Q7ZA 9LPRA 3RC6A 4E7NA 3SUDA 2GTBA 3KNXA 1ELDE 3HPTB 4LOYH 1O3MA 4FVDA 5AF9H 3A8AA 1O37A 4FUDA 4RT0A 3SUEA 2PGBB 3LU9B 4IMZA 3EA9A 2HLCA 3T26A 4X6MA 3BEUA 3ZZCA 2BQ7B 3M36A 1XVMA 1SC8U 4BAKB 1K21H 2RA0A 1HAVB 1SGPE 3GY4A 3UIRA 1QL7A 1GHBF 2UUJB 1WQSA 2ANYA 1XUGA 1P8VC 1O2YA 1QURH 1H8HD 3GCHB 4B2AA 3ZVEA 1UVPA 2R9PA 1V2TT 3SNAA 2HPQH 3QX5H 1NU7B 4IN2A 2G4TA 4O3UA 2FI5E 5DP6A 5F8ZA 1BQYA 4TY7A 2J34A 1HJAB 9ESTA 1TONA 1ELGA 2XW9A 4B6FA 1O2MA 1SLWB 2ALVA 4ESTE 1QQUA 1TNKA 3LGUA 4OS6A 4CBNA 1AB9C 1BTHH 2F4LA 2VB0A 1ELTA 4B2BA 1EJNA 1QNJA 1BBRH 3SNBA 1QJ7B 2UWLA 2VIOA 2QXHA 6GCHG 1S0RA 1ELBA 4IC5A 1TQ0B 1DXPA 1H9LB 5AFZH 2P3FH 1NRSH 5C1YA 5DG6A 3A7YA
chains in the Genus database with same CATH topology
1A2CH 3U1IB 3ZVAA 1GJ7B 1ELEE 1V2JT 1QA7A 5LH8A 1DY8A 2J2UA 2ZI2H 1V2UT 1TPOA 1YPMH 3AAVA 5GPIB 1TRYA 2OD3B 4WMDA 1O2JA 4A1XA 1DVAH 2WV5A 2UWPA 1SGYE 4K2YA 1O2VA 2Y82A 1SGRE 2K1QA 1HPGA 4AN7A 4LXBH 1DS2E 1C1OA 1MH0A 1NROH 2GKVE 1W12U 1OWHA 2SGEE 3MNBA 4BTIB 2B8OH 1C4V2 2ZGJA 5HXFA 1WBGB 3BF6H 3UNQA 1V2OT 1ZYOA 2C8YB 1T8OA 2GZ9A 8GCHG 1BHXF 1UVOA 2ULLA 2STBE 3U1JB 1JRSA 3Q3KA 1CO7E 3GY2A 5AHGH 1O2PA 2BLOA 5DP8A 3TU7H 1LVYA 1O30A 3FAOA 1BBRE 1A61H 4RKJB 2THFB 7KMEH 2FOHA 1MD8A 1K1PA 1O3BA 4K8BA 1D4PB 3KQCA 1HBTH 2ZNKH 2GVFA 3E16B 3ZZ6A 3ATIA 2ESTE 2GDDA 1AB9B 1VGCC 3FFGA 4K3JA 4WXVA 1L4DA 1ZHPA 3S9BA 3S7KB 2ZQ2A 1DSUA 1O3DA 1ZGIA 1TABE 2J4IA 1DFPA 2GT7A 3TJOA 2ZHQH 2BMGB 3A8CA 1J16A 2TBSA 1NESE 1BRAA 1NY22 1O35A 3KIDU 4Y71A 1TPAE 2EI6A 3RMOH 1O36A 1FZZA 3NUMA 1Z8JB 2AFQB 1CHGA 4AG2A 1SI5H 2DUCA 1SR5C 1YCPK 2ZGBH 1SLUB 1GI2A 4RKOB 3RXOA 3UWJH 4U32A 1O3AA 3MO9A 1GBDA 2QXJA 5TCCA 3SV6A 1HUTH 2OCVB 1F0RA 1KIGH 2BHGA 3M7QA 1IQGA 