4FUGA

Crystal structure of the urokinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
molecule keywords Urokinase-type plasminogen activator
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fugA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fugA01
2Z3EA 3NCLA 4O9VA 1QJ1B 5FCKA 4ZKNU 1VJ9U 3UR9A 1GBTA 1WUNH 1EAIA 2R3YA 2FTMA 1AD8H 1OYQA 1SQAA 2QV1A 2AGEX 1AE5A 1XXDA 2CF8H 1CA8B 1K1OA 1ZSJA 2UUKB 1HPGA 3A87A 5DGJA 2BQ7B 4MVNA 2FOEA 2ZCLP 4YESB 4ZKSU 4XSKU 4LZ1H 2CHAB 5DP6A 2ALVA 1TB6H 2XWBI 4ABGA 2FI4E 1NRQH 3OY5U 2SFAA 2ZQ2A 3HGPA 1V2WT 4I31A 2H9EH 3STIA 2NU3E 2AEIH 5L2YH 1S0QA 3SHAH 2FS8A 1O3PB 3OSYA 3ODFA 1GG6B 3P8OA 3L3TA 2J94A 5EQQA 1A5HA 2SGAA 4HGCA 1V2UT 1DY9A 4DY7B 1TX8A 3K9XB 4ISOA 1NM6A 3M3SA 1WTHD 3SU3A 2CMYA 2ZCKP 4MNXA 4CHAC 3C27B 3I77A 1LKAA 2ZPSA 3KEEA 3PWBA 2EA3A 4X8SH 1ZZZA 4H6TA 1AFQC 3S7HB 1IOEA 1C2JA 1UMAH 1A7SA 3A7ZA 1XM1A 5EXMA 1T7CA 2F9VA 3K6YA 2UWOA 1NO9H 2ZU1A 1FY5A 1FIWA 2V35A 4F4OC 1IQEA 2ANYA 4OS5A 2OD3B 1YP9A 3A7XA 2BTCE 2G55A 1A2CH 3LKWA 3S0NA 2B7DH 1YLDA 1FN8A 1UK2A 1YPLH 2STAE 1O2LA 2FZZA 1L1NA 1ZTKA 2OQ5A 3BEIB 2P3UB 1BJVA 3M5NA 1KXDA 1XUKA 3OY6U 3GCHC 4TWYA 3O8CA 2LNCA 1FZZA 3ZVAA 4YZUA 4E7NA 4BAKB 1Y5UT 3TPIZ 2XCFA 1O3MA 1Z1IA 2TGAA 4NGAH 3MNSA 3MNXA 1P03A 3SNEA 3EGKH 3MHWU 1O31A 3SJKA 1O2QA 2FYQA 1T32A 1VITG 2VWMA 1TBQH 1OWJA 3E3TA 1P2OA 3M35A 5EU8A 4ZHMU 2QXIA 1PFXC 1CE5A 1A0LA 3E90B 1CGIE 2ZPQA 3NPSA 5CMXH 1C5ZB 3UFAA 2ZGHA 4DOQA 1TRNA 2Y7ZA 1ETSH 1ZPZA 3KNXA 2NU2E 2C93B 3RC5A 3V13A 4JCNA 3RLYH 5EW1H 4PROA 7GCHG 3QZRA 3BIVH 1UHBB 1Y8TA 1AWFH 3MFJA 3GISB 2H9TH 1TABE 1NS3A 3BTDE 1O34A 5EODA 3KCGH 4ZXXH 1K21H 1O3OA 1H9IE 2BY9X 2NU4E 3A7WA 3TH3H 1DWDH 3M7TA 5AVDA 1KY9A 3SV2H 3ENSB 3RXTA 1Z71A 3ATLA 1O2WA 1JIMA 2FI3E 1ANCA 2A4GA 1BITA 1W2KH 1NRRH 2ZDLA 1J14A 2BY5X 1B7XB 4Z6AH 4Y8XA 1BBRH 4ISNA 1TMTH 1XX9A 4WWYA 2BY6X 1T8MA 1IQJA 4FU8A 2XTTB 1THPB 3E0PB 1BB0B 2GTBA 1ELBA 1OX1A 5HM9A 2A7JA 1OXGA 3ATWA 1P2QA 3KHVA 3F6UH 3SUEA 2BZ6H 2P8OC 2PV9B 1TNGA 1BMLA 2YNBA 2IJOB 1V6DA 4U32A 5DJ7A 3DFJA 1WCZA 2O8UA 1GBJA 1D4PB 4WXIA 2V3HH 2ZECA 1HAPH 1QFKH 3DHKH 1QNJA 5FCRA 4AN7A 1EAUA 1EAWA 2EI8A 2IOTA 2XYAA 1FY8E 1GBBA 2Y6TA 4K60A 1HAHH 2OQUA 2TGPZ 2BLWA 3RXIA 4IBLH 1N6YA 1NT1A 1T8OA 2BLQA 1BMAA 3FFGA 2VWLA 1BRAA 1CT0E 1BJUA 1P05A 5CHAC 1NZQH 3FVFB 2VJ1A 1QTFA 2DE9A 1DVAH 1AI8H 3GYLB 3SU5A 5A0CA 2ASUB 4WMFA 1SQOA 3MNBA 1NPMA 1O2ZA 3SOSA 1AMHA 2TRMA 1LVBA 3SORA 1UK4A 4I8GA 4IC6A 1HFDA 1LHFH 4RKOB 1MBQA 1FDPA 1TMUH 1Y59T 3TGKE 1SGFG 5L6NH 1GCDA 2JETB 2ODYB 3SJIA 1GMHF 1DX5M 2RA3A 1TPSA 1PQAA 1G32B 2XCNA 1HAIH 3UQVA 3TITA 3P8NA 2W7UA 1YC0A 3HATH 5FX5A 2FM2A 3ZZ6A 2A45B 1AKSB 4E06H 2CXVA 3LC5A 1G2MA 2ANWA 4KTCA 1ELAA 1YPMH 5PTPA 4A7IB 2R0LA 1S83A 1THRH 1DE7H 4ISLA 4KGAA 1Z8IB 2KAIA 5DP7A 5GCHF 1A61H 4Y0YE 1ZSKA 4DVAU 3F9GA 3QTOH 1EPTC 3RXFA 4YO9A 4GUXA 3T27A 1DLKB 4Q7XA 4WJG2 3Q3YA 3LC3A 1ARBA 1O3GA 3GDVA 2SGFE 3MI4A 2NU1E 1W0YH 5DP9A 2PFEA 4ABAA 2W26A 2WPHS 1O32A 1O2GH 1KLIH 2CN0H 2WYGA 5DP4A 2ZHFH 1UJ1A 2SNWA 1AWHB 2ZFQH 4B71A 1GI3A 2HNTC 5EPNA 2ZGBH 4TWWA 4UD9H 2C8WB 2AS9A 3GY2A 5JBBS 4MNWA 1VITF 1TPAE 2XC0A 2G00A 5ETXA 3RXDA 1B0EA 1YPJH 1QJ6B 1AN1E 1O3JA 4IW4E 1VZQH 1Y3UA 1EP5A 1KLTA 2FESH 2IN2A 4I33A 1O2XA 3PMAB 1O2TA 3EDXB 5E0GA 1UVUH 1QURH 1D3TB 2A7HA 2VIDA 4BANB 1DDJA 1RGQA 4X2YA 3TNTA 1SHHB 2PKSC 4B76A 5TJXA 3BN9A 4X2XA 3P17H 1J15A 1Z6EA 1ABJH 3F9EA 3VGCC 2A4QA 3T29A 1OOKB 1F7ZA 2FOBA 1GHAG 3ZVFA 4XOJA 1K9OE 1WBGB 1C1UH 2QF3A 2K1QA 1V2NT 1FUJA 5EOKA 1EZQA 1C1TA 4IGDA 1SGQE 5T6GA 4AZ2B 1ACBE 1ZHMA 5GIBA 2WV4A 2R2MB 3Q77A 3SQHE 2ZFSA 3Q00A 3O8RA 1C4U2 1O2PA 2FDAA 3A80A 3M7QA 1JBUH 1JOUB 3SU2A 1C2KA 1MAYA 3HKJB 1NTPA 1A46H 1AY6H 3P6ZB 1QGFA 3M5LA 1TALA 1C2DA 1BCUH 1GHVH 3P8FA 3OTJE 4Q2KA 2ALPA 2GX4A 4NFFA 4KKDA 1S81A 1UVSH 1PJPA 2FOCA 1FONA 4ZXYH 1KXFA 1C5PA 3UNSA 1YKTA 2ZZUH 1XVMA 4YTAA 2BXUH 3S9AA 1LPZB 2FODA 1ZTLA 3RMNH 3RXVA 1C1RA 3RU4E 2OBQA 3EA8A 3BTKE 3QLPH 4B2AA 1HJ8A 1D3PB 1D9IA 4MPVA 1ETRH 3E91A 1GJ7B 1JIRA 4H6SB 3BG4B 4XFQA 2A1DB 2ZDNA 2Y7XA 1BTYA 3ODDA 2PLXA 4MQAA 4O97A 2OINA 3A86A 5A8YA 3S9CA 4NG9H 1ZGIA 2F83A 3S7KB 3RXEA 3T2NA 3S9BA 1Z8JB 1CA0C 1GBMA 1N6XA 1GPZA 2BLVA 4Y76A 1O36A 2ZGCA 3P95A 5T6FA 2RA0A 3VPKA 5ESBA 1RTFB 4HI3A 2Z3DA 4BTIB 5B6OA 1DT2A 1HRTH 1GMCF 3Q3KA 1BTUA 3NKKA 3TH2H 4SGBE 1QQUA 1NESE 1LVYA 4CRAA 2WUCA 2ZO3H 5FBIA 1GI4A 3D62A 1ZHPA 1L1JA 1GL0E 1H1BA 2DE8A 1HB0B 1NROH 2HNTE 4FXGH 2QXHA 1AE8H 1EZSC 1ESAA 1V2TT 4DT7B 1O3FA 1ZSLA 1LKBA 2B0FA 3RXBA 3U9AH 5EXNA 4XBDA 5TCAA 3TNSA 4TYDA 1CBWB 3MMGA 3MO6A 1TLDA 1ANBA 1SR5C 1SL3A 1UO6A 3LPRA 3NUMA 3DFLA 1KXEA 1C5NH 2R0KA 4NCYA 2AIPA 1BTPA 1HGTH 1YPKH 8GCHF 1GJ6A 3KF2A 1P02A 2ZEBA 3RXOA 4I8LA 4XDEA 2A5AA 4DURA 1ABIH 1DM4B 1EAXA 1TOCB 4I8KA 2BOKA 3P92A 4YLQH 2YNAA 3SU6A 1GBHA 1C1MA 1TGCA 1OP8A 1BBRE 2EI6A 3U98H 3RUOA 3D49H 1FIZA 2VIVA 4NFEA 2IPHA 2VH6A 2Y82A 1RXPA 4R0IA 3TGJE 4BXSA 6GCHF 5H4IB 1LHCH 1V2QT 2J34A 1C5TA 1F92A 1UTPA 1OWEA 2OC0A 1K1MA 1G36A 2FLBH 2CF9H 1BMNH 3RXHA 1EQ9A 3V12A 2A4RA 