4FUFA

Crystal structure of the urokinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fufA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fufA01
3Q3XA 5HM2A 3ZV9A 5C1UA 1GHAG 1HB0B 2VWNA 3KQCA 1G37A 4AGJA 1K1JA 1V2LT 4I8GA 1O3NA 2J95A 3U98H 3I78A 1DXPA 4FVDA 3L6PA 1QY6A 4MQAA 4Y7AA 2P95A 1GCTC 1GVKB 1UHBB 2R0KA 3TGJE 4IGDA 1AHTH 1GBMA 1OXGA 3M5NA 3PLKA 1C9PA 5DK1A 2GCTC 1AE5A 2WPLS 3F9EA 3UQOA 1P57B 1SLXB 3E0NB 1EOLA 2YOLA 4B75A 1AD8H 1MTSA 1GMHG 3MU5A 4X8SH 2AS9A 1ZGIA 3NPSA 3TJOA 4QT8C 2HWLB 4AX9H 3H5CB 4FUIA 4I8HA 3DHKH 2TGAA 3ZVAA 2PUXB 2ZDNA 4A1VA 1ELEE 2Y7ZA 5HM9A 2ODPA 1GHYH 4E05H 1CHOG 1ZHMA 3GDUA 1ZPCA 2ALVA 1FY5A 3A82A 1LCYA 4DIIH 4ZXXH 2PUQH 1TX7A 2QY0B 1ELCA 2ZDVH 3ZVDA 3SV9A 3P92A 3VB5A 3SW2B 4J1YA 1GJCB 1PQ7A 1B0EA 3GDVA 2J9NA 1O2HA 1MKXH 7ESTE 1G3CA 1GL0E 5AHGH 2C93B 4FU9A 1ABIH 1SGDE 2ULLA 1IQHA 1P04A 1MU8B 1Y3WA 1GHBF 1F7ZA 4FUFA 2FX4A 1QL7A 3GY8A 1HUTH 1OP2A 1ZHRA 2UWOA 4I31A 1C2GA 1Q2WA 1ZMLA 3MH4A 1P06A 1MCTA 1YPHE 3PMHB 1XMNB 2HOBA 4UFDH 3Q00A 3CENA 1KIGH 4I32A 1MTUA 3DFLA 3IWMA 1WOFA 1KTTB 1A5HA 3PMAB 4JK6A 1TLDA 3UWJH 1ANCA 4XBCA 1AU8A 4OS6A 4JK5A 3SU4A 1O3HA 3RC4A 3A8BA 2P3FH 2ODYB 1V2NT 7KMEH 2HALA 3GISB 2H5CA 8LPRA 4YLQH 1DE7H 3KCGH 2F9NA 2EEKA 2VIOA 4X6PA 4X1RU 2VIVA 1THRH 1G30B 3GY7A 4K1SA 1A5GH 1OYTH 2BZ6H 3CS7A 1D3QB 3K6ZA 5DPAA 1CHGA 3FAOA 1CT4E 2Q1JA 4NWLA 1BTPA 1Y3UA 1LMWB 3BSQA 1ELVA 3SUGA 3RXTA 3TPIZ 1BBRE 4DGJA 5HYOA 2HNTC 4Y0YE 2Y7XA 1NRPH 4JZFH 1AWFH 1C5NH 3BTFE 5E0GA 1GBFA 1ZGVA 3RU4E 3OX7U 4WMDA 1E38B 2G5NA 2WPHS 3RXMA 1GDNA 2IPHA 4KELA 2VB0A 4X6OA 3D49H 4MNYA 4HI3A 3VGCC 1ZPZA 4ZHAA 1K1OA 1O2LA 2BY8X 3ZYEA 1LDTT 2GKVE 2TBSA 3HATH 1SGYE 5FXLA 3OTJE 2TGTA 4IC6A 4GUXA 2F9BH 3I29A 1HAXB 4JZEH 3GDSA 5TCAA 1P8VC 2R2MB 1LHEH 4NSYA 1HAVB 5JBBS 1JXPA 4X1QU 4RSPA 1BRAA 2ZGHA 3RP2A 1TONA 4IN2A 1GBHA 2LNCA 2QA9E 1FPCH 4FU8A 1HPGA 5EOKA 1BMNH 1ZYOA 2I6SA 5L2ZH 1OWDA 4GCHG 4K5ZA 1IQJA 1XKAC 2UWLA 1EASA 5T6GA 3P8OA 4AG2A 1BITA 3GOVB 1AZZA 2PKAB 1ZRKA 1SHYA 3MNCA 5JBTA 1WAYB 4AYVB 3VFEA 2XWAA 2ZU3A 1SQAA 2VWMA 3QZQA 1BOQA 1WYKA 1GDUA 1EZXC 1KLIH 2FOMB 2FYRA 3M3TA 1BMLA 3EA8A 1IQMA 1TBQH 4Y71A 1EUFA 2BD9A 1MU6B 5G4BA 1UO6A 4BTIB 1L4ZA 1FMGA 1C1UH 1NT1A 1V2TT 5FCRA 2BVXH 4NA8A 1E35B 4UD9H 1GMCF 4NIYA 3S7KB 4DCDA 1KY9A 1W11U 3ELAH 1Y5AT 4UONA 2ANMH 3SZNA 3LKWA 1EKBB 3HKIB 5FX5A 3A8AA 3ZZCA 1D4PB 3HK3B 3SHAH 2QGRA 2P94A 2W7UA 2FYQA 3UNSA 3BTTE 2Y5GA 2V3OH 1GL1A 1TNGA 1HDTH 1LHFH 4IW4E 4YTAA 1H1BA 5C5OA 1UVPA 1Y5UT 2O8MA 5K7RA 1TGSZ 1IQLA 1TAWA 2B9LA 2FOBA 3TIUA 1TMTH 3LC5A 2ZHEH 1DWEH 4ABGA 4YT7H 5I46H 1TQ7B 1P2QA 1K21H 1Z8IB 3QGJA 1BTHH 3SBKA 2R3UA 1AO5A 1O5BB 3Q3KA 4F4OC 4OS2A 5FPYA 1C5UA 4UFGH 1JWTA 2B5TB 3A88A 3PO1B 3EYDA 3SNCA 1VITF 3TGKE 2RDLA 3OSYA 5A8ZA 1HAHH 1TX8A 2Y80A 1WU1A 2SGPE 5E2PA 4K60A 2BD4A 1ZSJA 1OWKA 4FVBA 4UFEH 1GBEA 1T8NA 1A46H 1O3CA 1W0YH 3ZVBA 4K3JA 4I8LA 3AAVA 1NY22 2BLVA 1C2LA 1J9CH 1Z1JA 1BDAA 1ID5H 1KYNA 2ZTXA 3JZ2B 2H9HA 3RMMH 3MYWA 2OC7A 3TVJB 1XUHA 1DANH 1O32A 2QV1A 4X1PU 1GCTB 1EPTA 1P09A 1QJ7B 2ZU5A 1GJBB 1AB9B 1MBQA 1SGCA 3NWUA 1AFEH 4X2YA 1TOMH 3DD2H 1ARCA 1HIAA 1FJSA 4CBOA 1X7AC 1PFXC 2QXJA 1H8IH 4DY7B 1DWCH 1N8OC 2C8ZB 4YLUA 2WINI 1P0SH 1QJ1B 4YOIA 3SU2A 2ZPQA 2FOEA 4D7GA 1QJ6B 1AVGH 1H4WA 1T8LA 2WUBA 2ALPA 1SI5H 3MFJA 4CRFA 1P01A 2OTVA 2UUJB 4JZIA 1S0RA 4NWKA 3UTUH 2BDIA 1GBBA 1PPBH 3RXIA 3SV8A 2AERH 3V12A 2BDYA 4CREA 1C1OA 1A4WH 2A7JA 1SFIA 3JZ1B 2HRVA 4JYUH 1RD3B 5F8ZA 2OXSA 1LPZB 1V2UT 1K28D 1TALA 1S6HA 3VPKA 4WVPE 2VINA 3ATWA 5L30H 2B0FA 2GTBA 2IN2A 2ZPRA 4ZKSU 4LZ1H 1H9HE 5C2ZA 1CBWB 1P2JA 2XXLA 2TIOA 5LPEA 2GX4A 3ZZ3A 5EW2H 2O8LA 1IQNA 2A4QA 3CP7A 5A0BA 2FZZA 3SUFA 4ZAEA 1UK3A 4INLA 1AVWA 1ELDE 3GCTG 4F49A 1TMBH 3FP6E 5DP9A 1A1RA 1BTYA 1TRYA 2V35A 1DS2E 1LPKB 1C5OH 1TNLA 2Z9LA 3BTEE 3AAUA 3RXQA 1UCYK 2HNTF 1G36A 1NRRH 5E0HA 8KME2 3ZVCA 4ZKNU 2F83A 1QNJA 2H5DA 4IS5A 4OS5A 1F2SE 1FIZA 1AQ7A 4BTUB 4K8BA 5JB9S 4HGCA 2OINA 1QB1A 5DJ7A 4AFSA 2ZDMA 1KSNA 3RXSA 1O39A 3LGIA 4GHTA 3ZZ6A 2P3TB 1O2WA 2BHGA 3M7QA 1CA0C 1EAXA 4XSKU 2XW9A 1MBMA 2ZTZA 3C27B 4JZDH 1TB6H 1O2JA 2CHAB 2ZEBA 2XCNA 1TOCB 2IOTA 1GHZA 1ESTA 1YPLH 4GSOA 4WJG2 1TFXA 1V2VT 2ILNA 1EP5A 1MUEB 3GICB 3RM0H 3TITA 4DVAU 1CSOE 2PGBB 1C4Y2 2A0QB 4AFZA 1FPHH 1C1MA 3EGKH 3TLOA 1F5KU 3V3MA 3GY5A 2NU1E 1SVPA 1EAUA 2CV3A 2VIQA 4K1TA 3T28A 3T62A 3A84A 1O37A 1RTKA 1O2IA 4DIHH 4ISNA 3S7HB 2ZI2H 1C5LH 5EQSA 1E0FD 3ZYDA 1O35A 1QGFA 1F5RA 2ZFFH 1XVOA 1P2NA 1LPGB 1GBLA 1SOZA 1ZSKA 4K69A 2VWOA 3ZZ9A 1G2LA 2ZCLP 2ZHQH 3RXOA 3QO6A 4MLFB 4SGAE 3E16B 3IG6B 3M3SA 1GHWH 1MZDA 1S85A 2PWXA 2VJ1A 1HRTH 1MTNB 1RTLA 2OQ5A 4B76A 2ZU4A 1C1NA 1K2I1 1Z7KA 1O3PB 1W2KH 2J92A 1V2JT 2B8OH 1HV7A 1ANBA 3RXBA 4U2WA 2VH6A 5DP5A 2PLXA 3PV4A 3W94A 1GBDA 3A81A 1BTXA 2J2UA 4AB8A 1SPJA 5I25A 4NIWA 1V2MT 3PLBA 1GGDB 1IQEA 3F1SB 4TPYA 3BG4B 2OBOA 1H8DH 1HJAB 3MI4A 4KTSA 1ELAA 3K65B 3BTDE 3LDXH 1TPAE 4U01A 4B71A 4JMYA 1DUEA 2D26C 3RXUA 3O8BA 4J2YB 1QFKH 3QTVH 1IHTH 1QBNA 2ZCKP 1FY4A 2R0LA 1O3DA 1GBIA 1O3EA 