1RTFB 1BTZA 7LPRA 3TLOA 1A4WH 1W11U 2Z9IA 2OC8A 3ATLA 1ZR0A 2SGPE 1W13U 3A7ZA 1SQAA 3ATWA 1VITG 1WUNH 3RUOA 1AWFH 1DPOA 3O8RA 1C5XB 4BTTB 5A2MH 4F49A 4OS7A 1LHCH 1V2LT 2HALA 4AB9A 5G4BA 2D26C 5C20A 4DOQA 1YC0A 1UTOA 2IN2A 1MMJN 2VWOA 3GCOA 1QIXB 1KSNA 3RC5A 1IHTH 1OPHB 4NZQA 1QBNA 4CRBA 2WPIS 3CENA 1LQDB 3D65E 4X1SU 1GMHF 2ANKH 2PGQB 2ZU5A 1VGCB 1KLTA 4AORA 3RXGA 1YYY1 1WCZA 5IYTA 3WY8A 1O2KA 1ELCA 3MTYA 2RA3A 4NSVA 2A5AA 1INCA 2C93B 4THNH 4UFGH 2A45B 4GUXA 3ZZ4A 4IMQA 4SGAE 2GP9B 3ZZAA 4BAMB 1LQEA 3NPSA 1TA2A 1NC6A 3RXSA 5BPEA 5EOKA 4U01A 1C9PA 2O8MA 4I32A 2H9HA 4CR5A 2C8ZB 1GHVH 3DUXH 2PKAA 2H9TH 2H9EH 1LHGH 2VVVA 3PROA 5EU8A 1C4Y2 1GGDC 3MNCA 1W0YH 2BVXH 2GV6A 2PUQH 2R2MB 2FM2A 1A0HB 2GCTC 2C3SA 5E0GA 3H7OA 5K7RA 1IQNA 1GG6C 4ABHA 2QCYA 1P2NA 5DP9A 2ZFQH 1FPHH 4Q80A 1YLDA 2G5NA 2Y80A 1UTNA 2QYIA 4MG3A 3A84A 2ZU4A 1LO6A 1AUJA 1E34B 1HGTH 3PO1C 2OTVA 4UONA 1YPKH 1BOQA 4K8YA 1TBQH 1TX6A 4X8VH 5DP5A 4OGYA 1C1VH 1Z6EA 3ZZ7A 2CF9H 1NPMA 2AERH 4TPIZ 4NA8A 1N6XA 1Q31A 1B0FA 1LVBA 3M3VA 2BX3A 1TX7A 4ZROA 1GVKB 2VGCC 1O38A 2ZU1A 2HGTH 1FXYA 1AQ7A 4ISIH 2ZO3H 1P3EA 1ZTLA 2TRMA 1UVUH 1TWXB 3EA8A 4JMYA 1CHOF 3V3MA 1ZGVA 5J4SA 4FUBA 1DT2A 1OP8A 4GSOA 3IWMA 1G36A 1UK4A 2PUXB 2VIPA 5FBIA 1RTKA 1HAIH 5FPYA 5EXMA 1WAYB 5A8ZA 1YPEH 2ZGHA 2G5VA 3SJIA 2NU4E 2BDIA 3EAJA 3SU5A 2BY7X 4JK5A 5AVDA 1ZMLA 1JIMA 1C1MA 1GGDB 4BANB 1DSTA 2Z9LA 4BNRA 1ZPZA 3ZZ5A 2NU1E 4E7RG 2G52A 2QIQA 2BLVA 3UNRA 2GCTB 1GJ8B 1JXPA 1MBQA 3SO3A 1GG6B 5K0HA 3KQDA 2HPPH 2ZTYA 1XUFA 2PLXA 2G81E 3SN8A 1QTFA 1BB0B 2H1UA 4I8HA 1Y5UT 1EZXC 3QO6A 3QK1A 3QUMP 1SLVB 4K1TA 3LDXH 4ZKRU 1Y3YA 1ELAA 1AHTH 1D3TB 2ODQA 2O8WA 1DXWA 1FAKH 3BTQE 4GHQA 2CXVA 1PQAA 2FS9A 1BMMH 4B73A 