4FUGA

Crystal structure of the urokinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fugA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fugA01
3PLKA 2SNVA 1QHRB 3SHCH 5C1XA 1QNJA 2WYJA 2NU2E 1ARCA 2VNTA 3F9HA 4UD9H 4NFFA 3A8BA 1O34A 1O31A 4WF8A 3M3TA 3TK6A 3SU1A 3PO1C 1MZAA 2P59A 2P93A 1OS8A 4WMDA 4AGKA 5DPAA 3UREA 2QYIA 4MVNA 3LJJA 4GSOA 2H5DA 1OX1A 2QY0B 1O5GH 2GT8A 3BEFB 1SGIB 1P3EA 5LH8A 1GDUA 1GBHA 4GHQA 4D9RA 1SHHB 1HFDA 3HATH 1S6FA 1GJAB 2G55A 1QURH 1O30A 1Z7KA 3R3GB 4GVUA 1ID5H 3S7HB 3DA9B 2ZFRH 2A5IA 4ZXYH 5CHAB 3KGPA 3E16B 2W7UA 3ZVCA 7LPRA 3RXDA 3KQCA 1MU8B 3TPIZ 1QCPA 3BG8A 1BHXF 1AVGH 2FS9A 3TLOA 5ESBA 3S0NA 1UMAH 1VGCC 3GYMA 3VEQB 2HRVA 3T26A 2XTTB 2OCVB 1EX3A 1S81A 3HPTB 5GDSH 1QBOA 2TGPZ 2ANMH 3P8NA 5FCRA 1Y5BT 3SU6A 3K9XB 4E7RG 1O3MA 2THFB 4LZ1H 5A2MH 5GWZA 1VJ9U 1H9LB 1DFPA 2F9BH 2BD3A 1ZTKA 3B8JA 4HGCA 2Q6FA 5A0CA 1VCQA 2QN5T 4MNXA 1O2NA 1UVSH 3Q77A 5HMAA 4UE7H 1LQEA 4ZAEA 2ANYA 1DITH 4B75A 2BD5A 3EA8A 6CHAC 1CGJE 1Z71A 2ZKSA 1UTMA 1C1QA 1ELCA 1V2UT 2RA3A 2C8XB 1YCPK 3GY8A 3TH4H 2HOBA 1LTOA 3A7YA 3MH6A 3TH3H 5B6OA 2NWNA 3UQVA 1NU7B 3LGIA 4YLQH 1NRSH 3M37A 3M5OA 3F9FA 5IYTA 1EAIA 4BNRA 3RXFA 5DKMA 1HAOH 1CT2E 3SORA 1GHAG 1QB6A 2VIPA 5DG6A 2OC8A 4FU9A 5G4BA 5J4SA 3CP7A 2KAIA 4THNH 3UQOA 2VVUA 2OXSA 1AZ8A 1GHZA 3VXEH 4K69A 2W26A 1HAXB 3UOPA 1W7GH 1FONA 3QZQA 1FPHH 4A1XA 4HZHA 1OXGA 4DY7B 1C2LA 1P04A 3F1SB 3PM3A 2J92A 1CHOG 1Q3XA 2W5EA 4OS6A 2FOAA 2YNAA 4A5TS 3BTQE 4ZHAA 2Q1JA 4JK6A 2PKSB 2FX4A 1TX7A 2RDLA 1XUGA 2I6SA 2SGEE 2AERH 2JH6D 2BD9A 4U2WA 4X6OA 1YPGH 2SGPE 1IQLA 1ETRH 1XXFA 2V3OH 3PMBB 1G32B 3UPEA 1SSXA 2ZFSA 1A1RA 1IQFA 1CA8B 4GPGA 1ZLRA 1L1JA 5L2ZH 4ABIA 3TNTA 1D9IA 1P2JA 3HGNA 4BAKB 1O5BB 1BBRK 1LHFH 1MTUA 3H7OA 5FBEA 3TVJB 1UK3A 3MU8A 1BB0B 2WV4A 3A8CA 2CN0H 2ASUB 2TGAA 1VCPA 2ZWLH 4AFSA 7ESTE 2XC5A 2VWMA 3BEIB 1ZJDA 1Y3YA 3A80A 2VINA 1T8NA 3ZZ8A 4CRFA 3RXCA 1IOEA 4X1QU 5CHAC 1ESBA 2XCFA 3VB3A 1PPZA 2QXHA 3NK8A 2CHAB 4I8JA 1UCYE 1PPBH 1P2QA 1DOJA 6GCHG 5JB9S 2YNBA 2FYRA 1HIAA 2CJIA 4AFZA 4CREA 1JRTA 3K6ZA 1W0YH 3PB1E 1CT4E 2VWOA 2HPPH 1LKBA 1K1MA 2KAIB 2EI8A 1DSTA 4RKOB 1RXPA 3ZVGA 1O32A 4H4FA 2J2UA 2A7HA 2R2MB 3SNCA 4HTCH 3RC6A 1A61H 3MU5A 2PTCE 3F68H 1Z8RA 1ZMLA 1O35A 1E34B 4NA9H 2Z9GA 3BTME 3QTOH 2ZCHP 3GDUA 3T2NA 4D76A 1TFXA 2O8MA 1DLEA 1DWEH 3PTBA 2P16A 2P3TB 4AX9H 1H9IE 2Z3CA 2ZGXH 3KQDA 5IDKA 4Y8ZA 1INCA 1FN8A 1GVZA 4Q80A 1O2RA 3BN9A 1C5VA 3G01A 1B7XB 1BIOA 3RU4D 4MNWA 1GI5A 1F5RA 2ZU2A 4ABGA 2WPMS 3GISB 5BRRE 1C5QA 1GI7B 1V2LT 5JBCS 1HJ9A 1C1PA 2FIRH 3LH1A 3L6PA 1UTKA 4I33A 8GCHF 5C5NA 1S82A 1GJBB 1M9UA 2R2WU 2FXRA 2VGCB 3AW0A 4WVPE 4ZMAH 2EC9H 1G3BA 1SGPE 1KXDA 3UR6A 4MLFB 2WPJS 2AH4X 1VITG 1EZXC 1SG8B 2GV7A 3F9GA 4FVBA 9LPRA 1ELFA 1ABIH 1PYTD 3ZZCA 1TA6A 1T4VH 3S9AA 1GBEA 2ZEBA 1O3GA 3RC4A 1T31A 2G4TA 2ZFTA 1LDTT 1EPTA 5L6NH 4NSYA 1LVBA 3ZVFA 4D7FA 2XBVA 5C2ZA 3RMOH 3M3VA 1C5OH 3D62A 1QIXB 2G5NA 1UCYH 2ZHFH 4WMEA 3D49H 2UWPA 2ZF0H 4DOQA 2FOBA 1GJ8B 5HYOA 2H1UA 1TMUH 1HIAB 2OINA 1YM0A 1C5WB 3M36A 1C2HA 4CRDA 4MTBA 1WTGH 3ODFA 4ABEA 4Y7AA 2PKSC 3B9FH 3O8CA 4B2BA 4I31A 3MTYA 1G2MA 2AGIX 2A1DB 5T6FA 1C2KA 3ZVBA 2XC4A 2ZCLP 5DP3A 4YESB 1SVPA 3DHKH 3ITIA 3RXAA 4I8GA 3ZV9A 3UNRA 1C2IA 1AMHA 1SGYE 1TNJA 1SFIA 1O36A 5DP8A 3NKKA 1IQHA 2Y5FA 4CBOA 4IN2A 4ISHH 1XKBC 1BTPA 1GBJA 1ZPZA 1H8DH 1OPHB 2Y6TA 2ANWA 3GY5A 2UWLA 1C5SA 4O3UA 2H6MA 1Y3VA 1WOFA 1RD3B 2SGFE 1ZPCA 2W3IA 3DFJA 3M5LA 3KQBA 3RM0H 4BOHA 1YPKH 2QF3A 2CHAC 1GVKB 3E3TA 3GCOA 3ESTA 1GI8B 1TNIA 4X8UH 1OOKB 2PWXA 4ASHA 1EJMA 2A4QA 2AYWA 2WPKS 1GHBF 4DGJA 3VGCB 4KP0A 4IMZA 4ISNA 3SU3A 3MU1A 2ZP0H 1ZSJA 2FESH 2VVVA 4B74A 4OS7A 3RMNH 4XBCA 4KKDA 1JOUB 4Y0YE 1BTYA 3P8OA 1DXWA 1EPTB 3P6ZB 2R0KA 1QB1A 1ZTLA 4A1TA 4FU8A 1AI8H 5GJ4B 3RXOA 2XWBI 3LGVA 2O9QA 5AHGH 1QY6A 3AAUA 4B73A 5EXMA 1JIMA 2CMYA 3KNXA 1EAXA 1BHXB 1EOLA 2AIQA 2XYAA 4MNVA 4Y10E 5LPRA 1ANEA 3RXPA 1IHSH 1V2KT 4WWYA 2C8ZB 1OYTH 1ZZZA 3GY3A 1W8BH 1OSSA 3ATIA 3QLPH 5FX6A 1NTPA 5HGGA 1ZSKA 2BLOA 1LMWB 1O5AB 1AKSA 1QRZA 4IC6A 4LK4A 1O3EA 1AIXH 2FWWA 4XBDA 1QB9A 1SGEE 2Z94A 1BJUA 1SLWB 2F9OA 2UUFB 5DP9A 3MHWU 1HAIH 7KMEH 1O38A 2JH5D 2RG3A 1GBFA 5E2OA 1AWFH 2A2XH 3RXIA 1O2QA 2BYAX 3M3SA 3BV9B 2VGCC 1YPHE 3PYHA 2J38A 1GCTB 3SNBA 1JWTA 1GMHG 1S85A 1AN1E 2BY5X 3L3TA 4A6LA 1LVYA 1ELGA 4MNYA 1FXYA 1EJNA 1C1RA 3PLPA 1V2JT 1F92A 1BTZA 1TAWA 1ANDA 1IQJA 1A2CH 3LGYA 5E0GA 3RLWH 4O3TA 3MO3A 1P8VC 3TGKE 4DIHH 3U8RH 1C9TA 1Z6EA 1MTNB 3PLBA 3KCGH 1FY1A 3B23B 1ETSH 1GBDA 1P11E 1SBWA 3T28A 4AOQA 4IW4E 1ZPBA 1W3CA 1J16A 4AB8A 3SGBE 3O8RA 3SQHE 2FOMB 4TPIZ 4KTSA 1C2FA 2QAAA 4UFEH 4K3JA 4MQAA 1SGQE 3BEUA 1CA0B 4WMFA 1PQ8A 3F9EA 3TK9A 1SGRE 1C4Y2 1VR1H 3QGJA 1HXEH 1MU6B 3SW2B 3V0XA 1LPZB 3ELAH 3Q3YA 4YOJA 1F7ZA 2FP7B 3A8AA 1HPGA 1O3IA 3A8DA 2WV5A 2ZGBH 5CMXH 1DVAH 1MD7A 1QBVH 4DIIH 1O3DA 2OLGA 3V7TA 1CHGA 3SUGA 1LPGB 2A0QB 2ZO3H 4YT7H 2OC7A 1WV7H 1DM4B 3TGJE 3QZRA 2G8TA 4ESTE 3FVFB 3A86A 1Q31A 4GUXA 1T8LA 1AKSB 1QRWA 3RC5A 5C20A 4NCYA 3DFLA 4KELA 1TGBA 1Z8IB 