1UK2A 2ANYA 2BLQA 3EE0B 2ZDLA 1K1IA 2ZG0H 3RXLA 2H2ZA 1C5RA 3BIVH 1L4DA 1ZZZA 2WPKS 3LU9B 1FY8E 2WV4A 1EJAA 1TRMA 2Y6TA 7GCHG 2ZGBH 1O3LA 3MOCA 1ESBA 3B9FH 1KDQB 1V6DA 1P03A 3P70B 4I8KA 3VXFH 1UK4A 3M5OA 4Z6AH 2HGTH 4D76A 3SQHE 1CVWH 1O2PA 1MMJN 2J34A 1TGBA 2YNBA 3MHWU 4FUGA 2ZHFH 1RFNA 1UTNA 1B0FA 2GZ7A 3MWIU 3RXPA 4UDWH 4Y6DA 4MPWA 4D9RA 3KIDU 5DG6A 1K22H 3UNRA 3UOUA 2G4TA 2GT7A 3M5LA 2BY5X 2ZFTA 4AN7A 9ESTA 2BOHB 4ABFA 1NRNH 2CF9H 2GMTC 4K2YA 1RGQA 3VB6A 1GBTA 2Q6FA 3SU5A 1IQGA 1XX9A 1GDQA 1V3XA 5ESBA 2ZQ2A 3M61U 1DY8A 2WPJS 2XTTB 3SU1A 2EC9H 3ODFA 3A8DA 1K1MA 3S69A 2SGFE 1OP8A 5EPNA 4YESB 1RIWC 1YCPK 1TGNA 4LZ4B 4JCNA 3TJUA 2AIQA 2BDAA 4NSVA 2F9OA 2J94A 3SV6A 5FBIA 4RKOB 2ZU2A 2THFB 4AFUA 1D3TB 2HPQH 2BY9X 1O5GH 2A4RA 3DFJA 3KQDA 1DSTA 3D23A 1TE0A 1W12U 2XC4A 3RMNH 1AWHB 1SFQB 4XBBA 2GGVB 1GBAA 1NM6A 5GXPA 1OP0A 5DGJA 1MQ5A 4GVUA 1HJ8A 4I7YH 1EB2A 3UQVA 2K1QA 1YP9A 5T6FA 1C2KA 3KHVA 1BMMH 2ZF0H 3MNSA 5AFZH 3K6YA 4ABHA 3MNXA 1C1PA 1HNEE 4CRGA 1QB9A 3SUEA 1CHOF 4KGAA 2FOAA 2EA3A 3OU0A 1O30A 5JYIA 2G00A 4H42U 2BYAX 1QRXA 1F92A 1N8OB 4X2VA 5EQRA 3SU0A 3LGYA 2FI5E 3UWIA 4D9QA 4NIXA 1F5LA 2GV6A 2NU2E 4ISHH 3PLPA 1XUFA 1GJ6A 1CQQA 1LTOA 1DWBH 3B23B 1VITG 4Z0KA 1O2RA 3KQBA 1MD8A 5F03A 2C8WB 1BRBE 1QR3E 6LPRA 1H9LB 3MO3A 1E34B 4XBDA 1BCUH 1LQDB 3ZZBA 1SQTA 1QBVH 1DVAH 1GMDG 1CU1A 1DWDH 5PTPA 1QBOA 2GV7A 1WTHD 4ABDA 4CR5A 1W7XH 4DT7B 1NC6A 5SGAE 1ZMJA 2QN5T 2Z6BD 2A2XH 1F0SA 2PTNA 2PTCE 3U8TH 1AFQB 3NK8A 1NFXA 2C3SA 3HK6B 1SGPE 5J4SA 1Q3XA 2Y5HA 1O2QA 3GCTF 3EDXB 3PO1C 3B8JA 4BANB 2BY6X 5JB8S 1AUTC 3ZVEA 1D6WA 5DP4A 3HGNA 1GI6A 1GJ4H 2W7SA 5FBEA 1C4V2 1TQ0B 2ZGCA 4NA7A 1TNHA 1PPCE 1SLUB 5TCCA 4X8UH 1VCWA 3A80A 5CMXH 1HAZB 1C9TA 1EJNA 2GVFA 1O2XA 1P05A 5JBAS 4NFFA 3A86A 2BXUH 1S6FA 1IAUA 2VGCB 1EJMA 1C2MA 4WY3A 1BA8B 1SGTA 1RRKA 1SGFG 4FUJA 1HGTH 1GJ7B 3I77A 1BBRH 1C1TA 3O8RA 3NXPA 4FXGH 1NO9H 2SGAA 5EXMA 1YPKH 5T3HA 1ESAA 3E1XB 3EA7A 3PTNA 3S9AA 1O3KA 3T5FH 2R3YA 2DE8A 1GBKA 1TNKA 5F8TA 3GCHC 1BTUA 1NN6A 2M5TA 1FDPA 1GI5A 3P6ZB 1C2FA 1AN1E 4YM9A 2GP9B 3ZV8A 2VIDA 1ACBE 2OCVB 3KGPA 1GJ9B 1OKXA 2BLWA 1QURH 4R0IA 2XBYA 1KTSB 2EI6A 4DOQA 1GI9B 2TRMA 3QLPH 1Z71A 2D1JA 1L1GA 1ELBA 3U1JB 1NFUA 1VGCB 2XC5A 1L2EA 2PKSC 4WWYA 1P12E 2CMYA 1BUIA 2ZECA 3FZZA 2OUAA 4BTTB 4I33A 2SFAA 1EPTB 1B7XB 1QA0A 3UOPA 3SI3H 2P8OB 3T26A 1V2ST 1SGIB 3DUXH 8ESTE 2FEQH 1LVBA 2LPRA 6GCHF 4D7FA 3UFAA 2XRCA 1UVSH 3SU6A 1CE5A 2PW8H 1CGJE 5AVDA 2G51A 2AFQB 2SGDE 1ABJH 3F9HA 1IQIA 2RCEA 2GZ9A 2ESTE 1LHCH 1GI1A 3TK5A 7LPRA 5LGOA 1FV9A 5BPEA 3SGAE 2PSYA 4BOHA 4BNRA 1C5WB 1IOEA 3MO9A 4Q7YA 1MCVA 3OYPA 1TBZH 4CR9A 2BMGB 1SGRE 1PPGE 3BTKE 1O3GA 4E7RG 1P10A 5AF9H 3PWBA 3RXRA 5FCKA 1QHRB 1DFPA 1FLEE 3ZVFA 1S5SA 1VITH 2UWPA 4KTUA 2SGQE 4TY7A 1NTPA 1MTVA 1HLTH 3F9FA 3LH1A 3VEQB 1NU9A 4ZUHA 1GI3A 1VCQA 1LKAA 5GJ4B 1Y3VA 1YPJH 2Z3CA 3BEIB 1UCYE 1GMDF 2PFEA 1HAPH 2AGGX 2XC0A 1SLWB 4X0WU 4MPUA 2A1DB 3RXEA 1A5IA 4NG9H 1O2GH 4B1TA 2IJOB 2ZDKA 3P95A 1SGEE 1LVYA 1W0ZU 2FOFA 5JDUB 1FNIA 3RU4T 3ZZ4A 1DITH 1J8AA 5GCHF 3SOSA 4B2AA 1CGHA 1HYLA 1MTWA 2FIRH 1CBWC 5ESTE 2FI4E 4DJZB 2P59A 3M7UA 4FUCA 5DP6A 5CHAC 1GJ8B 1DLKB 1UMAH 1A0HB 1TNJA 3E90B 4KKDA 1FN8A 2VVVA 3T25A 1DLEA 1AIXH 2V6NA 1EZUC 2XNIA 3E3TA 3Q77A 4HFPB 1PYTC 4AZ2B 3E6PH 2ZHWH 2QXHA 1O3AA 5F8XA 2FPZA 1MKWK 5J4QA 2FOGA 1QB6A 1GWAA 2HLCA 1Y3YA 4AORA 4KTCA 1O38A 3STIA 1BHXB 1NRQH 1XUIA 1YGCH 2ODQA 1NU7B 1T4VH 2BDHA 3PM3A 1V2OT 5JPMH 1S83A 4MTBA 2XWBI 3LGUA 2QAAA 1O2YA 1EB1H 4INKA 3SQEE 4Q2KA 5A8YA 1FZZA 4Y76A 2A5KA 3MMGA 5GDSH 1KLTA 3ESTA 3RLWH 3LIWA 3TGIE 3QGNB 2ZA5A 2B7DH 4NA9H 2PKAA 1V2PT 1JIMA 2BX4A 1L1JA 2FLBH 2ZIQH 1UVTH 2A32A 2FWWA 3SGQE 2FM2A 2O8WA 3PROA 2ZCHP 1VR1H 1G3EA 1SC8U 5L2YH 1C5MD 8GCHG 4M7GA 2QCYA 3RDZA 2OBQA 4DURA 4LOYH 1XUJA 2A45B 1K1LA 1TPPA 2H9TH 2CGAA 4OS7A 4TPIZ 1YKTA 3AW1A 3TH3H 4UEHH 2WYGA 2OC1A 3RXKA 1Y8TA 3RC5A 4AYYB 2Z94A 3GY3A 2SGEE 2DE9A 1SL3A 3AVZA 1W14U 1U6QA 3ATLA 1SQOA 1ORFA 1KXDA 2GCTB 3MU1A 1QQ4A 1ZOMA 3RUOA 3URDA 1O3OA 3ATKA 1SOTA 3PTBA 3LPRA 2GCHF 1C4U2 2BY7X 5LH8A 1IHSH 2WPIS 1GBCA 2C8XB 1HAOH 1FUJA 4ESTE 1G2MA 1CT2E 1OWIA 4FUBA 1EX3A 2BVRH 6CHAB 1EAWA 1DM4B 3A7XA 4NIVA 3SGBE 1GBJA 3SJKA 3E8LA 3HPTB 1C2IA 1TWXB 1SR5C 3TNTA 4HTCH 4XE4A 3GCNA 1O2SA 4ZH8A 2ZKSA 4FU7A 1ELTA 3SJOA 1MZAA 3ZZ7A 4ZROA 1YLCA 1T32A 3SU3A 1C1SA 3U1IB 4INHA 3U69H 4GCHF 1C2JA 1TMUH 1EOJA 2OC0A 3UPEA 2WV5A 4ISIH 2CJIA 2V3HH 1A3BH 3ENSB 4WMFA 1GHBG 1GHXH 4D8NA 2SNWA 3T2NA 1FQ3A 1OOKB 2FLRH 1P3CA 2BLOA 1QQUA 5F6MA 2Y82A 5DP3A 5FAHA 2ZNKH 1XXFA 3BF6H 1BJUA 1Z8JB 6CHAC 5CHAB 4MNVA 2RA0A 3SI4H 3NKKA 3VB7A 2I6QA 1BQYA 3F9GA 2F91A 4SGBE 2NU4E 4TWWA 1UJ1A 4JYVH 1FI8A 5A2MH 2BDCA 2BD5A 4BAHB 1G9IE 1AVXA 2QF0A 3FP7E 1BRCE 1D6RA 1KXAA 1S84A 1LO6A 1ARBA 1B5GH 1ZLRA 1JRSA 3GYLB 3R0FA 2A5IA 3ATMA 3LGTA 1C1WH 1TYNA 3ZZDA 5C67A 1O2MA 1O3IA 1JIRA 5A0CA 1MKWH 3QN7A 3T29A 1MAXA 1ETSH 1BB0B 5EXLA 1O2ZA 3H7OA 1LVOA 2P3UB 2XBVA 1UTPA 1YBWA 3A7TA 3RMLH 1Y59T 1O31A 1C5QA 3LONA 4ABBA 2STAE 4MPVA 3RC6A 3URCA 