4FUGA

Crystal structure of the urokinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 60
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fugA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fugA01
2SGPE 1EP6A 2D2DA 1SLWB 1P06A 1RFNA 3QX5H 4MPUA 4JCNA 5DG6A 3OX7U 1VITG 2F9BH 2BTCE 1BITA 1SFQB 5E2OA 1GBFA 2VIDA 1LQDB 5FX5A 1G3CA 1O38A 4FU7A 3K9XB 3EE0B 1ZSKA 1AFQC 1IHSH 4I8KA 3ZZ8A 3EAJA 2HPQH 1XUFA 7KMEH 1ZOMA 1SC8U 1O3MA 1ZRBA 2Y5FA 3TK5A 1O33A 3SGQE 3A85A 3BG4B 1J8AA 2AGIX 3E6PH 1SGTA 1W0YH 2GX4A 6CHAC 4Q7YA 1BBRE 2ZECA 2Z3EA 1GBHA 1TNKA 1JRTA 4KP0A 4B2AA 3F9FA 1DITH 1YPJH 4D7FA 1V6DA 2O8UA 4ZKRU 1K22H 3QO6A 2JETC 1C5UA 3E8LA 2CV3A 4I8HA 1RTFB 1K21H 3TGKE 1UVOA 1WYKA 5DO4H 1T8LA 2FLRH 4MPXA 3RXGA 2R0LA 5TJXA 1NFXA 2QC2A 3UOUA 2VWNA 1DUEA 4AYYB 3KN2A 1TWXB 1DLEA 2FLBH 3LONA 1AKSA 1FZZA 1Y3VA 4FU8A 2OC7A 1DSTA 1NN6A 1YPLH 5EG4A 1Q31A 1GDUA 1D3DB 3H7TA 2AEIH 3ZZCA 2FDAA 4ZAEA 1ZTJA 1QJ7B 1W3CA 2BD2A 1KLIH 1BOQA 1ZSLA 1AB9C 1RTLA 4ESTE 1BTUA 3SBKA 2BDGA 4NZQA 2Y6TA 2ZWLH 1GHBG 4R8TB 5ESBA 2HGTH 4AB9A 4A92A 1SLUB 4UDWH 1AE8H 2OTVA 3CENA 3ZZ6A 1ESBA 3F1SB 2NU3E 2FPZA 4VGCB 1HNEE 3TNSA 1MKWK 1BBRK 2TBSA 4UFFH 2OBQA 3A7ZA 3MNBA 1E37B 4ABFA 2ZGCA 2BDYA 4ABEA 3MWIU 2PSYA 4ABIA 3KQEA 1H8DH 3TIUA 2JH0D 1LO6A 4HFPB 2FI3E 1QL9A 1O2UA 1K1OA 1PPHE 1QA7A 1LHCH 2XYAA 1PYTD 3PLBA 2BDBA 3VXFH 2H9EH 1DXPA 5L2YH 3M3VA 1LTOA 2QA9E 2NU4E 4TPIZ 2Y7ZA 1GMCF 2CF9H 3SU3A 1IQIA 2EI6A 2QYIA 2VU8E 2A31A 4KGAA 5L2ZH 1NC6A 1JMOH 5DP9A 1PPZA 1O3BA 3T28A 1GI8B 2FO9A 3TK9A 1NZQH 5C1XA 4FXGH 3LU9B 1C2DA 3LGYA 1E34B 2CGAA 3RXHA 1NRNH 5LGOA 2BDCA 1D3PB 3SNDA 1F2SE 4CHAC 2ZU1A 3UPEA 2BOKA 1NU7B 1BTWA 2FXRA 1J17T 5BRRE 5EPNA 2Z9IA 1UTJA 1TNHA 5DP5A 1MMJN 4DIHH 1QGFA 3QZRA 2H9TH 1LVYA 1TOCB 2P3FH 2GT7A 3BG8A 1YCPH 1OX1A 2ANYA 3EA7A 5A0AE 2BD7A 3MU5A 3MOCA 1SBWA 1W13U 4CH8B 1OWEA 3AW0A 3ZZ4A 4A1VA 1QCPA 4AFQA 5T6FA 3RC4A 4UEHH 5HM2A 1MTNB 1UCYE 2FX6A 4KELA 1AQ7A 1D3TB 5C67A 4WF8A 3UQVA 1C2HA 2Z3CA 4A1TA 4Y8XA 3OY6U 3UUZA 1SQTA 3KL6A 1T8OA 1MTWA 1TNLA 3RU4E 4NSVA 2ANKH 4K60A 1PYTC 4MLFB 1FQ3A 1YPEH 1HAZB 1P2NA 1B0EA 1DANH 3A7VA 2VJ1A 2ZDAH 3GCHC 2FOFA 2O8TA 1RIWB 1BZXE 1NS3A 2P94A 2VIPA 5HMAA 1EATA 2OQUA 1WAYB 3EQ0H 1CU1A 1RGQA 2D26C 1J16A 1Z1IA 3A7WA 3LIWA 4ZHLU 1AO5A 1ETTH 1GHWH 5I25A 4ABAA 1TPSA 3NKKA 1EPTA 1BJVA 4WMFA 3K65B 3A84A 4DJZB 1O2WA 1FNIA 2G8TA 1YLDA 1O35A 1C2FA 1S84A 2CF8H 1CQQA 2P3UB 3QWCH 3QGJA 1RS0A 1EZXC 2ANMH 1T31A 1KXFA 3U9AH 1HPGA 2OCVB 2C8WB 4ZKOU 1ZR0A 2OC0A 2R9PA 4HGCA 3BTQE 4OS1A 2ZDLA 1LPGB 1H9IE 1MUEB 3U8TH 1Y59T 4Z0KA 1O30A 4X1RU 1YM0A 5DP4A 2FS8A 3K6ZA 3ODFA 2GCTC 2ZZUH 5JBTA 1O5EH 1W11U 1ZPBA 4U30A 4AFSA 4WMDA 1ELAA 2YNAA 2P95A 2FODA 1JWTA 1CBWC 3SUGA 1GVLA 2NU2E 1ARCA 1HBTH 4X8TH 1PQ8A 1GI2A 3ZV8A 3SO3A 3SJKA 1ELVA 4CHAB 4Z6AH 3EDXB 1WQVH 4I8GA 1C5QA 1C1VH 3BTGE 1IQHA 2NU1E 1O3LA 1HAVB 3HGNA 3SU5A 1HV7A 4WH6A 1G9IE 1XKBC 1AN1E 5SGAE 1GBAA 1Q3XA 4I8JA 1XUHA 2FS9A 