2G81E 1PQ7A 2ZA5A 1SGDE 2VU8E 4MPXA 4NSYA 4A1TA 4E7RG 3A8AA 3BTFE 1O5EH 5FPYA 2W3IA 1T31A 2AFQB 2P16A 1RRKA 1GI6A 1SB1H 3TLOA 2XBVA 3TGIE 1QRXA 4AB8A 2ZTZA 2W3KA 1OWHA 2A0QB 2ODQA 1O2NA 3ZV8A 1P11E 2AMPA 2H1UA 3ZZ9A 1YCPM 3GCTG 4AG2A 1TNHA 4GSOA 3P8GA 4M7GA 2XBXA 5HM2A 1MKXK 3LIWA 1IQFA 1GHBG 1L4ZA 2GCHF 2HALA 4BOHA 2I6SA 4Y7AA 3M7UA 4NZLA 3U8TH 1GHZA 2HPQH 1TRMA 2BD3A 1KLJH 3E1XB 4NIYA 2ZNKH 1GBKA 2GZ9A 4FUEA 1N8OB 1EJAA 1GJAB 3FP6E 1ESBA 1HAOH 2GMTB 2QYIA 4Y79A 5GWZA 5JDUB 4IN1A 1A1RA 1EPTA 5EGMA 3V3MA 3PO1B 1GMDF 3LGIA 2A2XH 2CHAC 2P59A 2ZGJA 4LOYH 2Q6DA 2VH0A 3MOCA 1O38A 1FY3A 2GZ8A 1O0DH 2BD9A 5HYOA 3QWCH 2QA9E 2ZKSA 2SGPE 1IQHA 1BZXE 3VXFH 5JB9S 1Y3XA 3M36A 1OWDA 5C2ZA 5FPSA 2ZHEH 1MH0A 1C1SA 3QGNB 1MD7A 1SGRE 1EZXC 5I46H 1TRYA 7KMEH 1J8AA 2BQWB 3LT3A 3FP7E 3MU4A 3E8LA 4A92A 1ELGA 1IQNA 2C8XB 5IYTA 3SJ9A 4B2CA 4DGJA 5C5OA 3NZIA 3RC4A 2BM2A 1O3LA 2BXTH 3BSQA 1CT2E 1BTHH 3AW0A 3GDUA 1TGBA 1FY1A 1F5KU 1THSH 1XUJA 4CRBA 1MTNB 1HIAB 4JK6A 1AFEH 1IAUA 1ZPBA 4OS2A 3LGTA 1Q3XA 3RXMA 4K1TA 5C20A 2A31A 3DUXH 3LJJA 1SQTA 4ISIH 3SI4H 2BYAX 4OGXA 3JZ2B 2UWLA 3VEQB 3ZZCA 1TFXA 1AHTH 2ZU4A 3UPEA 1EATA 1AVWA 1KDQA 4Q7ZA 1GCTB 2BD7A 2VNTA 2ZF0H 2Y80A 1G3EA 2PKAA 2FOAA 4CR9A 2HVXA 1O3HA 3H7OA 4D7GA 1SLVB 2G4TA 2DUCA 5SGAE 5K0HA 4ZROA 1J16A 1HJ9A 2BX4A 4YOGA 5F6MA 5EQRA 4INHA 1GVKB 4NA8A 2ZCHP 2QAAA 3BV9B 1BIOA 1QHRB 1V2MT 1C5XB 2WPMS 1EOLA 2VIQA 1HDTH 4HZHA 1O5DH 3RXLA 4LZ4B 3L6PA 2UWPA 3RM2H 3IWMA 4FVBA 3RM0H 2ANMH 4NIXA 1SOZA 4NWKA 4DCDA 4HTCH 3UREA 4NIVA 1RFNA 3I78A 2RCEA 3I29A 5F8XA 3KQEA 1K1NA 1C5MD 2VGCC 1AFQB 1NU7B 1JXPA 1QL7A 1O2UA 2HPPH 4MNYA 3JZ1B 1G9IE 1HAVA 1ELFA 4IN2A 4XBCA 3EAJA 2ZFRH 1F0RA 4CBOA 2I6QA 3SNAA 1MQ5A 1O35A 4X1PU 2D26C 1QCPA 1C5QA 1Z8RA 3DT0H 2CV3A 3TK6A 2OUAA 1NRPH 2B9LA 2GZ7A 5BPEA 1SI5H 4JK5A 3PB1E 3TH4H 1UVOA 4B1TA 2GCTB 1HXEH 1FPCH 2AYWA 3KQDA 1C1OA 3RXKA 1GJ9B 2G51A 2GDEH 4UFDH 4A1XA 3T5FH 2PSXA 1C5YB 1YF4A 3GY5A 4GCHF 2UUJB 1TPOA 3DA9B 5A8ZA 1K22H 1UVPA 3SUGA 3URCA 1GI1A 1K1IA 2YOLA 1J17T 1ANEA 1CO7E 3PMJA 1YCPH 4IMQA 1P9SA 3S69A 1SGEE 4ABIA 4OS7A 1CSOE 1K1PA 3RMMH 1TGTA 1RD3B 4ABEA 2QN5T 3B9FH 2BD4A 5F03A 3PM3A 5BRRE 1GBCA 1P2JA 1MU6B 1QL9A 3A82A 1GHWH 2ZHDA 2FEQH 3NXPA 1P2MA 1L0ZA 2UUFB 1M9UA 1E34B 1SVPA 1Z7KA 2BDIA 4JZDH 1S84A 3ZVCA 1ZRBA 1Y3WA 2P3FH 1MKWH 1MTWA 1D6RA 3LJOA 1VJAU 1GBLA 2JH6D 3RC6A 5JBTA 3EYDA 2Z9KA 1KIGH 1ZJKA 2JETC 2ULLA 1CGHA 4KTSA 1JWTA 1QY6A 1IQGA 4K69A 1TAWA 4I8JA 1HJAB 4UE7H 1DXPA 4BAQB 1S82A 6LPRA 2Q6GA 3TK9A 2STBE 1NFXA 2O9QA 3T62A 2WUBA 5FHTA 2V6NA 4FU7A 3SNCA 1O33A 1CHOG 2EC9H 5AF9H 1QA7A 6ESTA 3MWIU 5GDSH 1O2MA 3MYWA 1F2SE 2FX6A 2JH5D 1ZYOA 2QC2A 4GPGA 1A3EH 2P8OB 4A6LA 2F9BH 1FNIA 2QY0B 4K2YA 1YPEH 1GWAA 2GVFA 1P8VC 1W8BH 1TOMH 3RXRA 1GVLA 1VGCB 1AZZA 3A84A 4X1SU 1HV7A 3PTNA 4A1VA 1QR3E 1TNJA 3M61U 2BDHA 3SV6A 1EOJA 4NZQA 1TNKA 1O30A 2PSYA 4K8BA 4BNRA 3M37A 3A83A 3ZYDA 4YOIA 3PMBB 3HK3B 3U8RH 1HAYB 1O3KA 2PUXB 3EQ0H 4XE4A 5LPRA 1DANH 1E36B 1EB1H 3N7OA 2FX4A 3TJVA 3A7TA 1X7AC 3SO3A 1C2HA 1MU8B 3TK5A 2FWWA 3ZZ4A 3MU5A 3MH4A 3ZVBA 3AASA 1Z8GA 3TIUA 1HCGA 2BVXH 3MNCA 4FUDA 1NRNH 2ZPRA 1P2IA 5ESTE 3UY9A 3UNRA 1P06A 3E0NB 4CRCA 4OGYA 4BAOB 2EI7A 3ZZ8A 1QIXB 2BDYA 2BX3A 4FUHA 3BTTE 1O5FH 1ARCA 4BXWA 1P3EA 1UTKA 1XMNB 3ATMA 5HMAA 2ZFPH 2XXLA 1TGSZ 1FQ3A 4MG3A 4SGAE 3L33A 4Y8ZA 3MU1A 2VIPA 1TPPA 1NFUA 1MBMA 1H8DH 4AFZA 4B75A 4YT6H 7GCHF 3PWCA 3SNBA 4VGCB 5FPTA 1IQMA 1DICA 1LO6A 1Q31A 1VCPA 1EASA 3CENA 3BEFB 2F3CE 4ZMAH 1KXCA 2FTLE 2OTVA 4JZFH 1C5RA 1GI2A 3QGJA 1TMBH 1SLWB 3QO6A 1O5AB 1RS0A 1BBRK 1BMMH 3PTBA 3T26A 3SI3H 4KELA 5F8ZA 3CP7A 1QA0A 1QRZA 2AGGX 3QUMP 4X8UH 3RU4T 4YOJA 4DW2U 1YPGH 3SUDA 1RTLA 1GHXH 1ZMJA 3BG4C 1C4V2 2R9PA 2Q6FA 4DIIH 1V2JT 4ISHH 5T3HA 3A8BA 2BD5A 1KXAA 3GY4A 2F9NA 1Y3YA 3F9HA 2ZDVH 1WU1A 3URDA 2JKHA 3K6ZA 3PROA 5DPAA 1P01A 2ZDKA 3M3TA 5LPFA 3AW1A 4CBNA 2BD2A 3OX7U 1MKWK 2WPKS 4LK4A 1YPHC 3SGAE 2WINI 3VGCB 4JZ1A 1ANDA 1VR1H 4B74A 1BOQA 1XUFA 1BTZA 2A7CA 1UCYH 4RKJB 1FI8A 2FOHA 2ZU2A 1UHBA 1LPKB 1V2PT 3QDZB 1LTOA 1O2HA 1C5WB 3TU7H 1KTTB 1TX6A 2VIWA 4JYUH 2VWOA 2VVCA 1Q2WA 2GV6A 1L1GA 1HYLA 2G4UA 2ZDMA 1GJ5H 4TPYA 2QCYA 1GJ8B 1GI8B 2O8WA 2BZAA 3E16B 1V2RT 4H42U 1EP6A 3A88A 1A0JA 3ZZDA 4X6MA 4LXBH 3GYMA 1PPEE 3NWUA 3VB7A 1CBWC 2BY7X 2TGTA 2OC8A 4UEHH 4NWLA 3UR6A 1XXFA 3F68H 2A4OA 2EEKA 1MTVA 1YGCH 1Z1JA 1W0ZU 1A4WH 2H6MA 1F5LA 1QB1A 2W7SA 3A7VA 1O39A 5GXPA 3UWIA 4GHTA 1ZR0A 2D8WA 5DP5A 1SGTA 3B23B 4YLUA 5C67A 1O3DA 5J4QA 3PV4A 2FLRH 3RXQA 1O2YA 1YBWA 1U6QA 1O5CB 1DOJA 3A8CA 3ZZ7A 2Z6BD 1V2LT 3GY6A 1MTSA 8ESTE 3RP2A 3RXAA 1UTNA 1CU1A 1EUFA 1F0SA 3R3GB 5AFYH 1HAXB 1HLTH 1DPOA 3GY8A 4UFFH 3SU4A 3MTYA 3WY8A 1BTXA 1ELCA 2NU0E 4JZEH 1GJBB 3W95A 2BD8A 1TYNA 1AUTC 2WV5A 5JYIA 1YYY1 3GY7A 6CHAB 3M3VA 1O5GH 3K65B 1KSNA 1RIWB 1JMOH 4BAMB 3AAVA 5F8TA 4I7YH 2G5VA 1GHYH 1S6HA 1TA2A 4O3UA 4JMYA 2HLCA 2D2DA 3MH6A 1IHSH 2J38A 3ATKA 3RMOH 2WPIS 2VVVA 3UOPA 1BRBE 4INKA 1SFIA 3RXSA 1FY4A 3UIRA 4ABJA 5C5NA 3ZZBA 3LH1A 3SU0A 3LGVA 5JB8S 1AB9C 2QGRA 2P95A 