4X6MA 2HNTE 2Z9JA 3ZZBA 2GT7A 3SI3H 2QXGA 4FUDA 1A3EH 1P12E 4Y0ZE 3VGCC 5A09A 3L33A 2UUJB 1E37B 3A7ZA 1NFUA 1O5CB 2TBSA 2VIWA 1QJ6B 2GX4A 3OTJE 4ZHMU 3SZNA 4K8BA 3A7VA 5T6DA 5EXLA 5AF9H 1SGCA 1PQ5A 1K9OE 1KXBA 2AMQA 2ZHWH 3RXUA 1FN6A 3MU4A 1EPTC 1JBUH 1IQGA 1P2IA 3H7TA 4K1SA 2XCNA 2FODA 1C1UH 2FOCA 1AE8H 4D7GA 1HAPH 3TJUA 1MCTA 2BDYA 1HCGA 3AASA 3NXPA 1O3AA 2BD8A 2BDBA 3SV2H 2A4RA 1UK2A 1T7CA 2A4GA 1BTUA 2FOFA 4U30A 1IQNA 1ZHPA 3TJNA 1F2SE 2RA0A 1V6DA 1G3DA 2ZDVH 1QL8A 1AUTC 5T3HA 2V6NA 2TGTA 1T32A 2QCYA 2GZ7A 2HALA 4SGAE 1GHVH 1AHTH 3CENA 4ABFA 4B2AA 3E1XB 1C2JA 4CRGA 1MH0A 1GCTC 4CHAB 1F0UA 2QXIA 2GCTB 1AE5A 2G4UA 3I78A 5AFYH 4AORA 3GCTF 1LPKB 3GY2A 4XDEA 3BG4B 2XWAA 2WPHS 3GCTG 5EQQA 2CF9H 3V13A 4MPVA 1ANBA 2OC1A 1NS3A 1DX5M 3QX5H 4ZHLU 3ZZ5A 4YO9A 1W14U 1TMBH 2BOKA 4DURA 2FOEA 2H9EH 4U32A 3EQ0H 4UFFH 2W7SA 4FUHA 1UTOA 1K1LA 1WTHD 1WAYB 3RU4E 3IG6B 2PSYA 1MTNC 2BX4A 2C4FH 1GMCF 3JZ1B 1O37A 1TE0A 2A5KA 5TJXA 3TJVA 1P03A 2BDGA 3LH3A 4ABBA 4NIWA 2PTNA 5T6GA 1GI2A 1W12U 2D8WA 4DCDA 4BXWA 3AAVA 5EW1H 1KLTA 3URCA 3MNBA 4CRAA 2HGTH 1CA0C 1L1NA 1C5ZB 1CBWB 3OU0A 1O2UA 2VIDA 2B7DH 3P70B 1YLDA 2GZ8A 3ENSB 2FYQA 4BANB 1TYNA 1FI8A 2Z9IA 2PR3A 5LPEA 2B0FA 2ZZUH 3KIDU 2A31A 2UUYA 1C5TA 1L4ZA 2OQ5A 1WBGB 1D3PB 1XX9A 2P94A 1YP9A 2PGQB 3BTEE 2HPQH 1OP8A 1KTSB 1NFYA 2BY6X 3PWCA 4WH8A 4XE4A 4WY3A 2VH6A 1RTKA 3QUMP 5I25A 3E0NB 3ZYDA 1F0TA 1KXCA 2A45B 1O2XA 1NPMA 1SOZA 3SOSA 2ILNA 1C5LH 1OWEA 1TONA 3UIRA 2GP9B 4UONA 1G3CA 1HAHH 4MPXA 1WQSA 3SUDA 1F0SA 2PUQH 2VIVA 1UJ1A 2PFEA 2H9HA 3K2UA 5EU8A 8LPRA 1LO6A 1TBQH 2ANKH 2Q6GA 2Z9KA 1E38B 2LNCA 3MU0A 1WQVH 1NY22 1P0SH 3GICB 1JRSA 4IS5A 1HAZB 1K1NA 4UFGH 1TB6H 5DK1A 1L4DA 4X2WA 1K1PA 4GCHF 3SI4H 3HKJB 5PTPA 3KF2A 3U98H 2I6QA 1BITA 2DE9A 3SJOA 3VB7A 1UTNA 2ZCKP 4BTTB 1FUJA 1P01A 2SFAA 4CH8B 5F6MA 2TPIZ 2ZTXA 4IGDA 3RP2A 5JBAS 2BQWB 2XXLA 3Q00A 3MNCA 1OWJA 1MKXK 4YOIA 4IC5A 2UUKB 1HNEE 2FX6A 5A0AE 4TY6A 4NG9H 3AW1A 3LU9B 4A92A 5JB8S 2EI6A 2H9TH 1W2KH 1TWXB 4LOYH 3TIUA 1GHWH 5HM9A 4QT8C 1P09A 1GBMA 4YLUA 4TY7A 1O3KA 3UNQA 3GDSA 4I8HA 2GZ9A 1NRNH 4NZLA 4XFQA 2BY8X 5C1YA 2BLVA 2ZIQH 3A84A 3W95A 2XBXA 1B0FA 3A87A 4JK5A 1SLVB 2F9UA 5FPSA 4CHAC 3P17H 2GCTC 1FAKH 3SJKA 1MTVA 2XW9A 5EW2H 3BTFE 3D23A 3FAOA 1EQ9A 3BG4C 4WJG2 2Z9LA 1VZQH 1GWAA 1GJDB 4IN1A 1DY8A 1SQOA 1TABE 4F4OC 2EI7A 4BAQB 1O33A 4X8VH 4JZEH 4X8TH 1UK4A 3HKIB 4ISOA 1U6QA 1A46H 1NFWA 1IQIA 4MDSA 1L0ZA 4OS5A 3MH4A 4ABHA 4Y8XA 4ABDA 1A5HA 1ELBA 3ZVAA 2HNTF 4BTUB 1SQAA 2GVFA 2QIQA 1ANCA 1AU8A 1EB1H 1MBQA 3ATKA 1A4WH 1GI1A 2WPLS 2V0BA 1S83A 2Y7ZA 1O2JA 4H6SB 3UNSA 1QA0A 2ESTE 3RMLH 2ZFFH 1CBWC 2BVSH 1GBLA 3TH2H 1LCYA 2GCHF 1AVXA 1ZGVA 8GCHG 4AZ2B 1O2HA 4I8KA 2AEIH 1T8OA 3U1JB 4JYVH 4E06H 3RXRA 2BVXH 2FLRH 3UOUA 6LPRA 2OP9A 1O3JA 1XVOA 2GKVE 4YT6H 1RGQA 4H6TA 3U1IB 4YOGA 2JETB 4MPWA 1Y5AT 3UTUH 3ZZ7A 1FY4A 3NPSA 4BAHB 4WH6A 1FMGA 2M5TA 1ELTA 2BDCA 1YC0A 5FHTA 3RMMH 1GBBA 1BBRE 2NU1E 1BRAA 1GI6A 1X7AC 3MMGA 3GYLB 3I77A 1YCPH 1ELVA 1VCWA 1HLTH 2DUCA 4GHTA 2VU8E 1GG6B 1SR5C 2PSXA 1FY8E 1C5YB 1SHYA 1PQ7A 2VH0A 5AFZH 2BQ6B 3T27A 1YPMH 1KDQA 1DY9A 3V3MA 1MKWK 5E0JA 3BF6H 1BRCE 1TNGA 2HLCA 1BA8B 1H8IH 2J4IA 3ZZDA 1NRRH 2BZ6H 1MUEB 1W7XH 2D1JA 4SGBE 2K1QA 1CGIE 3AVZA 4K2YA 3OSYA 1EAWA 1V3XA 2R0LA 4TWWA 1O3NA 1QQUA 1NROH 1WU1A 3U8TH 1XUFA 4ABJA 3FP8E 1MTSA 4INLA 2CF8H 1UO6A 3RXQA 1KY9A 1QA7A 1QL9A 4HI3A 1ELEE 2AMDA 3LC5A 1PPCE 1AGJA 2FTMA 1EAUA 3MNSA 1PYTC 4YTAA 1SGDE 1Z8JB 4LZ4B 1F0RA 1ELDE 4RSPA 1TNHA 4TWYA 2F3CE 5ABWA 1TNKA 2ZU5A 1FPCH 1L1GA 5HXFA 1C5XB 1FY3A 2XBWA 2BLWA 3PMAB 4I7YH 1PPGE 3NZIA 3A83A 3KEEA 1SC8U 1TALA 1FY5A 4X6PA 4ISLA 4CR5A 1GHBG 4BXSA 1BRBE 3FP7E 4AGJA 1V2OT 1UTPA 2G81E 4DJZB 2ODPA 2C90B 2BD2A 1J17T 3OY5U 1YBWA 1ZRBA 4D8NA 4O03A 3TJOA 1C2MA 1HGTH 3BSQA 2J95A 3QTVH 1BBRH 5DJ7A 5EXNA 4DVAU 2PKAA 4E05H 1EB2A 2OTVA 2RCEA 1MKXH 1P2KA 3EGKH 3PV4A 2ODYB 5A8ZA 4Y7BA 4FUFA 1J15A 3KL6A 1V2RT 2V3HH 2YOLA 1N6YA 2ZNKH 2IJOB 1AFEH 1BMAA 4ISIH 4OGYA 1V2TT 1RS0A 1ESTA 1TQ0B 2ZTZA 3C1KA 1KDQB 1C4U2 2FOHA 3MI4A 1IQMA 1YPEH 4VGCB 3SNAA 3RXHA 2BVRH 2BXUH 1E0FD 5A8XA 1ELAA 5C5OA 1SQTA 1LHCH 1P3CA 1UVUH 5F8ZA 1HV7A 1UTQA 1TPAE 3DUXH 1C5NH 2A7CA 4NIYA 4JZDH 1TLDA 1O3HA 4JYUH 3M5NA 3V12A 1N1LA 1DPOA 1O2LA 4JYTA 1BOQA 2XBYA 1C5MD 1P02A 1S0QA 4AYYB 2EEKA 2IN2A 1YPLH 3QK1A 1CVWH 2ZU3A 1W11U 1TGSZ 1THSH 2JETC 1BMNH 4Q7YA 1JXPA 4NIXA 3LDXH 1RFNA 1KLJH 2BX3A 3M7QA 1Z1JA 1EP5A 1GI3A 3ZV8A 1PPFE 1FDPA 2FOGA 1JIRA 3RXKA 1W10U 4Z0KA 2ZGJA 3SV7A 1EP6A 1F5KU 1ZHMA 2V35A 3LGWA 3MO6A 4OS1A 4Y8YA 1RIWB 2F9PA 2P8OB 5E0HA 1GG6C 2BLQA 2GDDA 3MH5A 1ZMJA 4INHA 2XNIA 1SMFE 1QTFA 1UTJA 1QRXA 1ZGIA 5ESTE 3QWCH 3HK3B 1FLEE 1QBNA 4R8TB 1P05A 1THPB 3LONA 1IAUA 5FAHA 3D65E 4Y71A 2ZDKA 3RXGA 2ZGCA 4UDWH 2IPHA 2ZPSA 2STBE 1GBKA 4K1EA 4BTIB 1QL7A 1XUKA 3EE0B 2BTCE 1J8AA 2B8OH 2A5AA 2HWLB 1TGTA 2C8WB 2PKAB 3QDZB 1V2NT 2GV6A 3GOVB 1HUTH 1IHTH 3A7XA 1DUEA 3A89A 3BTDE 2QGRA 1B5GH 4AYVB 1KYNA 1NESE 3R0FA 1CSOE 4NIVA 4NWKA 1C1WH 4LXBH 3P8FA 2WINI 1CT0E 1GMDF 