1UTLM 1ZMNA 1Z6JH 1A7SA 3ODDA 1FAXA 4DG4A 1QJ1B 3O8CA 2A32A 1P9UA 4IMQA 2XTTB 2KAIB 3RXSA 1XX9A 2VGCC 2YNBA 2D1JA 3PTNA 2STAE 4WH8A 4FUJA 5HXFA 5FAHA 2FTLE 1DLKB 2G4UA 5DKMA 4ISLA 3O8BA 3SU1A 3LGVA 1GBCA 3MH4A 3SI3H 1UVTH 4YM9A 3R0FA 4RN6A 4CRFA 5A2MH 2XCFA 3GCTG 4O97A 3RP2A 1LHEH 4ZXXH 9LPRA 1WOFA 5FX6A 2FZZA 1IOEA 2H5CA 4DVAU 1TBZH 3SV6A 1BHXB 1C1SA 3LGTA 2H2ZA 1LVMA 3BIUH 2XXLA 1AFQB 3KQBA 2SNWA 5DK1A 3EA9A 3PYHA 4CRDA 2ILNA 1FV9A 4AB8A 4DIIH 1EQ9A 1QQUA 2PTCE 3TH3H 3KQCA 1AFEH 1AI8H 1UHBA 2ZDNA 1AE5A 2OBOA 4A1XA 1BQYA 1QNJA 3LC5A 3GICB 5FPTA 2HALA 3CS7A 1D3QB 3M7TA 3L3TA 1TNJA 1BA8B 2WPHS 4LXBH 5AF9H 3N7OA 5FPSA 2I6SA 4Q7XA 2A7CA 4YOGA 4Y0YE 4TY7A 2W26A 3I78A 4GUXA 5ESTE 1ELTA 4U2WA 3KF2A 1OP0A 2PKAB 6GCHF 1GI0A 4B2CA 4Q7ZA 1S82A 4Y7BA 1O3KA 1ZPZA 1E0FD 1C5RA 3STIA 4CRCA 2FOHA 2UUFB 3RM0H 5A8ZA 3E0NB 4XFQA 1O3FA 2XBXA 3A81A 3AASA 1A3BH 2GV7A 1P3EA 2ZTZA 1A0JA 3NCLA 2VVVA 1Z8RA 4E05H 2A7HA 1YLCA 3M61U 4IGDA 5DPAA 1NTPA 5FCKA 4ZROA 1MTUA 5LPRA 2ZDMA 3MH5A 1N8OB 1KSNA 1GMHF 6CHAB 2O9QA 3OSYA 1C4Y2 2OC1A 1LKAA 4B74A 1Z1JA 3A86A 4O03A 4UONA 1GI6A 1F5RA 3RXRA 2AMDA 1MU8B 2FOAA 4BAMB 1P10A 1BB0B 2NU0E 2D8WA 2XC0A 1P2MA 1S6HA 2VIVA 1GL1A 1C1PA 1XKAC 3QUMP 3UR9A 2GD4B 2O8MA 4BXWA 4BAOB 5L30H 2Y7XA 3BTFE 1HXEH 1O3EA 3TGIE 3TJUA 3ATLA 4GAWA 1DVAH 1GCDA 1JIRA 1TRMA 1O2TA 3FZDA 5CHAC 3RXVA 1A2CH 2Z3DA 3UOPA 1OWHA 1H8IH 1NRRH 3B8JA 4IMZA 4WWYA 1C1MA 4ASHA 2ZHEH 1OWKA 2ZCHP 3RC6A 1XXDA 1SPJA 1A5IA 1T7CA 4RSPA 1K9OE 1LHDH 3MYWA 1QRZA 3TJVA 1MBMA 3MHWU 3VEQB 4ABBA 1GWAA 1HJAB 1FY8E 5C2ZA 1G3EA 4Y79A 1VJAU 2HVXA 4MNYA 4CR5A 2Y81A 7LPRA 3K6YA 1EAUA 2FYRA 2ZQ2A 1GI3A 1AVXA 1UO6A 2LPRA 2BXTH 1KXEA 1C5VA 2VH6A 5GWZA 3TVJB 1O3NA 3T29A 2PKSB 1WSSH 3DFJA 4CREA 1P01A 1CO7E 3GDSA 1ZHRA 3E90B 3NXPA 2SFAA 1GBLA 4B73A 3RXQA 1TB6H 2J2UA 1G30B 4HZHA 3BEIB 1V2OT 1IQFA 1QFKH 1G32B 1L1NA 5F8TA 2WV5A 1UK2A 1VR1H 1HAVA 4HI3A 2A5KA 1EOLA 5ETXA 3RLYH 4X6PA 4FUBA 1BRBE 1PJPA 3BTDE 5L6NH 1IQGA 1NROH 1PFXC 1K1LA 3SU2A 1SGFG 1MZDA 4NG9H 1EASA 2A5IA 1L1JA 4OS5A 3RMLH 1YPHE 3PWBA 1L1GA 2FOCA 1UTMA 3VPKA 1SG8B 1BTHH 2BQWB 5JBBS 1YKTA 1L4DA 1O3DA 3LGIA 5BPEA 1ELCA 3SZNA 3ATMA 1GCTC 3MO6A 3Q3KA 2W7UA 3P6ZB 1CGJE 3F9GA 3FFGA 2WPIS 1QL8A 3EA8A 5FBIA 3RXFA 5A0BA 2ALVA 3IWMA 4GCHG 3MFJA 4MVNA 1BMAA 1UVSH 3BSQA 3WY8A 3M36A 3OY5U 3H7OA 4ZHMU 1HAGE 1YPMH 1MTNC 2PGQB 1W0ZU 1ELFA 3PMHB 4LZ4B 4H6TA 4UFGH 4XSKU 1HIAA 4Y71A 1GJCB 1O3CA 1P2QA 4GHQA 1SFIA 1GBBA 1W12U 1CSOE 5A8XA 1ZSJA 2XNIA 3MNCA 2PKSC 2ZFSA 1FY3A 1AWFH 1ARBA 1DDJA 1DE7H 1SGYE 3E91A 1TIOA 4K5ZA 1GBKA 4JMYA 2TGPZ 1UTOA 1CVWH 1V2JT 1NFWA 2ZDVH 2G81E 2FWWA 1QBVH 2H5DA 4KTSA 5A0CA 2AERH 1UTQA 1LMWB 4I8LA 3TITA 2FOMB 3LC3A 2XC4A 1GMHG 3TLOA 1SQAA 3MH6A 4B1TA 4X1PU 1FUJA 2TGDA 2Z9JA 2WPMS 1FLEE 1TGBA 1XVOA 3PB1E 2B9LA 1HGTH 3SN8A 2XBYA 3ENSB 3C27B 2BQ6B 2FX4A 3A8DA 1Y5AT 2AMPA 1QA0A 5EXNA 4FUCA 1OYTH 1V2KT 1K1PA 4IC5A 1AZ8A 3GY2A 5K7RA 1QBNA 3LJOA 5CHAB 2ZCKP 2GZ9A 