1PPGE 2GT8A 5LH8A 3LONA 4GAWA 4X1QU 1AKSA 1CQQA 2O8LA 5DO4H 1OPHB 1W7XH 2GV7A 4WMDA 2BOHB 1C1WH 1N8OC 1YPHE 2ZTXA 1GHAF 4X2WA 1OKXA 4Y71A 1SGIB 3D23A 3QZQA 4D8NA 5A0BA 2F91A 4X6NA 4CR5A 2HRVA 2QXJA 4B2BA 4KTUA 3FZDA 2BMGB 1INCA 5GPIB 1RJXB 3IG6B 4UFGH 3PO1C 1G37A 5E0JA 1W10U 1QBVH 2RG3A 2Z9IA 1IHTH 1ZTJA 4MLFB 1AU8A 3ZV9A 1F0TA 3ZZ3A 1GJCB 1V2KT 4U01A 2CJIA 2AERH 5HGGA 1AUJA 1D3DB 1YM0A 3U1IB 3SV8A 1AGJA 1EJNA 3UNQA 1GGDB 2HOBA 2SGEE 3A89A 4Y6DA 3VB5A 1CVWH 2BDCA 1O3BA 3HK6B 1T8LA 1O3EA 4MPWA 1P12E 2GDDA 3EE0B 3SV7A 2G52A 1T4UH 1HUTH 3MH5A 3SJ8A 4ASHA 1KTSB 1UCYK 1D3QB 1VCWA 2C90B 5IDKA 4A5TS 4TY7A 1E0FD 4WY3A 5E2OA 1TBZH 1XKBC 4E05H 3EA7A 1EXFA 1EJMA 2ODPA 4MPUA 1O2SA 2F9OA 3V0XA 2TBSA 1G3CA 3BF6H 1GG6C 3T28A 2OC1A 4Z0KA 2ZHWH 1LVMA 1MTNC 3QN7A 1SHYA 2BVRH 1SLUB 4FUCA 1OWIA 4JYVH 1SC8U 2C3SA 1LCYA 1ORFA 3MO9A 4BAHB 2ZIQH 4K5ZA 2KAIB 4AYYB 1ZHRA 3TJUA 5EPYA 3C1KA 3AAUA 3SZNA 3QX5H 3MU8A 2HNTF 1C1PA 4FUIA 2THFB 3RDZA 2OLGA 5LGOA 2AH4X 1GBEA 3LGWA 2A5KA 1N1LA 1GCTC 4FUJA 1PQ8A 2H5CA 2Y5HA 1MAXA 1O2JA 1QB6A 1MCVA 4ZKRU 4ABHA 1V2OT 3O8BA 5A09A 2O8MA 2ZTYA 1ELDE 1O2KA 4TPIZ 2F9PA 3OYPA 4H4FA 2XNIA 4ABDA 1C5OH 1QQ4A 3KN2A 4D9RA 1OP2A 4AOQA 4AX9H 1EZUC 4IS5A 3MU0A 5C1XA 1SGCA 1ESTA 9LPRA 1GMHG 2A5IA 1DS2E 2GGVB 2PTNA 2H9HA 1SLXB 1P0SH 3CS0A 4CRFA 1C5LH 1IQIA 1ZJDA 1A5IA 1DWCH 5JBCS 3SW2B 4AGJA 2PW8H 1GDUA 1TIOA 1VCQA 3PLKA 1QL8A 1XUIA 2PUQH 3F9FA 1ID5H 3RXUA 1DXWA 5C3NA 3RXCA 4ZUHA 5GCHG 4BTTB 4WH8A 2FOFA 3RMLH 4CHAB 1XKAC 1YLCA 4FUFA 1A0HB 4AB9A 2OXSA 2V3OH 5E2PA 1AVGH 2GCTC 1C9PA 5FBEA 1QBOA 3DD2H 4HFPB 2Q1JA 4FVDA 1O3IA 1TQ0B 4X1NU 2AGIX 2J95A 4Y10E 1P9UA 4J2YB 1BRCE 3B8JA 2XC5A 3QTVH 4K1SA 1C1VH 2Z9LA 2V0BA 4Q7YA 4CH2B 2Z9GA 2D1JA 1UCYE 1HNEE 1WSSH 1SPJA 1O3AA 2G8TA 1O2IA 4I8HA 1BHXF 1G30B 3FZZA 4GHQA 4RSPA 1C1QA 2PWXA 1GBFA 5EQSA 5ABWA 3SUFA 4FU9A 1EB2A 2PGQB 3ZVDA 2W5EA 1G3DA 2ZP0H 2FO9A 3GCTF 1UTOA 2H2ZA 1FN6A 2BQ6B 3GCHB 1GHBF 1L2EA 2OC7A 1FMGA 3BTHE 3D65E 2FMJA 2XRCA 1LMWB 3ELAH 2BDGA 4AFQA 4CRDA 1GI7B 1FJSA 4K1EA 3UOUA 4I32A 1BA8B 1A3BH 5G4BA 1DWBH 2ILNA 4O3TA 4Y8YA 4AORA 1NU9A 2VGCB 1MMJN 3BTEE 3UWJH 2BDAA 1AZ8A 1HAZB 1LVOA 1B0FA 1ZLRA 1DSUA 3KQBA 3RXPA 1SMFE 1Y3VA 1HJAC 2HWLB 1UTJA 4NIWA 3P70B 3U69H 3A7YA 1O2RA 9ESTA 2BY8X 1DSTA 3PLBA 3MH7A 1HBTH 1K28D 3RLWH 2ZWLH 1C2LA 1BTWA 4X6OA 3SBKA 3W94A 7LPRA 4K8YA 1FAKH 3RU4D 1TX7A 4QT8C 2BHGA 3CS7A 1UK3A 1P3CA 1P10A 4Y11E 4FUBA 3ZYEA 1W3CA 2Z3CA 3QK1A 1W14U 3LU9B 4TY6A 4ZAEA 3VXEH 1AVXA 1CHGA 4Y0ZE 4KP0A 1VGCC 3PYHA 1LHEH 4IC5A 4ABFA 4AYVB 2WPJS 2WYJA 1B5GH 4ZH8A 2P94A 2SGDE 1GBDA 1C9TA 2ZFTA 1FXYA 3VFEA 1PPHE 1ZMLA 2BLOA 1UTLM 1S0RA 3GDSA 3BEUA 1C1NA 1DUAA 4UFEH 3A81A 3A8DA 5L2ZH 4WXVA 4DIHH 2FIRH 1P2NA 2FOMB 1O37A 1JRSA 4D9QA 2WPLS 1W11U 1OYTH 4Y7BA 1QRWA 1IQLA 4WF8A 1GMCG 1G2LA 4IMZA 2ZC9H 2J92A 1E37B 1SGYE 3BIUH 2FI5E 3MO3A 4YM9A 3KIDU 5E8EH 1RTKA 2HGTH 1TQ7B 1NFYA 2JH0D 5CHAB 5DK1A 8LPRA 2XWAA 3OU0A 4BTUB 1OS8A 1O2VA 1K1JA 1QBNA 5C1UA 4F49A 2TGDA 1MTUA 1GI5A 1NC6A 2CGAA 2SGQE 4ESTE 1DWEH 5K7RA 3M5OA 4X6PA 1W7GH 1ZMNA 1SGPE 8KME2 1GJDB 2F9UA 4NA7A 2ANKH 4ZHAA 3O8DA 1SFQB 4NA9H 1IQKA 2C8ZB 3ZZ5A 2BVSH 8GCHG 4VGCC 1K1LA 3GICB 2J4IA 1NFWA 2FP7B 3LGUA 1OSSA 4AFSA 3GCOA 5DKMA 5TCCA 5LPEA 2ZU5A 1TONA 2VWNA 2FXRA 1HIAA 1MQ6A 5J4SA 4D76A 1FAXA 1C2IA 3RXGA 2VINA 1PPFE 4NSVA 1S6FA 1LDTT 4AGKA 5AHGH 4OS4A 1DFPA 2B8OH 1BQYA 3PLPA 2ZQ1A 1ELTA 5DG6A 1T8NA 6GCHG 1WTGH 3U1JB 1EPTB 3SV9A 4WH6A 1UVTH 2P3TB 4R8TB 5E0HA 3SHCH 1NRSH 2VIOA 1TWXB 3SJOA 4WVPE 1NY22 1WV7H 2SNVA 2PGBB 4OS6A 1BDAA 3FP8E 1FLEE 4ZKOU 3LGYA 2ZG0H 1YCPK 3LOXA 1EKBB 3Q76A 2ZDAH 3SQEE 1GI9B 3KL6A 1H9HE 5A8XA 7ESTE 1V2ST 1C5SA 2PR3A 1XVOA 1ZRKA 3GY3A 1KXBA 1LQEA 1MCTA 1DY8A 3Q3XA 1GBAA 4MTBA 2GKVE 1P04A 5CE1A 3GOVB 1F0UA 2GCHG 3H5CB 1D6WA 4FUGA 4RN6A 4THNH 2AMQA 5DP3A 1AO5A 2PKSB 2QF0A 1C2FA 1E35B 5GJ4B 5A2MH 2GP9B 1MKXH 1Z6JH 3K2UA 1O3NA 1DLEA 1SGNE 1S85A 4UONA 3VB3A 1JRTA 3G01A 2OBOA 1P2KA 3BTWE 1QB9A 3BTGE 3FANA 2O8TA 3NK8A 5HXFA 5I25A 1GMDG 1Y5AT 1TBRH 3SGQE 4B73A 2FOGA 4CH8B 1C2EA 1ZPCA 3TVJB 1TE0A 1KDQB 1H8IH 1XUHA 1O2OA 4ABBA 1VITH 1PYTD 1CT4E 2PKAB 3VB4A 4AFUA 2ZFFH 1CHOF 1C4Y2 1GJ4H 1P09A 4X0WU 2QIQA 5FAHA 3GCNA 1OP0A 1AIXH 2LPRA 5FX6A 1W12U 1C5UA 2P93A 2PTCE 3BG8A 3ZVEA 1EX3A 1L4DA 2FYRA 1SGFA 2R2WU 1S5SA 3BTQE 2TPIZ 1CGJE 1WYKA 3ATIA 4XBBA 3FAOA 1P57B 4WMEA 2Z9JA 2ZU3A 4YT7H 4MDSA 3ZZAA 2A32A 2ESTE 3E6PH 1KYNA 5EXLA 4K3JA 6CHAC 4DJZB 2OCVB 3IITA 3SNDA 3KGPA 2Y5GA 1RIWC 1GI0A 1BHXB 4O03A 1TNIA 1LHDH 3ITIA 3STJA 2Z7FE 3LH3A 1CA0B 1H4WA 1HAVB 1UTMA 1BUIA 1DITH 4JYTA 4CRGA 1GDNA 2UUYA 1G3BA 4MNVA 3U8OH 1TGNA 4Q80A 1V3XA 1AQ7A 3BTME 1QJ7B 1SBWA 3PMHB 1GBIA 5A0AE 1PYTC 2ZHQH 2ZGXH 2ZI2H 1E38B 1O3CA 1MD8A 1A5GH 2NWNA 4GVUA 4X8VH 1Y5BT 1J9CH 4D7FA 2B5TB 5L30H 2Y5FA 3T25A 2XBWA 2Y81A 3TJNA 4U30A 2C8YB 2XW9A 1LHGH 3SN8A 1WAYB 4DG4A 3M5MA 2C4FH 3RXJA 1BRUP 1C2MA 3ZVGA 1HAGE 4X8TH 3HPTB 4U2WA 4GLYA 3AVZA 1MUEB 1WOFA 1ZGVA 4ZHLU 1HXFH 2OP9A 4CREA 3KQCA 1ZOMA 5JPMH 5DP8A 3R0FA 1FV9A 1PQ5A 1PPBH 4OS1A 2BB4A 1ETTH 4INLA 4X2VA 3EA9A 1O5BB 2TIOA 1GGDC 3UUZA 2G5NA 2GMTC 1UTQA 2J2UA 1BT7A 1PPZA 2VVUA 2FPZA 1V2VT 1DUEA 3UTUH 3F1SB 1PPCE 5AFZH 5FXLA 1T4VH 5EW2H 2H5DA 2M5TA 1WQVH 2A2QH 5T6DA 2XBYA 4J1YA 2RDLA 1ELVA 2GD4B 1GL1A 1LQDB 5JBAS 1MZAA 1XUGA 2AIQA 2FS9A 3ESTA 1GVZA 3A85A 1WQSA 3VB6A 4JZIA 2PHBA 1TA6A 1H9LB 1AB9B 1ELEE 1GDQA 1F5RA 4X1RU 1W13U 3SGBE 4UDWH 1C2GA 4AG1A 2AMDA 4GCHG 3H7TA 3V7TA 2QXGA 2VB0A 3HKIB 3TJOA 1FPHH 1C5VA 1SOTA 1OWKA 5C1YA 1TNLA 2GT7A 2Z94A 1NN6A 3HGNA 2XC4A 2BDBA 1LPGB 1SSXA 2R3UA 3UQOA 1K2I1 1MZDA 2J9NA 1SG8B 3SU1A 3LDXH 5EG4A