2DUCA 3VGCB 3KL6A 2TGPZ 2G52A 4Y11E 5EG4A 1T8MA 1G3DA 2QXGA 3SJ9A 2W26A 1UTJA 1ZHPA 4Y7BA 5GPIB 1M9UA 2A7HA 4UFFH 1HAYB 2AEIH 3LT3A 4FUEA 4Y79A 4H6TA 1K1PA 1AE8H 1NESE 2AIPA 1JBUH 1FAXA 1WQVH 3TJNA 2FMJA 1MAYA 2FTMA 1NRSH 3M36A 3H7TA 2Z9JA 6ESTA 1O5DH 4GPGA 4BAMB 3NCLA 2BD8A 1AGJA 2ANKH 2Z3EA 1XVMA 4DW2U 4WXVA 4XDEA 2BQ7B 1BMAA 4BXWA 4E7NA 1TA2A 2P8OC 3FFGA 2W3IA 1EAIA 1AKSA 3RXHA 1P2KA 3RLYH 1ELGA 1UHBA 4IC5A 1DXWA 4X6MA 1WCZA 3MH7A 3MU0A 1P2IA 4AFQA 2Z9GA 2ZFQH 3E91A 1VJAU 2PKSB 3KEEA 1VGCC 2ZDAH 2GCHG 1T8OA 3P8GA 1WV7H 3A7ZA 2EI8A 1GPZA 1TABE 4E06H 1NFWA 3BEFB 1O5AB 4X1SU 5GIBA 2C8YB 1IQFA 3SNDA 1UTLM 1O34A 2AGEX 3EAJA 1O2UA 1GHVH 1Z1IA 1QIXB 2G55A 5A09A 1J14A 4BXSA 1S0QA 5IDKA 1YPEH 3PMJA 1EQ9A 2BB4A 4IBLH 5HXFA 1F0RA 3V13A 1O36A 1AZ8A 2ZFRH 2CXVA 4A5TS 2EI7A 3A87A 2AYWA 3SORA 1TGTA 1QRZA 2PSXA 4U30A 1O2KA 2RA3A 1YF4A 3RXAA 2BOKA 3U9AH 3UR9A 3P17H 3S9CA 1TIOA 1ZMNA 4YT6H 3FZDA 3DT0H 2P93A 1O2NA 3TK9A 1DY9A 1N6YA 1LKBA 2F3CE 4H4FA 2VGCC 3MU4A 1D3DB 3MNBA 4AGKA 5LPRA 4Y10E 1RTFB 3EA9A 1KXCA 1GG6C 3U8OH 3Q3YA 3BN9A 1TA6A 1D9IA 1EP6A 1T4UH 1WQSA 2FODA 4ISOA 1AI8H 1CA8B 1PQAA 4X8TH 4K1EA 1L0ZA 3D65E 4OS4A 3A7YA 3N7OA 2FS8A 1ANEA 3M35A 1V2QT 1FONA 1PPEE 3GYMA 2GZ8A 3KF2A 2PHBA 1Z6JH 4TY6A 2QF3A 3O8CA 4IN1A 1IQKA 6GCHG 3A85A 1NFYA 1O3BA 1WBGB 3ODDA 1O33A 3T27A 3V0XA 2BDBA 3HKJB 1UTQA 4CRDA 4Q7XA 3P8NA 1C1RA 2XBWA 2Z3DA 1C1VH 4NGAH 3TNSA 1EPTC 4AOQA 3UUZA 2STBE 4LK4A 2JKHA 2ZFPH 1BT7A 3PYHA 2R2WU 3BG8A 2AMPA 4LXBH 1UTOA 1GMCG 3SHCH 3OY5U 2VIPA 2NU3E 1G3BA 4BAKB 4Y0ZE 4NZQA 3GY4A 3NZIA 1OYQA 4Q7ZA 5FPSA 3TJVA 4O9VA 1NS3A 1RS0A 3TK6A 1HAGE 1HIAB 2ZTYA 1A61H 2C90B 3FANA 3ZVGA 5A8XA 2FXRA 1N6XA 2J38A 2BX3A 1CGIE 3A7WA 3MH5A 3QTOH 3GCHB 1CT0E 2GT8A 2D8WA 1TRNA 2ZU1A 2PV9B 1C5XB 1FXYA 4CH8B 1PPZA 1Q31A 1O3FA 1YLDA 5EGMA 2BTCE 5C1YA 1XUGA 2UUFB 5IYTA 4B2BA 1UVOA 4MVNA 2J4IA 3KN2A 1OS8A 3TH2H 1XUKA 2ZHDA 4OGXA 1O3MA 3R3GB 2BXTH 3BV9B 3RXGA 1Z8RA 3O8DA 3U8RH 5C5NA 4VGCC 5TJXA 3QWCH 3EQ0H 4BAQB 1RIWB 5H4IB 1O3JA 4MNWA 1AY6H 2Q6DA 2G5VA 5EU8A 2G4UA 3SV2H 3UNQA 4WF8A 1YPMH 3GY6A 1TX6A 3GCOA 1L1NA 4ZXYH 2AGIX 1BIOA 2YNAA 1GJAB 5EODA 1E37B 2ZFSA 2QYIA 4DG4A 4CHAB 2C4FH 1C1QA 1TBRH 1AFQC 3M37A 2OLGA 3SNBA 1RJXB 3C1KA 4A92A 1G32B 2WPMS 5E2OA 3BTHE 1VJ9U 4RN6A 3SV7A 1P9SA 1GMHF 2GD4B 2NWNA 2OP9A 2ZC9H 3LC3A 4K8YA 2BZAA 4CHAC 1SBWA 1SGFA 3RMOH 4O03A 2BQ6B 1J15A 1P02A 5DP7A 1JRTA 1FN6A 1DICA 1KDQA 5EQQA 2JH0D 1ZR0A 3STJA 2ASUB 3BTQE 1BTZA 2A31A 1BRUP 1GI0A 1PYTD 1YM0A 1Y5BT 1ZTLA 3RM2H 2A5AA 1ZPBA 2O8UA 3A7VA 1W8BH 4I8JA 4A1TA 2A2QH 1W3CA 3FVFB 2F9PA 3SJ8A 1RXPA 2A7CA 2UUYA 3SNAA 2FDAA 3QDZB 4TYDA 4MG3A 4A6LA 2AH4X 2WYJA 4CRAA 1A3EH 2KAIB 2NU0E 4CBNA 1OWHA 3P8FA 1YPGH 1GI7B 3SNEA 3FP8E 1BTWA 1HJAC 5E0JA 3BG4C 3Q76A 1GGDC 1W7GH 4NZLA 1GJDB 1BZXE 1S81A 1VZQH 2Z7FE 1HAVA 3QZRA 5ETXA 3LGWA 1MQ6A 1ELFA 2F9UA 1W13U 1QRWA 5C3NA 4OS1A 1DT2A 2W3KA 1MH0A 3M3VA 1P2MA 2O8TA 1O2VA 4YOGA 5JBCS 1ZJDA 1CO7E 2ZWLH 3TH4H 2BD3A 4ZKOU 4GLYA 2XBXA 4YOJA 2QXIA 3RXVA 4CRBA 1DSUA 1ETTH 5EPYA 1V2KT 1OX1A 5A0AE 3BIUH 3F6UH 1OWEA 1UCYH 2OQUA 3AASA 3G01A 1C2DA 1YYY1 3SJIA 1UTMA 3LGVA 1NROH 1EATA 2ZGXH 3IITA 2HVXA 2GMTB 4IMQA 4TWYA 2OC8A 9LPRA 3GY2A 2KAIA 4BAOB 2ZPSA 4KP0A 5HMAA 1QL9A 1DUAA 5CE1A 1WTGH 1T31A 1YPHC 2FX6A 3UR6A 4IMZA 4A7IB 3MTYA 3VB4A 1P3EA 1S82A 1ZRBA 2W5EA 3SUDA 2JETC 2VH0A 2VNTA 1A2CH 1O5FH 2BQWB 1P9UA 2GDDA 2VU8E 4A1XA 3MU8A 4AG1A 3S0NA 1ETRH 3UIRA 2CHAC 2BVSH 1XM1A 1HXFH 2Z9KA 1QA7A 4FUDA 3PWCA 2BM2A 1PPFE 2ZZUH 1A0LA 5AFYH 4ISLA 2H9EH 1ANDA 3CS0A 5B6OA 2BDGA 4O3TA 2Y81A 1FY3A 1GI8B 1SHHB 3UY9A 3A8CA 4Q80A 1GG6B 1JMOH 4HZHA 1DX5M 1ZJKA 4CRCA 2VVCA 1YCPH 4ABEA 2FTLE 2BD2A 1UVUH 1THPB 1BHXF 1C5ZB 5DP8A 3ZZAA 2JETB 1LQEA 1YCPM 3QUMP 1DDJA 3M7TA 1A7SA 4Y8XA 2P16A 3SO3A 4MDSA 4NCYA 1OSSA 2GDEH 3BTGE 1HFDA 1O5CB 1WUNH 1GVZA 2TPIZ 2ZQ1A 1O2OA 1TNIA 2QC2A 2SNVA 1A0JA 1EZQA 1PPHE 2WUCA 1Z6EA 3LOXA 4ABAA 1O0DH 1PQ5A 3KNXA 5FHTA 1HJ9A 1YC0A 4GAWA 1ZTKA 1SSXA 2FOHA 1P2OA 4B2CA 1GI4A 2G81E 3A89A 2ZGJA 1MKXK 1H9IE 2VVUA 4O97A 5E8EH 2D2DA 1MTNC 4RKJB 1INCA 3K2UA 4Y8ZA 1C5SA 3MO6A 3BEUA 3QK1A 2FS9A 2QIQA 5LPFA 1C2HA 4Y8YA 1W10U 3QX5H 4R8TB 1BBRK 1KXFA 2JH5D 1SB1H 5GCHG 3W95A 1SGQE 1GVLA 2FP7B 1DPOA 2G8TA 1QCPA 2XYAA 4MNXA 4B74A 4B73A 7GCHF 1N1LA 2HPPH 4NFEA 2PR3A 4GHQA 1HAIH 4ABJA 5GWZA 3AW0A 1C5VA 1XKBC 3MH6A 1MD7A 2CN0H 1C5YB 4WXIA 1SMFE 4X6NA 3RXDA 4ABIA 2CF8H 1J17T 4X2XA 4XOJA 4X2WA 1TPOA 2TGDA 1FY1A 5EW1H 1PQ8A 3F68H 1THSH 5HGGA 1KLJH 4XFQA 1GCDA 1TPSA 5L6NH 4ZHMU 1Y3XA 4ZMAH 3RU4D 1JOUB 1CA0B 1OPHB 3RXJA 4H6SB 1OWJA 1O5EH 1AUJA 2HNTE 1SGNE 1AB9C 4ZKRU 3K9XB 1GI2A 3LJJA 4X1NU 5K0HA 2AMQA 4OGYA 1FAKH 3S9BA 5C20A 1NPMA 3KQEA 1UTKA 1C2EA 1K9OE 1SG8B 3A83A 3VXEH 1DOJA 4ZHLU 1FIWA 1E36B 2R9PA 1HBTH 2F9VA 4ASHA 5ABWA 1NZQH 1V2RT 2XCFA 1LHDH 2UUKB 1AMHA 4X8VH 2O9QA 3HGPA 3NUMA 1GJ5H 2A4OA 1V2WT 1D3PB 5DKMA 5FX6A 4FUHA 1SLVB 4AB9A 1BJVA 1ZTJA 8GCHF 1Z8GA 4WMEA 3DA9B 3BTME 1KXBA 1HCGA 3BTWE 3V7TA 1EZSC 1KXEA 1T7CA 3RXFA 4JZ1A 4PROA 2OD3B 3SN8A 2ANWA 2Z9IA 2BD7A 1EXFA 1P11E 1XXDA 4CH2B 1F0UA 2H6MA 2VWLA 1C5TA 4VGCB 4YO9A 1QTFA 3M5MA 3VB3A 1TGCA 1LHGH 2Q6GA 5BRRE 2FOCA 3LH3A 3PB1E 4MPXA 3L3TA 3ITIA 3OY6U 4JYTA 4WH8A 3ZZ8A 2JH6D 3D62A 4U32A 1GHAF 1QL8A 2RG3A 2AMDA 1LVMA 1ZSLA 2ZO3H 3UREA 4THNH 4WH6A 3RXCA 2ZP0H 2VIWA 3L33A 2A4GA 5T6DA 1HXEH 1PJPA 2FO9A 3TU7H 1AKSB 3ATIA 1J16A 2FESH 1VCPA 2FI3E 5C1XA 4UE7H 3WY8A 5EXNA 3ZZ5A 2PGQB 5FPTA 5DO4H 4O3UA 4YZUA 1O2TA 1WSSH 1F0TA 1K1NA 2Y5FA 3E0PB 3LJOA 1C5PA 2V0BA 2H1UA 3PMBB