3UNQA 2R3YA 2VNTA 5I46H 1RXPA 3BTHE 3O8DA 5JBCS 1A3EH 2FP7B 5EQRA 1Y3UA 4SGBE 2FTMA 2OLGA 1NFUA 4MNVA 1KIGH 2F9PA 2W3KA 1TAWA 1ANCA 1DX5M 2ZI2H 2CJIA 5AVDA 2ZQ1A 4E7RG 5C20A 3P8GA 1GJ8B 3B9FH 1UCYH 1UTKA 3SHAH 1W2KH 1GJ5H 1W10U 4X0WU 3M3TA 4JYVH 1BUIA 3Q76A 1W8BH 2G00A 1V2UT 3C1KA 2WPJS 4ABHA 3RXJA 1BMMH 1NY22 2UWPA 3MTYA 1NESE 1CGIE 1AMHA 4NA7A 3SNCA 4VGCC 1V2NT 1MAXA 1JRSA 1OXGA 3TNTA 3UIRA 1S5SA 1PQ7A 1OWIA 4X8VH 4O3UA 1FJSA 1GPZA 1V2LT 3GOVB 3NUMA 4DOQA 4RKOB 3B23B 1FY1A 1WBGB 1P03A 1ZJKA 2AS9A 3AAVA 2O8LA 1HYLA 2XWBI 1ELEE 3SHCH 2J94A 1EUFA 1V2MT 4THNH 3SV2H 3MH7A 1AVGH 2TGAA 1QQ4A 2ULLA 1GMCG 3SW2B 2WINI 2P59A 1O2ZA 4WMEA 1MQ5A 1BTYA 8GCHG 1AUTC 2AYWA 1NO9H 1RTKA 2BD5A 2ZGBH 2A2QH 1C5SA 2QXGA 1PPBH 2JH5D 1F5KU 1C1OA 2BYAX 2OXSA 5JYIA 2F83A 1EZUC 3M5MA 1TX7A 2BY5X 2CHAC 2F9VA 3LH1A 1KXDA 1QIXB 1FXYA 1V3XA 4NIYA 1HJ8A 2JETB 1G2LA 5H4IB 1BRCE 1EKBB 2RCEA 4HTCH 4KTCA 3I77A 1F0UA 1O2OA 3K2UA 1TBQH 3ZYDA 2J38A 3IITA 4GCHF 1K1IA 4WXIA 3CP7A 3QLPH 1M9UA 4YLQH 1S0QA 2AGGX 4D7GA 1SGFA 1HAOH 3PLKA 1LKBA 8LPRA 3BG4C 4JYTA 1P2OA 1O2RA 1C5MD 3P70B 1P12E 1MCVA 2C4FH 4CRAA 3KEEA 1HAIH 3QGNB 1L0ZA 2PWXA 1HJ9A 1TMBH 2R0KA 2BY6X 2P8OC 3E1XB 2PLXA 5EGMA 2AFQB 5T6DA 3Q77A 1ZMJA 2FI4E 3MU8A 5E2PA 3P17H 1QB1A 3NK8A 2ZNKH 4DGJA 4K8YA 2QF3A 2FI5E 3UNSA 3A89A 5F8XA 4FU9A 1BJUA 2GZ7A 1TBRH 1GG6C 3GY7A 5T3HA 2BDAA 1RJXB 4ABJA 2CN0H 4YOIA 1H4WA 2ZU2A 3RM2H 1T8NA 3GY6A 1UJ1A 3BIVH 1UCYK 2Z9KA 4KTUA 1L4ZA 1INCA 3OU0A 4X6MA 3SNAA 5E8EH 3Q00A 1TMUH 4BXSA 4NWKA 1GJ9B 3ZYEA 5EW1H 1O5AB 1C2MA 1ETRH 1O2PA 5JB9S 2ZKSA 3SUDA 1S85A 3URDA 2Y5GA 1JOUB 1C2LA 1OKXA 2GCTB 1F0RA 1CT4E 2AIQA 2IOTA 4AN7A 4BAKB 1Z7KA 1EZQA 1C1NA 3A8AA 3V3MA 4GPGA 1TX6A 3AW1A 2ZHDA 1AUJA 1O2XA 3F6UH 2XBWA 3MO9A 1C1UH 3RXKA 1DM4B 1OSSA 2XBVA 4K69A 1QB6A 3BTTE 3T62A 1F5LA 5HGGA 1GHVH 2ALPA 1SHYA 1A61H 3RXEA 1QRWA 2ZHWH 1OPHB 1Y8TA 1J15A 3ZVEA 1AZZA 3GDVA 3ZZDA 1HUTH 2PUXB 1HLTH 1LPKB 2R2MB 1HAHH 2DE8A 3ZZ5A 2HRVA 3RXPA 4D76A 2ZPQA 3GY3A 3RXIA 5DJ7A 1AU8A 2V3OH 1TALA 3RMMH 1BT7A 2C8YB 3SGBE 1O34A 1K1NA 1PPEE 4JZIA 5B6OA 1TYNA 2H6MA 4YT6H 3TU7H 1H9HE 4H4FA 1ZYOA 1QY6A 1CA0B 1DWDH 3S0NA 5A8YA 1CA8B 2TRMA 4J1YA 2J92A 1SGIB 2B7DH 3SJOA 1GJDB 6GCHG 4O3TA 1LVBA 1C2KA 4TWYA 2NWNA 1MBQA 2SGDE 3TPIZ 1XUJA 2BY8X 1AHTH 3UWJH 3BEUA 3V0XA 3STJA 1O3PB 2J95A 1TLDA 1RIWC 1OP8A 1XM1A 3MO3A 1DICA 2FYQA 5FBEA 2GVFA 1SGEE 1KDQB 2CMYA 5JDUB 5DGJA 4NIXA 3F68H 2BY7X 1P11E 5EU8A 3T26A 1C2GA 3LDXH 2THFB 3M35A 1C5NH 1DT2A 3R3GB 5C3NA 2ZCLP 4JK6A 4BAHB 1G37A 2BD9A 2GDDA 3ZZBA 2C3SA 4UFEH 1T4VH 1J14A 1GMDG 1BHXF 1IQLA 3U1IB 4U32A 1YCPM 4BNRA 2QIQA 3PMBB 4D9RA 2ZG0H 3MI4A 2GMTC 1QL7A 2ZU3A 1SOZA 4XBDA 3ATWA 2HNTC 1XXFA 2A4OA 1P04A 4OS6A 1K28D 2TIOA 3O8RA 1GBEA 1G36A 1O2GH 4Q2KA 3PMJA 3Q3YA 3S69A 1VITH 2C90B 3BEFB 1ABJH 1EX3A 5EOKA 3SUFA 1GL0E 1O3HA 2F9OA 2C8XB 3D49H 2H1UA 3HATH 1BRUP 2IN2A 1T32A 1GVKB 1HJAC 1DUAA 3GCTF 1YCPK 3A7YA 4JZEH 1ETSH 1TABE 2Q6FA 