chains in the Genus database with same CATH superfamily
2Z3EA 3NCLA 4M9FA 4O9VA 1QJ1B 5FCKA 4ZKNU 1QZ8A 1VJ9U 3UR9A 1GBTA 1WUNH 1EAIA 2R3YA 2FTMA 1AD8H 1OYQA 1SQAA 2QV1A 2AGEX 1AE5A 1XXDA 2CF8H 1CA8B 1K1OA 1ZSJA 2UUKB 1HPGA 3A87A 5DGJA 2BQ7B 4MVNA 2FOEA 2ZCLP 4YESB 4ZKSU 4XSKU 4LZ1H 3OEHD 2CHAB 5DP6A 2ALVA 1TB6H 2XWBI 5KEDA 4ABGA 2FI4E 2IJD1 1NRQH 3OY5U 2SFAA 2ZQ2A 3HGPA 1V2WT 4I31A 2H9EH 3STIA 2NU3E 2AEIH 1OHHD 5L2YH 1S0QA 3SHAH 2FS8A 1O3PB 5B6LA 3OSYA 3ODFA 1GG6B 3P8OA 3L3TA 2J94A 5EQQA 1A5HA 2SGAA 4HGCA 1V2UT 1DY9A 4DY7B 1TX8A 3K9XB 4ISOA 1NM6A 3M3SA 1WTHD 3SU3A 2CMYA 4HG6A 2ZCKP 4MNXA 4CHAC 3C27B 3I77A 1LKAA 2ZPSA 3KEEA 3PWBA 2EA3A 4X8SH 1ZZZA 4H6TA 1AFQC 3S7HB 1IOEA 1C2JA 1UMAH 1A7SA 3A7ZA 1XM1A 5EXMA 1T7CA 2F9VA 3K6YA 5C0TA 2UWOA 1NO9H 2ZU1A 1FY5A 1FIWA 2V35A 4F4OC 1IQEA 2ANYA 4OS5A 2OD3B 1YP9A 3A7XA 2BTCE 2G55A 1YY3A 1A2CH 2J97A 3LKWA 3S0NA 2B7DH 1YLDA 4F55A 1FN8A 1UK2A 1YPLH 2STAE 1O2LA 2FZZA 1L1NA 1ZTKA 2OQ5A 3BEIB 2P3UB 1BJVA 3M5NA 1KXDA 1XUKA 3OY6U 3GCHC 4TWYA 3O8CA 2LNCA 1FZZA 3ZVAA 4YZUA 4E7NA 4BAKB 5HKKD 1Y5UT 3TPIZ 2XCFA 1O3MA 1Z1IA 2TGAA 4NGAH 3MNSA 3MNXA 1P03A 3SNEA 3EGKH 3MHWU 1O31A 3SJKA 1O2QA 4ACAA 2FYQA 1T32A 1VITG 2VWMA 1TBQH 3PRDA 1OWJA 3E3TA 1P2OA 3EE7A 3F2HA 3M35A 5EU8A 4ZHMU 2QXIA 1PFXC 1CE5A 1A0LA 3E90B 1CGIE 2ZPQA 3NPSA 5CMXH 1C5ZB 2F4LA 3UFAA 2J5UA 2ZGHA 4DOQA 1TRNA 2Y7ZA 1ETSH 1ZPZA 3KNXA 2NU2E 2C93B 1UW7A 3RC5A 3V13A 4JCNA 3RLYH 5EW1H 4PROA 7GCHG 3QZRA 3BIVH 1UHBB 1Y8TA 1AWFH 3MFJA 3GISB 2H9TH 3F0PA 1TABE 1NS3A 3BTDE 1O34A 5EODA 3KCGH 4ZXXH 1K21H 1O3OA 1H9IE 2BY9X 2NU4E 3A7WA 3TH3H 1DWDH 5FL7D 3M7TA 5AVDA 1KY9A 3SV2H 1SKYE 3ENSB 3RXTA 1Z71A 3ATLA 1O2WA 1JIMA 2FI3E 1ANCA 2A4GA 1BITA 1W2KH 1NRRH 2ZDLA 1J14A 2BY5X 1B7XB 4Z6AH 4Y8XA 1BBRH 4ISNA 1TMTH 1XX9A 4RT1A 4WWYA 2BY6X 1T8MA 1IQJA 4FU8A 2XTTB 1THPB 3E0PB 1BB0B 2GTBA 1ELBA 1OX1A 5HM9A 2A7JA 2PP6A 3OTPA 1OXGA 3ATWA 1P2QA 3KHVA 3F6UH 5EJZA 3SUEA 2BZ6H 2P8OC 2PV9B 1TNGA 1BMLA 2YNBA 2IJOB 1V6DA 4U32A 5DJ7A 3DFJA 1WCZA 5CDFE 2O8UA 1GBJA 1D4PB 4WXIA 2V3HH 2ZECA 1HAPH 1QFKH 3DHKH 1QNJA 5FCRA 3PRBA 4AN7A 1EAUA 1EAWA 2EI8A 2IOTA 2XYAA 1FY8E 2WV9A 1GBBA 2Y6TA 2KFWA 4K60A 1HAHH 2OQUA 2TGPZ 2BLWA 3RXIA 4IBLH 1N6YA 1NT1A 1T8OA 2BLQA 1BMAA 3FFGA 2VWLA 1BRAA 1CT0E 1BJUA 1P05A 5CHAC 1NZQH 3FVFB 2VJ1A 1QTFA 2DE9A 1DVAH 1AI8H 3GYLB 3SU5A 5A0CA 2ASUB 4WMFA 1SQOA 3MNBA 1NPMA 1O2ZA 3SOSA 1AMHA 2TRMA 1LVBA 3SORA 1UK4A 4I8GA 4IC6A 1HFDA 1LHFH 4RKOB 1MBQA 1FDPA 1TMUH 1Y59T 3TGKE 1SGFG 5L6NH 1GCDA 2JETB 2ODYB 3SJIA 1GMHF 1DX5M 2RA3A 1TPSA 1PQAA 1G32B 2XCNA 1HAIH 3UQVA 3TITA 3P8NA 2W7UA 1YC0A 3HATH 4RI0A 5FX5A 2FM2A 3ZZ6A 2A45B 1AKSB 4E06H 2CXVA 3WWBA 3LC5A 1G2MA 2ANWA 4KTCA 1ELAA 1YPMH 5PTPA 4A7IB 2R0LA 1S83A 1THRH 1DE7H 4ISLA 4KGAA 1Z8IB 2KAIA 5DP7A 5GCHF 1A61H 4Y0YE 1ZSKA 4DVAU 3F9GA 3QTOH 1EPTC 3RXFA 4YO9A 4GUXA 3T27A 1DLKB 4Q7XA 4WJG2 3Q3YA 3LC3A 1ARBA 1O3GA 3GDVA 2SGFE 3MI4A 2NU1E 1W0YH 5DP9A 2PFEA 4ABAA 2W26A 2WPDD 2WPHS 1O32A 1O2GH 1KLIH 2CN0H 2WYGA 5DP4A 2ZHFH 1UJ1A 2SNWA 1AWHB 2ZFQH 4B71A 1GI3A 2HNTC 5EPNA 2ZGBH 4TWWA 4UD9H 3SZEA 2C8WB 2AS9A 3GY2A 5JBBS 4MNWA 1VITF 1TPAE 2XC0A 2G00A 5ETXA 3RXDA 1B0EA 1YPJH 1QJ6B 1AN1E 1O3JA 4IW4E 1VZQH 1Y3UA 1EP5A 1KLTA 2FESH 2IN2A 4I33A 1O2XA 3PMAB 1O2TA 3EDXB 5E0GA 1UVUH 1QURH 1D3TB 2A7HA 2VIDA 4BANB 1DDJA 1RGQA 4X2YA 3TNTA 1SHHB 2PKSC 4B76A 5TJXA 2F43B 3BN9A 4X2XA 3P17H 1J15A 2YMSC 1Z6EA 1ABJH 3F9EA 3VGCC 2A4QA 3T29A 1OOKB 1F7ZA 2FOBA 1GHAG 1W0JD 3ZVFA 4XOJA 1K9OE 1WBGB 1C1UH 1SQRA 2QF3A 2K1QA 1V2NT 1FUJA 5EOKA 1EZQA 1C1TA 4IGDA 1SGQE 5T6GA 4AZ2B 1ACBE 1ZHMA 5GIBA 2WV4A 2R2MB 3Q77A 3SQHE 2ZFSA 3Q00A 3O8RA 1C4U2 1O2PA 2FDAA 3A80A 3M7QA 1JBUH 1JOUB 3SU2A 1C2KA 1MAYA 3HKJB 1NTPA 1A46H 1AY6H 3P6ZB 1QGFA 3M5LA 1TALA 1C2DA 1BCUH 1GHVH 3P8FA 3OTJE 4Q2KA 2ALPA 2GX4A 4NFFA 4KKDA 1S81A 1UVSH 1PJPA 2FOCA 1FONA 4ZXYH 1KXFA 1C5PA 3UNSA 1YKTA 2ZZUH 1XVMA 4YTAA 2BXUH 3S9AA 1LPZB 2FODA 1ZTLA 4FETA 3RMNH 4ASUD 3RXVA 1C1RA 3NRLA 3RU4E 2OBQA 3EA8A 3BTKE 3QLPH 4B2AA 1HJ8A 1D3PB 1D9IA 4MPVA 1ETRH 3E91A 1GJ7B 1JIRA 4H6SB 3BG4B 4XFQA 2A1DB 2ZDNA 2Y7XA 1BTYA 3ODDA 3UAIC 2PLXA 4MQAA 4O97A 2OINA 3A86A 5A8YA 3S9CA 4NG9H 1WDIA 1ZGIA 1KMHB 2F83A 3RXEA 3S7KB 3T2NA 3S9BA 1Z8JB 1CA0C 1GBMA 1N6XA 1GPZA 2BLVA 4Y76A 1O36A 2ZGCA 3P95A 5T6FA 2RA0A 3VPKA 4OM9A 5ESBA 1RTFB 4HI3A 2Z3DA 4BTIB 5B6OA 1DT2A 1HRTH 1GMCF 3Q3KA 1BTUA 3NKKA 3TH2H 4SGBE 3OAAD 1QQUA 1NESE 1LVYA 4CRAA 2WUCA 2ZO3H 5FBIA 