chains in the Genus database with same CATH superfamily
3Q3XA 5HM2A 3ZV9A 5C1UA 1GHAG 1HB0B 2VWNA 3KQCA 1G37A 4AGJA 1K1JA 1V2LT 4I8GA 1O3NA 1NBMD 2J95A 3U98H 3I78A 1DXPA 4FVDA 2KCOA 3L6PA 2XOKD 1QY6A 4MQAA 4Y7AA 2P95A 1GCTC 1GVKB 1UHBB 2R0KA 3TGJE 4IGDA 1AHTH 1GBMA 1OXGA 3M5NA 3PLKA 1C9PA 5DK1A 2GCTC 1AE5A 2WPLS 3F9EA 3UQOA 1P57B 1SLXB 3E0NB 1EOLA 2YOLA 4B75A 1AD8H 3KYFA 1MTSA 1GMHG 3MU5A 4X8SH 2AS9A 1ZGIA 3NPSA 3TJOA 1SKYE 4QT8C 2HWLB 4AX9H 3H5CB 4FUIA 4I8HA 3DHKH 2TGAA 3ZVAA 2PUXB 2ZDNA 4A1VA 1ELEE 2Y7ZA 5HM9A 5EIYA 3NRLA 2ODPA 1GHYH 4E05H 1CHOG 1ZHMA 3GDUA 1ZPCA 2ALVA 1FY5A 3A82A 1LCYA 4DIIH 4ZXXH 2PUQH 1TX7A 2QY0B 1ELCA 2ZDVH 3ZVDA 2CK3D 3SV9A 3P92A 3VB5A 3SW2B 4J1YA 1GJCB 1PQ7A 2KM0A 1B0EA 3GDVA 2J9NA 1O2HA 1MKXH 3CNRA 7ESTE 1G3CA 1GL0E 5AHGH 3ZIAD 2C93B 4FU9A 1ABIH 1SGDE 2ULLA 1IQHA 1P04A 1MU8B 1Y3WA 1GHBF 1F7ZA 2W6JD 4FUFA 2FX4A 1QL7A 3GY8A 1HUTH 1OP2A 1ZHRA 2UWOA 4I31A 1C2GA 1Q2WA 3MQKC 1ZMLA 3MH4A 1P06A 1MCTA 1YPHE 3PMHB 1XMNB 2HOBA 1BMFD 4UFDH 3Q00A 3CENA 1KIGH 4I32A 1MTUA 3DFLA 3IWMA 1WOFA 4I86A 1KTTB 1A5HA 3PMAB 4JK6A 1TLDA 3UWJH 1ANCA 4XBCA 1AU8A 4OS6A 4JK5A 3DSGA 4RT0A 3SU4A 1O3HA 3RC4A 3A8BA 2P3FH 5DSFA 2ODYB 1V2NT 7KMEH 2HALA 3GISB 2H5CA 8LPRA 4YLQH 1DE7H 3KCGH 4P02A 2F9NA 2EEKA 2VIOA 4X6PA 4X1RU 2VIVA 1THRH 1G30B 3GY7A 4K1SA 1A5GH 1OYTH 2BZ6H 3CS7A 1D3QB 3K6ZA 5DPAA 1CHGA 3FAOA 1CT4E 2Q1JA 4NWLA 1BTPA 2XNDD 1Y3UA 1LMWB 3BSQA 1ELVA 3SUGA 3RXTA 3TPIZ 1BBRE 4DGJA 5HYOA 2HNTC 4Y0YE 2Y7XA 1NRPH 4JZFH 2J97A 1AWFH 1C5NH 3BTFE 5E0GA 1GBFA 1ZGVA 3RU4E 3OX7U 4WMDA 1E38B 2G5NA 2WPHS 3RXMA 2YMSD 1GDNA 2IPHA 4KELA 2VB0A 4X6OA 3D49H 4MNYA 4HI3A 3VGCC 1ZPZA 4ZHAA 1K1OA 1O2LA 2BY8X 3ZYEA 2KZ4A 1LDTT 2GKVE 2TBSA 3HATH 1SGYE 5FXLA 3OTJE 2TGTA 4IC6A 4GUXA 2F9BH 3I29A 1HAXB 4JZEH 3GDSA 5TCAA 1P8VC 2R2MB 1LHEH 4NSYA 1HAVB 5JBBS 1JXPA 4X1QU 4RSPA 1BRAA 2ZGHA 3RP2A 1TONA 1W0JD 4IN2A 1GBHA 2LNCA 2QA9E 1FPCH 4FU8A 1HPGA 5EOKA 1BMNH 1ZYOA 2I6SA 5L2ZH 1OWDA 4GCHG 2KFWA 4K5ZA 1IQJA 1XKAC 2UWLA 1EASA 5T6GA 3P8OA 4AG2A 1BITA 3GOVB 1AZZA 2PKAB 1ZRKA 1SHYA 3MNCA 5JBTA 1WAYB 4AYVB 3VFEA 2XWAA 2ZU3A 1SQAA 2VWMA 3DSPA 3QZQA 1BOQA 1WYKA 1GDUA 1EZXC 1KLIH 2FOMB 2FYRA 3M3TA 1BMLA 2KR7A 3EA8A 1IQMA 1TBQH 4Y71A 1EUFA 2BD9A 1MU6B 5G4BA 1UO6A 3N7EA 4BTIB 1L4ZA 1FMGA 1C1UH 1NT1A 1V2TT 5FCRA 2BVXH 4NA8A 1E35B 4UD9H 1GMCF 3WW7A 4NIYA 3S7KB 4DCDA 1KY9A 1W11U 3ELAH 1Y5AT 4UONA 2ANMH 3SZNA 3LKWA 1EKBB 3HKIB 5FX5A 4AC9A 3A8AA 3ZZCA 1D4PB 3HK3B 3SHAH 2QGRA 2P94A 2W7UA 1K0HA 2FYQA 3UNSA 3BTTE 2Y5GA 2QF4A 1GL1A 2V3OH 1TNGA 1HDTH 1LHFH 4IW4E 4YTAA 1H1BA 5C5OA 1UVPA 1Y5UT 3U28C 2O8MA 5K7RA 1TGSZ 1IQLA 1TAWA 2B9LA 2FOBA 4FETA 3TIUA 3FOAA 1TMTH 3LC5A 2ZHEH 1DWEH 4ABGA 4YT7H 5I46H 1TQ7B 1P2QA 1K21H 1Z8IB 3QGJA 1BTHH 3SBKA 2R3UA 2IJD1 2WV9A 1AO5A 1O5BB 3Q3KA 4F4OC 4OS2A 5FPYA 1C5UA 4UFGH 1JWTA 2B5TB 3A88A 3PO1B 3EYDA 3SNCA 1VITF 3TGKE 2RDLA 3OSYA 5A8ZA 1HAHH 1TX8A 2Y80A 1WU1A 2SGPE 5E2PA 4K60A 2BD4A 1ZSJA 1OWKA 4FVBA 4UFEH 1GBEA 1T8NA 1A46H 1KMHB 1O3CA 1W0YH 3ZVBA 4K3JA 4I8LA 3AAVA 1NY22 2BLVA 1C2LA 1J9CH 1Z1JA 1BDAA 1ID5H 1KYNA 2ZTXA 3JZ2B 2H9HA 3RMMH 3MYWA 2OC7A 3TVJB 1XUHA 1DANH 3W1EA 1O32A 2QV1A 4X1PU 1GCTB 1EPTA 1P09A 1QJ7B 2ZU5A 1GJBB 1AB9B 1MBQA 1SGCA 3NWUA 1AFEH 4X2YA 1TOMH 3DD2H 1ARCA 1HIAA 1FJSA 4CBOA 1X7AC 1PFXC 2QXJA 1H8IH 4DY7B 1DWCH 1N8OC 2C8ZB 4ACAA 4YLUA 2WINI 1P0SH 5B6LA 3F0OA 1QJ1B 4YOIA 3SU2A 2ZPQA 2FOEA 4D7GA 1QJ6B 1AVGH 1H4WA 1T8LA 2WUBA 2ALPA 1SI5H 3MFJA 4CRFA 1P01A 2OTVA 2UUJB 4JZIA 1S0RA 4NWKA 3UTUH 2BDIA 5EJLA 1GBBA 1PPBH 2WPDD 3RXIA 3SV8A 2AERH 3V12A 2BDYA 4CREA 1C1OA 1A4WH 2A7JA 1SFIA 3JZ1B 2HRVA 4JYUH 1RD3B 5F8ZA 2HLDD 2OXSA 1LPZB 1V2UT 1K28D 1E1QD 1TALA 1S6HA 3VPKA 4WVPE 2VINA 3ATWA 5L30H 2B0FA 2GTBA 2IN2A 2ZPRA 4ZKSU 4LZ1H 1H9HE 5C2ZA 1CBWB 1P2JA 2XXLA 2TIOA 5LPEA 2GX4A 3ZZ3A 5EW2H 2O8LA 1IQNA 2A4QA 3CP7A 5A0BA 2FZZA 3F2FA 3SUFA 3DSOA 4ZAEA 1UK3A 4INLA 1AVWA 1ELDE 3FO8D 3GCTG 3EE7A 4F49A 1TMBH 3FP6E 5DP9A 1A1RA 1BTYA 1TRYA 2V35A 1DS2E 2L74A 1LPKB 1C5OH 1TNLA 2Z9LA 3BTEE 3AAUA 3RXQA 1UCYK 2HNTF 1G36A 1NRRH 5E0HA 8KME2 3ZVCA 3OEHD 4ZKNU 2F83A 1QNJA 2H5DA 4IS5A 4OS5A 1F2SE 1FIZA 1AQ7A 4BTUB 4K8BA 5JB9S 4HGCA 2OINA 1QB1A 5DJ7A 4AFSA 2ZDMA 1KSNA 3RXSA 1O39A 3LGIA 3KYGA 4GHTA 3ZZ6A 2P3TB 1O2WA 2BHGA 3M7QA 1CA0C 1EAXA 4XSKU 2XW9A 1MBMA 2ZTZA 3C27B 4JZDH 1TB6H 1O2JA 2CHAB 2ZEBA 2XCNA 1TOCB 2IOTA 1GHZA 1ESTA 1YPLH 4GSOA 4WJG2 1TFXA 1V2VT 2ILNA 1EP5A 1MUEB 3GICB 4TSFD 3RM0H 3TITA 4DVAU 1CSOE 2PGBB 1C4Y2 2A0QB 4AFZA 1FPHH 2LELA 1C1MA 