1SGFG 2AIQA 3TGJE 2NU2E 2A32A 1TRNA 2VH0A 4Y7AA 4ABJA 1GI8B 5SGAE 1Q3XA 3SU6A 1HXEH 1GJ9B 1FY5A 1T4VH 2A7HA 3P8GA 4X1NU 3SV2H 1NTPA 3RXBA 2Q6FA 3M5MA 1QBOA 1ZOMA 1PPGE 1S82A 3SORA 1ELVA 2ALPA 4J2YB 4A5TS 2EI8A 1XX9A 4ZHAA 1TYNA 3DFLA 2FPZA 1OSSA 1H9IE 1MQ5A 2CMYA 3EE0B 4ABAA 3NXPA 1F5RA 1BCUH 4XBBA 4OS5A 2BD5A 1IQMA 1WYKA 1XUHA 1B0EA 3MH6A 4MLFB 2EA3A 5A09A 3RDZA 2C90B 4I8GA 4AYVB 1XUJA 2VIQA 3LOXA 1TAWA 2CGAA 1RIWC 1CGIE 4A7IB 1C2HA 3KEEA 3SI3H 1MU8B 1C2JA 1ESTA 2FYRA 4FUEA 2J38A 5C5OA 1O2RA 1CSOE 3U69H 1QL9A 5E0JA 4B74A 1FUJA 1FIZA 2G51A 5EW2H 4YZUA 1FN8A 4MNXA 1EAWA 2BZAA 3MU5A 1UK3A 5CHAC 3RXFA 2Y5FA 4FUGA 3LGVA 4DVAU 1S81A 1O3KA 5DKMA 1PQ7A 5I46H 1IQHA 1YM0A 4Q7XA 2HOBA 1DE7H 4JZDH 2FIRH 5JYIA 2UUKB 1ZPCA 2ZTXA 1CA0C 3QGNB 1SOZA 2CV3A 2GZ8A 1MZAA 3FP8E 3LKWA 2FWWA 1QQ4A 1ANCA 1FMGA 8KME2 1CVWH 1C5LH 1K9OE 2XC0A 3TJVA 3ZYDA 4LZ1H 2H2ZA 2PKSC 1YLCA 2BDGA 1F5KU 1BRCE 3PWCA 4B76A 3BTEE 4JZEH 1TOMH 1D6RA 3TJUA 1WV7H 1K2I1 1TGSZ 3W94A 1QB6A 2ZPRA 1DX5M 1YPHC 3A80A 1F7ZA 2V0BA 1O3GA 2ZQ1A 1A0LA 1AKSB 6LPRA 3TK5A 2QV1A 3V13A 3LH3A 2BQWB 5FBEA 1O3LA 1QRZA 1E38B 1RJXB 2VIWA 3GCHC 1AGJA 1NFYA 3R0FA 1XVOA 1HNEE 2GMTC 3SU4A 1EOJA 4FU7A 5C1XA 1SGQE 2SGDE 1P2MA 1O3NA 1SB1H 1C5WB 1MTNC 3Q77A 1DICA 1RIWB 2WPMS 3GDSA 3DA9B 1EXFA 1LHFH 2QC2A 1UTKA 1GHYH 3BTFE 4GLYA 1KXAA 3MOCA 1PPZA 3GY7A 3P95A 5FX6A 1ARCA 5DPAA 1P04A 5JBAS 5EGMA 3M61U 5DGJA 1O31A 1EJMA 2WPKS 3MFJA 1SHHB 3EGKH 5CHAB 1EX3A 1NO9H 4NWKA 3A7TA 3RXDA 3BTDE 1B5GH 3TGIE 1SOTA 3E8LA 3AW1A 1C1SA 2V35A 4GAWA 1O3JA 3RXIA 3BG8A 2H5CA 4OGXA 1A3EH 1AKSA 2BTCE 1WTGH 1ETSH 4OS4A 8GCHF 1QBVH 1CA0B 4OS2A 3RXJA 3H7TA 1DLKB 4UD9H 1GBJA 1JOUB 2YNBA 1EAIA 1EQ9A 2DE8A 1L2EA 4HI3A 