3ATKA 3A82A 2LNCA 1O2IA 2EEKA 1O3OA 1GI4A 4O9VA 1EPTB 1BMNH 1GG6B 1LQEA 1T8MA 1UVUH 1CGHA 4R0IA 2VB0A 5EQQA 1NRQH 2K1QA 3SU6A 1CHGA 4K1SA 2ESTE 1YGCH 3HK6B 2GZ8A 2QCYA 2RG3A 2VWMA 1TGSZ 1V2VT 5HM9A 3GYMA 2ZHFH 3HGPA 3SU4A 4NZLA 1V2PT 1Y3XA 4M7GA 3PROA 4X2YA 4INLA 1KXBA 3L6PA 4LZ1H 2V35A 3SV9A 2XRCA 4IN2A 4GVUA 3SJ8A 3A83A 1VGCC 1BMLA 1O2NA 1UHBB 1MKWH 1O3GA 1BTXA 1CHOF 1N8OC 1SGPE 1AB9B 3SJIA 2HNTF 1FI8A 2BVRH 1NFYA 1O39A 1P9SA 5DP6A 4MTBA 1IQNA 2ZU5A 3HPTB 2ZC9H 1PQAA 4MNWA 2OINA 3VB7A 4ISNA 2BX4A 2UUYA 1O31A 1ABIH 3M7QA 3S7HB 1TPAE 1P3CA 1AGJA 4BOHA 2A7JA 3MU4A 1SI5H 2ZO3H 1C1QA 4GSOA 3A8CA 4IS5A 1U6QA 4DW2U 5EXLA 4F4OC 1EB1H 1QRXA 4YTAA 4E7NA 1A46H 1SGRE 1KYNA 4LK4A 1KXAA 1O5GH 1FMGA 1W7XH 3NWUA 3RC5A 1OOKB 1X7AC 4B71A 1A1RA 1B0FA 3T5FH 1XUGA 4Y10E 5AHGH 3MNSA 3T2NA 1ZRKA 3MMGA 3LJJA 4AGKA 2ANWA 1HAXB 3SV8A 2ZEBA 1IQEA 3DHKH 5T6GA 1PPFE 3M5LA 1VGCB 2P8OB 2AGEX 1WTGH 4JZDH 2G4TA 4WVPE 4JK5A 1TOMH 1GGDB 3L33A 4RKJB 1GGDC 1UK3A 1C5WB 3RXMA 2ASUB 3FP7E 5FPYA 5TCAA 2QV1A 2GDEH 3P92A 3SV7A 2OUAA 3GY8A 1GBTA 1VCPA 2FOEA 5TCCA 1SB1H 3VB5A 2PGBB 2PUQH 5A09A 3SUEA 2FOGA 2PHBA 4K2YA 3BV9B 1JIMA 3LOXA 1IAUA 2QXHA 2XCNA 1TPOA 1DFPA 1EJNA 4YLUA 2J4IA 1SVPA 3ZV9A 2R2WU 1BDAA 4ISOA 3S9BA 1S83A 1LPZB 1P02A 4F49A 1C9PA 4ZXYH 1TGTA 1DWCH 1VCWA 1N1LA 4OGXA 4FUIA 1FN6A 1S81A 3DT0H 2TPIZ 4QT8C 1IHTH 2HOBA 2OP9A 4ZMAH 4BTIB 2UWLA 1VITF 1S0RA 1P0SH 1Y3WA 1IQJA 3GCNA 2J34A 3HK3B 2A5AA 4AZ2B 1Y5BT 1GJBB 1GI9B 2VVUA 3QN7A 4ZUHA 3V13A 1HRTH 1GI1A 5AFZH 1AIXH 5JPMH 5LPEA 4A7IB 1A0HB 2ZGHA 3PV4A 2PSXA 2GMTB 6ESTA 2VIQA 3A87A 1ZGVA 2Y5HA 2GP9B 1LHGH 1SGQE 2EC9H 1GBJA 1B5GH 1TFXA 1FPCH 3PO1C 2WPKS 4IN1A 1SOTA 3UR6A 1C2IA 1MH0A 4K3JA 4D8NA 1IQKA 1HAYB 2A4QA 3FANA 1HDTH 1J9CH 3GY5A 2W7SA 1OP2A 2M5TA 4SGAE 4AX9H 3I29A 3KIDU 1A0LA 3ZZ9A 1P09A 1K1JA 1GI7B 2ZTXA 1GHBF 1E36B 1O2MA 4I7YH 3VB6A 2ZDKA 4BAQB 1FIWA 2EA3A 3A7XA 4H6SB 4NA8A 5GXPA 3RXDA 3A8BA 1NM6A 2QXJA 4FVDA 1MTSA 1WU1A 3SOSA 2BDHA 3T25A 1WV7H 1ID5H 4CRGA 2VH0A 1ZLRA 1D4PB 2BX3A 2ZGJA 1TRNA 1O32A 2CXVA 1ELBA 4WY3A 3VB3A 3DA9B 7GCHG 9ESTA 3U8RH 4GLYA 2FESH 2GTBA 4JZ1A 4TY6A 5FXLA 5DP3A 2VIOA 2SGQE 1UMAH 3NZIA 1O3JA 1JXPA 2Z94A 3GCOA 4KKDA 1GVZA 1Z8GA 4AYVB 1Q2WA 1TPPA 2WYJA 2BLVA 1C5XB 4OS2A 1HB0B 4FUEA 1LHFH 3RMOH 1P2JA 1DOJA 2G5NA 3LPRA 1F0SA 3H5CB 3VFEA 2UUJB 5GCHG 1EXFA 1QR3E 1QTFA 3SI4H 3LH3A 1D6WA 4K8BA 5IYTA 1GDQA 4CRBA 3BTWE 2ZF0H 3MNXA 2AH4X 2B0FA 4AORA 4Y0ZE 3JZ1B 4FUDA 5EQSA 1ZMLA 2GGVB 1KY9A 2BDIA 2BLOA 3OTJE 1ELDE 1YBWA 2BVXH 1EAXA 2IJOB 1N6YA 1A4WH 1KXCA 1UK4A 5C1UA 3W95A 1ZTLA 2BB4A 3U98H 2W5EA 2BLWA 3RXLA 3MU1A 4OGYA 5J4SA 1MD8A 1O3IA 4MPVA 3VB4A 1XUIA 3KQDA 3FP6E 1HXFH 2DUCA 3PTBA 1GJ6A 3QTVH 2ZHQH 4J2YB 1O36A 1BIOA 4CBOA 1V2TT 4AOQA 1DWEH 4Y7AA 4K1EA 4YESB 1WTHD 2GCHF 5HYOA 5FHTA 1G2MA 1AVWA 1CA0C 1O2SA 3A88A 1W14U 1GCTB 3F9EA 4FUHA 3UNRA 1NU9A 1AY6H 1Y5UT 3SNEA 2XWAA 5ABWA 4B76A 4Y8ZA 4CBNA 1KDQA 3QTOH 1C5PA 1SGDE 4X2VA 