3EGKH 3TLOA 1F5KU 3V3MA 3GY5A 2NU1E 1SVPA 1EAUA 2CV3A 2VIQA 4K1TA 3T28A 3T62A 3A84A 1O37A 1RTKA 1O2IA 4DIHH 4ISNA 3S7HB 2ZI2H 3UB0A 2IPQX 1C5LH 2JJ2D 5EQSA 1E0FD 3ZYDA 1O35A 1QGFA 1F5RA 2ZFFH 1XVOA 1P2NA 1LPGB 1GBLA 1SOZA 1ZSKA 4K69A 2VWOA 3ZZ9A 1G2LA 2ZCLP 2ZHQH 3RXOA 3QO6A 4MLFB 4SGAE 3E16B 3IG6B 3M3SA 1GHWH 1MZDA 1S85A 2PWXA 2VJ1A 1HRTH 1MTNB 1RTLA 2OQ5A 4B76A 2ZU4A 1C1NA 1K2I1 1Z7KA 1O3PB 1W2KH 2J92A 1V2JT 2V3MA 2B8OH 1HV7A 1ANBA 3RXBA 1NBME 4U2WA 2VH6A 5DP5A 2PLXA 3PV4A 3W94A 1GBDA 3A81A 1BTXA 2J2UA 4AB8A 1SPJA 5I25A 4NIWA 1V2MT 3PLBA 1GGDB 1IQEA 3F1SB 4TPYA 3BG4B 2OBOA 1H8DH 1HJAB 3MI4A 4KTSA 1ELAA 3K65B 3BTDE 3LDXH 1TPAE 4U01A 4B71A 4JMYA 3OEED 1DUEA 2D26C 3RXUA 2KCYA 3O8BA 4J2YB 1QFKH 3QTVH 1IHTH 1QBNA 2ZCKP 1FY4A 2R0LA 1O3DA 1GBIA 1O3EA 1UK2A 2ANYA 4Q4LA 2BLQA 3EE0B 2ZDLA 1K1IA 2ZG0H 3RXLA 2H2ZA 1C5RA 3BIVH 1L4DA 1ZZZA 2WPKS 3LU9B 4OM9A 1FY8E 2WV4A 1EJAA 1TRMA 2Y6TA 7GCHG 2ZGBH 1O3LA 3MOCA 1ESBA 3B9FH 1KDQB 1V6DA 3N99A 1P03A 3P70B 4I8KA 3VXFH 1UK4A 3M5OA 4Z6AH 2HGTH 4D76A 3SQHE 1CVWH 1O2PA 1MMJN 2J34A 1TGBA 2YNBA 3MHWU 4FUGA 2ZHFH 1RFNA 1UTNA 1B0FA 2GZ7A 3MWIU 3RXPA 4UDWH 4Y6DA 4MPWA 4D9RA 3KIDU 5DG6A 1K22H 3UNRA 3UOUA 2G4TA 1MABB 2GT7A 3M5LA 2BY5X 2ZFTA 4AN7A 9ESTA 2BOHB 4ABFA 1NRNH 2CF9H 2GMTC 4K2YA 2PP6A 1RGQA 3VB6A 1GBTA 2Q6FA 3SU5A 1IQGA 1XX9A 4XRNA 1GDQA 1V3XA 5ESBA 2ZQ2A 3M61U 1DY8A 2WPJS 2XTTB 3SU1A 2EC9H 3ODFA 3A8DA 1K1MA 3S69A 2SGFE 1OP8A 5EPNA 4YESB 1RIWC 1YCPK 1TGNA 4LZ4B 4JCNA 3TJUA 2AIQA 2BDAA 4NSVA 2F9OA 2J94A 3SV6A 5FBIA 4RKOB 2ZU2A 2THFB 4AFUA 1D3TB 2HPQH 2BY9X 1O5GH 2A4RA 3DFJA 3KQDA 1DSTA 3D23A 1TE0A 1W12U 2XC4A 3RMNH 1AWHB 1SFQB 3F2GA 4XBBA 2GGVB 1GBAA 1NM6A 5GXPA 1OP0A 5DGJA 1MQ5A 4GVUA 1HJ8A 4I7YH 1EB2A 3UQVA 2K1QA 1YP9A 5T6FA 1C2KA 3KHVA 1BMMH 2ZF0H 3MNSA 5AFZH 3K6YA 4ABHA 3MNXA 1C1PA 1HNEE 4CRGA 1QB9A 3SUEA 1CHOF 4KGAA 2FOAA 2EA3A 3OU0A 1O30A 5JYIA 4DT4A 2G00A 4H42U 2BYAX 1QRXA 1F92A 1N8OB 4X2VA 5EQRA 4XD7D 3SU0A 3LGYA 2FI5E 3UWIA 4D9QA 5GNDA 4NIXA 1F5LA 2GV6A 2NU2E 4ISHH 3PLPA 1XUFA 1GJ6A 1CQQA 1LTOA 1DWBH 3B23B 1VITG 4Z0KA 1O2RA 3KQBA 1MD8A 2YMSB 2C8WB 5F03A 1BRBE 1QR3E 6LPRA 1H9LB 3MO3A 1E34B 4XBDA 1BCUH 1LQDB 3ZZBA 1SQTA 1QBVH 1DVAH 1GMDG 1CU1A 1DWDH 5PTPA 1QBOA 2GV7A 1WTHD 4ABDA 4CR5A 1W7XH 4DT7B 1NC6A 5SGAE 1ZMJA 2QN5T 2Z6BD 2A2XH 1F0SA 5CHBA 2PTNA 3DCLA 2PTCE 3U8TH 1AFQB 3NK8A 1NFXA 2C3SA 3HK6B 1COWD 1SGPE 5J4SA 1Q3XA 1O2QA 2Y5HA 3GCTF 4M9FA 3EDXB 3PO1C 3B8JA 4BANB 2BY6X 5JB8S 1AUTC 3ZVEA 1D6WA 5DP4A 3HGNA 1GI6A 1GJ4H 2W7SA 5FBEA 1C4V2 2KCPA 1TQ0B 2ZGCA 4NA7A 1TNHA 1PPCE 1SLUB 5TCCA 4X8UH 1VCWA 3A80A 5CMXH 4ZCNA 1HAZB 1C9TA 1EJNA 2GVFA 1O2XA 1P05A 5JBAS 4NFFA 3A86A 2BXUH 1S6FA 1IAUA 2VGCB 1EJMA 1C2MA 4WY3A 1BA8B 1SGTA 1RRKA 1SGFG 4FUJA 1W0KD 1HGTH 1GJ7B 3I77A 1BBRH 1C1TA 3O8RA 3NXPA 4FXGH 1NO9H 2SGAA 5EXMA 1YPKH 5T3HA 1ESAA 3E1XB 3EA7A 3PTNA 3S9AA 1O3KA 3T5FH 2R3YA 2DE8A 1GBKA 1TNKA 1SQRA 5F8TA 3GCHC 1BTUA 1NN6A 2M5TA 1FDPA 1GI5A 3P6ZB 2JIZD 5EJ1A 1C2FA 1AN1E 4YM9A 2GP9B 3ZV8A 2VIDA 1ACBE 2OCVB 3KGPA 1GJ9B 1FX0B 1OKXA 2BLWA 1QURH 4R0IA 2XBYA 1KTSB 2EI6A 4DOQA 1GI9B 2TRMA 5F53A 4F55A 1Z71A 3QLPH 2D1JA 1L1GA 2JDID 1ELBA 3U1JB 1NFUA 1VGCB 2XC5A 1L2EA 2PKSC 4WWYA 1P12E 2CMYA 1BUIA 2ZECA 3FZZA 2OUAA 4BTTB 4I33A 2SFAA 1EPTB 1B7XB 1QA0A 3UOPA 3SI3H 3PRDA 2P8OB 3T26A 1V2ST 1SGIB 3DUXH 8ESTE 5HIZA 2FEQH 1LVBA 2LPRA 6GCHF 4D7FA 3UFAA 2XRCA 1UVSH 3SU6A 1CE5A 2PW8H 1CGJE 5AVDA 2G51A 2AFQB 4ACBA 2SGDE 1ABJH 3F9HA 1IQIA 2RCEA 2GZ9A 2ESTE 1LHCH 1GI1A 3TK5A 7LPRA 5LGOA 1FV9A 5BPEA 3SGAE 2PSYA 4BOHA 4BNRA 1C5WB 1IOEA 3MO9A 4Q7YA 1MCVA 3OYPA 1TBZH 4CR9A 2BMGB 1SGRE 1PPGE 3BTKE 1O3GA 4E7RG 1P10A 5AF9H 3PWBA 3RXRA 5FCKA 1QHRB 1DFPA 1FLEE 2AHME 3ZVFA 1S5SA 1VITH 2UWPA 4KTUA 2SGQE 4TY7A 1NTPA 1MTVA 1HLTH 3F9FA 3LH1A 3VEQB 1NU9A 4ZUHA 1GI3A 1VCQA 1LKAA 5GJ4B 1Y3VA 1YPJH 2Z3CA 3BEIB 1UCYE 1GMDF 2PFEA 1HAPH 2AGGX 2XC0A 1SLWB 4X0WU 1OHHD 2LP6A 4MPUA 2A1DB 3RXEA 1A5IA 4NG9H 1O2GH 4B1TA 2IJOB 2ZDKA 2QF5A 3P95A 1SGEE 1LVYA 1W0ZU 2FOFA 5JDUB 1FNIA 3RU4T 3ZZ4A 1DITH 1J8AA 5GCHF 3SOSA 4B2AA 1CGHA 1HYLA 1MTWA 2FIRH 1CBWC 5ESTE 2FI4E 4DJZB 2M2AA 2P59A 3M7UA 4FUCA 5DP6A 5CHAC 1GJ8B 1DLKB 1UMAH 1A0HB 1TNJA 3E90B 4KKDA 1YY3A 1FN8A 2VVVA 3T25A 1DLEA 1AIXH 2V6NA 1EZUC 2XNIA 3E3TA 3Q77A 4HFPB 1PYTC 4AZ2B 3E6PH 2ZHWH 2QXHA 1O3AA 5F8XA 2FPZA 1MKWK 5J4QA 2FOGA 1QB6A 1GWAA 1EFRD 1Y3YA 2HLCA 4AORA 1H8ED 4KTCA 1O38A 5T1VA 1BHXB 1NRQH 1XUIA 1YGCH 3STIA 2ODQA 1NU7B 1T4VH 2BDHA 3PM3A 1V2OT 5JPMH 1S83A 4MTBA 1WXRA 2XWBI 3LGUA 2QAAA 1YWUA 1O2YA 1EB1H 4INKA 3SQEE 4Q2KA 5A8YA 1FZZA 4Y76A 2A5KA 3MMGA 5GDSH 1KLTA 3ESTA 3RLWH 3LIWA 3TGIE 3QGNB 2ZA5A 2B7DH 4NA9H 2PKAA 1V2PT 1JIMA 2BX4A 1L1JA 5C0TA 2FLBH 2ZIQH 1UVTH 2A32A 2FWWA 3SGQE 2FM2A 2O8WA 3PROA 2ZCHP 1VR1H 1G3EA 1SC8U 5L2YH 1C5MD 8GCHG 4M7GA 2QCYA 3RDZA 2OBQA 4DURA 4LOYH 1XUJA 2A45B 1K1LA 1TPPA 2H9TH 3N7DA 2CGAA 4OS7A 4TPIZ 1YKTA 3AW1A 3TH3H 4UEHH 2WYGA 2OC1A 3RXKA 1Y8TA 2WSSD 3RC5A 4AYYB 2Z94A 3GY3A 2SGEE 2DE9A 1SL3A 3AVZA 1W14U 1U6QA 3ATLA 2GJGA 