1OP0A 3MOCA 3SU2A 5L2YH 2NU0E 3ODDA 2ZECA 5LGOA 1K2I1 1H9HE 1EOJA 3C27B 3VB6A 1Z8GA 2ZGHA 2BXTH 1G30B 1T4UH 1AO5A 3A88A 3VB4A 1D3DB 1XMNB 1MKWH 3NWUA 3PMHB 1C4V2 2AGEX 4AG2A 1XKAC 2GMTB 2BDIA 2QF0A 1RTFB 1HXFH 1EXFA 1UTLM 2ZHQH 3MO9A 1CE5A 1LVMA 4K8YA 1SLXB 1EZUC 2G52A 3GDVA 2QV1A 5JBTA 1GBTA 1W0ZU 2XC0A 3SJ9A 1RJXB 1SOTA 2A2QH 4ZKRU 1DS2E 2Y81A 1O3BA 1HB0B 3F6UH 1LKAA 5F8TA 4M7GA 2FM2A 4X2XA 4B76A 1XUJA 1A5GH 1O2YA 3EAJA 1AY6H 1LHGH 3FANA 5DP5A 3A7WA 2AMPA 4OS2A 1UVOA 1GBAA 3S7KB 1D3QB 1IQEA 1KXEA 2AS9A 4NZQA 2VB0A 4X1RU 3M35A 3QGNB 2BOHB 2WUCA 2WYGA 3WY8A 1Y3XA 5DP7A 2NU3E 2Z6BD 3UR9A 2F83A 4AFQA 3SV8A 1XVMA 1ZOMA 3SJIA 1MAYA 1GJCB 1AUJA 2BD4A 4VGCC 1OWIA 2A32A 2STAE 3H5CB 2PV9B 1ORFA 4IMQA 2BD7A 3BTKE 4J2YB 1HRTH 3O8DA 3KQEA 1LHEH 1TGNA 4RKJB 5JDUB 1DUAA 3M7UA 5DGJA 5EQSA 2ALVA 1O3FA 4YZUA 1GL0E 4CR9A 2FS8A 3GCHB 2WUBA 3QN7A 3T25A 3ATLA 2ZDLA 4NWLA 4OGXA 3IWMA 3Q3XA 1BMMH 9ESTA 1V2WT 5C67A 4CBNA 2ULLA 1C1VH 1HAGE 1OKXA 2J34A 3DT0H 2EA3A 3RXMA 4ZKSU 4X1SU 2P3FH 2FLBH 3VB5A 2NU4E 4TPYA 1KXFA 2F9NA 5CE1A 5GXPA 3A81A 1GJ6A 3TU7H 1FIWA 1RIWC 1C5RA 2P8OC 1UHBA 3SU4A 5I46H 1GMCG 3SN8A 2FZZA 4MPUA 3PMJA 1SFQB 3P8GA 3SV6A 2J9NA 1PQAA 1HJAB 4FVDA 4O9VA 1NO9H 1AB9B 1EZSC 4Y11E 1HAVA 4A1VA 1GI4A 2GDEH 1TOMH 1DSUA 1UCYK 2P3UB 1TRNA 5JYIA 1J9CH 1TQ7B 4U01A 3EYDA 5AVDA 2B9LA 3SNEA 1O39A 1Y3UA 1DXPA 3ATWA 3M61U 1MBMA 4FUBA 1BTWA 1O2ZA 1P10A 1W13U 3OX7U 1BQYA 5K0HA 1DICA 1QQ4A 3NUMA 1P06A 1G3EA 4OS4A 1D3TB 3MWIU 1F5LA 1ARBA 4J1YA 3ZZ3A 4HFPB 2C8YB 1VITH 1GHAF 1E36B 1G36A 1YCPM 4X1NU 1DWCH 4ZH8A 4B71A 1WYKA 1GJ7B 2FO9A 2BZAA 1XXDA 1L2EA 2BMGB 3LIWA 5FXLA 2O8LA 2IOTA 1ZYOA 5H4IB 3GY7A 2PGBB 1YPHC 3I29A 3EA7A 1SB1H 1LQDB 2TGDA 3BIVH 3DD2H 3SO3A 1A5IA 2FI5E 2VIOA 3U69H 1CU1A 1O2PA 1GI0A 1SGFG 3JZ2B 1O3OA 2GMTC 1GI9B 2ZQ2A 1O2IA 2BB4A 1MCVA 4DT7B 1O2MA 1YF4A 1MAXA 3NCLA 1CHOF 1D6RA 3LT3A 2BQ7B 5EOKA 5E8EH 2Q6DA 2BY7X 4ZXXH 5F8XA 3SGAE 1TX8A 2SGDE 4GCHG 4FUIA 1O2TA 1TNLA 4K1TA 2ZA5A 3SV9A 5J4QA 3S69A 1ACBE 5JBBS 5BPEA 4A7IB 3BTTE 1K1OA 1S84A 1KSNA 1K21H 1P9SA 1YYY1 2A7JA 5L30H 4INKA 7GCHF 4Q2KA 2OQUA 2FEQH 3MNXA 2OBQA 3UFAA 7GCHG 1OWHA 1P2MA 4X2VA 1XUIA 1N8OB 3UY9A 3FZZA 1QGFA 1TPSA 3CS0A 3W94A 1HJ8A 1AFQB 3E90B 2R9PA 1UHBB 5HM2A 2DE8A 3CS7A 1BDAA 1ZJKA 3KHVA 3MH7A 1OP2A 1NFXA 5TCCA 2J94A 5DO4H 4MG3A 1S5SA 4IBLH 5A8YA 1HAVB 3T62A 4NA7A 1DWDH 2OBOA 2O8UA 3HK6B 3ZVEA 1FV9A 3RUOA 4WXVA 3PWBA 3PTNA 1NT1A 5ETXA 1DWBH 3U8OH 6GCHF 1J14A 4ABAA 1AVWA 2BY9X 3GCHC 1C5UA 3A82A 4B1TA 1V2QT 3T5FH 1BUIA 4GLYA 1H4WA 1P57B 2AFQB 5FBIA 2TIOA 1BTXA 1GPZA 1SLUB 1TOCB 2HNTC 4R0IA 3RXJA 1ZR0A 1HAYB 1MMJN 4FU7A 5DP4A 1XM1A 2BM2A 3RXLA 1PPHE 4X2YA 3Q76A 4Y6DA 4JMYA 1TIOA 1GL1A 3RU4T 1HJAC 2ZU1A 3EA9A 4UFDH 5C3NA 1Q2WA 2PLXA 1AB9C 2GTBA 3N7OA 1TBZH 2BHGA 3BIUH 1GJ5H 1WSSH 3M5MA 2GCHG 1FQ3A 2ZDAH 2G5VA 4XBBA 1G37A 2O8WA 1DANH 1PJPA 3UUZA 1KXAA 1AD8H 1SPJA 2FMJA 3E91A 1IQKA 2GD4B 1JMOH 2H2ZA 4FUGA 1ZRKA 3LOXA 4CRCA 1DLKB 2SNWA 2AGGX 4X6NA 5F03A 1OYQA 1C2EA 1O2GH 3LJOA 1MZDA 4NA8A 2Y82A 3T29A 4ZUHA 1MQ5A 3LGTA 3SU5A 3VXFH 1AWHB 1BMLA 1GVLA 3OY6U 2Y5HA 1ZMNA 1VITF 4RN6A 1BRUP 3RXVA 1EUFA 4E7NA 1HYLA 2UWOA 4Q7XA 1Y5UT 1ABJH 2Y5GA 3K6YA 3QO6A 4O97A 2Z3DA 2FI4E 2SGQE 5EODA 3RXBA 1UVPA 4H42U 1QJ7B 2PW8H 2GGVB 5EPYA 1TPOA 5FCKA 2XRCA 2H5CA 1A7SA 3E6PH 5K7RA 1O5FH 2VIQA 4KTCA 1EATA 4FUJA 1NU9A 4NGAH 1C1OA 1FJSA 2VVCA 1E35B 1SI5H 1TX6A 5DP6A 1NZQH 4ZKOU 4UEHH 4FUEA 3TITA 8ESTE 3UWJH 3LGUA 4GAWA 2F91A 5GIBA 1QFKH 1ESAA 1TRYA 2SGAA 5C1UA 1O5EH 4NFEA 3RXTA 1GJ9B 2Z3EA 1AQ7A 1G9IE 1A0JA 1N8OC 1TMTH 4ZROA 4FXGH 2ALPA 2QXJA 1NRPH 1AFQC 3URDA 1O3CA 2BDHA 3ZYEA 2FDAA 1C5PA 4JZFH 6ESTA 1DT2A 2ZFPH 1K1JA 3SGQE 1THRH 1H1BA 2P95A 1T8MA 1FIZA 1GHYH 1GDQA 1Y59T 1AZZA 3GY6A 1BZXE 3STJA 3TNSA 1A0LA 1V2ST 4DW2U 1S0RA 1C1TA 1C9PA 1GGDB 1SGNE 3RXSA 3BTGE 3EDXB 3TGIE 1LHDH 1VJAU 3SJ8A 1NRQH 1B0EA 3VPKA 1EKBB 3U9AH 2ZDNA 3PROA 4JCNA 1C2DA 1CQQA 1TPPA 1QJ1B 4JZ1A 1KTTB 1LVOA 2JKHA 1KIGH 1V2VT 4ZKNU 1K1IA 4AFUA 3BTHE 2QA9E 1P2OA 1CO7E 3TK5A 1V2MT 1O2KA 1GDNA 5SGAE 2R3YA 3RDZA 3PO1B 1GJ4H 1D4PB 5FPYA 1ETTH 3LPRA 2VJ1A 1K28D 1GBCA 1SGFA 1O0DH 1ZTJA 1FAXA 1QR3E 4I8LA 3BTWE 1TA2A 3SHAH 5LPFA 5GCHF 3MFJA 4XOJA 1A0HB 1FNIA 2F9VA 1EZQA 2ZPQA 4DG4A 1GHXH 4Y76A 1N6XA 5GCHG 3RM2H 3SUEA 3ZZAA 2CV3A 2VWLA 3S9BA 2CXVA 3FFGA 4X8SH 2PUXB 1PFXC 3LC3A 4WXIA 1DDJA 4B2CA 1EASA 1FZZA 1ZSLA 2G00A 1PPEE 3VFEA 4D9QA 2HVXA 1SGTA 4K60A 3FZDA 2WPIS 5EG4A 2ZPRA 4TYDA 3RLYH 1HBTH 3S9CA 2ZG0H 3IITA 1OWKA 2W3KA 1VGCB 2ZFQH 2A4OA 2ZQ1A 3KN2A 1DE7H 1NM6A 2ZHEH 5EPNA 3HGPA 4AN7A 4I32A 2ODQA 1GMHF 1D6WA 2OC0A 3A7TA 1G2LA 2OD3B 1V2PT 4X1PU 4AB9A 2Z7FE 2FTLE 2BDAA 1WCZA 1P9UA 1RTLA 2PHBA 3ZZ6A 1WUNH 1NC6A 3FP6E 3MYWA 1YGCH 4K5ZA 5A0BA 2C93B 2B5TB 4KGAA 5GPIB 4FUCA 3SQEE 1O3PB 1BCUH 3RXEA 3ZZ4A 1C2GA 3SU0A 6CHAB 1KLIH 1Y3WA 1C1SA 1GBIA 2ZC9H 1NN6A 3ZZ9A 2D2DA 2CGAA 3GY4A 4JZIA 3LKWA 1BT7A 4CH2B 1HDTH 1O2SA 1MTWA 1O2WA 4PROA 2ZTYA 4KTUA 4BAOB 2FPZA 1A3BH 3ZVDA 4Y79A 1P2NA 4YM9A 1Z6JH 3OYPA 1YLCA 3P92A 8KME2 1EJAA 1TBRH 5TCAA 3STIA 1O2OA 1XUHA 5JPMH 1SL3A 1C1NA 5FPTA 4NSVA 4CRBA 1UVTH 2D26C 3K65B 3SNDA 1Z1IA 3E0PB 2O8TA 1GCDA 1TRMA 2AIPA 1RRKA 1O5DH 3P95A 2C3SA 2FI3E 2LPRA 1GMDG 1YKTA 1S6HA 2JH0D 2ZU4A 4X0WU 2R3UA 5EGMA 3SUFA 5FX5A 2Y80A 4F49A 4XSKU 3ATMA 2VWNA 2ZDMA 4Q7ZA 4BAMB 1C1MA 1O3LA 1YPJH 1Y8TA 3Q3KA 3UWIA 2Y7XA 4AG1A 2G51A 1BJVA 1MQ6A 1K22H 1BTHH 5EQRA 1CGHA 1MD8A 2QC2A 1GGDC 1TGCA 2TRMA 3M7TA 3GCNA 3E8LA 3SBKA 2ZHDA 4Z6AH 1OWDA 5E2PA 1ZHRA 2OUAA 3O8BA 2ZI2H 1O2VA 3A85A