1GI4A 3D62A 2KM0A 1ZHPA 1L1JA 1GL0E 1H1BA 2DE8A 1HB0B 1NROH 2HNTE 4FXGH 2QXHA 3UB0A 1AE8H 1EZSC 1ESAA 1V2TT 4DT7B 4TT3D 1O3FA 1ZSLA 1LKBA 2B0FA 3RXBA 3U9AH 5EXNA 4XBDA 5GNDA 5TCAA 3TNSA 4TYDA 1CBWB 3MMGA 3ZIAD 3MO6A 1EFRD 1TLDA 1ANBA 1SR5C 1SL3A 1UO6A 3LPRA 3NUMA 3DFLA 1KXEA 1C5NH 2R0KA 4NCYA 4DT4A 2AIPA 1BTPA 1HGTH 1YPKH 8GCHF 1GJ6A 3KF2A 1P02A 2ZEBA 3RXOA 4I8LA 4XDEA 2A5AA 4DURA 1ABIH 1DM4B 1EAXA 1TOCB 4I8KA 2BOKA 3P92A 4YLQH 2YNAA 3SU6A 1GBHA 1C1MA 1TGCA 1OP8A 1BBRE 2EI6A 3U98H 3RUOA 3D49H 1FIZA 2VIVA 4NFEA 2IPHA 2VH6A 2Y82A 1RXPA 4R0IA 3TGJE 4BXSA 6GCHF 5H4IB 1LHCH 1V2QT 2J34A 1C5TA 1F92A 1UTPA 1OWEA 2OC0A 3OFND 1K1MA 1G36A 2FLBH 2CF9H 1BMNH 3RXHA 1EQ9A 3V12A 2A4RA 2G81E 1PQ7A 2ZA5A 1NBMD 1SGDE 2VU8E 2QF4A 4MPXA 4NSYA 4A1TA 2WZQA 4E7RG 3A8AA 3BTFE 1O5EH 5FPYA 2W3IA 1T31A 4B6EA 2AFQB 2P16A 1RRKA 1GI6A 1SB1H 3TLOA 2XBVA 3TGIE 1QRXA 5DSFA 4AB8A 2ZTZA 2W3KA 1OWHA 2A0QB 2ODQA 2V7QD 1O2NA 3ZV8A 1P11E 2AMPA 2H1UA 3ZZ9A 1YCPM 3GCTG 4AG2A 1TNHA 4GSOA 3P8GA 4M7GA 2XBXA 5HM2A 1MKXK 3LIWA 1IQFA 1GHBG 1L4ZA 2GCHF 2HALA 4BOHA 2I6SA 4Y7AA 3M7UA 4NZLA 3U8TH 1GHZA 2HPQH 1TRMA 2BD3A 1KLJH 3E1XB 4NIYA 5KGOA 2ZNKH 1GBKA 2GZ9A 4FUEA 1N8OB 1EJAA 1GJAB 3FP6E 1ESBA 1HAOH 2GMTB 2QYIA 4Y79A 5GWZA 5JDUB 4IN1A 1A1RA 1EPTA 5EGMA 3V3MA 3PO1B 1GMDF 3LGIA 2A2XH 2CHAC 2P59A 2ZGJA 4LOYH 2Q6DA 2VH0A 3MOCA 1O38A 1FY3A 2GZ8A 1O0DH 2BD9A 5HYOA 3QWCH 2QA9E 2ZKSA 2SGPE 1IQHA 1BZXE 3VXFH 5JB9S 1Y3XA 3M36A 1OWDA 5C2ZA 5FPSA 2ZHEH 1MH0A 1C1SA 3QGNB 1MD7A 1SGRE 1EZXC 2J98A 5I46H 1TRYA 7KMEH 1J8AA 2BQWB 3LT3A 3FP7E 3MU4A 3E8LA 4A92A 1ELGA 1IQNA 2C8XB 5IYTA 3SJ9A 4B2CA 4DGJA 5C5OA 3NZIA 3RC4A 2BM2A 2V3MA 5EIYA 1O3LA 2BXTH 3BSQA 1CT2E 1BTHH 3AW0A 3GDUA 1TGBA 2OK5A 1FY1A 1F5KU 1THSH 1XUJA 5HIZA 4CRBA 1MTNB 1HIAB 3F3BA 4JK6A 1AFEH 1IAUA 1ZPBA 1COWD 2L6OA 4OS2A 3LGTA 1Q3XA 3RXMA 4K1TA 5C20A 2A31A 3PV2A 3DUXH 3LJJA 1SQTA 4ISIH 3SI4H 2BYAX 4OGXA 3JZ2B 2UWLA 3VEQB 1BMFD 3ZZCA 1TFXA 1AHTH 2ZU4A 3UPEA 1EATA 1AVWA 1KDQA 4Q7ZA 1GCTB 2BD7A 2VNTA 2ZF0H 2Y80A 1G3EA 2FOAA 2PKAA 4CR9A 2HVXA 1O3HA 3H7OA 4D7GA 1SLVB 2G4TA 2DUCA 5SGAE 5K0HA 4ZROA 1J16A 1HJ9A 2BX4A 3F2GA 4XD7D 4YOGA 5F6MA 5EQRA 4INHA 1GVKB 4NA8A 2ZCHP 2QAAA 3BV9B 1BIOA 1QHRB 1V2MT 1C5XB 2WPMS 1EOLA 2VIQA 1HDTH 4HZHA 1O5DH 3RXLA 4LZ4B 3L6PA 2UWPA 3RM2H 3IWMA 4FVBA 3RM0H 2ANMH 4NIXA 1SOZA 4NWKA 4DCDA 4HTCH 3UREA 4NIVA 1RFNA 3I78A 2RCEA 3I29A 5F8XA 2K8IA 1K1NA 3KQEA 1C5MD 2VGCC 1AFQB 1NU7B 1JXPA 1QL7A 1O2UA 2HPPH 4MNYA 3JZ1B 1G9IE 1HAVA 1ELFA 4IN2A 4XBCA 3EAJA 2ZFRH 1F0RA 4CBOA 2I6QA 3SNAA 1MQ5A 1O35A 4X1PU 2D26C 1QCPA 1C5QA 1Z8RA 2JJ2D 2CV3A 3DT0H 3TK6A 2OUAA 1NRPH 2B9LA 2GZ7A 5BPEA 1SI5H 4JK5A 3PB1E 3TH4H 1UVOA 4B1TA 2GCTB 1HXEH 1FPCH 2AYWA 3KQDA 1C1OA 3RXKA 2K0QA 1GJ9B 2G51A 2GDEH 4UFDH 4A1XA 3T5FH 2PSXA 1C5YB 1YF4A 3GY5A 4GCHF 2UUJB 1TPOA 3DA9B 5A8ZA 1K22H 1UVPA 3SUGA 3URCA 1GI1A 1K1IA 2YOLA 3DCLA 1J17T 1ANEA 1CO7E 3PMJA 1YCPH 4IMQA 1P9SA 3S69A 1SGEE 4ABIA 4OS7A 1CSOE 1K1PA 3RMMH 1TGTA 1RD3B 4ABEA 2QN5T 3B9FH 2BD4A 2HVYB 5F03A 3PM3A 5BRRE 1GBCA 1P2JA 1MU6B 1QL9A 3A82A 1GHWH 2ZHDA 2FEQH 3NXPA 1P2MA 1L0ZA 2UUFB 1M9UA 1E34B 3H09A 1SVPA 1Z7KA 2BDIA 4JZDH 1S84A 3ZVCA 2VBCA 1ZRBA 1Y3WA 2P3FH 1MKWH 1MTWA 1D6RA 3LJOA 1VJAU 1GBLA 2JH6D 3RC6A 5JBTA 3EYDA 1VKYA 2Z9KA 1KIGH 1ZJKA 2JETC 2ULLA 1CGHA 4KTSA 5HIYA 1JWTA 1QY6A 3KYFA 1IQGA 4K69A 1TAWA 4I8JA 1HJAB 4UE7H 1DXPA 4BAQB 1S82A 6LPRA 2Q6GA 3TK9A 2STBE 1NFXA 2O9QA 3T62A 2WUBA 5FHTA 2V6NA 4FU7A 3SNCA 1O33A 1CHOG 2EC9H 5AF9H 1QA7A 6ESTA 3MWIU 5GDSH 1O2MA 3MYWA 1F2SE 2FX6A 2JH5D 3N7DA 1ZYOA 2QC2A 1WXRA 4GPGA 1A3EH 2P8OB 4A6LA 2F9BH 1FNIA 2QY0B 4K2YA 1YPEH 1GWAA 2GVFA 1P8VC 1W8BH 1TOMH 3RXRA 1GVLA 1VGCB 1AZZA 3A84A 4X1SU 1HV7A 3PTNA 4A1VA 1QR3E 1TNJA 3M61U 2BDHA 3SV6A 1EOJA 4NZQA 1TNKA 1O30A 2PSYA 4K8BA 4BNRA 3M37A 3A83A 3ZYDA 3DSPA 4YOIA 3PMBB 3HK3B 3U8RH 1HAYB 1O3KA 2PUXB 2M2AA 3EQ0H 4XE4A 5LPRA 1DANH 1E36B 1EB1H 3N7OA 2FX4A 3TJVA 3A7TA 1X7AC 3SO3A 1C2HA 1MU8B 3TK5A 2EQNA 2FWWA 2LP6A 3ZZ4A 3MU5A 3MH4A 3ZVBA 3AASA 1Z8GA 3TIUA 1HCGA 2BVXH 3MNCA 4FUDA 1NRNH 2ZPRA 1P2IA 5ESTE 3UY9A 3UNRA 1P06A 3E0NB 4CRCA 3GS9A 4OGYA 4BAOB 2EI7A 3ZZ8A 1QIXB 2BDYA 2BX3A 4FUHA 3BTTE 1O5FH 1MABB 3N99A 1ARCA 4BXWA 1P3EA 1UTKA 1XMNB 3ATMA 5HMAA 2ZFPH 2XXLA 1TGSZ 1FQ3A 4MG3A 4SGAE 3L33A 4Y8ZA 3MU1A 5EJLA 2VIPA 1TPPA 1NFUA 1MBMA 1H8DH 4AFZA 4B75A 4YT6H 7GCHF 5T1VA 3PWCA 3SNBA 4VGCB 5FPTA 1IQMA 4B6FA 3DSOA 1DICA 1LO6A 1Q31A 1VCPA 1EASA 3CENA 3BEFB 2F3CE 4ZMAH 1KXCA 2FTLE 2OTVA 4JZFH 1C5RA 1GI2A 3QGJA 1TMBH 1SLWB 3QO6A 1O5AB 1RS0A 1BBRK 1BMMH 3PTBA 5KECA 1YLNA 3SI3H 3T26A 4KELA 5F8ZA 3CP7A 1QA0A 1QRZA 2AGGX 3QUMP 4X8UH 3RU4T 4YOJA 2JDID 4DW2U 1YPGH 3SUDA 2L74A 1RTLA 1GHXH 1ZMJA 3BG4C 1C4V2 2KR7A 2R9PA 2Q6FA 4DIIH 1V2JT 4ISHH 5T3HA 3A8BA 2BD5A 1KXAA 3GY4A 2F9NA 1Y3YA 3F9HA 2ZDVH 1WU1A 3URDA 2JKHA 3K6ZA 3PROA 5DPAA 1P01A 2ZDKA 3M3TA 5LPFA 3AW1A 4CBNA 2BD2A 3OX7U 1MKWK 2WPKS 4LK4A 1E1QD 1YPHC 3SGAE 2WINI 3VGCB 4JZ1A 1ANDA 1VR1H 4B74A 1BOQA 1XUFA 1BTZA 2A7CA 1UCYH 4RKJB 1FI8A 2FOHA 2ZU2A 