1SQOA 1ORFA 1KXDA 2GCTB 3OFND 3MU1A 1QQ4A 1ZOMA 3RUOA 3URDA 1O3OA 3ATKA 1SOTA 3PTBA 3LPRA 2GCHF 1C4U2 3UAIC 5C94A 2BY7X 5LH8A 1IHSH 2WPIS 1GBCA 2C8XB 1HAOH 1FUJA 4YXWD 4ESTE 1G2MA 1CT2E 3KQ5A 1OWIA 4FUBA 1EX3A 2BVRH 6CHAB 1EAWA 1DM4B 3A7XA 4NIVA 3SGBE 1GBJA 3SJKA 3E8LA 3HPTB 1C2IA 1TWXB 1SR5C 3TNTA 4HTCH 2WZQA 3GCNA 1O2SA 4XE4A 4ZH8A 2ZKSA 4FU7A 1ELTA 3SJOA 1MZAA 3ZZ7A 4ZROA 1YLCA 1T32A 3SU3A 1C1SA 2F4LA 3U1IB 4INHA 3U69H 4GCHF 1C2JA 1TMUH 1EOJA 2OC0A 3UPEA 2WV5A 4RT1A 4ISIH 2CJIA 2V3HH 1A3BH 3ENSB 4WMFA 1GHBG 1GHXH 4D8NA 2SNWA 3T2NA 1FQ3A 1OOKB 2FLRH 4TT3D 1P3CA 2BLOA 1QQUA 5F6MA 2Y82A 5DP3A 5FAHA 2ZNKH 1XXFA 3BF6H 1BJUA 1Z8JB 6CHAC 5CHAB 4MNVA 2RA0A 3SI4H 3NKKA 2K0QA 3VB7A 2I6QA 1BQYA 3F9GA 2F91A 4SGBE 2NU4E 4TWWA 1UJ1A 4JYVH 1FI8A 5A2MH 2BDCA 5C17A 2BD5A 4BAHB 1G9IE 1AVXA 2QF0A 3FP7E 1BRCE 1D6RA 1YLNA 1KXAA 2J98A 1S84A 1LO6A 1ARBA 1B5GH 1ZLRA 1JRSA 3GYLB 3R0FA 2A5IA 3ATMA 3LGTA 1C1WH 1TYNA 3ZZDA 5C67A 1O2MA 1O3IA 1JIRA 5A0CA 1MKWH 3QN7A 3T29A 1MAXA 1ETSH 1BB0B 5EXLA 1O2ZA 3H7OA 1LVOA 2P3UB 2XBVA 1UTPA 1YBWA 3A7TA 3RMLH 1Y59T 1O31A 1C5QA 3LONA 4ABBA 2STAE 4MPVA 3RC6A 3URCA 2DUCA 3VGCB 3KL6A 2TGPZ 2G52A 4Y11E 5EG4A 1T8MA 1G3DA 2QXGA 3SJ9A 2W26A 1UTJA 1ZHPA 4Y7BA 5GPIB 1M9UA 2A7HA 4UFFH 1HAYB 2AEIH 3LT3A 4FUEA 4Y79A 4H6TA 1K1PA 1AE8H 1NESE 2AIPA 1JBUH 1FAXA 1WQVH 3TJNA 2FMJA 1MAYA 2FTMA 1NRSH 3M36A 3H7TA 2Z9JA 2W6ID 6ESTA 1O5DH 4GPGA 4BAMB 3NCLA 2BD8A 1AGJA 2ANKH 2Z3EA 1XVMA 4DW2U 4WXVA 4XDEA 2BQ7B 1BMAA 4BXWA 4E7NA 3OAAD 1TA2A 2P8OC 3FFGA 2W3IA 1EAIA 1AKSA 3RXHA 1P2KA 3RLYH 1ELGA 1UHBA 5FL7D 1E1RD 4IC5A 1DXWA 4X6MA 1WCZA 3MH7A 3MU0A 1P2IA 4AFQA 4P00A 2Z9GA 2ZFQH 3E91A 1VJAU 2PKSB 3KEEA 1VGCC 2ZDAH 2GCHG 1T8OA 3P8GA 1WV7H 5HIYA 3A7ZA 2EI8A 1GPZA 1TABE 4E06H 1NFWA 3BEFB 1O5AB 4X1SU 5GIBA 2C8YB 1IQFA 3SNDA 1UTLM 1O34A 2AGEX 3EAJA 1O2UA 1GHVH 1Z1IA 1QIXB 2G55A 5A09A 1J14A 4BXSA 1S0QA 5IDKA 1YPEH 3PMJA 1EQ9A 2BB4A 2F43B 4IBLH 5HXFA 1F0RA 3V13A 1O36A 1AZ8A 2ZFRH 2CXVA 4A5TS 2EI7A 4B6EA 3A87A 2AYWA 3SORA 1TGTA 1QRZA 2PSXA 4U30A 1O2KA 2RA3A 1YF4A 2VBCA 3RXAA 2BOKA 3U9AH 3UR9A 3P17H 3S9CA 1TIOA 1ZMNA 4YT6H 3FZDA 3DT0H 2P93A 1O2NA 3TK9A 1DY9A 1N6YA 1LKBA 2F3CE 4H4FA 2VGCC 3MU4A 1D3DB 1S6LA 3MNBA 4AGKA 4Z1MD 5LPRA 4Y10E 1RTFB 3EA9A 1KXCA 1GG6C 3U8OH 3Q3YA 3BN9A 1TA6A 1D9IA 1EP6A 1T4UH 1WQSA 2FODA 4ISOA 1AI8H 1CA8B 1PQAA 4X8TH 4K1EA 1L0ZA 3D65E 4OS4A 3A7YA 3N7OA 2FS8A 1ANEA 3M35A 1V2QT 1FONA 5KEDA 1PPEE 3GYMA 2GZ8A 3KF2A 2PHBA 1Z6JH 1UW7A 4TY6A 2QF3A 3O8CA 4IN1A 1IQKA 6GCHG 3A85A 1NFYA 3AK5A 1O3BA 1WBGB 1VKYA 3ODDA 3PV2A 1O33A 3T27A 3V0XA 2BDBA 3HKJB 1UTQA 4CRDA 4Q7XA 3P8NA 4FOUC 1C1RA 2XBWA 2Z3DA 1C1VH 4NGAH 3TNSA 1EPTC 4AOQA 3UUZA 2STBE 4LK4A 2JKHA 2ZFPH 1BT7A 3PYHA 2R2WU 3BG8A 2AMPA 4LXBH 1UTOA 1GMCG 2YMSC 3SHCH 3OY5U 2VIPA 2NU3E 1G3BA 4BAKB 3F2HA 4Y0ZE 4NZQA 3GY4A 3NZIA 1OYQA 4Q7ZA 5FPSA 3TJVA 4O9VA 1NS3A 1RS0A 3TK6A 1HAGE 1HIAB 2ZTYA 1A61H 2C90B 3FANA 3ZVGA 5A8XA 2FXRA 1N6XA 2J38A 2BX3A 1CGIE 3A7WA 3MH5A 3QTOH 3GCHB 1CT0E 2GT8A 2D8WA 1TRNA 2ZU1A 2PV9B 1C5XB 1FXYA 4CH8B 1PPZA 1Q31A 1O3FA 3H09A 1YLDA 5EGMA 2BTCE 5C1YA 2J5UA 1XUGA 2UUFB 3PV5A 5IYTA 4B2BA 1UVOA 4MVNA 2J4IA 3KN2A 1OS8A 3TH2H 1XUKA 2ZHDA 4OGXA 1O3MA 3R3GB 2BXTH 3BV9B 3RXGA 1Z8RA 3O8DA 3U8RH 5C5NA 2OK5A 4VGCC 3OTPA 5TJXA 3QWCH 3EQ0H 4BAQB 1RIWB 5H4IB 1O3JA 4MNWA 1AY6H 2Q6DA 4Q63A 2G5VA 5EU8A 2G4UA 3SV2H 3UNQA 4WF8A 1YPMH 3GY6A 1TX6A 3GCOA 1L1NA 4ZXYH 2AGIX 1BIOA 2YNAA 1GJAB 2KX4A 5EODA 1E37B 2ZFSA 5DN6D 2QYIA 4DG4A 4CHAB 3VG8A 2C4FH 1C1QA 1TBRH 1AFQC 3M37A 2OLGA 3SNBA 1RJXB 3C1KA 4A92A 1G32B 2WPMS 5E2OA 3BTHE 1VJ9U 4RN6A 3SV7A 1P9SA 1GMHF 2GD4B 2NWNA 2OP9A 1E79D 2ZC9H 3LC3A 4K8YA 2BZAA 4CHAC 1SBWA 1SGFA 3RMOH 4O03A 2BQ6B 1J15A 1P02A 5DP7A 1JRTA 1FN6A 1DICA 1KDQA 5EQQA 4F48B 2JH0D 1ZR0A 3STJA 2ASUB 3BTQE 1BTZA 2A31A 1BRUP 4RI0A 1GI0A 1PYTD 1YM0A 1Y5BT 1ZTLA 3RM2H 2A5AA 1ZPBA 2O8UA 3A7VA 1W8BH 4I8JA 4A1TA 2A2QH 1W3CA 3FVFB 2F9PA 2WHXA 3SJ8A 1RXPA 2A7CA 2UUYA 3SNAA 2FDAA 3QDZB 4TYDA 4MG3A 4A6LA 2AH4X 2WYJA 4CRAA 1A3EH 2KAIB 2NU0E 4CBNA 1OWHA 3P8FA 1YPGH 1GI7B 3F3BA 3SNEA 3FP8E 1BTWA 1HJAC 5E0JA 3BG4C 3Q76A 1GGDC 1W7GH 4NZLA 1GJDB 1BZXE 1S81A 1VZQH 2Z7FE 1HAVA 3QZRA 5ETXA 2EY4C 3LGWA 3WWBA 1MQ6A 1ELFA 2F9UA 1W13U 1QRWA 5C3NA 4OS1A 1DT2A 2W3KA 1MH0A 3M3VA 1P2MA 2O8TA 1O2VA 4YOGA 5JBCS 1ZJDA 1CO7E 2ZWLH 5HKKD 3TH4H 2BD3A 4ZKOU 4GLYA 2XBXA 4YOJA 2QXIA 3RXVA 4CRBA 1DSUA 1ETTH 5EPYA 1V2KT 1OX1A 5A0AE 3BIUH 3F6UH 1OWEA 1UCYH 2OQUA 3AASA 3G01A 1C2DA 1YYY1 3SJIA 1UTMA 3PRBA 3LGVA 1NROH 1EATA 2ZGXH 3IITA 2HVXA 2GMTB 4IMQA 4TWYA 2OC8A 9LPRA 3GY2A 2KAIA 4BAOB 2ZPSA 4KP0A 5HMAA 1QL9A 1DUAA 5CE1A 1WTGH 1T31A 1YPHC 2FX6A 3UR6A 4IMZA 4A7IB 3MTYA 3VB4A 1P3EA 1S82A 1ZRBA 2W5EA 3F0PA 3SUDA 2JETC 2VH0A 2VNTA 1A2CH 1O5FH 2BQWB 1P9UA 2GDDA 2QE7D 2VU8E 4A1XA 3MU8A 4AG1A 3S0NA 4ASUD 1ETRH 2J98B 3UIRA 2CHAC 2BVSH 1XM1A 1HXFH 2Z9KA 1QA7A 4FUDA 3PWCA 2BM2A 1PPFE 2ZZUH 1A0LA 5AFYH 4ISLA 2H9EH 2JJ1D 1ANDA 3CS0A 5B6OA 2BDGA 4O3TA 2Y81A 1FY3A 1GI8B 5EJZA 1SHHB 3UY9A 