6LPRA 4ZKSU 2FEQH 4NSYA 1A5GH 1C4V2 2DE9A 2R3UA 3ZVBA 3D65E 3RDZA 2WUBA 2EI8A 3D62A 5G4BA 1YPKH 2XC5A 2BVSH 1W7GH 5EXMA 5EODA 1LDTT 1OWJA 1YPGH 2TGTA 3UWIA 1A5HA 1UVPA 1O0DH 2F91A 4XDEA 1EZSC 1SGNE 3IG6B 4BANB 4CR9A 4X2XA 4BTTB 5C1YA 3RXAA 3NPSA 1TGCA 4NWLA 1GHXH 1GHAF 4TWWA 2BD3A 1SL3A 1GJ4H 4FUFA 1C5TA 2FIRH 2ZFPH 4ZKNU 4MPWA 3SORA 2UUKB 3ZVGA 3V7TA 5F6MA 4YO9A 2ODYB 3P8FA 2XW9A 4X8UH 1THRH 3LKWA 1VZQH 3U1JB 1SLVB 4NIWA 1B7XB 1OWDA 3RMNH 3E0PB 3SQHE 1AD8H 1P8VC 3QK1A 4ZHAA 1PPCE 2G5VA 3DUXH 4I31A 2OD3B 2GT8A 1SMFE 1ZZZA 3RXOA 4X6NA 1MKXH 1VCQA 2P93A 3TH4H 3EGKH 4X6OA 4A6LA 1NRPH 1QBOA 5DP7A 3UTUH 3ZVDA 4AGJA 2ZFTA 2YOLA 3KHVA 3RXBA 4X1NU 2Y80A 1NRSH 2F9NA 1O2VA 3ZZ7A 4A5TS 1MU6B 1TQ0B 1DPOA 4DCDA 5CE1A 3KCGH 2ZPSA 2VINA 3MU0A 1C2JA 3U69H 1DSUA 1FDPA 3GY4A 5C5NA 1GBMA 2BZ6H 2ZA5A 1EAWA 4YOJA 3RLWH 1O2LA 1O3AA 2I6QA 3ZZ3A 1OS8A 1SR5C 1TA6A 3S9AA 2FOBA 4LOYH 2FM2A 4H42U 2F3CE 4NIVA 1Z71A 1O37A 5EPYA 1TA2A 2QY0B 3CS0A 3OYPA 3PM3A 4JZFH 2H9HA 2Y82A 1E38B 3UREA 1BBRH 8GCHF 4BTUB 2HLCA 1ESAA 1MKXK 2VIWA 3V12A 1Z6EA 3RUOA 2ZGXH 4B75A 2ZU4A 1GMDF 5E0HA 2ODQA 1HFDA 2ZFQH 4U01A 1O5FH 1ZGIA 3KGPA 4OS7A 4FUGA 1EAIA 1SGCA 2BHGA 3DFLA 3VXEH 2FMJA 1PPGE 3FZZA 4Y8YA 2AMQA 2CHAB 5DP8A 2BLQA 1DY8A 5E0JA 2J9NA 3TK6A 3BTEE 2BMGB 5GPIB 2O8WA 2UWOA 3BN9A 5EW2H 2ZIQH 1TONA 4DURA 1ANEA 4TYDA 1TX8A 2W3IA 3GDUA 2RA3A 3P8NA 4WJG2 1HAPH 1T4UH 4WXVA 4YT7H 1E35B 1ANDA 1UTPA 1QHRB 3KNXA 3PWCA 3RXUA 1IQMA 3BTME 1PQ5A 1XMNB 2ZPRA 3ELAH 2A2XH 4MNXA 1Z8IB 2C8ZB 1MCTA 1ZHMA 4MDSA 1BTPA 4Y76A 1K1MA 4AG2A 1O5CB 2BZAA 4DY7B 1G3BA 2A45B 3TGJE 4DT7B 2PKAA 4K1TA 2VWOA 4ISHH 3A7TA 2QXIA 2WPLS 1DY9A 2A1DB 2G55A 1F92A 3EYDA 4MQAA 1N6XA 1O2QA 2ZP0H 2EI7A 1YPHC 1C5OH 1QB9A 3PLPA 1YP9A 4X1SU 1BTZA 1V2QT 5F8ZA 1FONA 2OC8A 1CHOG 4X1QU 5GCHF 1ANBA 1D6RA 4UE7H 1SHHB 1GJAB 8KME2 5CMXH 5K0HA 3LT3A 3P95A 2GKVE 2PTNA 1CT0E 1O5BB 2ZTYA 1WUNH 3QZQA 3SQEE 4ISIH 1S6FA 3P8OA 1H1BA 1QJ6B 1V2RT 1SLXB 1KLJH 3U8OH 3FAOA 4JYUH 1BRAA 5FCRA 2IPHA 2QF0A 1YYY1 5LPFA 1FY5A 1EPTC 1GI5A 2BM2A 3ATIA 2BQ7B 2SNVA 3URCA 4I32A 2VGCB 1CE5A 3RU4T 1MAYA 1AWHB 1GHAG 1L2EA 3SNBA 1NPMA 2SGEE 1P05A 3FP8E 1ZHPA 1MQ6A 4XBBA 3S9CA 2QAAA 4E06H 1FPHH 1GHYH 2P16A 2PR3A 1O2YA 3PMAB 1KTSB 1P2IA 1EJAA 1XUKA 4I33A 4TPYA 3TJOA 1GHZA 1D9IA 4XOJA 4AG1A 2STBE 1WCZA 8ESTE 1TNGA 3A80A 2Z7FE 1YF4A 3VGCC 1O2KA 3ESTA 1F0TA 4UD9H 1HIAB 1QURH 4Q80A 1KLTA 1WQSA 2G52A 4INHA 1ZPCA 1CBWB 2A4GA 3Q3XA 1GDNA 1K2I1 2GV6A 5GDSH 5GJ4B 1TQ7B 4IW4E 2Z6BD 4XE4A 1EJMA 3M5NA 2HPPH 5J4QA 1SQOA 2BD4A 1ESTA 5JB8S 1V2WT 3GYLB 4UFDH 1ORFA 3SJ9A 2KAIA 1C9TA 2P3TB 3M3SA 1RD3B 4AFZA 1OYQA 1Y3YA 4NA9H 1FN8A 3RXTA 2C93B 1FIZA 1EOJA 1TNIA 3LGWA 4D9QA 2Q6DA 2V0BA 1NT1A 2V3HH 4GHTA 2BXUH 2SGAA 1RRKA 1FY4A 3ITIA 2WYGA 4NFEA 3ZVAA 1V2ST 2B5TB 1XVMA 3JZ2B 4X2WA 7ESTE 2F9UA 1BCUH 3F9HA 3SGAE 2PV9B 1MZAA 3RU4D 4B2BA 1C2EA 1TRYA 4Y11E 2Z9LA 1C1TA 5F03A 2JKHA 3W94A 2G51A 4IC6A 3FVFB 1TMTH 1G3DA 3HKIB 1THPB 