chains in the Genus database with same CATH superfamily
3PLKA 2SNVA 1QHRB 3SHCH 5C1XA 1QNJA 2WYJA 2NU2E 1ARCA 2VNTA 3F9HA 4UD9H 5KGOA 4NFFA 3A8BA 1O34A 1O31A 4WF8A 3M3TA 3TK6A 3SU1A 3PO1C 1MZAA 2P59A 2P93A 1OS8A 4WMDA 4AGKA 5DPAA 3UREA 2QYIA 4MVNA 3LJJA 4GSOA 2H5DA 1OX1A 2QY0B 1O5GH 2GT8A 3BEFB 1SGIB 1P3EA 5LH8A 1GDUA 1GBHA 4GHQA 4D9RA 1SHHB 1HFDA 5GNDA 3HATH 1S6FA 1GJAB 2G55A 1QURH 1O30A 1Z7KA 3R3GB 4GVUA 1ID5H 3S7HB 3DA9B 2ZFRH 2A5IA 4ZXYH 5CHAB 2JJ2D 3KGPA 3E16B 2W7UA 3ZVCA 7LPRA 3RXDA 3KQCA 1MU8B 3TPIZ 1QCPA 3BG8A 1BHXF 1AVGH 2FS9A 3TLOA 5ESBA 3S0NA 1UMAH 1VGCC 3GYMA 3VEQB 2HRVA 3T26A 2XTTB 2OCVB 1EX3A 1S81A 3HPTB 5GDSH 1QBOA 2TGPZ 2ANMH 3P8NA 5FCRA 1Y5BT 3SU6A 3K9XB 4E7RG 1O3MA 2THFB 4LZ1H 5A2MH 5GWZA 1VJ9U 4RT1A 1H9LB 1DFPA 2F9BH 2BD3A 1ZTKA 3B8JA 4HGCA 2Q6FA 5A0CA 1VCQA 2QN5T 3OEED 1O2NA 4MNXA 2QE7D 1UVSH 3Q77A 5HIZA 4UE7H 5HMAA 1LQEA 4ZAEA 2ANYA 1DITH 4I86A 4B75A 2BD5A 3EA8A 6CHAC 1CGJE 1Z71A 2ZKSA 1UTMA 1C1QA 1ELCA 1V2UT 4F48B 2RA3A 2C8XB 1YCPK 5T1VA 3GY8A 3TH4H 1E1QD 2HOBA 1LTOA 3A7YA 3MH6A 3TH3H 5B6OA 2NWNA 3UQVA 1NU7B 3LGIA 4YLQH 1NRSH 3M37A 3M5OA 3F9FA 4P00A 5IYTA 1EAIA 4BNRA 3RXFA 5DKMA 1HAOH 1CT2E 3SORA 1GHAG 1QB6A 2VIPA 5DG6A 2OC8A 4FU9A 5G4BA 5J4SA 3CP7A 2KAIA 4YXWD 4THNH 3UQOA 2VVUA 2OXSA 1AZ8A 1GHZA 3VXEH 4K69A 2W26A 1HAXB 2JDID 3UOPA 1W7GH 1FONA 2YMSC 3QZQA 1FPHH 4A1XA 4HZHA 1OXGA 4DY7B 1C2LA 1P04A 3F1SB 3PM3A 2J92A 1CHOG 1Q3XA 2W5EA 4OS6A 2FOAA 2YNAA 4A5TS 3BTQE 4ZHAA 2Q1JA 4JK6A 2PKSB 2FX4A 1TX7A 2RDLA 1XUGA 2I6SA 1VKYA 2SGEE 2AERH 2JH6D 2BD9A 4U2WA 4X6OA 1YPGH 2SGPE 1IQLA 2QF5A 1ETRH 1XXFA 2V3OH 3PMBB 1G32B 3UPEA 5EJZA 1SSXA 2ZFSA 1A1RA 1IQFA 1CA8B 4GPGA 1ZLRA 1L1JA 5L2ZH 4ABIA 3TNTA 1D9IA 1P2JA 3HGNA 4BAKB 1O5BB 1BBRK 1LHFH 1MTUA 3H7OA 5FBEA 3TVJB 1UK3A 3MU8A 1BB0B 2WV4A 3A8CA 2CN0H 2ASUB 2TGAA 1VCPA 2ZWLH 4AFSA 7ESTE 2XC5A 2VWMA 3BEIB 1ZJDA 1Y3YA 3A80A 2VINA 1T8NA 3ZZ8A 4CRFA 3RXCA 1IOEA 4X1QU 5CHAC 1ESBA 2XCFA 3VB3A 1PPZA 2QXHA 3NK8A 2CHAB 4I8JA 1UCYE 1PPBH 1P2QA 1DOJA 6GCHG 5JB9S 2YNBA 2FYRA 1HIAA 2CJIA 4AFZA 4CREA 5KECA 1JRTA 1UW7A 3K6ZA 4ASUD 1W0YH 3PB1E 1CT4E 2VWOA 1YLNA 2HPPH 1LKBA 1K1MA 2KAIB 2EI8A 1DSTA 4RKOB 1RXPA 3ZVGA 1O32A 4H4FA 2J2UA 2A7HA 2XOKD 2R2MB 3SNCA 4HTCH 3RC6A 1A61H 2KCYA 2PTCE 3MU5A 3F68H 1Z8RA 1ZMLA 1O35A 2QF4A 1E34B 4NA9H 2Z9GA 3BTME 3QTOH 2ZCHP 3GDUA 3T2NA 2XNDD 4D76A 1TFXA 2O8MA 1DLEA 1DWEH 3PTBA 2P16A 2P3TB 4AX9H 1H9IE 2Z3CA 2ZGXH 3KQDA 5IDKA 4Y8ZA 1INCA 1FN8A 1GVZA 3UAIC 4ACBA 4Q80A 1O2RA 3BN9A 1C5VA 3G01A 1B7XB 1BIOA 3RU4D 4MNWA 1GI5A 1F5RA 2ZU2A 4ABGA 2WPMS 3GISB 5BRRE 1C5QA 1GI7B 1V2LT 5JBCS 1HJ9A 1C1PA 2FIRH 3LH1A 3L6PA 1UTKA 4I33A 8GCHF 5C5NA 1S82A 1GJBB 1M9UA 2J98A 2FXRA 2R2WU 2VGCB 3AW0A 4WVPE 2EC9H 4ZMAH 1G3BA 1SGPE 1KXDA 3UR6A 4MLFB 2WPJS 2AH4X 1VITG 1EZXC 1SG8B 2GV7A 3F9GA 4FVBA 9LPRA 1ELFA 1ABIH 1PYTD 3ZZCA 1TA6A 1T4VH 3S9AA 1GBEA 2ZEBA 1O3GA 3N7DA 3RC4A 1T31A 2G4TA 2ZFTA 1LDTT 1EPTA 5L6NH 4NSYA 1LVBA 3ZVFA 4D7FA 2XBVA 5C2ZA 3RMOH 3M3VA 1C5OH 3D62A 1QIXB 2G5NA 1UCYH 2ZHFH 4WMEA 3D49H 2UWPA 2ZF0H 4DOQA 2FOBA 1GJ8B 5HYOA 2H1UA 1TMUH 1HIAB 2OINA 1YM0A 1C5WB 3M36A 1C2HA 4CRDA 4MTBA 1WTGH 3SZEA 3ODFA 4ABEA 4Y7AA 2PKSC 3B9FH 3O8CA 4B2BA 4I31A 3MTYA 1G2MA 2AGIX 2A1DB 5T6FA 1C2KA 3F3BA 3ZVBA 2XC4A 2KCPA 2ZCLP 5DP3A 4YESB 1SVPA 3DHKH 3ITIA 3RXAA 4I8GA 3ZV9A 3UNRA 1C2IA 1AMHA 1SGYE 1TNJA 1SFIA 1O36A 5DP8A 3NKKA 1IQHA 2Y5FA 4CBOA 4IN2A 4ISHH 1XKBC 1BTPA 1GBJA 1ZPZA 1H8DH 1OPHB 2Y6TA 2ANWA 3GY5A 2UWLA 1C5SA 4O3UA 1OHHD 1YWUA 2H6MA 1Y3VA 1WOFA 1RD3B 2SGFE 1ZPCA 2W3IA 3DFJA 3M5LA 3AK5A 3KQBA 3RM0H 4BOHA 1YPKH 2QF3A 2CHAC 1GVKB 3E3TA 3GCOA 3ESTA 1GI8B 1TNIA 4X8UH 1OOKB 2PWXA 4ASHA 1EJMA 2A4QA 2AYWA 2WPKS 2J98B 1GHBF 4DGJA 3VGCB 4KP0A 4IMZA 2WSSD 4ISNA 3SU3A 3MU1A 2ZP0H 1ZSJA 2FESH 2VVVA 4B74A 4OS7A 3RMNH 4XBCA 4KKDA 1JOUB 4Y0YE 2W6ID 1BTYA 3P8OA 1DXWA 1EPTB 3P6ZB 2R0KA 1QB1A 1ZTLA 1SQRA 4FU8A 1AI8H 5GJ4B 3RXOA 2XWBI 3LGVA 4A1TA 2O9QA 5AHGH 1QY6A 3AAUA 4B73A 5EXMA 1JIMA 2CMYA 5C0UA 3KNXA 2AHME 1EAXA 1BHXB 1EOLA 2AIQA 2XYAA 4MNVA 4Y10E 5LPRA 1ANEA 3RXPA 1IHSH 1V2KT 3KQ5A 4WWYA 2C8ZB 1OYTH 1ZZZA 3GY3A 1W8BH 1OSSA 3ATIA 3QLPH 5FX6A 1NTPA 5HGGA 1ZSKA 2BLOA 3VG8A 1LMWB 1O5AB 1AKSA 1QRZA 3CNRA 4IC6A 4LK4A 1O3EA 1AIXH 2FWWA 4XBDA 2HVYB 3PRDA 1QB9A 1SGEE 2Z94A 1BJUA 1SLWB 2F9OA 2UUFB 5DP9A 3MHWU 1HAIH 7KMEH 1O38A 2JH5D 2RG3A 1GBFA 5E2OA 1AWFH 2A2XH 3RXIA 1O2QA 2BYAX 3M3SA 3BV9B 1W0JD 2VGCC 1YPHE 3PYHA 2J38A 1GCTB 3SNBA 1JWTA 1GMHG 1S85A 2WV9A 1AN1E 2BY5X 4P02A 3FOAA 