4I7YH 3RU4D 1Y59T 3SU1A 4LZ4B 4IC6A 2PKSB 1TGCA 2XCNA 1GHAG 2WYJA 1O3EA 1ZJDA 1MAXA 3KQEA 4FUJA 2PHBA 1PFXC 4KP0A 2GCHG 7ESTE 1L1JA 1GBLA 3LH1A 5TJXA 5ETXA 1KXBA 3BEFB 4MPVA 3UR9A 2V3OH 3GISB 1IQIA 4K1SA 1V2MT 4I8LA 4KKDA 2FLRH 2BY6X 1BJVA 4MNVA 1SMFE 1W7XH 3RXQA 1O5DH 1FJSA 1C2LA 4YT7H 2GMTB 7GCHG 1BT7A 2ZGXH 4YM9A 1F2SE 2ZDKA 2G8TA 3P70B 1TQ7B 1MTNB 1QA0A 4JK6A 3RXRA 1QRWA 4Y8YA 2OC0A 1CT0E 1SGDE 2FP7B 4X2XA 1BMLA 1EPTB 5JDUB 2BB4A 1EASA 4NSYA 2SNWA 1SGNE 3UREA 1HAYB 2ZDMA 1ACBE 4ZAEA 2FS8A 5GDSH 4TYDA 4A92A 2VJ1A 2QXIA 2EI7A 1LMWB 1IQFA 1W0ZU 3GCTG 2WPJS 4J1YA 3O8BA 4JYVH 4YTAA 1V2KT 2VVUA 1HAVA 3KN2A 2C4FH 4DIHH 3T25A 1Y3XA 4GCHF 2UUYA 3W95A 1ANEA 1VITF 1GWAA 2I6SA 3S0NA 1WQVH 2ZHWH 1C5OH 1AUTC 4DG4A 1O3OA 5LGOA 3UOPA 5JB9S 2I6QA 1UTJA 2FOBA 1K1MA 5IDKA 1PPCE 4NA7A 3KQBA 2HNTE 3Q3XA 3RXKA 2AIPA 2PW8H 4RSPA 1VJ9U 1C1NA 2Z3CA 4BAHB 4O3TA 3BTTE 1E36B 3NK8A 3VFEA 3VB4A 1P9SA 2BD8A 1Z1IA 4NIXA 1NRQH 3P8NA 1J17T 1S5SA 3MO3A 1TGNA 5EXLA 2YOLA 1BMAA 5A0BA 5DP7A 3SI4H 4ISNA 4HFPB 1YF4A 1MKXH 5PTPA 3NKKA 3KGPA 8ESTE 1TMBH 1JMOH 2ZCHP 1THPB 4FUIA 1TMTH 1P10A 4K5ZA 1K1OA 3AW0A 2WPLS 2P16A 1P0SH 3BSQA 1P57B 3KCGH 3OTJE 1MZDA 3GY8A 1AO5A 1FAXA 1YGCH 1HIAB 1A46H 1H4WA 2FYQA 4BXWA 1AZ8A 1SSXA 4DCDA 4D9RA 1O2IA 3L33A 5A8YA 1P11E 2ZPSA 3FVFB 4Y0YE 4CREA 2HRVA 2A2QH 5EXNA 1GHBG 3MO6A 2Y7ZA 4Y6DA 2CN0H 1MCTA 2XBYA 3T5FH 1OWKA 5T6FA 1DWBH 2GX4A 3SBKA 1TGTA 1SLXB 1G32B 4CH2B 2AYWA 3LPRA 4X8SH 1E0FD 2BY9X 3E6PH 1GBKA 5C1UA 3SNCA 1WOFA 4I8JA 2IJOB 1GI4A 1E35B 4WMEA 1BDAA 1GDUA 1O34A 2F9VA 4WH6A 3Q3YA 2J9NA 1UTPA 2ANWA 1SBWA 1HIAA 1TNJA 1K22H 5JBBS 4I31A 1P02A 2BD7A 4WMFA 4PROA 3S9AA 4RN6A 3OY6U 1YP9A 1SL3A 3HK3B 3SV9A 4CRAA 4X0WU 1UMAH 