1UHBA 1LPKB 1V2PT 3QDZB 1LTOA 1O2HA 1C5WB 3TU7H 1KTTB 1TX6A 2VIWA 4JYUH 2VWOA 2VVCA 1Q2WA 2GV6A 1L1GA 1HYLA 2G4UA 2ZDMA 1GJ5H 4TPYA 2QCYA 1GJ8B 1GI8B 2O8WA 2BZAA 3E16B 1V2RT 4H42U 1EP6A 3A88A 1A0JA 3ZZDA 4X6MA 4LXBH 3GYMA 1PPEE 3NWUA 3VB7A 1CBWC 2BY7X 2TGTA 2OC8A 4UEHH 4NWLA 3UR6A 1XXFA 3F68H 2A4OA 2EEKA 1MTVA 1YGCH 1Z1JA 1W0ZU 1A4WH 2H6MA 1F5LA 1QB1A 2W7SA 1S6LA 3A7VA 1O39A 5GXPA 3UWIA 4GHTA 1ZR0A 2D8WA 5DP5A 1SGTA 3OEED 3B23B 4YLUA 5C67A 1O3DA 5J4QA 3PV4A 2FLRH 3RXQA 1O2YA 1YBWA 1U6QA 1O5CB 1DOJA 3A8CA 3ZZ7A 2Z6BD 1V2LT 3GY6A 1MTSA 8ESTE 3RP2A 3RXAA 1UTNA 2HLDD 1CU1A 1EUFA 1F0SA 3R3GB 5EJ1A 5AFYH 1HAXB 1HLTH 1DPOA 3GY8A 4UFFH 3SU4A 3MTYA 3WY8A 1BTXA 1ELCA 2NU0E 4JZEH 1GJBB 3W95A 2BD8A 1TYNA 1AUTC 2WV5A 5JYIA 1YYY1 3GY7A 6CHAB 3M3VA 1O5GH 3K65B 1KSNA 1RIWB 1JMOH 4BAMB 3AAVA 5F8TA 4I7YH 2G5VA 1GHYH 1S6HA 1TA2A 4O3UA 4JMYA 3DSGA 2HLCA 2D2DA 3MH6A 1IHSH 2J38A 3WW7A 3ATKA 3RMOH 2WPIS 2VVVA 3UOPA 1BRBE 4INKA 1SFIA 2WHXA 3RXSA 1FY4A 3UIRA 4ABJA 5C5NA 3ZZBA 3LH1A 3SU0A 3LGVA 5JB8S 1AB9C 2QGRA 1PPGE 2P95A 2GT8A 5LH8A 3LONA 4GAWA 4X1QU 1AKSA 1CQQA 2O8LA 5DO4H 1OPHB 1W7XH 2GV7A 4WMDA 2BOHB 1C1WH 1N8OC 1YPHE 2ZTXA 1GHAF 4X2WA 1OKXA 4Y71A 1SGIB 3D23A 3QZQA 4D8NA 5A0BA 2F91A 4X6NA 4CR5A 2HRVA 2QXJA 4B2BA 4KTUA 3FZDA 2BMGB 1INCA 5GPIB 1RJXB 3IG6B 4UFGH 3PO1C 1G37A 5E0JA 1W10U 1QBVH 2RG3A 2Z9IA 1IHTH 1ZTJA 4MLFB 1AU8A 3ZV9A 1F0TA 3ZZ3A 1GJCB 1V2KT 4U01A 2CJIA 4F48B 2AERH 5HGGA 1AUJA 1D3DB 1YM0A 3U1IB 3SV8A 1AGJA 1EJNA 3UNQA 1GGDB 2HOBA 2SGEE 3A89A 4Y6DA 4FOUC 1CVWH 3VB5A 2BDCA 1O3BA 3HK6B 1T8LA 1O3EA 4MPWA 1P12E 2GDDA 3EE0B 3SV7A 2G52A 1T4UH 1HUTH 3MH5A 3SJ8A 4ASHA 1KTSB 1UCYK 1D3QB 1VCWA 2C90B 5IDKA 4A5TS 4TY7A 1E0FD 4WY3A 5E2OA 1TBZH 1XKBC 4E05H 3EA7A 1EXFA 1EJMA 2ODPA 3KQ5A 4MPUA 1O2SA 2F9OA 3V0XA 2TBSA 1G3CA 3BF6H 1GG6C 3T28A 2OC1A 4Z0KA 2ZHWH 1LVMA 1MTNC 3QN7A 1SHYA 2BVRH 1SLUB 4FUCA 1OWIA 4JYVH 1SC8U 2C3SA 1LCYA 1ORFA 3MO9A 4RT0A 3OE7D 4BAHB 2ZIQH 4K5ZA 2KAIB 4AYYB 1ZHRA 3TJUA 5EPYA 3C1KA 3AAUA 3SZNA 3QX5H 3MU8A 2HNTF 1C1PA 4FUIA 2THFB 3RDZA 2AHME 2OLGA 5LGOA 2W6ID 2KZ4A 2AH4X 2XOKD 1GBEA 3KYGA 3LGWA 2A5KA 1N1LA 1GCTC 4FUJA 1PQ8A 2H5CA 2RFKC 2Y5HA 1MAXA 1O2JA 1QB6A 1MCVA 4ZKRU 4ABHA 1V2OT 3O8BA 5A09A 4Q63A 2O8MA 2ZTYA 1ELDE 1O2KA 4TPIZ 2F9PA 3OYPA 4H4FA 2XNIA 4ABDA 1C5OH 1QQ4A 3KN2A 3N7EA 4D9RA 1OP2A 4AOQA 4AX9H 1EZUC 4IS5A 3MU0A 5C1XA 1SGCA 1ESTA 9LPRA 1GMHG 2A5IA 2KX4A 1DS2E 2GGVB 2PTNA 2H9HA 1SLXB 1P0SH 3CS0A 4CRFA 1C5LH 1IQIA 1ZJDA 1A5IA 1DWCH 5JBCS 3SW2B 4AGJA 2PW8H 1GDUA 1TIOA 1VCQA 3PLKA 1QL8A 1XUIA 2PUQH 3F9FA 1ID5H 3RXUA 5C0UA 1DXWA 5C3NA 3RXCA 4ZUHA 5GCHG 4BTTB 4WH8A 2FOFA 3RMLH 2IPQX 4CHAB 1XKAC 1YLCA 4FUFA 1A0HB 4AB9A 2OXSA 2V3OH 5E2PA 1AVGH 2CK3D 2GCTC 1C9PA 5FBEA 1QBOA 3DD2H 4HFPB 2Q1JA 4FVDA 1O3IA 1TQ0B 4X1NU 2AGIX 2J95A 4Y10E 1P9UA 4J2YB 1BRCE 2XNDD 2XC5A 3B8JA 3QTVH 4K1SA 1C1VH 2Z9LA 2V0BA 4Q7YA 4CH2B 4P00A 2Z9GA 2D1JA 1UCYE 1HNEE 1WSSH 1NBME 1SPJA 1O3AA 2G8TA 1O2IA 2KCAA 1BHXF 1G30B 4I8HA 5F53A 3FZZA 4GHQA 4RSPA 1C1QA 2PWXA 1GBFA 5EQSA 5ABWA 3SUFA 4FU9A 1EB2A 2PGQB 3PV5A 3ZVDA 2W5EA 1G3DA 2ZP0H 2FO9A 3GCTF 1UTOA 2H2ZA 1FN6A 2BQ6B 3GCHB 1GHBF 4TSFD 1L2EA 2OC7A 1FMGA 3BTHE 3D65E 2FMJA 2XRCA 1LMWB 3ELAH 3U28C 2EY4C 2BDGA 4AFQA 4CRDA 1GI7B 1FJSA 4K1EA 3UOUA 4I32A 1BA8B 1A3BH 5G4BA 1DWBH 2ILNA 4O3TA 4Y8YA 4AORA 1NU9A 2VGCB 1MMJN 3BTEE 3UWJH 2RDEA 2BDAA 1AZ8A 2GJGA 1HAZB 1LVOA 1B0FA 1ZLRA 1DSUA 3KQBA 3RXPA 1SMFE 1Y3VA 1HJAC 2HWLB 1UTJA 4NIWA 3P70B 3U69H 3A7YA 1O2RA 9ESTA 2JIZD 2BY8X 1DSTA 3PLBA 3MH7A 1HBTH 1K28D 3RLWH 2ZWLH 1C2LA 5CHBA 1BTWA 4X6OA 3SBKA 3W94A 7LPRA 4K8YA 1FAKH 3RU4D 1TX7A 4QT8C 2BHGA 3CS7A 1UK3A 1P3CA 1P10A 4Y11E 4FUBA 3AK5A 3ZYEA 1W3CA 2Z3CA 3QK1A 1W14U 3LU9B 4TY6A 4ZAEA 3VXEH 1AVXA 1CHGA 4Y0ZE 4KP0A 1VGCC 3PYHA 1LHEH 4IC5A 3FKSD 4ABFA 4AYVB 2WPJS 2WYJA 1B5GH 4ZH8A 2P94A 2SGDE 1GBDA 1C9TA 2ZFTA 1FXYA 3VFEA 1PPHE 2KCYA 1ZMLA 2BLOA 1UTLM 1S0RA 3GDSA 3BEUA 1C1NA 1DUAA 4UFEH 3A81A 3A8DA 3F2FA 5L2ZH 4WXVA 4DIHH 2FIRH 4Z1MD 1P2NA 2FOMB 1O37A 1JRSA 4D9QA 2WPLS 1W11U 1OYTH 4Y7BA 1QRWA 1IQLA 4WF8A 1GMCG 1G2LA 4IMZA 2ZC9H 2J92A 1E37B 1SGYE 2QE7D 3BIUH 2FI5E 3MO3A 4YM9A 3KIDU 5E8EH 1RTKA 2HGTH 1TQ7B 1NFYA 2JH0D 5CHAB 4Q4LA 5DK1A 8LPRA 3FN8A 2XWAA 3OU0A 3VG8A 4BTUB 1OS8A 1O2VA 1K1JA 1QBNA 5C1UA 4F49A 3SYJA 2TGDA 1MTUA 1GI5A 1NC6A 2CGAA 2SGQE 4ESTE 1DWEH 5K7RA 3M5OA 4X6PA 1W7GH 1ZMNA 1SGPE 8KME2 1GJDB 2F9UA 4NA7A 2ANKH 4ZHAA 3O8DA 1SFQB 4NA9H 1IQKA 2C8ZB 3ZZ5A 2YMSD 2BVSH 8GCHG 3CNRA 1K1LA 3GICB 2J4IA 4VGCC 1NFWA 2FP7B 2QF5A 3LGUA 1OSSA 4AFSA 2JJ1D 3GCOA 5DKMA 5TCCA 5LPEA 2ZU5A 1TONA 2VWNA 2FXRA 1HIAA 1MQ6A 5J4SA 4D76A 1FAXA 1C2IA 3RXGA 2VINA 1PPFE 4NSVA 1S6FA 1LDTT 4AGKA 5AHGH 4OS4A 4ACBA 1DFPA 2B8OH 1BQYA 3PLPA 2ZQ1A 1ELTA 5DG6A 1T8NA 6GCHG 1WTGH 3U1JB 1EPTB 3SV9A 4WH6A 1UVTH 2P3TB 4R8TB 5E0HA 3SHCH 1NRSH 2VIOA 1TWXB 3SJOA 4WVPE 1NY22 1WV7H 2SNVA 2PGBB 4OS6A 1BDAA 2WSSD 3FP8E 1FLEE 4ZKOU 3LGYA 2ZG0H 1YCPK 3LOXA 1EKBB 3Q76A 2ZDAH 3SQEE 1GI9B 3KL6A 2J98B 1E1RD 1H9HE 5A8XA 7ESTE 1V2ST 1C5SA 