3L3TA 4A6LA 1LVYA 1ELGA 4MNYA 1FXYA 1EJNA 1C1RA 3PLPA 1V2JT 1F92A 1BTZA 1TAWA 1ANDA 1IQJA 1A2CH 3LGYA 5E0GA 3RLWH 4O3TA 3MO3A 1P8VC 3TGKE 4DIHH 3U8RH 1C9TA 3WWBA 1Z6EA 1MTNB 3PLBA 3KCGH 1FY1A 3B23B 3MQKC 1ETSH 1GBDA 1P11E 1SBWA 3T28A 4B6EA 4AOQA 4IW4E 1ZPBA 1W3CA 1J16A 4AB8A 3SGBE 3O8RA 3SQHE 2FOMB 4TPIZ 4KTSA 1C2FA 2QAAA 4UFEH 4K3JA 4MQAA 1SGQE 3BEUA 1CA0B 4WMFA 1PQ8A 3F9EA 3TK9A 3DSOA 1SGRE 3DCLA 2J97A 1C4Y2 1VR1H 3QGJA 1HXEH 1MU6B 3SW2B 3V0XA 1LPZB 3ELAH 3Q3YA 4YOJA 3U28C 1F7ZA 2FP7B 3A8AA 1HPGA 1O3IA 3A8DA 2WV5A 2ZGBH 5CMXH 1DVAH 1MD7A 1QBVH 4DIIH 3OFND 5DSFA 1O3DA 2OLGA 3V7TA 1CHGA 3SUGA 1LPGB 4Z1MD 2A0QB 2ZO3H 4YT7H 2OC7A 1WV7H 1DM4B 3TGJE 3QZRA 2G8TA 4ESTE 3FVFB 3A86A 1Q31A 4GUXA 1T8LA 1AKSB 1QRWA 3RC5A 5C20A 5B6LA 4NCYA 3DFLA 3OE7D 4KELA 1TGBA 1Z8IB 4X6MA 2F4LA 2HNTE 2Z9JA 3ZZBA 2GT7A 3SI3H 2QXGA 4FUDA 1A3EH 1P12E 4Y0ZE 3VGCC 5A09A 1S6LA 3L33A 2UUJB 1E37B 3A7ZA 1H8HD 1NFUA 1O5CB 2TBSA 2VIWA 1QJ6B 2GX4A 2LELA 3OTJE 4ZHMU 3SZNA 4K8BA 3A7VA 5T6DA 5EXLA 5AF9H 1SGCA 1PQ5A 1K9OE 1KXBA 2AMQA 2ZHWH 3RXUA 1FN6A 3MU4A 1EPTC 1JBUH 1IQGA 1P2IA 3DSPA 3H7TA 4K1SA 2XCNA 2FODA 1C1UH 2FOCA 1AE8H 4D7GA 1HAPH 3TJUA 1MCTA 2BDYA 1HCGA 3AASA 3NXPA 1O3AA 2BD8A 2BDBA 3SV2H 2A4RA 1UK2A 1T7CA 2A4GA 1BTUA 2FOFA 4U30A 1IQNA 1ZHPA 3TJNA 1F2SE 2RA0A 1V6DA 1G3DA 2ZDVH 1QL8A 1AUTC 5T3HA 2V6NA 5F53A 2TGTA 1T32A 2QCYA 2GZ7A 2HALA 4SGAE 1GHVH 1AHTH 3CENA 4ABFA 4B2AA 3N99A 3E1XB 1C2JA 4CRGA 1MH0A 1GCTC 4CHAB 1F0UA 2QXIA 2GCTB 1AE5A 2G4UA 3I78A 5AFYH 4AORA 3GCTF 1LPKB 3GY2A 4XDEA 3BG4B 2XWAA 2WPHS 3GCTG 5EQQA 2CF9H 3V13A 4MPVA 1ANBA 2OC1A 1NS3A 1DX5M 3QX5H 4ZHLU 3ZZ5A 4YO9A 1W14U 1TMBH 2BOKA 4DURA 2FOEA 2H9EH 4U32A 3EQ0H 4UFFH 4Q63A 2W7SA 4FUHA 1UTOA 1K1LA 1WTHD 1WAYB 3RU4E 3IG6B 2PSYA 1MTNC 2BX4A 2C4FH 1GMCF 3JZ1B 1O37A 1TE0A 2A5KA 5TJXA 3TJVA 1P03A 2BDGA 3LH3A 4ABBA 1H8ED 4NIWA 2PTNA 5T6GA 1GI2A 1W12U 2D8WA 4DCDA 4BXWA 3AAVA 5EW1H 1KLTA 2WZQA 3URCA 3MNBA 4CRAA 2HGTH 1CA0C 1L1NA 1C5ZB 1CBWB 3OU0A 1O2UA 2VIDA 2B7DH 3P70B 1YLDA 2GZ8A 3ENSB 2FYQA 4BANB 1TYNA 1FI8A 2Z9IA 2PR3A 2KM0A 5LPEA 2B0FA 2ZZUH 3KIDU 2A31A 2UUYA 1C5TA 1L4ZA 2OQ5A 1WBGB 1D3PB 1XX9A 2P94A 1YP9A 2PGQB 3BTEE 2HPQH 1OP8A 1KTSB 1NFYA 2BY6X 3PWCA 4WH8A 4XE4A 4WY3A 2VH6A 1RTKA 3QUMP 5I25A 3E0NB 3ZYDA 1F0TA 1KXCA 2A45B 1O2XA 1NPMA 1SOZA 3SOSA 2ILNA 1C5LH 1OWEA 1TONA 3UIRA 2GP9B 4UONA 1G3CA 1HAHH 4MPXA 1WQSA 3SUDA 1F0SA 2PUQH 2VIVA 1UJ1A 2PFEA 2H9HA 3K2UA 5EU8A 8LPRA 4M9FA 1LO6A 1TBQH 2ANKH 2Q6GA 2Z9KA 1E38B 2LNCA 3MU0A 1WQVH 1NY22 1P0SH 3GICB 1JRSA 4IS5A 1HAZB 1K1NA 4UFGH 1TB6H 5DK1A 1L4DA 4X2WA 1K1PA 4GCHF 1BMFD 3SI4H 3HKJB 5PTPA 3KF2A 3U98H 1MABB 1BITA 2DE9A 2I6QA 3SJOA 3VB7A 1UTNA 2ZCKP 4BTTB 1FUJA 1P01A 2SFAA 4CH8B 5F6MA 2TPIZ 2ZTXA 4IGDA 3RP2A 5JBAS 2BQWB 2XXLA 3Q00A 3MNCA 1OWJA 1MKXK 4YOIA 4IC5A 2UUKB 1HNEE 2FX6A 5A0AE 4TY6A 4NG9H 3OTPA 3AW1A 3LU9B 4A92A 5JB8S 2EI6A 2H9TH 1W2KH 1TWXB 4LOYH 3TIUA 1GHWH 5HM9A 4QT8C 1P09A 1GBMA 4YLUA 4TY7A 1O3KA 3UNQA 3GDSA 4OM9A 4I8HA 2GZ9A 1NRNH 4NZLA 4XFQA 2BY8X 5C1YA 2BLVA 2ZIQH 3A84A 3W95A 2XBXA 1B0FA 3A87A 4JK5A 1SLVB 2F9UA 5FPSA 4CHAC 3P17H 2GCTC 1FAKH 3SJKA 1MTVA 2XW9A 5EW2H 3BTFE 3D23A 3FAOA 1EQ9A 3BG4C 4WJG2 2Z9LA 1VZQH 1GWAA 1GJDB 4IN1A 1DY8A 1SQOA 1TABE 4F4OC 2LP6A 2EI7A 2EY4C 4BAQB 1O33A 4X8VH 4JZEH 4X8TH 1UK4A 3HKIB 4ISOA 1U6QA 1A46H 1NFWA 1IQIA 4MDSA 1L0ZA 4OS5A 3MH4A 4ABHA 4Y8XA 4ABDA 1A5HA 1ELBA 3ZVAA 2HNTF 4BTUB 1SQAA 2GVFA 2QIQA 1ANCA 1AU8A 1EB1H 1MBQA 3ATKA 1A4WH 1GI1A 2WPLS 2CK3D 2V0BA 3WW7A 1S83A 2Y7ZA 1O2JA 4H6SB 3UNSA 1QA0A 2ESTE 3KYFA 3RMLH 2ZFFH 1CBWC 2BVSH 1GBLA 5HIYA 3TH2H 1LCYA 2GCHF 1AVXA 1ZGVA 8GCHG 4AZ2B 1O2HA 4I8KA 2AEIH 1T8OA 3U1JB 4JYVH 4E06H 3RXRA 2BVXH 2FLRH 3UOUA 6LPRA 2OP9A 3F2FA 5C0TA 1O3JA 1XVOA 2GKVE 4YT6H 1RGQA 4H6TA 3U1IB 4YOGA 2JETB 4MPWA 1Y5AT 3UTUH 3ZZ7A 4DT4A 1FY4A 3NPSA 2KFWA 4BAHB 4WH6A 1FMGA 2M5TA 1ELTA 2BDCA 1YC0A 5FHTA 3RMMH 1GBBA 1BBRE 2NU1E 1BRAA 1GI6A 1X7AC 3MMGA 3GYLB 3I77A 1YCPH 1ELVA 1VCWA 1HLTH 2DUCA 4GHTA 2VU8E 1GG6B 1SR5C 2PSXA 1FY8E 1C5YB 1SHYA 1PQ7A 2VH0A 5AFZH 2BQ6B 3T27A 1YPMH 1KDQA 1DY9A 3V3MA 1MKWK 5E0JA 3BF6H 4FETA 1BRCE 1TNGA 2HLCA 1BA8B 1H8IH 2J4IA 3ZZDA 1NRRH 2BZ6H 1MUEB 1W7XH 2D1JA 4SGBE 2K1QA 1CGIE 5EIYA 3AVZA 4K2YA 3OSYA 1EAWA 1V3XA 5EJLA 2R0LA 4TWWA 3F0PA 1O3NA 1QQUA 1NROH 1WU1A 3U8TH 1XUFA 4ABJA 3FP8E 1MTSA 4INLA 2CF8H 1UO6A 3RXQA 1KY9A 1QA7A 1QL9A 4HI3A 1ELEE 2AMDA 3LC5A 1PPCE 1AGJA 2FTMA 4ACAA 1EAUA 3MNSA 1PYTC 4YTAA 1SGDE 1Z8JB 4LZ4B 1F0RA 1ELDE 4RSPA 4TSFD 1TNHA 4TWYA 2F3CE 5ABWA 1TNKA 2ZU5A 1FPCH 1L1GA 5HXFA 1C5XB 1FY3A 2F43B 2XBWA 2BLWA 3PMAB 4I7YH 1PPGE 3NZIA 3A83A 3KEEA 1SC8U 1TALA 1FY5A 4X6PA 4ISLA 4CR5A 1GHBG 4BXSA 1BRBE 3FP7E 4AGJA 1V2OT 1UTPA 2G81E 4DJZB 2ODPA 1SKYE 2C90B 2BD2A 1J17T 3OY5U 1YBWA 1ZRBA 4D8NA 4O03A 3TJOA 1C2MA 1HGTH 3BSQA 2J95A 3QTVH 1BBRH 5DJ7A 5EXNA 4DVAU 2PKAA 4E05H 1EB2A 2OTVA 2RCEA 1MKXH 1P2KA 3EGKH 3PV4A 2ODYB 5A8ZA 4Y7BA 4FUFA 1J15A 3KL6A 1V2RT 2V3HH 2YOLA 1N6YA 2ZNKH 2IJOB 1AFEH 1BMAA 4ISIH 4OGYA 1V2TT 1RS0A 