3A8CA 4Q80A 1GG6B 2RDEA 1JMOH 4HZHA 1DX5M 1ZJKA 4CRCA 2VVCA 1YCPH 4ABEA 2FTLE 2BD2A 1UVUH 1THPB 1BHXF 1C5ZB 5DP8A 3ZZAA 2JETB 1LQEA 1YCPM 3QUMP 1DDJA 3M7TA 1A7SA 4Y8XA 2P16A 3SO3A 4MDSA 4NCYA 1OSSA 2GDEH 3BTGE 1HFDA 1O5CB 1WUNH 1GVZA 2TPIZ 2ZQ1A 1O2OA 1TNIA 2QC2A 2SNVA 1A0JA 1EZQA 1PPHE 2WUCA 1Z6EA 1QZ8A 3LOXA 4ABAA 1O0DH 1PQ5A 3KNXA 5FHTA 1HJ9A 1YC0A 4GAWA 1ZTKA 1SSXA 2FOHA 2KCAA 1P2OA 4B2CA 1GI4A 2G81E 3A89A 2ZGJA 1MKXK 1H9IE 2VVUA 4O97A 5E8EH 2D2DA 1MTNC 4RKJB 1INCA 3K2UA 4Y8ZA 1C5SA 3MO6A 3BEUA 3QK1A 2FS9A 2QIQA 5LPFA 1C2HA 4Y8YA 1W10U 3QX5H 4R8TB 1BBRK 1KXFA 2JH5D 1SB1H 1H8HD 5GCHG 3W95A 1SGQE 1GVLA 2FP7B 1DPOA 2G8TA 2L6OA 1QCPA 2XYAA 4MNXA 4B74A 4B73A 2EQNA 2K8IA 7GCHF 1N1LA 3OE7D 2HPPH 4NFEA 2PR3A 4GHQA 1HAIH 4ABJA 5GWZA 3AW0A 1C5VA 1XKBC 3MH6A 2CN0H 1MD7A 1C5YB 4WXIA 2V7QD 1SMFE 4X6NA 3RXDA 4ABIA 2CF8H 1J17T 4X2XA 4XOJA 4X2WA 1TPOA 2TGDA 1FY1A 5EW1H 1PQ8A 3F68H 3SYJA 1THSH 5HGGA 1KLJH 4XFQA 1GCDA 1TPSA 5L6NH 5CDFE 4ZHMU 1Y3XA 4ZMAH 3RU4D 1JOUB 1CA0B 1OPHB 3RXJA 4H6SB 1OWJA 1O5EH 1AUJA 2HNTE 1SGNE 1AB9C 4ZKRU 3K9XB 1GI2A 3LJJA 4X1NU 5K0HA 2AMQA 4OGYA 1FAKH 3S9BA 5C20A 1NPMA 3KQEA 1UTKA 1C2EA 1K9OE 1SG8B 3A83A 3VXEH 1DOJA 3FN8A 4ZHLU 1FIWA 1E36B 2R9PA 1HBTH 2F9VA 4ASHA 5ABWA 1NZQH 1V2RT 2XCFA 3FKSD 1LHDH 2UUKB 1AMHA 4B6FA 4X8VH 2O9QA 3HGPA 3NUMA 1GJ5H 2A4OA 1V2WT 1D3PB 5DKMA 5FX6A 4FUHA 2HVYB 1SLVB 4AB9A 3WWFA 3GS9A 1BJVA 1ZTJA 8GCHF 1Z8GA 4WMEA 3DA9B 3BTME 1KXBA 1HCGA 3BTWE 3V7TA 1EZSC 1KXEA 1T7CA 3RXFA 4JZ1A 4PROA 1WDIA 2OD3B 3SN8A 2ANWA 2Z9IA 2BD7A 1EXFA 1P11E 1XXDA 4CH2B 1F0UA 2H6MA 2VWLA 1C5TA 4VGCB 4YO9A 1QTFA 3M5MA 3VB3A 1TGCA 1LHGH 2Q6GA 5BRRE 2FOCA 3LH3A 3PB1E 4MPXA 5KECA 3L3TA 3ITIA 3OY6U 4JYTA 3SZEA 4WH8A 3ZZ8A 2JH6D 3D62A 2RFKC 4U32A 1GHAF 1QL8A 2RG3A 5C0UA 2AMDA 1LVMA 1ZSLA 2ZO3H 3UREA 4THNH 5KGOA 4WH6A 3RXCA 2ZP0H 2VIWA 3L33A 2A4GA 5T6DA 1HXEH 5IK2D 1PJPA 2FO9A 3TU7H 1AKSB 3ATIA 1J16A 2FESH 1VCPA 2FI3E 5C1XA 4UE7H 3WY8A 5EXNA 3ZZ5A 2PGQB 5FPTA 5DO4H 4O3UA 4HG6A 4YZUA 1O2TA 1WSSH 1F0TA 1K1NA 2Y5FA 3E0PB 3LJOA 1C5PA 2V0BA 2H1UA 3PMBB
chains in the Genus database with same CATH topology
3Q3XA 5HM2A 3ZV9A 5C1UA 1GHAG 1HB0B 2VWNA 3KQCA 1G37A 4AGJA 1K1JA 1V2LT 4I8GA 1O3NA 2J95A 3U98H 3I78A 1DXPA 4FVDA 3L6PA 1QY6A 4MQAA 4Y7AA 2P95A 1GCTC 1GVKB 1UHBB 2R0KA 3TGJE 4IGDA 1AHTH 1GBMA 1OXGA 3M5NA 3PLKA 1C9PA 5DK1A 2GCTC 1AE5A 2WPLS 3F9EA 3UQOA 1P57B 1SLXB 3E0NB 1EOLA 2YOLA 4B75A 1AD8H 1MTSA 1GMHG 3MU5A 4X8SH 2AS9A 1ZGIA 3NPSA 3TJOA 4QT8C 2HWLB 4AX9H 3H5CB 4FUIA 4I8HA 3DHKH 2TGAA 3ZVAA 2PUXB 2ZDNA 4A1VA 1ELEE 2Y7ZA 5HM9A 2ODPA 1GHYH 4E05H 1CHOG 1ZHMA 3GDUA 1ZPCA 2ALVA 1FY5A 3A82A 1LCYA 4DIIH 4ZXXH 2PUQH 1TX7A 2QY0B 1ELCA 2ZDVH 3ZVDA 3SV9A 3P92A 3VB5A 3SW2B 4J1YA 1GJCB 1PQ7A 1B0EA 3GDVA 2J9NA 1O2HA 1MKXH 7ESTE 1G3CA 1GL0E 5AHGH 2C93B 4FU9A 1ABIH 1SGDE 2ULLA 1IQHA 1P04A 1MU8B 1Y3WA 1GHBF 1F7ZA 4FUFA 2FX4A 1QL7A 3GY8A 1HUTH 1OP2A 1ZHRA 2UWOA 4I31A 1C2GA 1Q2WA 1ZMLA 3MH4A 1P06A 1MCTA 1YPHE 3PMHB 1XMNB 2HOBA 4UFDH 3Q00A 3CENA 1KIGH 4I32A 1MTUA 3DFLA 3IWMA 1WOFA 1KTTB 1A5HA 3PMAB 4JK6A 1TLDA 3UWJH 1ANCA 4XBCA 1AU8A 4OS6A 4JK5A 3SU4A 1O3HA 3RC4A 3A8BA 2P3FH 2ODYB 1V2NT 7KMEH 2HALA 3GISB 2H5CA 8LPRA 4YLQH 1DE7H 3KCGH 2F9NA 2EEKA 2VIOA 4X6PA 4X1RU 2VIVA 1THRH 1G30B 3GY7A 4K1SA 1A5GH 1OYTH 2BZ6H 3CS7A 1D3QB 3K6ZA 5DPAA 1CHGA 3FAOA 1CT4E 2Q1JA 4NWLA 1BTPA 1Y3UA 1LMWB 3BSQA 1ELVA 3SUGA 3RXTA 3TPIZ 1BBRE 4DGJA 5HYOA 2HNTC 4Y0YE 2Y7XA 1NRPH 4JZFH 1AWFH 1C5NH 3BTFE 5E0GA 1GBFA 1ZGVA 3RU4E 3OX7U 4WMDA 1E38B 2G5NA 2WPHS 3RXMA 1GDNA 2IPHA 4KELA 2VB0A 4X6OA 3D49H 4MNYA 4HI3A 3VGCC 1ZPZA 4ZHAA 1K1OA 1O2LA 2BY8X 3ZYEA 1LDTT 2GKVE 2TBSA 3HATH 1SGYE 5FXLA 3OTJE 2TGTA 4IC6A 4GUXA 2F9BH 3I29A 1HAXB 4JZEH 3GDSA 5TCAA 1P8VC 2R2MB 1LHEH 4NSYA 1HAVB 5JBBS 1JXPA 4X1QU 4RSPA 1BRAA 2ZGHA 3RP2A 1TONA 4IN2A 1GBHA 2LNCA 2QA9E 1FPCH 4FU8A 1HPGA 5EOKA 1BMNH 1ZYOA 2I6SA 5L2ZH 1OWDA 4GCHG 4K5ZA 1IQJA 1XKAC 2UWLA 1EASA 5T6GA 3P8OA 4AG2A 1BITA 3GOVB 1AZZA 2PKAB 1ZRKA 1SHYA 3MNCA 5JBTA 1WAYB 4AYVB 3VFEA 2XWAA 2ZU3A 1SQAA 2VWMA 3QZQA 1BOQA 1WYKA 1GDUA 1EZXC 1KLIH 2FOMB 2FYRA 3M3TA 1BMLA 3EA8A 1IQMA 1TBQH 4Y71A 1EUFA 2BD9A 1MU6B 5G4BA 1UO6A 4BTIB 1L4ZA 1FMGA 1C1UH 1NT1A 1V2TT 5FCRA 2BVXH 4NA8A 1E35B 4UD9H 1GMCF 4NIYA 3S7KB 4DCDA 1KY9A 1W11U 3ELAH 1Y5AT 4UONA 2ANMH 3SZNA 3LKWA 1EKBB 3HKIB 5FX5A 3A8AA 3ZZCA 1D4PB 3HK3B 3SHAH 2QGRA 2P94A 2W7UA 2FYQA 3UNSA 3BTTE 2Y5GA 2V3OH 1GL1A 1TNGA 1HDTH 1LHFH 4IW4E 4YTAA 1H1BA 5C5OA 1UVPA 1Y5UT 2O8MA 5K7RA 1TGSZ 1IQLA 1TAWA 2B9LA 2FOBA 3TIUA 1TMTH 3LC5A 2ZHEH 1DWEH 4ABGA 4YT7H 5I46H 1TQ7B 1P2QA 1K21H 1Z8IB 3QGJA 1BTHH 3SBKA 2R3UA 1AO5A 1O5BB 3Q3KA 4F4OC 4OS2A 5FPYA 1C5UA 4UFGH 1JWTA 2B5TB 3A88A 3PO1B 3EYDA 3SNCA 1VITF 3TGKE 2RDLA 3OSYA 5A8ZA 1HAHH 1TX8A 2Y80A 1WU1A 2SGPE 5E2PA 4K60A 2BD4A 1ZSJA 1OWKA 4FVBA 4UFEH 1GBEA 1T8NA 1A46H 1O3CA 1W0YH 3ZVBA 4K3JA 4I8LA 3AAVA 1NY22 2BLVA 1C2LA 1J9CH 1Z1JA 1BDAA 1ID5H 1KYNA 2ZTXA 3JZ2B 2H9HA 3RMMH 3MYWA 2OC7A 3TVJB 1XUHA 1DANH 1O32A 2QV1A 4X1PU 1GCTB 