2PR3A 5DN6D 1XVOA 1ZRKA 3GY3A 1KXBA 1LQEA 1MCTA 1DY8A 3Q3XA 1GBAA 4MTBA 2GKVE 1P04A 5CE1A 2KCOA 3GOVB 1H8ED 1F0UA 2GCHG 3H5CB 1D6WA 4FUGA 4RN6A 4THNH 2AMQA 5DP3A 1AO5A 2PKSB 2QF0A 1C2FA 1E35B 5GJ4B 5A2MH 2GP9B 1MKXH 1Z6JH 3K2UA 1O3NA 1DLEA 2YMSB 1SGNE 1S85A 4UONA 3VB3A 1JRTA 3G01A 2OBOA 1P2KA 3BTWE 2LELA 1QB9A 3BTGE 3FANA 5IK2D 2O8TA 3NK8A 5HXFA 5I25A 1GMDG 1Y5AT 1TBRH 3SGQE 4B73A 2FOGA 4CH8B 1C2EA 1ZPCA 3TVJB 1TE0A 1KDQB 3WWFA 1H8IH 1XUHA 1O2OA 4ABBA 1VITH 1PYTD 1CT4E 2PKAB 3VB4A 4AFUA 2ZFFH 1CHOF 1C4Y2 1GJ4H 1P09A 4X0WU 2QIQA 5FAHA 3GCNA 1OP0A 1AIXH 2LPRA 5FX6A 1W12U 1C5UA 2P93A 2PTCE 3BG8A 3ZVEA 1EX3A 1L4DA 2FYRA 1SGFA 2R2WU 1S5SA 3BTQE 2TPIZ 1CGJE 1WYKA 3ATIA 4XBBA 3FAOA 1P57B 4WMEA 2Z9JA 2ZU3A 4YT7H 1K0HA 4MDSA 3ZZAA 2A32A 2ESTE 3E6PH 1KYNA 5C17A 5EXLA 4K3JA 6CHAC 3F0OA 4DJZB 2OCVB 3IITA 3SNDA 3KGPA 2Y5GA 1RIWC 1GI0A 1BHXB 4O03A 1TNIA 2KCPA 1LHDH 3ITIA 3STJA 2Z7FE 3FO8D 3LH3A 1CA0B 1H4WA 1H8HD 1HAVB 1UTMA 1BUIA 1DITH 4JYTA 4CRGA 1GDNA 2UUYA 1G3BA 4MNVA 3U8OH 1TGNA 4Q80A 1V3XA 3MQKC 1AQ7A 3BTME 1QJ7B 1SBWA 3PMHB 5C94A 1GBIA 5A0AE 1PYTC 2ZHQH 4YXWD 2ZGXH 2ZI2H 1E38B 1O3CA 1MD8A 1A5GH 2NWNA 4GVUA 4X8VH 1Y5BT 1J9CH 4D7FA 2B5TB 5L30H 2Y5FA 3T25A 2XBWA 2Y81A 3TJNA 4U30A 2C8YB 1E79D 1LHGH 2XW9A 1WAYB 3SN8A 4DG4A 3M5MA 2C4FH 3RXJA 1BRUP 1C2MA 3ZVGA 1HAGE 4X8TH 3HPTB 4U2WA 4GLYA 3AVZA 1MUEB 1WOFA 1ZGVA 4ZHLU 1HXFH 2OP9A 4CREA 3KQCA 1ZOMA 5JPMH 5DP8A 3R0FA 2W6JD 1FV9A 1PQ5A 1PPBH 4OS1A 2BB4A 1ETTH 4INLA 4X2VA 3EA9A 1O5BB 2TIOA 1GGDC 3UUZA 2G5NA 4I86A 1FX0B 2GMTC 1UTQA 2J2UA 1BT7A 1PPZA 2VVUA 2FPZA 1V2VT 1DUEA 3UTUH 3F1SB 1PPCE 5AFZH 5FXLA 1T4VH 5EW2H 1YWUA 2H5DA 1W0KD 2M5TA 1WQVH 2A2QH 5T6DA 2XBYA 4J1YA 2RDLA 1ELVA 2GD4B 1GL1A 1LQDB 4XRNA 5JBAS 3FOAA 1MZAA 1XUGA 4AC9A 2AIQA 2FS9A 3ESTA 1GVZA 3A85A 1WQSA 3VB6A 4JZIA 2PHBA 1TA6A 1H9LB 1AB9B 1ELEE 1GDQA 1F5RA 4X1RU 1W13U 3SGBE 4UDWH 1C2GA 3W1EA 4AG1A 2AMDA 4GCHG 3H7TA 3V7TA 2QXGA 2VB0A 3HKIB 3TJOA 1FPHH 4ZCNA 1C5VA 1SOTA 1OWKA 5C1YA 1TNLA 2GT7A 2Z94A 1NN6A 3HGNA 2XC4A 2BDBA 1LPGB 1SSXA 2R3UA 3UQOA 1K2I1 1MZDA 2J9NA 1SG8B 3SU1A 3LDXH 5EG4A 4P02A
chains in the Genus database with same CATH topology
2Z3EA 3NCLA 4O9VA 1QJ1B 5FCKA 4ZKNU 1VJ9U 3UR9A 1GBTA 1WUNH 1EAIA 2R3YA 2FTMA 1AD8H 1OYQA 1SQAA 2QV1A 2AGEX 1AE5A 1XXDA 2CF8H 1CA8B 1K1OA 1ZSJA 2UUKB 1HPGA 3A87A 5DGJA 2BQ7B 4MVNA 2FOEA 2ZCLP 4YESB 4ZKSU 4XSKU 4LZ1H 2CHAB 5DP6A 2ALVA 1TB6H 2XWBI 4ABGA 2FI4E 1NRQH 3OY5U 2SFAA 2ZQ2A 3HGPA 1V2WT 4I31A 2H9EH 3STIA 2NU3E 2AEIH 5L2YH 1S0QA 3SHAH 2FS8A 1O3PB 3OSYA 3ODFA 1GG6B 3P8OA 3L3TA 2J94A 5EQQA 1A5HA 2SGAA 4HGCA 1V2UT 1DY9A 4DY7B 1TX8A 3K9XB 4ISOA 1NM6A 3M3SA 1WTHD 3SU3A 2CMYA 2ZCKP 4MNXA 4CHAC 3C27B 3I77A 1LKAA 2ZPSA 3KEEA 3PWBA 2EA3A 4X8SH 1ZZZA 4H6TA 1AFQC 3S7HB 1IOEA 1C2JA 1UMAH 1A7SA 3A7ZA 1XM1A 5EXMA 1T7CA 2F9VA 3K6YA 2UWOA 1NO9H 2ZU1A 1FY5A 1FIWA 2V35A 4F4OC 1IQEA 2ANYA 4OS5A 2OD3B 1YP9A 3A7XA 2BTCE 2G55A 1A2CH 3LKWA 3S0NA 2B7DH 1YLDA 1FN8A 1UK2A 1YPLH 2STAE 1O2LA 2FZZA 1L1NA 1ZTKA 2OQ5A 3BEIB 2P3UB 1BJVA 3M5NA 1KXDA 1XUKA 3OY6U 3GCHC 4TWYA 3O8CA 2LNCA 1FZZA 3ZVAA 4YZUA 4E7NA 4BAKB 1Y5UT 3TPIZ 2XCFA 1O3MA 1Z1IA 2TGAA 4NGAH 3MNSA 3MNXA 1P03A 3SNEA 3EGKH 3MHWU 1O31A 3SJKA 1O2QA 2FYQA 1T32A 1VITG 2VWMA 1TBQH 1OWJA 3E3TA 1P2OA 3M35A 5EU8A 4ZHMU 2QXIA 1PFXC 1CE5A 1A0LA 3E90B 1CGIE 2ZPQA 3NPSA 5CMXH 1C5ZB 3UFAA 2ZGHA 4DOQA 1TRNA 2Y7ZA 1ETSH 1ZPZA 3KNXA 2NU2E 2C93B 3RC5A 3V13A 4JCNA 3RLYH 5EW1H 4PROA 7GCHG 3QZRA 3BIVH 1UHBB 1Y8TA 1AWFH 3MFJA 3GISB 2H9TH 1TABE 1NS3A 3BTDE 1O34A 5EODA 3KCGH 4ZXXH 1K21H 1O3OA 1H9IE 2BY9X 2NU4E 3A7WA 3TH3H 1DWDH 3M7TA 5AVDA 1KY9A 3SV2H 3ENSB 3RXTA 1Z71A 3ATLA 1O2WA 1JIMA 2FI3E 1ANCA 2A4GA 1BITA 1W2KH 1NRRH 2ZDLA 1J14A 2BY5X 1B7XB 4Z6AH 4Y8XA 1BBRH 4ISNA 1TMTH 1XX9A 4WWYA 2BY6X 1T8MA 1IQJA 4FU8A 2XTTB 1THPB 3E0PB 1BB0B 2GTBA 1ELBA 1OX1A 5HM9A 2A7JA 1OXGA 3ATWA 1P2QA 3KHVA 3F6UH 3SUEA 2BZ6H 2P8OC 2PV9B 1TNGA 1BMLA 2YNBA 2IJOB 1V6DA 4U32A 5DJ7A 3DFJA 1WCZA 2O8UA 1GBJA 1D4PB 4WXIA 2V3HH 2ZECA 1HAPH 1QFKH 3DHKH 1QNJA 5FCRA 4AN7A 1EAUA 1EAWA 2EI8A 2IOTA 2XYAA 1FY8E 1GBBA 2Y6TA 4K60A 1HAHH 2OQUA 2TGPZ 2BLWA 3RXIA 4IBLH 1N6YA 1NT1A 1T8OA 2BLQA 1BMAA 3FFGA 2VWLA 1BRAA 1CT0E 1BJUA 1P05A 5CHAC 1NZQH 3FVFB 2VJ1A 1QTFA 2DE9A 1DVAH 1AI8H 3GYLB 3SU5A 5A0CA 2ASUB 4WMFA 1SQOA 3MNBA 1NPMA 1O2ZA 3SOSA 1AMHA 2TRMA 1LVBA 3SORA 1UK4A 4I8GA 4IC6A 1HFDA 1LHFH 4RKOB 1MBQA 1FDPA 1TMUH 1Y59T 3TGKE 1SGFG 5L6NH 1GCDA 2JETB 2ODYB 3SJIA 1GMHF 1DX5M 2RA3A 1TPSA 1PQAA 1G32B 2XCNA 1HAIH 3UQVA 3TITA 3P8NA 2W7UA 1YC0A 3HATH 5FX5A 2FM2A 3ZZ6A 2A45B 1AKSB 4E06H 2CXVA 3LC5A 1G2MA 2ANWA 4KTCA 1ELAA 1YPMH 5PTPA 4A7IB 2R0LA 1S83A 1THRH 1DE7H 4ISLA 4KGAA 1Z8IB 2KAIA 5DP7A 5GCHF 1A61H 4Y0YE 1ZSKA 4DVAU 3F9GA 3QTOH 1EPTC 3RXFA 4YO9A 4GUXA 3T27A 1DLKB 4Q7XA 4WJG2 3Q3YA 3LC3A 1ARBA 1O3GA 3GDVA 2SGFE 3MI4A 2NU1E 1W0YH 5DP9A 2PFEA 4ABAA 2W26A 2WPHS 1O32A 1O2GH 1KLIH 2CN0H 2WYGA 5DP4A 2ZHFH 1UJ1A 2SNWA 1AWHB 2ZFQH 4B71A 1GI3A 2HNTC 5EPNA 2ZGBH 4TWWA 4UD9H 2C8WB 2AS9A 3GY2A 5JBBS 4MNWA 1VITF 