2HWLB 3VGCB 2AIPA 4PROA 3QDZB 2Z9GA 1P2KA 1ZJDA 3E3TA 3M5OA 4Y6DA 2BD8A 5AFYH 1O2HA 1ACBE 1KTTB 3GCHB 2RDLA 2WV4A 1F7ZA 4ABDA 1CT2E 7GCHF 3ZVFA 2GCHG 3AVZA 3D23A 3GISB 2VWLA 3BF6H 4IBLH 3UQOA 1ELGA 1LVOA 1ZTKA 1C4U2 2HNTE 1MD7A 3DD2H 4X8SH 2V6NA 2WUCA 2BY9X 5GIBA 3UFAA 3TJNA 2A0QB 1C5ZB 3LGUA 1SSXA 2QGRA 3M37A 2VVCA 2B8OH 4NGAH 3RXCA 3SU0A 4MG3A 4NFFA 4AFUA 3BTKE 3PO1B 1VJ9U 3AAUA 1C5LH 1GBIA 2Q1JA 3ZZAA 1C5YB 1FAKH 2RA0A 2ZFFH 5JBAS 2ZFRH 1O2JA 1THSH 3ZVCA 1LCYA 2OQ5A 3E16B 1TGNA 1O5DH 1GJ7B 1YC0A 5IDKA 3G01A 1AKSB 3HKJB 1C1RA 1MTVA 1H9LB 1P57B 4FVBA 2A4RA 4XBCA 4OS4A 1TE0A 1UTNA 5E0GA 2PFEA 4INKA 3T27A 3TH2H 1EB2A 3M7UA 5LH8A 5C5OA 2QN5T 1JBUH 2ODPA 4ABGA 2BOHB 3UY9A 2PW8H 1EP5A 2SGFE 4CH2B 5PTPA 4YZUA 1C1WH 1DXWA 1HCGA 2JH6D 4NCYA 3S7KB 1DWBH 4ZH8A 2Q6GA 1GBDA 1Z8JB 1DS2E
chains in the Genus database with same CATH superfamily
2SGPE 1EP6A 2D2DA 1SLWB 1P06A 1RFNA 3QX5H 4MPUA 4JCNA 5DG6A 3OX7U 1VITG 2F9BH 2BTCE 3OE7D 1BITA 1SFQB 5E2OA 4ZCNA 1GBFA 2VIDA 1LQDB 5FX5A 1G3CA 1O38A 3KQ5A 4FU7A 3K9XB 3EE0B 1ZSKA 1AFQC 1IHSH 4I8KA 3ZZ8A 3DSOA 3EAJA 2HPQH 4P02A 1XUFA 7KMEH 1ZOMA 1SC8U 1O3MA 1ZRBA 2Y5FA 3TK5A 1O33A 3SGQE 3A85A 3BG4B 4FOUC 4RI0A 1J8AA 2AGIX 3E6PH 1SGTA 1W0YH 2GX4A 6CHAC 5KEDA 4Q7YA 1BBRE 2ZECA 2Z3EA 1GBHA 1TNKA 1JRTA 4KP0A 4B2AA 3F9FA 1DITH 1YPJH 4D7FA 1V6DA 2O8UA 4ZKRU 1K22H 3QO6A 2JETC 1C5UA 1H8HD 3E8LA 2CV3A 4I8HA 1RTFB 1K21H 3TGKE 1UVOA 1WYKA 5DO4H 1T8LA 4I86A 2FLRH 4MPXA 3RXGA 2R0LA 5TJXA 1NFXA 2QC2A 3UOUA 2VWNA 1DUEA 2JJ2D 4AYYB 3KN2A 1TWXB 1DLEA 2FLBH 3LONA 1AKSA 1FZZA 1Y3VA 4FU8A 2OC7A 1DSTA 5EIYA 1NN6A 1YPLH 5EG4A 1Q31A 1GDUA 1D3DB 3H7TA 2AEIH 3ZZCA 2FDAA 4ZAEA 1ZTJA 1QJ7B 1W3CA 2BD2A 1KLIH 1BOQA 2KCAA 1ZSLA 1AB9C 1RTLA 1W0KD 4ESTE 1BTUA 3SBKA 2BDGA 4NZQA 2Y6TA 2ZWLH 2K8IA 1GHBG 4R8TB 5ESBA 2HGTH 4AB9A 4A92A 1SLUB 4UDWH 1AE8H 2OTVA 3CENA 3ZZ6A 1ESBA 3F1SB 2NU3E 2FPZA 4VGCB 1HNEE 2AHME 3TNSA 1MKWK 3PRDA 1BBRK 2TBSA 4UFFH 2OBQA 3A7ZA 3MNBA 1E37B 4ABFA 4YXWD 2ZGCA 2BDYA 4ABEA 3MWIU 2PSYA 3ZIAD 1WXRA 4ABIA 5DSFA 3KQEA 1H8DH 3TIUA 2JH0D 1LO6A 4HFPB 2FI3E 1QL9A 1O2UA 1K1OA 1PPHE 1QA7A 4RT0A 1LHCH 2XYAA 1PYTD 3PLBA 2BDBA 3VXFH 2H9EH 1DXPA 5L2YH 1YLNA 3M3VA 1LTOA 2QA9E 2NU4E 4TPIZ 2Y7ZA 2J97A 1GMCF 2CF9H 3SU3A 1IQIA 2EI6A 2QYIA 2VU8E 2V3MA 2A31A 4KGAA 5L2ZH 1NC6A 1JMOH 5DP9A 1PPZA 1O3BA 3T28A 1GI8B 2FO9A 3TK9A 1NZQH 5C1XA 4FXGH 3LU9B 1C2DA 3LGYA 1E34B 2CGAA 3RXHA 1NRNH 5LGOA 2BDCA 1D3PB 3SNDA 1F2SE 4CHAC 2ZU1A 3UPEA 2BOKA 1NU7B 1BTWA 2FXRA 2W6ID 1J17T 5BRRE 5EPNA 2Z9IA 1UTJA 1TNHA 5DP5A 1MMJN 4DIHH 1QGFA 3QZRA 2H9TH 1LVYA 1TOCB 2P3FH 2GT7A 3BG8A 1YCPH 1OX1A 2ANYA 3EA7A 5A0AE 2BD7A 3MU5A 3MOCA 1SBWA 3FN8A 1W13U 4CH8B 1OWEA 3AW0A 3ZZ4A 4A1VA 1QCPA 4AFQA 5T6FA 3RC4A 4UEHH 5HM2A 1MTNB 1UCYE 2FX6A 4KELA 1AQ7A 1D3TB 1EFRD 5C67A 4WF8A 3UQVA 1C2HA 2Z3CA 4A1TA 4Y8XA 3OY6U 3UUZA 1SQTA 3KL6A 2YMSD 1T8OA 1MTWA 1TNLA 3RU4E 4NSVA 2ANKH 4K60A 1PYTC 4MLFB 1FQ3A 1YPEH 1HAZB 