1EPTA 1P09A 1QJ7B 2ZU5A 1GJBB 1AB9B 1MBQA 1SGCA 3NWUA 1AFEH 4X2YA 1TOMH 3DD2H 1ARCA 1HIAA 1FJSA 4CBOA 1X7AC 1PFXC 2QXJA 1H8IH 4DY7B 1DWCH 1N8OC 2C8ZB 4YLUA 2WINI 1P0SH 1QJ1B 4YOIA 3SU2A 2ZPQA 2FOEA 4D7GA 1QJ6B 1AVGH 1H4WA 1T8LA 2WUBA 2ALPA 1SI5H 3MFJA 4CRFA 1P01A 2OTVA 2UUJB 4JZIA 1S0RA 4NWKA 3UTUH 2BDIA 1GBBA 1PPBH 3RXIA 3SV8A 2AERH 3V12A 2BDYA 4CREA 1C1OA 1A4WH 2A7JA 1SFIA 3JZ1B 2HRVA 4JYUH 1RD3B 5F8ZA 2OXSA 1LPZB 1V2UT 1K28D 1TALA 1S6HA 3VPKA 4WVPE 2VINA 3ATWA 5L30H 2B0FA 2GTBA 2IN2A 2ZPRA 4ZKSU 4LZ1H 1H9HE 5C2ZA 1CBWB 1P2JA 2XXLA 2TIOA 5LPEA 2GX4A 3ZZ3A 5EW2H 2O8LA 1IQNA 2A4QA 3CP7A 5A0BA 2FZZA 3SUFA 4ZAEA 1UK3A 4INLA 1AVWA 1ELDE 3GCTG 4F49A 1TMBH 3FP6E 5DP9A 1A1RA 1BTYA 1TRYA 2V35A 1DS2E 1LPKB 1C5OH 1TNLA 2Z9LA 3BTEE 3AAUA 3RXQA 1UCYK 2HNTF 1G36A 1NRRH 5E0HA 8KME2 3ZVCA 4ZKNU 2F83A 1QNJA 2H5DA 4IS5A 4OS5A 1F2SE 1FIZA 1AQ7A 4BTUB 4K8BA 5JB9S 4HGCA 2OINA 1QB1A 5DJ7A 4AFSA 2ZDMA 1KSNA 3RXSA 1O39A 3LGIA 4GHTA 3ZZ6A 2P3TB 1O2WA 2BHGA 3M7QA 1CA0C 1EAXA 4XSKU 2XW9A 1MBMA 2ZTZA 3C27B 4JZDH 1TB6H 1O2JA 2CHAB 2ZEBA 2XCNA 1TOCB 2IOTA 1GHZA 1ESTA 1YPLH 4GSOA 4WJG2 1TFXA 1V2VT 2ILNA 1EP5A 1MUEB 3GICB 3RM0H 3TITA 4DVAU 1CSOE 2PGBB 1C4Y2 2A0QB 4AFZA 1FPHH 1C1MA 3EGKH 3TLOA 1F5KU 3V3MA 3GY5A 2NU1E 1SVPA 1EAUA 2CV3A 2VIQA 4K1TA 3T28A 3T62A 3A84A 1O37A 1RTKA 1O2IA 4DIHH 4ISNA 3S7HB 2ZI2H 1C5LH 5EQSA 1E0FD 3ZYDA 1O35A 1QGFA 1F5RA 2ZFFH 1XVOA 1P2NA 1LPGB 1GBLA 1SOZA 1ZSKA 4K69A 2VWOA 3ZZ9A 1G2LA 2ZCLP 2ZHQH 3RXOA 3QO6A 4MLFB 4SGAE 3E16B 3IG6B 3M3SA 1GHWH 1MZDA 1S85A 2PWXA 2VJ1A 1HRTH 1MTNB 1RTLA 2OQ5A 4B76A 2ZU4A 1C1NA 1K2I1 1Z7KA 1O3PB 1W2KH 2J92A 1V2JT 2B8OH 1HV7A 1ANBA 3RXBA 4U2WA 2VH6A 5DP5A 2PLXA 3PV4A 3W94A 1GBDA 3A81A 1BTXA 2J2UA 4AB8A 1SPJA 5I25A 4NIWA 1V2MT 3PLBA 1GGDB 1IQEA 3F1SB 4TPYA 3BG4B 2OBOA 1H8DH 1HJAB 3MI4A 4KTSA 1ELAA 3K65B 3BTDE 3LDXH 1TPAE 4U01A 4B71A 4JMYA 1DUEA 2D26C 3RXUA 3O8BA 4J2YB 1QFKH 3QTVH 1IHTH 1QBNA 2ZCKP 1FY4A 2R0LA 1O3DA 1GBIA 1O3EA 1UK2A 2ANYA 2BLQA 3EE0B 2ZDLA 1K1IA 2ZG0H 3RXLA 2H2ZA 1C5RA 3BIVH 1L4DA 1ZZZA 2WPKS 3LU9B 1FY8E 2WV4A 1EJAA 1TRMA 2Y6TA 7GCHG 2ZGBH 1O3LA 3MOCA 1ESBA 3B9FH 1KDQB 1V6DA 1P03A 3P70B 4I8KA 3VXFH 1UK4A 3M5OA 4Z6AH 2HGTH 4D76A 3SQHE 1CVWH 1O2PA 1MMJN 2J34A 1TGBA 2YNBA 3MHWU 4FUGA 2ZHFH 1RFNA 1UTNA 1B0FA 2GZ7A 3MWIU 3RXPA 4UDWH 4Y6DA 4MPWA 4D9RA 3KIDU 5DG6A 1K22H 3UNRA 3UOUA 2G4TA 2GT7A 3M5LA 2BY5X 2ZFTA 4AN7A 9ESTA 2BOHB 4ABFA 1NRNH 2CF9H 2GMTC 4K2YA 1RGQA 3VB6A 1GBTA 2Q6FA 3SU5A 1IQGA 1XX9A 1GDQA 1V3XA 5ESBA 2ZQ2A 3M61U 1DY8A 2WPJS 2XTTB 3SU1A 2EC9H 3ODFA 3A8DA 1K1MA 3S69A 2SGFE 1OP8A 5EPNA 4YESB 1RIWC 1YCPK 1TGNA 4LZ4B 4JCNA 3TJUA 2AIQA 2BDAA 4NSVA 2F9OA 2J94A 3SV6A 5FBIA 4RKOB 2ZU2A 2THFB 4AFUA 1D3TB 2HPQH 2BY9X 1O5GH 2A4RA 3DFJA 3KQDA 1DSTA 3D23A 1TE0A 1W12U 2XC4A 3RMNH 1AWHB 1SFQB 4XBBA 2GGVB 1GBAA 1NM6A 5GXPA 1OP0A 5DGJA 1MQ5A 4GVUA 1HJ8A 4I7YH 1EB2A 3UQVA 2K1QA 1YP9A 5T6FA 1C2KA 3KHVA 1BMMH 2ZF0H 3MNSA 5AFZH 3K6YA 4ABHA 3MNXA 1C1PA 1HNEE 4CRGA 1QB9A 3SUEA 1CHOF 4KGAA 2FOAA 2EA3A 3OU0A 1O30A 5JYIA 2G00A 4H42U 2BYAX 1QRXA 1F92A 1N8OB 4X2VA 5EQRA 3SU0A 3LGYA 2FI5E 3UWIA 4D9QA 4NIXA 1F5LA 2GV6A 2NU2E 4ISHH 3PLPA 1XUFA 1GJ6A 1CQQA 1LTOA 1DWBH 3B23B 1VITG 4Z0KA 1O2RA 3KQBA 1MD8A 5F03A 2C8WB 1BRBE 1QR3E 6LPRA 1H9LB 3MO3A 1E34B 4XBDA 1BCUH 1LQDB 3ZZBA 1SQTA 1QBVH 1DVAH 1GMDG 1CU1A 1DWDH 5PTPA 1QBOA 2GV7A 1WTHD 4ABDA 4CR5A 1W7XH 4DT7B 1NC6A 5SGAE 1ZMJA 2QN5T 2Z6BD 2A2XH 1F0SA 2PTNA 2PTCE 3U8TH 1AFQB 3NK8A 1NFXA 2C3SA 3HK6B 1SGPE 5J4SA 1Q3XA 2Y5HA 1O2QA 3GCTF 3EDXB 3PO1C 3B8JA 4BANB 2BY6X 5JB8S 1AUTC 3ZVEA 1D6WA 5DP4A 3HGNA 1GI6A 1GJ4H 2W7SA 5FBEA 1C4V2 1TQ0B 2ZGCA 4NA7A 1TNHA 1PPCE 1SLUB 5TCCA 4X8UH 1VCWA 3A80A 5CMXH 1HAZB 1C9TA 1EJNA 2GVFA 1O2XA 1P05A 5JBAS 4NFFA 3A86A 2BXUH 1S6FA 1IAUA 2VGCB 1EJMA 1C2MA 4WY3A 1BA8B 1SGTA 1RRKA 1SGFG 4FUJA 1HGTH 1GJ7B 3I77A 1BBRH 1C1TA 3O8RA 3NXPA 4FXGH 1NO9H 2SGAA 5EXMA 1YPKH 5T3HA 1ESAA 3E1XB 3EA7A 3PTNA 3S9AA 1O3KA 3T5FH 2R3YA 2DE8A 1GBKA 1TNKA 5F8TA 3GCHC 1BTUA 1NN6A 2M5TA 1FDPA 1GI5A 3P6ZB 1C2FA 1AN1E 4YM9A 2GP9B 3ZV8A 2VIDA 1ACBE 2OCVB 3KGPA 1GJ9B 1OKXA 2BLWA 1QURH 4R0IA 2XBYA 1KTSB 2EI6A 4DOQA 1GI9B 2TRMA 3QLPH 1Z71A 2D1JA 1L1GA 1ELBA 3U1JB 1NFUA 1VGCB 2XC5A 1L2EA 2PKSC 4WWYA 1P12E 2CMYA 1BUIA 2ZECA 3FZZA 2OUAA 4BTTB 4I33A 2SFAA 1EPTB 1B7XB 1QA0A 3UOPA 3SI3H 2P8OB 3T26A 1V2ST 1SGIB 3DUXH 8ESTE 2FEQH 1LVBA 2LPRA 6GCHF 4D7FA 3UFAA 2XRCA 1UVSH 3SU6A 1CE5A 2PW8H 1CGJE 5AVDA 2G51A 2AFQB 2SGDE 1ABJH 3F9HA 1IQIA 2RCEA 2GZ9A 2ESTE 1LHCH 1GI1A 3TK5A 7LPRA 5LGOA 1FV9A 5BPEA 3SGAE 2PSYA 4BOHA 4BNRA 1C5WB 1IOEA 3MO9A 4Q7YA 1MCVA 3OYPA 1TBZH 4CR9A 2BMGB 1SGRE 1PPGE 3BTKE 1O3GA 4E7RG 1P10A 5AF9H 3PWBA 3RXRA 5FCKA 1QHRB 1DFPA 1FLEE 3ZVFA 1S5SA 1VITH 2UWPA 4KTUA 2SGQE 4TY7A 1NTPA 1MTVA 1HLTH 3F9FA 3LH1A 3VEQB 1NU9A 4ZUHA 1GI3A 1VCQA 1LKAA 5GJ4B 1Y3VA 1YPJH 2Z3CA 3BEIB 1UCYE 1GMDF 2PFEA 1HAPH 2AGGX 2XC0A 1SLWB 4X0WU 4MPUA 2A1DB 3RXEA 1A5IA 4NG9H 1O2GH 4B1TA 2IJOB 2ZDKA 3P95A 1SGEE 1LVYA 1W0ZU 2FOFA 5JDUB 1FNIA 3RU4T 3ZZ4<