1ESTA 1TQ0B 2ZTZA 3C1KA 1KDQB 1C4U2 2FOHA 3MI4A 1IQMA 1YPEH 4VGCB 3SNAA 3RXHA 2BVRH 2BXUH 1E0FD 5A8XA 1ELAA 5C5OA 1SQTA 1LHCH 2GJGA 1P3CA 1UVUH 5F8ZA 1HV7A 1UTQA 1TPAE 3DUXH 2HLDD 1C5NH 2A7CA 4NIYA 4JZDH 1TLDA 1O3HA 4JYUH 3M5NA 3V12A 1N1LA 3SYJA 5CDFE 1DPOA 1O2LA 4JYTA 1BOQA 2XBYA 1C5MD 1P02A 1S0QA 4AYYB 2EEKA 2IN2A 1YPLH 3QK1A 1CVWH 2ZU3A 5FL7D 1W11U 1TGSZ 3KYGA 1THSH 2JETC 4XD7D 1BMNH 4Q7YA 1JXPA 4NIXA 3LDXH 1NBME 1RFNA 3PV5A 5KEDA 1KLJH 2BX3A 3M7QA 1Z1JA 1EP5A 1GI3A 3ZV8A 1PPFE 1FDPA 2FOGA 1JIRA 3RXKA 1W10U 4Z0KA 2ZGJA 3SV7A 1EP6A 1F5KU 1ZHMA 2V35A 3LGWA 3MO6A 4OS1A 4Y8YA 1RIWB 2F9PA 2P8OB 5E0HA 1GG6C 2BLQA 2GDDA 3MH5A 1ZMJA 4INHA 2XNIA 1SMFE 1QTFA 3W1EA 1UTJA 1QRXA 1ZGIA 5ESTE 3QWCH 3HK3B 1FLEE 1QBNA 4R8TB 1P05A 1THPB 3LONA 1IAUA 5FAHA 3D65E 4Y71A 2ZDKA 3RXGA 2ZGCA 4UDWH 2IPHA 2ZPSA 2STBE 1GBKA 4K1EA 4BTIB 1QL7A 1XUKA 3EE0B 2BTCE 4HG6A 1J8AA 2B8OH 2A5AA 2HWLB 1TGTA 5CHBA 2C8WB 2PKAB 3QDZB 1V2NT 2GV6A 3GOVB 1HUTH 1IHTH 3A7XA 1DUEA 3A89A 3BTDE 2QGRA 1B5GH 4AYVB 3GS9A 1KYNA 1NESE 3R0FA 1CSOE 4NIVA 4NWKA 1C1WH 4LXBH 3P8FA 2WINI 1CT0E 1GMDF 1OP0A 3MOCA 3SU2A 5L2YH 2NU0E 3ODDA 2ZECA 5LGOA 1K2I1 1H9HE 1EOJA 3C27B 3VB6A 1Z8GA 2ZGHA 2BXTH 1G30B 1T4UH 1AO5A 3A88A 3VB4A 1D3DB 1XMNB 1MKWH 3NWUA 3PMHB 1C4V2 2AGEX 4AG2A 1E79D 1XKAC 2GMTB 2BDIA 2QF0A 1RTFB 1HXFH 1EXFA 1UTLM 2ZHQH 3MO9A 1CE5A 1LVMA 4K8YA 1SLXB 2V3MA 1EZUC 2G52A 3GDVA 2QV1A 5JBTA 1GBTA 1W0ZU 2XC0A 3SJ9A 1RJXB 1SOTA 2A2QH 4ZKRU 1DS2E 2Y81A 1O3BA 1HB0B 2JJ1D 3F6UH 1LKAA 5F8TA 4M7GA 2FM2A 4X2XA 1COWD 4B76A 1XUJA 1A5GH 1O2YA 3EAJA 1AY6H 1LHGH 3FANA 5DP5A 3A7WA 2AMPA 4OS2A 1UVOA 1GBAA 3S7KB 1D3QB 1IQEA 1KXEA 2AS9A 4NZQA 3FN8A 2VB0A 4X1RU 3M35A 3QGNB 2BOHB 2WUCA 2WYGA 3WY8A 1Y3XA 5DP7A 2NU3E 2Z6BD 3UR9A 4B6FA 2F83A 4AFQA 3SV8A 3DSGA 1XVMA 1ZOMA 3SJIA 1MAYA 1GJCB 1AUJA 2BD4A 2WPDD 4VGCC 3FO8D 1OWIA 2A32A 2STAE 3H5CB 2PV9B 1ORFA 4IMQA 2BD7A 3BTKE 4J2YB 1HRTH 3UB0A 3O8DA 2M2AA 3KQEA 1LHEH 1TGNA 4RKJB 5JDUB 1DUAA 2RFKC 3M7UA 5DGJA 5EQSA 1EFRD 2ALVA 1O3FA 4YZUA 1GL0E 4CR9A 2FS8A 3GCHB 2WUBA 3QN7A 3ZIAD 3T25A 3ATLA 2ZDLA 2IJD1 4NWLA 4OGXA 3IWMA 3Q3XA 1BMMH 9ESTA 1V2WT 5C67A 4CBNA 2ULLA 1C1VH 1HAGE 1OKXA 2J34A 3DT0H 2EA3A 3RXMA 4ZKSU 4X1SU 2P3FH 2FLBH 2YMSD 2NU4E 4RT0A 1KXFA 2F9NA 4TPYA 3VB5A 5CE1A 5GXPA 3A81A 1GJ6A 3TU7H 1FIWA 1NBMD 1RIWC 1C5RA 2P8OC 1UHBA 3SU4A 5I46H 1GMCG 3SN8A 2FZZA 4MPUA 3PMJA 1SFQB 3P8GA 3SV6A 2J9NA 1PQAA 1HJAB 2OK5A 4FVDA 2K0QA 4O9VA 1NO9H 1AB9B 1EZSC 4Y11E 1HAVA 4A1VA 1GI4A 2GDEH 1TOMH 1DSUA 1UCYK 2P3UB 1TRNA 5JYIA 1J9CH 1KMHB 1TQ7B 3N7EA 3EYDA 4U01A 2B9LA 5AVDA 3SNEA 1O39A 1Y3UA 1DXPA 2K8IA 3ATWA 3M61U 1MBMA 4FUBA 1BTWA 1O2ZA 1P10A 1W13U 2KR7A 3OX7U 2VBCA 1BQYA 5K0HA 1DICA 1QQ4A 3NUMA 1P06A 1G3EA 4OS4A 1D3TB 2L74A 3MWIU 1F5LA 1ARBA 4J1YA 3ZZ3A 3F2HA 4HFPB 2IPQX 2C8YB 2WHXA 1VITH 1GHAF 1E36B 1G36A 1YCPM 4X1NU 3H09A 1DWCH 4ZH8A 4B71A 1WYKA 1GJ7B 2FO9A 2BZAA 1XXDA 1L2EA 2BMGB 4Q4LA 3LIWA 5FXLA 2O8LA 2IOTA 1ZYOA 5H4IB 3GY7A 2PGBB 1YPHC 3I29A 3EA7A 1SB1H 1LQDB 2TGDA 3BIVH 3DD2H 3SO3A 1A5IA 2FI5E 2VIOA 3U69H 3OEHD 1CU1A 1O2PA 1GI0A 1SGFG 3JZ2B 1O3OA 2GMTC 1GI9B 2ZQ2A 1O2IA 2BB4A 1MCVA 2KZ4A 4DT7B 1O2MA 1YF4A 1MAXA 3NCLA 1CHOF 3F2GA 1D6RA 3LT3A 2BQ7B 5EOKA 5E8EH 2Q6DA 2BY7X 4ZXXH 5F8XA 3SGAE 1TX8A 2SGDE 4GCHG 4FUIA 1O2TA 1TNLA 4K1TA 2ZA5A 3SV9A 5J4QA 3S69A 1ACBE 5JBBS 5BPEA 4A7IB 3BTTE 1K1OA 1S84A 1KSNA 1K21H 1P9SA 1YYY1 2A7JA 5L30H 4INKA 7GCHF 4Q2KA 2OQUA 2FEQH 3MNXA 2OBQA 3UFAA 7GCHG 1OWHA 1P2MA 4X2VA 1XUIA 1WXRA 1N8OB 3UY9A 3FZZA 1QGFA 1TPSA 3CS0A 3W94A 1HJ8A 1AFQB 3E90B 2R9PA 1WDIA 1UHBB 5HM2A 2DE8A 3CS7A 1BDAA 1ZJKA 3KHVA 3MH7A 1OP2A 1NFXA 5TCCA 2J94A 5DO4H 4MG3A 5HKKD 1S5SA 4IBLH 5A8YA 1HAVB 3T62A 4NA7A 1DWDH 2OBOA 2O8UA 3HK6B 3ZVEA 5C94A 1FV9A 3RUOA 4WXVA 3PWBA 3PTNA 1NT1A 5ETXA 1DWBH 3U8OH 1YY3A 6GCHF 1J14A 4ABAA 4TT3D 1AVWA 2BY9X 3GCHC 1C5UA 3A82A 4B1TA 2W6JD 1V2QT 3T5FH 1BUIA 4GLYA 1H4WA 1P57B 2AFQB 5FBIA 2TIOA 1BTXA 1GPZA 1SLUB 1TOCB 2HNTC 4R0IA 4FOUC 5C17A 3RXJA 1ZR0A 1HAYB 1MMJN 4FU7A 5DP4A 1XM1A 2BM2A 3RXLA 1PPHE 4X2YA 3Q76A 4Y6DA 4JMYA 1TIOA 1GL1A 3RU4T 2JIZD 1HJAC 2ZU1A 3EA9A 4UFDH 5C3NA 1Q2WA 2PLXA 4AC9A 1AB9C 2GTBA 2RDEA 3N7OA 1TBZH 2BHGA 2V7QD 3BIUH 1GJ5H 1WSSH 3M5MA 3EE7A 3NRLA 2GCHG 1FQ3A 2ZDAH 2G5VA 4XBBA 1G37A 1FX0B 2O8WA 1DANH 1PJPA 3UUZA 1KXAA 1AD8H 1SPJA 2FMJA 3E91A 1IQKA 2GD4B 1JMOH 2H2ZA 4FUGA 1ZRKA 3LOXA 4CRCA 1DLKB 2SNWA 2AGGX 4X6NA 5F03A 1OYQA 1C2EA 1O2GH 3LJOA 1MZDA 4NA8A 2Y82A 3T29A 4ZUHA 4XRNA 1MQ5A 3LGTA 3SU5A 3VXFH 1AWHB 1BMLA 1GVLA 3OY6U 2Y5HA 1ZMNA 1VITF 4RN6A 1BRUP 3RXVA 1EUFA 4E7NA 1HYLA 2UWOA 4Q7XA 1Y5UT 1ABJH 2Y5GA 3K6YA 3QO6A 4O97A 2Z3DA 2FI4E 2SGQE 5EODA 3RXBA 1UVPA 4H42U 1QJ7B 2PW8H 2GGVB 5EPYA 1TPOA 4ZCNA 5FCKA 2XRCA 2H5CA 1A7SA 3E6PH 5K7RA 1O5FH 2VIQA 4KTCA 1EATA 4FUJA 1NU9A 4NGAH 1C1OA 1FJSA 2VVCA 1E35B 3WWFA 1SI5H 1TX6A 5DP6A 1NZQH 4ZKOU 4UEHH 1QZ8A 4FUEA 3TITA 8ESTE 2EQNA 3UWJH 3LGUA 4GAWA 2F91A 5GIBA 1QFKH 1ESAA 1TRYA 2SGAA 2KCOA 5C1UA 1O5EH 4NFEA 3RXTA 1GJ9B 2Z3EA 1AQ7A 1G9IE 