1P2NA 1B0EA 1DANH 3A7VA 2VJ1A 2ZDAH 3GCHC 2FOFA 2O8TA 1RIWB 1BZXE 1NS3A 2P94A 2VIPA 5HMAA 3H09A 1EATA 2OQUA 1WAYB 3EQ0H 1CU1A 1RGQA 2D26C 1J16A 1Z1IA 3A7WA 3LIWA 4ZHLU 1AO5A 1ETTH 1GHWH 5I25A 4ABAA 1TPSA 3NKKA 1EPTA 1BJVA 4WMFA 3K65B 3A84A 4DJZB 1O2WA 1FNIA 2G8TA 1YLDA 1O35A 1C2FA 1S84A 4ASUD 2KFWA 2CF8H 1CQQA 2P3UB 3QWCH 3QGJA 1RS0A 1EZXC 2ANMH 1T31A 1KXFA 3U9AH 2WHXA 4F48B 5EJ1A 1HPGA 2OCVB 2C8WB 4ZKOU 1ZR0A 2OC0A 2R9PA 4HGCA 3BTQE 4OS1A 2ZDLA 1LPGB 1H9IE 1MUEB 3U8TH 1Y59T 4Z0KA 1O30A 4X1RU 1YM0A 5DP4A 2FS8A 3K6ZA 3ODFA 2GCTC 2ZZUH 5JBTA 1O5EH 1W11U 1ZPBA 4U30A 4AFSA 4WMDA 1ELAA 2YNAA 2P95A 2YMSC 2FODA 1JWTA 1CBWC 3SUGA 3DCLA 1GVLA 2NU2E 1ARCA 1HBTH 4X8TH 1PQ8A 1GI2A 3ZV8A 3SO3A 3SJKA 3U28C 1ELVA 4CHAB 4Z6AH 3EDXB 1WQVH 4I8GA 5C0TA 1C5QA 1C1VH 3BTGE 1IQHA 2NU1E 1O3LA 1HAVB 3HGNA 3SU5A 1HV7A 4WH6A 1G9IE 1XKBC 1AN1E 5SGAE 1GBAA 1Q3XA 4I8JA 1XUHA 2FS9A 1UTLM 1ZMNA 1Z6JH 1A7SA 3ODDA 1FAXA 4DG4A 1QJ1B 3O8CA 2A32A 1P9UA 4IMQA 2XTTB 2KAIB 3RXSA 1XX9A 2VGCC 2YNBA 2D1JA 3PTNA 2STAE 4WH8A 4FUJA 5HXFA 5FAHA 2FTLE 1DLKB 2G4UA 5DKMA 2KZ4A 4ISLA 3O8BA 3SU1A 3LGVA 1GBCA 3MH4A 3SI3H 1UVTH 4YM9A 1NBMD 3R0FA 4RN6A 4CRFA 5A2MH 2XCFA 3GCTG 4O97A 3RP2A 1LHEH 4ZXXH 9LPRA 1WOFA 5FX6A 2FZZA 1IOEA 2H5CA 4DVAU 1TBZH 3N7DA 3SV6A 1BHXB 1C1SA 3LGTA 2H2ZA 1LVMA 3BIUH 2XXLA 1AFQB 3KQBA 2SNWA 5DK1A 3EA9A 3PYHA 4HG6A 4CRDA 2ILNA 1FV9A 4AB8A 4DIIH 1EQ9A 1QQUA 2PTCE 3TH3H 3KQCA 1AFEH 1AI8H 1UHBA 2ZDNA 1AE5A 2OBOA 4A1XA 1BQYA 1QNJA 3LC5A 3GICB 5FPTA 2KCOA 2HALA 3CS7A 1D3QB 3M7TA 3L3TA 1TNJA 1BA8B 2WPHS 4LXBH 5AF9H 3N7OA 5FPSA 2I6SA 4Q7XA 2A7CA 4YOGA 4Y0YE 4TY7A 2W26A 3I78A 4M9FA 4GUXA 5ESTE 1ELTA 4U2WA 3KF2A 2PP6A 1OP0A 2PKAB 6GCHF 1GI0A 4B2CA 4Q7ZA 1S82A 2KM0A 4Y7BA 1O3KA 1ZPZA 1E0FD 1C5RA 3STIA 4CRCA 2FOHA 3F3BA 2UUFB 3RM0H 5A8ZA 3E0NB 4XFQA 1O3FA 2XBXA 3A81A 3AASA 1A3BH 2GV7A 1P3EA 2ZTZA 1A0JA 3NCLA 2VVVA 5CHBA 1Z8RA 4E05H 2A7HA 1YLCA 3M61U 3OTPA 4IGDA 5DPAA 1NTPA 5FCKA 4ZROA 2F4LA 1MTUA 5LPRA 2ZDMA 3MH5A 5C17A 1N8OB 1KSNA 1GMHF 6CHAB 2O9QA 3OSYA 1C4Y2 2OC1A 1LKAA 1K0HA 4B74A 1Z1JA 3A86A 4O03A 4UONA 1GI6A 1F5RA 3RXRA 2AMDA 1MU8B 2FOAA 4BAMB 1P10A 1BB0B 2NU0E 4ACAA 2D8WA 2XC0A 1P2MA 1S6HA 2VIVA 1GL1A 1C1PA 1XKAC 3QUMP 3UR9A 2GD4B 2O8MA 4BXWA 4BAOB 5L30H 2Y7XA 3BTFE 1HXEH 1O3EA 3TGIE 3TJUA 1FX0B 2JJ1D 3ATLA 4GAWA 1DVAH 1GCDA 1JIRA 1TRMA 1O2TA 3FZDA 5CHAC 3RXVA 5HIZA 1A2CH 2Z3DA 1KMHB 2VBCA 3UOPA 1OWHA 5FL7D 1H8IH 1NRRH 3B8JA 4IMZA 4WWYA 1C1MA 4ASHA 2ZHEH 1OWKA 2ZCHP 3RC6A 1XXDA 1SPJA 1A5IA 1T7CA 4RSPA 1K9OE 3OAAD 1LHDH 3MYWA 1QRZA 3TJVA 1MBMA 3MHWU 3VEQB 4ABBA 1GWAA 1HJAB 1FY8E 5C2ZA 1G3EA 4Y79A 1VJAU 2HVXA 4MNYA 4CR5A 2Y81A 7LPRA 1E79D 3K6YA 1EAUA 2FYRA 2ZQ2A 1GI3A 1AVXA 5C94A 2WZQA 1UO6A 3AK5A 2LPRA 2BXTH 1KXEA 1C5VA 2VH6A 5GWZA 3TVJB 1O3NA 3T29A 2PKSB 1WSSH 3DFJA 4CREA 1P01A 1CO7E 3GDSA 1ZHRA 3E90B 3NXPA 2SFAA 1GBLA 4B73A 3RXQA 1TB6H 2J2UA 1G30B 4DT4A 4HZHA 3BEIB 1V2OT 1IQFA 1QFKH 1G32B 1L1NA 5F8TA 