1P06A 1NFWA 1TMUH 4BAOB 4Y79A 3TJNA 2ZHDA 3BTKE 4GVUA 2V6NA 2ZWLH 3ZV8A 3SUFA 2VNTA 4BAQB 1Y5BT 1GDQA 3D62A 1W7GH 1C5QA 1TLDA 1IAUA 5C2ZA 3RXUA 1BA8B 1HAHH 1O32A 4IGDA 2ZHEH 1DWEH 1G3EA 2A2XH 1SQTA 2PV9B 2ZCLP 1SVPA 5E0HA 2ZECA 3PMHB 3GICB 1GL1A 4AFZA 1A5IA 1NFXA 1AIXH 2VU8E 1PYTC 2Y5GA 2VH6A 1G37A 1NS3A 2EEKA 3OY5U 4CRCA 1UCYK 3M37A 2M5TA 3LIWA 3LGIA 1EB1H 2OINA 1C5PA 1HAGE 3QWCH 4NGAH 1HYLA 4D7FA 1EKBB 3JZ1B 1MBMA 3CS0A 3LT3A 1GL0E 1GJ5H 1GI9B 3VB5A 3PMBB 4A1TA 1ZZZA 3ODDA 1C1WH 1C2DA 6CHAC 1TOCB 2ZU2A 4GPGA 4ABIA 4UDWH 5GWZA 4KGAA 3UOUA 1S85A 1GMDG 4JCNA 2JH5D 1Z6JH 4VGCC 3TK9A 2Q6DA 5HM2A 1CU1A 2HWLB 3F9FA 1N1LA 4X1QU 4NA9H 1AVGH 1KTSB 3M5NA 1O0DH 2ZDVH 3PTNA 3LJOA 3N7OA 4JYUH 3SJ9A 1MKWK 5GCHF 1X7AC 3MWIU 3K6ZA 4X1RU 1RS0A 3A8DA 1H1BA 1G3BA 1P2KA 3EA7A 1E37B 1S84A 3QZRA 2BLQA 4DY7B 1S0QA 3MH7A 4Y11E 4UEHH 1FN6A 2PR3A 5EG4A 3RLWH 3FP6E 1C2IA 1GBTA 1VR1H 1GMCF 4O03A 1JRTA 5A8XA 1GHZA 1K1JA 2W3KA 1O5BB 1Q2WA 2TIOA 4TWWA 1H9HE 1IQJA 3B8JA 3SGQE 3U9AH 4B1TA 5GXPA 1PPHE 2VINA 3C1KA 2Z94A 2SGQE 1C5MD 1MTVA 2OC1A 4XSKU 3MYWA 1HAXB 5C67A 3SUGA 4I8KA 1KY9A 2OQUA 2BM2A 1UHBB 2FODA 2ZHFH 1EJAA 1KDQB 4FU8A 3SU0A 1EATA 1AU8A 4WF8A 3ZZDA 5DK1A 2Z9JA 2PSXA 3ZV9A 3T2NA 4X6PA 1Y8TA 3BIUH 4UFEH 3MI4A 3ELAH 4MNWA 4BOHA 1ANDA 3CP7A 4AGJA 1G9IE 1TB6H 1GCTC 3P92A 2BLWA 1Z8IB 3RP2A 3ZZ8A 4H4FA 4X8UH 4M7GA 6CHAB 1C9TA 2BD4A 4DURA 1TRMA 3V0XA 3BTHE 4FXGH 1P03A 2FI4E 5EQSA 1EB2A 5L2YH 1SPJA 3D23A 4VGCB 1DDJA 1MTWA 1O39A 3BV9B 2J92A 1L0ZA 1D6WA 3FANA 1FY8E 2ZU3A 3A85A 2QGRA 3RM2H 2SFAA 2XRCA 3RXAA 4XFQA 2BXUH 1YCPH 4Q2KA 1KXEA 2BY8X 1TX8A 1WU1A 3SU2A 3E0PB 3MH5A 4IW4E 1O2NA 1T8NA 2ZDNA 1P2OA 1THRH 2FOMB 1OXGA 3HKJB 1V2QT 2FX6A 1KXCA 1LHDH