1TPAE 2XC0A 2G00A 5ETXA 3RXDA 1B0EA 1YPJH 1QJ6B 1AN1E 1O3JA 4IW4E 1VZQH 1Y3UA 1EP5A 1KLTA 2FESH 2IN2A 4I33A 1O2XA 3PMAB 1O2TA 3EDXB 5E0GA 1UVUH 1QURH 1D3TB 2A7HA 2VIDA 4BANB 1DDJA 1RGQA 4X2YA 3TNTA 1SHHB 2PKSC 4B76A 5TJXA 3BN9A 4X2XA 3P17H 1J15A 1Z6EA 1ABJH 3F9EA 3VGCC 2A4QA 3T29A 1OOKB 1F7ZA 2FOBA 1GHAG 3ZVFA 4XOJA 1K9OE 1WBGB 1C1UH 2QF3A 2K1QA 1V2NT 1FUJA 5EOKA 1EZQA 1C1TA 4IGDA 1SGQE 5T6GA 4AZ2B 1ACBE 1ZHMA 5GIBA 2WV4A 2R2MB 3Q77A 3SQHE 2ZFSA 3Q00A 3O8RA 1C4U2 1O2PA 2FDAA 3A80A 3M7QA 1JBUH 1JOUB 3SU2A 1C2KA 1MAYA 3HKJB 1NTPA 1A46H 1AY6H 3P6ZB 1QGFA 3M5LA 1TALA 1C2DA 1BCUH 1GHVH 3P8FA 3OTJE 4Q2KA 2ALPA 2GX4A 4NFFA 4KKDA 1S81A 1UVSH 1PJPA 2FOCA 1FONA 4ZXYH 1KXFA 1C5PA 3UNSA 1YKTA 2ZZUH 1XVMA 4YTAA 2BXUH 3S9AA 1LPZB 2FODA 1ZTLA 3RMNH 3RXVA 1C1RA 3RU4E 2OBQA 3EA8A 3BTKE 3QLPH 4B2AA 1HJ8A 1D3PB 1D9IA 4MPVA 1ETRH 3E91A 1GJ7B 1JIRA 4H6SB 3BG4B 4XFQA 2A1DB 2ZDNA 2Y7XA 1BTYA 3ODDA 2PLXA 4MQAA 4O97A 2OINA 3A86A 5A8YA 3S9CA 4NG9H 1ZGIA 2F83A 3S7KB 3RXEA 3T2NA 3S9BA 1Z8JB 1CA0C 1GBMA 1N6XA 1GPZA 2BLVA 4Y76A 1O36A 2ZGCA 3P95A 5T6FA 2RA0A 3VPKA 5ESBA 1RTFB 4HI3A 2Z3DA 4BTIB 5B6OA 1DT2A 1HRTH 1GMCF 3Q3KA 1BTUA 3NKKA 3TH2H 4SGBE 1QQUA 1NESE 1LVYA 4CRAA 2WUCA 2ZO3H 5FBIA 1GI4A 3D62A 1ZHPA 1L1JA 1GL0E 1H1BA 2DE8A 1HB0B 1NROH 2HNTE 4FXGH 2QXHA 1AE8H 1EZSC 1ESAA 1V2TT 4DT7B 1O3FA 1ZSLA 1LKBA 2B0FA 3RXBA 3U9AH 5EXNA 4XBDA 5TCAA 3TNSA 4TYDA 1CBWB 3MMGA 3MO6A 1TLDA 1ANBA 1SR5C 1SL3A 1UO6A 3LPRA 3NUMA 3DFLA 1KXEA 1C5NH 2R0KA 4NCYA 2AIPA 1BTPA 1HGTH 1YPKH 8GCHF 1GJ6A 3KF2A 1P02A 2ZEBA 3RXOA 4I8LA 4XDEA 2A5AA 4DURA 1ABIH 1DM4B 1EAXA 1TOCB 4I8KA 2BOKA 3P92A 4YLQH 2YNAA 3SU6A 1GBHA 1C1MA 1TGCA 1OP8A 1BBRE 2EI6A 3U98H 3RUOA 3D49H 1FIZA 2VIVA 4NFEA 2IPHA 2VH6A 2Y82A 1RXPA 4R0IA 3TGJE 4BXSA 6GCHF 5H4IB 1LHCH 1V2QT 2J34A 1C5TA 1F92A 1UTPA 1OWEA 2OC0A 1K1MA 1G36A 2FLBH 2CF9H 1BMNH 3RXHA 1EQ9A 3V12A 2A4RA 2G81E 1PQ7A 2ZA5A 1SGDE 2VU8E 4MPXA 4NSYA 4A1TA 4E7RG 3A8AA 3BTFE 1O5EH 5FPYA 2W3IA 1T31A 2AFQB 2P16A 1RRKA 1GI6A 1SB1H 3TLOA 2XBVA 3TGIE 1QRXA 4AB8A 2ZTZA 2W3KA 1OWHA 2A0QB 2ODQA 1O2NA 3ZV8A 1P11E 2AMPA 2H1UA 3ZZ9A 1YCPM 3GCTG 4AG2A 1TNHA 4GSOA 3P8GA 4M7GA 2XBXA 5HM2A 1MKXK 3LIWA 1IQFA 1GHBG 1L4ZA 2GCHF 2HALA 4BOHA 2I6SA 4Y7AA 3M7UA 4NZLA 3U8TH 1GHZA 2HPQH 1TRMA 2BD3A 1KLJH 3E1XB 4NIYA 2ZNKH 1GBKA 2GZ9A 4FUEA 1N8OB 1EJAA 1GJAB 3FP6E 1ESBA 1HAOH 2GMTB 2QYIA 4Y79A 5GWZA 5JDUB 4IN1A 1A1RA 1EPTA 5EGMA 3V3MA 3PO1B 1GMDF 3LGIA 2A2XH 2CHAC 2P59A 2ZGJA 4LOYH 2Q6DA 2VH0A 3MOCA 1O38A 1FY3A 2GZ8A 1O0DH 2BD9A 5HYOA 3QWCH 2QA9E 2ZKSA 2SGPE 1IQHA 1BZXE 3VXFH 5JB9S 1Y3XA 3M36A 1OWDA 5C2ZA 5FPSA 2ZHEH 1MH0A 1C1SA 3QGNB 1MD7A 1SGRE 1EZXC 5I46H 1TRYA 7KMEH 1J8AA 2BQWB 3LT3A 3FP7E 3MU4A 3E8LA 4A92A 1ELGA 1IQNA 2C8XB 5IYTA 3SJ9A 4B2CA 4DGJA 5C5OA 3NZIA 3RC4A 2BM2A 1O3LA 2BXTH 3BSQA 1CT2E 1BTHH 3AW0A 3GDUA 1TGBA 1FY1A 1F5KU 1THSH 1XUJA 4CRBA 1MTNB 1HIAB 4JK6A 1AFEH 1IAUA 1ZPBA 4OS2A 3LGTA 1Q3XA 3RXMA 4K1TA 5C20A 2A31A 3DUXH 3LJJA 1SQTA 4ISIH 3SI4H 2BYAX 4OGXA 3JZ2B 2UWLA 3VEQB 3ZZCA 1TFXA 1AHTH 2ZU4A 3UPEA 1EATA 1AVWA 1KDQA 4Q7ZA 1GCTB 2BD7A 2VNTA 2ZF0H 2Y80A 1G3EA 2PKAA 2FOAA 4CR9A 2HVXA 1O3HA 3H7OA 4D7GA 1SLVB 2G4TA 2DUCA 5SGAE 5K0HA 4ZROA 1J16A 1HJ9A 2BX4A 4YOGA 5F6MA 5EQRA 4INHA 1GVKB 4NA8A 2ZCHP 2QAAA 3BV9B 1BIOA 1QHRB 1V2MT 1C5XB 2WPMS 1EOLA 2VIQA 1HDTH 4HZHA 1O5DH 3RXLA 4LZ4B 3L6PA 2UWPA 3RM2H 3IWMA 4FVBA 3RM0H 2ANMH 4NIXA 1SOZA 4NWKA 4DCDA 4HTCH 3UREA 4NIVA 1RFNA 3I78A 2RCEA 3I29A 5F8XA 3KQEA 1K1NA 1C5MD 2VGCC 1AFQB 1NU7B 1JXPA 1QL7A 1O2UA 2HPPH 4MNYA 3JZ1B 1G9IE 1HAVA 1ELFA 4IN2A 4XBCA 3EAJA 2ZFRH 1F0RA 4CBOA 2I6QA 3SNAA 1MQ5A 1O35A 4X1PU 2D26C 1QCPA 1C5QA 1Z8RA 3DT0H 2CV3A 3TK6A 2OUAA 1NRPH 2B9LA 2GZ7A 5BPEA 1SI5H 4JK5A 3PB1E 3TH4H 1UVOA 4B1TA 2GCTB 1HXEH 1FPCH 2AYWA 3KQDA 1C1OA 3RXKA 1GJ9B 2G51A 2GDEH 4UFDH 4A1XA 3T5FH 2PSXA 1C5YB 1YF4A 3GY5A 4GCHF 2UUJB 1TPOA 3DA9B 5A8ZA 1K22H 1UVPA 3SUGA 3URCA 1GI1A 1K1IA 2YOLA 1J17T 1ANEA 1CO7E 3PMJA 1YCPH 4IMQA 1P9SA 3S69A 1SGEE 4ABIA 4OS7A 1CSOE 1K1PA 3RMMH 1TGTA 1RD3B 4ABEA 2QN5T 3B9FH 2BD4A 5F03A 3PM3A 5BRRE 1GBCA 1P2JA 1MU6B 1QL9A 3A82A 1GHWH 2ZHDA 2FEQH 3NXPA 1P2MA 1L0ZA 2UUFB 1M9UA 1E34B 1SVPA 1Z7KA 2BDIA 4JZDH 1S84A 3ZVCA 1ZRBA 1Y3WA 2P3FH 1MKWH 1MTWA 1D6RA 3LJOA 1VJAU 1GBLA 2JH6D 3RC6A 5JBTA 3EYDA 2Z9KA 1KIGH 1ZJKA 2JETC 2ULLA 1CGHA 4KTSA 1JWTA 1QY6A 1IQGA 4K69A 1TAWA 4I8JA 1HJAB 4UE7H 1DXPA 4BAQB 1S82A 6LPRA 2Q6GA 3TK9A 2STBE 1NFXA 2O9QA 3T62A 2WUBA 5FHTA 2V6NA 4FU7A 3SNCA 1O33A 1CHOG 2EC9H 5AF9H 1QA7A 6ESTA 3MWIU 5GDSH 1O2MA 3MYWA 1F2SE 2FX6A 2JH5D 1ZYOA 2QC2A 4GPGA 1A3EH 2P8OB 4A6LA 2F9BH 1FNIA 2QY0B 4K2YA 1YPEH 1GWAA 2GVFA 1P8VC 1W8BH 1TOMH 3RXRA 1GVLA 1VGCB 1AZZA 3A84A 4X1SU 1HV7A 3PTNA 4A1VA 1QR3E 1TNJA 3M61U 2BDHA 3SV6A 1EOJA 4NZQA 1TNKA 1O30A 2PSYA 4K8BA 4BNRA 3M37A 3A83A 3ZYDA 4YOIA 3PMBB 3HK3B 3U8RH 1HAYB 1O3KA 2PUXB 3EQ0H 4XE4A 5LPRA 1DANH 1E36B 1EB1H 3N7OA 2FX4A 3TJVA 3A7TA 1X7AC 3SO3A 1C2HA 1MU8B 3TK5A 2FWWA 3ZZ4A 3MU5A 3MH4A 3ZVBA 3AASA 1Z8GA 3TIUA 1HCGA 2BVXH 3MNCA 4FUDA 1NRNH