1A0JA 1N8OC 1TMTH 4ZROA 2KCAA 2ALPA 4FXGH 2QXJA 1NRPH 1AFQC 3URDA 1O3CA 2BDHA 1W0KD 3ZYEA 2FDAA 1C5PA 4RI0A 4JZFH 6ESTA 1DT2A 2ZFPH 1K1JA 3SGQE 1THRH 1H1BA 2P95A 1T8MA 1FIZA 1GHYH 1GDQA 1Y59T 1AZZA 3GY6A 1BZXE 3STJA 3TNSA 1A0LA 1V2ST 4DW2U 1S0RA 1C1TA 1C9PA 1GGDB 1SGNE 3RXSA 3BTGE 3EDXB 3TGIE 1LHDH 1VJAU 3SJ8A 2KX4A 1NRQH 1B0EA 3VPKA 1EKBB 3U9AH 2ZDNA 3PROA 4JCNA 1C2DA 1CQQA 1TPPA 1QJ1B 4JZ1A 1KTTB 1LVOA 2J5UA 2JKHA 1KIGH 1V2VT 4ZKNU 1K1IA 4AFUA 3BTHE 2QA9E 1P2OA 1CO7E 3TK5A 1V2MT 1O2KA 1GDNA 5SGAE 5DN6D 2R3YA 3RDZA 3PO1B 1GJ4H 1D4PB 5FPYA 1ETTH 5IK2D 3LPRA 2VJ1A 1K28D 1GBCA 1SGFA 2L6OA 1O0DH 1ZTJA 1FAXA 1QR3E 4I8LA 3BTWE 1TA2A 3SHAH 5LPFA 5GCHF 3MFJA 4XOJA 1A0HB 1FNIA 2F9VA 1EZQA 2ZPQA 4DG4A 1GHXH 4Y76A 1N6XA 5GCHG 3RM2H 3SUEA 3ZZAA 2CV3A 2VWLA 3S9BA 2CXVA 3FFGA 4X8SH 2PUXB 1PFXC 3LC3A 4WXIA 1DDJA 4B2CA 1EASA 1FZZA 1ZSLA 3FKSD 2G00A 1PPEE 3VFEA 2PP6A 4D9QA 2HVXA 1SGTA 4K60A 3FZDA 2WPIS 5EG4A 2ZPRA 4TYDA 3RLYH 1HBTH 3S9CA 2ZG0H 3IITA 1OWKA 2W3KA 1VGCB 2ZFQH 2A4OA 2ZQ1A 3KN2A 1DE7H 1NM6A 2ZHEH 5EPNA 3HGPA 4AN7A 4I32A 2ODQA 1GMHF 1D6WA 2OC0A 3A7TA 1G2LA 2OD3B 1V2PT 4X1PU 4AB9A 2Z7FE 2FTLE 2BDAA 1WCZA 1P9UA 1RTLA 2PHBA 3ZZ6A 1WUNH 1NC6A 3FP6E 3MYWA 1YGCH 3OAAD 4K5ZA 5A0BA 2C93B 2B5TB 4KGAA 5GPIB 1E1RD 4FUCA 3SQEE 1O3PB 1BCUH 3RXEA 3ZZ4A 1C2GA 3SU0A 6CHAB 1KLIH 1Y3WA 1C1SA 1GBIA 2ZC9H 1NN6A 3ZZ9A 2D2DA 2CGAA 3GY4A 4JZIA 3LKWA 1BT7A 4CH2B 1HDTH 3PRBA 1O2SA 3PV2A 1MTWA 1O2WA 4PROA 2ZTYA 4KTUA 4BAOB 2FPZA 1A3BH 3ZVDA 4Y79A 1P2NA 4YM9A 1Z6JH 3OYPA 1YLCA 3P92A 8KME2 1EJAA 1TBRH 5TCAA 3STIA 1O2OA 1XUHA 5JPMH 1SL3A 1C1NA 5FPTA 4NSVA 4CRBA 1UVTH 2D26C 3K65B 3SNDA 1Z1IA 3E0PB 2O8TA 1GCDA 1TRMA 2AIPA 1RRKA 1O5DH 3P95A 2C3SA 2FI3E 2LPRA 1GMDG 1K0HA 1YKTA 1S6HA 2JH0D 2ZU4A 3F0OA 2R3UA 4X0WU 5EGMA 3SUFA 5FX5A 2Y80A 4F49A 4XSKU 3ATMA 2VWNA 2ZDMA 4Q7ZA 4BAMB 1C1MA 1O3LA 1YPJH 1Y8TA 3Q3KA 3UWIA 2Y7XA 4AG1A 2G51A 5EJ1A 1BJVA 1MQ6A 1K22H 1BTHH 5EQRA 2YMSB 1CGHA 1MD8A 2QC2A 1GGDC 1TGCA 2TRMA 3M7TA 3GCNA 3E8LA 3SBKA 2ZHDA 4Z6AH 1OWDA 5E2PA 1ZHRA 2OUAA 3O8BA 2ZI2H 1O2VA 3A85A 4F55A
chains in the Genus database with same CATH topology
3PLKA 2SNVA 1QHRB 3SHCH 5C1XA 1QNJA 2WYJA 2NU2E 1ARCA 2VNTA 3F9HA 4UD9H 4NFFA 3A8BA 1O34A 1O31A 4WF8A 3M3TA 3TK6A 3SU1A 3PO1C 1MZAA 2P59A 2P93A 1OS8A 4WMDA 4AGKA 5DPAA 3UREA 2QYIA 4MVNA 3LJJA 4GSOA 2H5DA 1OX1A 2QY0B 1O5GH 2GT8A 3BEFB 1SGIB 1P3EA 5LH8A 1GDUA 1GBHA 4GHQA 4D9RA 1SHHB 1HFDA 3HATH 1S6FA 1GJAB 2G55A 1QURH 1O30A 1Z7KA 3R3GB 4GVUA 1ID5H 3S7HB 3DA9B 2ZFRH 2A5IA 4ZXYH 5CHAB 3KGPA 3E16B 2W7UA 3ZVCA 7LPRA 3RXDA 3KQCA 1MU8B 3TPIZ 1QCPA 3BG8A 1BHXF 1AVGH 2FS9A 3TLOA 5ESBA 3S0NA 1UMAH 1VGCC 3GYMA 3VEQB 2HRVA 3T26A 2XTTB 2OCVB 1EX3A 1S81A 3HPTB 5GDSH 1QBOA 2TGPZ 2ANMH 3P8NA 5FCRA 1Y5BT 3SU6A 3K9XB 4E7RG 1O3MA 2THFB 4LZ1H 5A2MH 5GWZA 1VJ9U 1H9LB 1DFPA 2F9BH 2BD3A 1ZTKA 3B8JA 4HGCA 2Q6FA 5A0CA 1VCQA 2QN5T 4MNXA 1O2NA 1UVSH 3Q77A 5HMAA 4UE7H 1LQEA 4ZAEA 2ANYA 1DITH 4B75A 2BD5A 3EA8A 6CHAC 1CGJE 1Z71A 2ZKSA 1UTMA 1C1QA 1ELCA 1V2UT 2RA3A 2C8XB 1YCPK 3GY8A 3TH4H 2HOBA 1LTOA 3A7YA 3MH6A 3TH3H 5B6OA 2NWNA 3UQVA 1NU7B 3LGIA 4YLQH 1NRSH 3M37A 3M5OA 3F9FA 5IYTA 1EAIA 4BNRA 3RXFA 5DKMA 1HAOH 1CT2E 3SORA 1GHAG 1QB6A 2VIPA 5DG6A 2OC8A 4FU9A 5G4BA 5J4SA 3CP7A 2KAIA 4THNH 3UQOA 2VVUA 2OXSA 1AZ8A 1GHZA 3VXEH 4K69A 2W26A 1HAXB 3UOPA 1W7GH 1FONA 3QZQA 1FPHH 4A1XA 4HZHA 1OXGA 4DY7B 1C2LA 1P04A 3F1SB 3PM3A 2J92A 1CHOG 1Q3XA 2W5EA 4OS6A 2FOAA 2YNAA 4A5TS 3BTQE 4ZHAA 2Q1JA 4JK6A 2PKSB 2FX4A 1TX7A 2RDLA 1XUGA 2I6SA 2SGEE 2AERH 2JH6D 2BD9A 4U2WA 4X6OA 1YPGH 2SGPE 1IQLA 1ETRH 1XXFA 2V3OH 3PMBB 1G32B 3UPEA 1SSXA 2ZFSA 1A1RA 1IQFA 1CA8B 4GPGA 1ZLRA 1L1JA 5L2ZH 4ABIA 3TNTA 1D9IA 1P2JA 3HGNA 4BAKB 1O5BB 1BBRK 1LHFH 1MTUA 3H7OA 5FBEA 3TVJB 1UK3A 3MU8A 1BB0B 2WV4A 3A8CA 2CN0H 2ASUB 2TGAA 1VCPA 2ZWLH 4AFSA 7ESTE 2XC5A 2VWMA 3BEIB 1ZJDA 1Y3YA 3A80A 2VINA 1T8NA 3ZZ8A 4CRFA 3RXCA 1IOEA 4X1QU 5CHAC 1ESBA 2XCFA 3VB3A 1PPZA 2QXHA 3NK8A 2CHAB 4I8JA 1UCYE 1PPBH 1P2QA 1DOJA 6GCHG 5JB9S 2YNBA 2FYRA 1HIAA 2CJIA 4AFZA 4CREA 1JRTA 3K6ZA 1W0YH 3PB1E 1CT4E 2VWOA 2HPPH 1LKBA 1K1MA 2KAIB 2EI8A 1DSTA 4RKOB 1RXPA 3ZVGA 1O32A 4H4FA 2J2UA 2A7HA 2R2MB 3SNCA 4HTCH 3RC6A 1A61H 3MU5A 2PTCE 3F68H 1Z8RA 1ZMLA 1O35A 1E34B 4NA9H 2Z9GA 3BTME 3QTOH 2ZCHP 3GDUA 3T2NA 4D76A 1TFXA 2O8MA 1DLEA 1DWEH 3PTBA 2P16A 2P3TB 4AX9H 1H9IE 2Z3CA 2ZGXH 3KQDA 5IDKA 4Y8ZA 1INCA 1FN8A 1GVZA 4Q80A 1O2RA 3BN9A 1C5VA 3G01A 1B7XB 1BIOA 3RU4D 4MNWA 1GI5A 1F5RA 2ZU2A 4ABGA 2WPMS 3GISB 5BRRE 1C5QA 1GI7B 1V2LT 5JBCS 1HJ9A 1C1PA 2FIRH 3LH1A 3L6PA 1UTKA 4I33A 8GCHF 5C5NA 1S82A 1GJBB 1M9UA 2R2WU 2FXRA 2VGCB 3AW0A 4WVPE 4ZMAH 2EC9H 1G3BA 1SGPE 1KXDA 3UR6A 4MLFB 2WPJS 2AH4X 1VITG 1EZXC 1SG8B 2GV7A 3F9GA 4FVBA 9LPRA 1ELFA 1ABIH 1PYTD 3ZZCA 1TA6A 1T4VH 3S9AA 1GBEA 2ZEBA 1O3GA 3RC4A 1T31A 2G4TA 2ZFTA 1LDTT 1EPTA 5L6NH 4NSYA 1LVBA 3ZVFA 4D7FA 2XBVA 5C2ZA 3RMOH 3M3VA 1C5OH 3D62A 1QIXB 2G5NA 1UCYH 2ZHFH 4WMEA 3D49H 2UWPA 2ZF0H 4DOQA 2FOBA 1GJ8B 5HYOA 2H1UA 1TMUH 1HIAB 2OINA 1YM0A 1C5WB 3M36A 1C2HA 4CRDA 4MTBA 1WTGH 3ODFA 4ABEA 4Y7AA 2PKSC 3B9FH 3O8CA 4B2BA 4I31A 3MTYA 1G2MA 2AGIX 2A1DB 5T6FA 1C2KA 3ZVBA 2XC4A 2ZCLP 5DP3A 4YESB 1SVPA 3DHKH 3ITIA 3RXAA 4I8GA 3ZV9A 3UNRA 1C2IA 1AMHA 1SGYE 1TNJA 1SFIA 1O36A 5DP8A 3NKKA 1IQHA 2Y5FA 4CBOA 4IN2A 4ISHH 1XKBC 1BTPA 1GBJA 1ZPZA 1H8DH 1OPHB 2Y6TA 2ANWA 3GY5A 2UWLA 1C5SA 4O3UA 2H6MA 1Y3VA 1WOFA 1RD3B 2SGFE 1ZPCA 2W3IA 3DFJA 3M5LA 3KQBA 3RM0H 4BOHA 1YPKH 2QF3A 2CHAC 1GVKB 3E3TA 3GCOA 3ESTA 1GI8B 1TNIA 4X8UH 1OOKB 2PWXA 4ASHA 1EJMA 2A4QA 2AYWA 2WPKS 1GHBF 4DGJA 3VGCB 4KP0A 4IMZA 4ISNA 3SU3A 3MU1A 2ZP0H 1ZSJA 2FESH 2VVVA 4B74A 4OS7A 3RMNH 4XBCA 4KKDA 1JOUB 4Y0YE 1BTYA 3P8OA 1DXWA 1EPTB 3P6ZB 2R0KA 1QB1A 1ZTLA 4A1TA 4FU8A 1AI8H 5GJ4B 3RXOA 2XWBI 3LGVA 2O9QA 5AHGH 1QY6A 3AAUA 4B73A 5EXMA 1JIMA 2CMYA 3KNXA 1EAXA 1BHXB 1EOLA 2AIQA 2XYAA 4MNVA 4Y10E 5LPRA 1ANEA 3RXPA 1IHSH 1V2KT 4WWYA 2C8ZB 1OYTH 1ZZZA 3GY3A 1W8BH 1OSSA 3ATIA 3QLPH 5FX6A 1NTPA 5HGGA 1ZSKA 2BLOA 1LMWB 1O5AB 1AKSA 1QRZA 4IC6A 4LK4A 1O3EA 1AIXH 2FWWA 4XBDA 1QB9A 1SGEE 2Z94A 1BJUA 1SLWB 2F9OA 2UUFB 5DP9A 3MHWU 1HAIH 7KMEH 1O38A 2JH5D 2RG3A 1GBFA 5E2OA 1AWFH 2A2XH 3RXIA 1O2QA 2BYAX 3M3SA 3BV9B 2VGCC 1YPHE 3PYHA 2J38A 1GCTB 3SNBA 1JWTA 1GMHG 1S85A 1AN1E 2BY5X 3L3TA 4A6LA 1LVYA 1ELGA 4MNYA 1FXYA 1EJNA 1C1RA 3PLPA 1V2JT 1F92A 1BTZA 1TAWA 1ANDA 1IQJA 1A2CH 3LGYA 5E0GA 3RLWH 4O3TA 3MO3A 1P8VC 3TGKE 4DIHH 3U8RH 1C9TA 1Z6EA 1MTNB 3PLBA 3KCGH 1FY1A 3B23B 1ETSH 1GBDA 1P11E 1SBWA 3T28A 4AOQA 4IW4E 1ZPBA 1W3CA 1J16A 4AB8A 3SGBE 3O8RA 3SQHE 2FOMB 4TPIZ 4KTSA 1C2FA 2QAAA 4UFEH 4K3JA 4MQAA 1SGQE 3BEUA 1CA0B 4WMFA 1PQ8A 3F9EA 3TK9A 1SGRE 1C4Y2 1VR1H 3QGJA 1HXEH 1MU6B 3SW2B 3V0XA 1LPZB 3ELAH 3Q3YA 4YOJA 1F7ZA 2FP7B 3A8AA 1HPGA 1O3IA 3A8DA 2WV5A 2ZGBH 5CMXH 1DVAH 1MD7A 1QBVH 4DIIH 1O3DA 2OLGA 3V7TA 1CHGA 3SUGA 1LPGB 2A0QB 2ZO3H 4YT7H 2OC7A 1WV7H 1DM4B 3TGJE 3QZRA 2G8TA 4ESTE 3FVFB 3A86A 1Q31A 4GUXA 1T8LA 1AKSB 1QRWA 3RC5A 5C20A 4NCYA 3DFLA 4KELA 1TGBA 1Z8IB 4X6MA 2HNTE 2Z9JA 3ZZBA 2GT7A 3SI3H 2QXGA 4FUDA 1A3EH 1P12E 4Y0ZE 3VGCC 5A09A 3L33A 2UUJB 1E37B 3A7ZA 1NFUA 1O5CB 2TBSA 2VIWA 1QJ6B 2GX4A 3OTJE 4ZHMU 3SZNA 4K8BA 3A7VA 5T6DA 5EXLA 5AF9H 1SGCA 1PQ5A 1K9OE 1KXBA 2AMQA 2ZHWH 3RXUA 1FN6A 3MU4A 1EPTC 1JBUH 1IQGA 1P2IA 3H7TA 4K1SA 2XCNA 2FODA 1C1UH 2FOCA 1AE8H 4D7GA 1HAPH 3TJUA 1MCTA 2BDYA 1HCGA 3AASA 3NXPA 1O3AA 2BD8A 2BDBA 3SV2H 2A4RA 1UK2A 1T7CA 2A4GA 1BTUA 2FOFA 4U30A 1IQNA 1ZHPA 3TJNA 1F2SE 2RA0A 1V6DA 1G3DA 2ZDVH 1QL8A 1AUTC 5T3HA 2V6NA 2TGTA 1T32A 2QCYA 2GZ7A 2HALA 4SGAE 1GHVH 1AHTH 3CENA 4ABFA 4B2AA 3E1XB 1C2JA 4CRGA 1MH0A 1GCTC 4CHAB 1F0UA 2QXIA 2GCTB 1AE5A 2G4UA 3I78A 5AFYH 4AORA 3GCTF 1LPKB 3GY2A 4XDEA 3BG4B 2XWAA 2WPHS 3GCTG 5EQQA 2CF9H 3V13A 4MPVA 1ANBA 2OC1A 1NS3A 1DX5M 3QX5H 4ZHLU 3ZZ5A 4YO9A 1W14U 1TMBH 2BOKA 4DURA 2FOEA 2H9EH 4U32A 3EQ0H 4UFFH 2W7SA 4FUHA 1UTOA 1K1LA 1WTHD 1WAYB 3RU4E 3IG6B 2PSYA 1MTNC 2BX4A 2C4FH 1GMCF 3JZ1B 1O37A 1TE0A 2A5KA 5TJXA 3TJVA 1P03A 2BDGA 3LH3A 4ABBA 4NIWA 2PTNA 5T6GA 1GI2A 1W12U 2D8WA 4DCDA 4BXWA 3AAVA 5EW1H 1KLTA 3URCA 3MNBA 4CRAA 2HGTH 1CA0C 1L1NA 1C5ZB 1CBWB 3OU0A 1O2UA 2VIDA 2B7DH 3P70B 1YLDA 2GZ8A 3ENSB 2FYQA 4BANB 1TYNA 1FI8A 2Z9IA 2PR3A 5LPEA 2B0FA 2ZZUH 3KIDU 2A31A 2UUYA 1C5TA 1L4ZA 2OQ5A 1WBGB 1D3PB 1XX9A 2P94A 1YP9A 2PGQB 3BTEE 2HPQH 1OP8A 1KTSB 1NFYA 2BY6X 3PWCA 4WH8A 4XE4A 4WY3A 2VH6A 1RTKA 3QUMP 5I25A 3E0NB 3ZYDA 1F0TA 1KXCA 2A45B 1O2XA 1NPMA 1SOZA 3SOSA 2ILNA 1C5LH 1OWEA 1TONA 3UIRA 2GP9B 4UONA 1G3CA 1HAHH 4MPXA 1WQSA 3SUDA 1F0SA 2PUQH 2VIVA 1UJ1A 2PFEA 2H9HA 3K2UA 5EU8A 8LPRA 1LO6A 1TBQH 2ANKH 2Q6GA 2Z9KA 1E38B 2LNCA 3MU0A 1WQVH 1NY22 1P0SH 3GICB 1JRSA 4IS5A 1HAZB 1K1NA 4UFGH 1TB6H 5DK1A 1L4DA 4X2WA 1K1PA 4GCHF 3SI4H 3HKJB 5PTPA 3KF2A 3U98H 2I6QA 1BITA 2DE9A 3SJOA 3VB7A 1UTNA 2ZCKP 4BTTB 1FUJA 1P01A 2SFAA 4CH8B 5F6MA 2TPIZ 2ZTXA 4IGDA 3RP2A 5JBAS 2BQWB 2XXLA 3Q00A 3MNCA 1OWJA 1MKXK 4YOIA 4IC5A 2UUKB 1HNEE 2FX6A 5A0AE 4TY6A 4NG9H 3AW1A 3LU9B 4A92A 5JB8S 2EI6A 2H9TH 1W2KH 1TWXB 4LOYH 3TIUA 1GHWH 5HM9A 4QT8C 1P09A 1GBMA 4YLUA 4TY7A 1O3KA 3UNQA 3GDSA 4I8HA 2GZ9A 1NRNH 4NZLA 4XFQA 2BY8X 5C1YA 2BLVA 2ZIQH 3A84A 3W95A 2XBXA 1B0FA 3A87A 4JK5A 1SLVB 2F9UA 5FPSA 4CHAC 3P17H 2GCTC 1FAKH 3SJKA 1MTVA 2XW9A 5EW2H 3BTFE 3D23A 3FAOA 1EQ9A 3BG4C 4WJG2 2Z9LA 1VZQH 1GWAA 1GJDB 4IN1A 1DY8A 1SQOA 1TABE 4F4OC 2EI7A 4BAQB 1O33A 4X8VH 4JZEH 4X8TH 1UK4A 3HKIB 4ISOA 1U6QA 1A46H 1NFWA 1IQIA 4MDSA 1L0ZA 4OS5A 3MH4A 4ABHA 4Y8XA 4ABDA 1A5HA 1ELBA 3ZVAA 2HNTF 4BTUB 1SQAA 2GVFA 2QIQA 1ANCA 1AU8A 1EB1H 1MBQA 3ATKA 1A4WH 1GI1A 2WPLS 2V0BA 1S83A 2Y7ZA 1O2JA 4H6SB 3UNSA 1QA0A 2ESTE 3RMLH 2ZFFH 1CBWC 2BVSH 1GBLA 3TH2H 1LCYA 2GCHF 1AVXA 1ZGVA 8GCHG 4AZ2B 1O2HA 4I8KA 2AEIH 1T8OA 3U1JB 4JYVH 4E06H 3RXRA 2BVXH 2FLRH 3UOUA 6LPRA 2OP9A 1O3JA 1XVOA 2GKVE 4YT6H 1RGQA 4H6TA 3U1IB 4YOGA 2JETB 4MPWA 1Y5AT 3UTUH 3ZZ7A 1FY4A 3NPSA 4BAHB 4WH6A 1FMGA 2M5TA 1ELTA 2BDCA 1YC0A 5FHTA 3RMMH 1GBBA 1BBRE 2NU1E 1BRAA 1GI6A 1X7AC 3MMGA 3GYLB 3I77A 1YCPH 1ELVA 1VCWA 1HLTH 2DUCA 4GHTA 2VU8E <