2WV5A 1UK2A 2F43B 1VR1H 1HAVA 4HI3A 2A5KA 1EOLA 5ETXA 3RLYH 4X6PA 4FUBA 1BRBE 1PJPA 3BTDE 5L6NH 1IQGA 1NROH 1PFXC 1K1LA 3SU2A 1SGFG 1MZDA 4NG9H 1EASA 2A5IA 1L1JA 4OS5A 3RMLH 1YPHE 3PWBA 1L1GA 2FOCA 1UTMA 3VPKA 1SG8B 1BTHH 2BQWB 5JBBS 1YKTA 1L4DA 1O3DA 3LGIA 5BPEA 1ELCA 3SZNA 2RFKC 3ATMA 1GCTC 3MO6A 3Q3KA 2W7UA 3P6ZB 1CGJE 3F9GA 3FFGA 2WPIS 1QL8A 3EA8A 5FBIA 5HIYA 3RXFA 5A0BA 3KYGA 2ALVA 2QF5A 3IWMA 4GCHG 2WV9A 3MFJA 4MVNA 1BMAA 1UVSH 3BSQA 3WY8A 3M36A 3OY5U 3H7OA 4ZHMU 1HAGE 1YPMH 1W0JD 1MTNC 2PGQB 4AC9A 1W0ZU 1ELFA 3PMHB 4LZ4B 4H6TA 4UFGH 4XSKU 1HIAA 4Y71A 1GJCB 1O3CA 1P2QA 4GHQA 1SFIA 1GBBA 1W12U 1CSOE 5A8XA 1ZSJA 2XNIA 3MNCA 2PKSC 2ZFSA 3CNRA 1FY3A 1AWFH 1ARBA 1DDJA 1DE7H 1SGYE 3E91A 1TIOA 4K5ZA 1GBKA 4JMYA 2TGPZ 1UTOA 1CVWH 1V2JT 2KR7A 1NFWA 2ZDVH 2G81E 2FWWA 1QBVH 2H5DA 4KTSA 5A0CA 2AERH 1UTQA 1LMWB 4I8LA 3TITA 2FOMB 3LC3A 2XC4A 4RT1A 1GMHG 3TLOA 1SQAA 3MH6A 4B1TA 4X1PU 1FUJA 2TGDA 2Z9JA 2WPMS 1FLEE 1TGBA 1XVOA 3PB1E 2B9LA 1HGTH 3SN8A 2XBYA 3ENSB 3C27B 2BQ6B 2FX4A 3VG8A 3A8DA 1Y5AT 2AMPA 1QA0A 5EXNA 4FUCA 1OYTH 1V2KT 1K1PA 4IC5A 1AZ8A 3GY2A 5K7RA 1QBNA 3LJOA 5CHAB 2ZCKP 2GZ9A 3UNQA 2R3YA 2VNTA 5I46H 1RXPA 3BTHE 3O8DA 5JBCS 4B6EA 1A3EH 2FP7B 5GNDA 2KCPA 5EQRA 1Y3UA 4SGBE 2FTMA 2OLGA 1NFUA 4MNVA 1KIGH 2F9PA 2W3KA 1TAWA 1ANCA 1DX5M 2ZI2H 2CJIA 5AVDA 2LELA 2ZQ1A 4E7RG 5B6LA 3P8GA 5C20A 1GJ8B 3B9FH 1UCYH 1UTKA 3PV5A 3SHAH 1W2KH 1GJ5H 1W10U 4X0WU 3M3TA 4JYVH 1BUIA 3Q76A 1W8BH 2G00A 1V2UT 3C1KA 2WPJS 4ABHA 3RXJA 1BMMH 1NY22 5HKKD 2UWPA 3MTYA 1NESE 1CGIE 1AMHA 4NA7A 3SNCA 4VGCC 1V2NT 1MAXA 1JRSA 1OXGA 3TNTA 3UIRA 1S5SA 1PQ7A 1OWIA 4X8VH 1YY3A 4O3UA 1FJSA 1GPZA 1V2LT 3GOVB 3NUMA 4DOQA 4RKOB 3B23B 1FY1A 1WBGB 3WWFA 1P03A 1ZJKA 2AS9A 3AAVA 2O8LA 1HYLA 2XWBI 1ELEE 3SHCH 2J94A 1EUFA 2WPDD 1V2MT 4THNH 3SV2H 3MH7A 1AVGH 2TGAA 1QQ4A 2ULLA 1GMCG 3F0OA 3SW2B 2WINI 2J98A 2P59A 1O2ZA 3N99A 4WMEA 1MQ5A 1BTYA 3PRBA 1AUTC 2AYWA 8GCHG 1NO9H 1RTKA 2BD5A 2ZGBH 2A2QH 1C5SA 2QXGA 1PPBH 2JH5D 1F5KU 1C1OA 2BYAX 2OXSA 1OHHD 5JYIA 2F83A 1EZUC 3MQKC 3M5MA 1TX7A 2BY5X 2CHAC 2F9VA 3LH1A 1KXDA 1QIXB 1FXYA 1V3XA 4NIYA 1HJ8A 2JETB 1G2LA 5H4IB 1BRCE 1EKBB 2RCEA 4HTCH 4KTCA 3I77A 1F0UA 1O2OA 3K2UA 1TBQH 3ZYDA 2J38A 3IITA 4GCHF 1K1IA 4WXIA 3CP7A 3QLPH 1M9UA 4YLQH 1S0QA 2AGGX 4D7GA 1SGFA 1HAOH 3PLKA 1LKBA 3SZEA 8LPRA 3BG4C 4JYTA 1P2OA 1O2RA 1C5MD 3P70B 1P12E 1NBME 1MCVA 2C4FH 4CRAA 3KEEA 3F0PA 1HAIH 3QGNB 1L0ZA 2PWXA 1HJ9A 1TMBH 2R0KA 2BY6X 2P8OC 3E1XB 2PLXA 5EGMA 2AFQB 5T6DA 3Q77A 1ZMJA 2FI4E 3MU8A 5E2PA 3P17H 1QB1A 3NK8A 3FOAA 2ZNKH 4DGJA 4K8YA 2QF3A 2FI5E 3UNSA 3A89A 5F8XA 4FU9A 1BJUA 2GZ7A 1TBRH 1GG6C 3GY7A 5T3HA 2BDAA 1RJXB 4ABJA 2CN0H 4YOIA 1H4WA 2ZU2A 3RM2H 1T8NA 3GY6A 1UJ1A 3BIVH 1UCYK 2Z9KA 4KTUA 1L4ZA 1INCA 3OU0A 4X6MA 3SNAA 5E8EH 3Q00A 1TMUH 4BXSA 4NWKA 1GJ9B 3ZYEA 5EW1H 1O5AB 1C2MA 1ETRH 1O2PA 5JB9S 2ZKSA 3SUDA 1S85A 3URDA 2Y5GA 1JOUB 1C2LA 1OKXA 2GCTB 1F0RA 1CT4E 2AIQA 2IOTA 4AN7A 4BAKB 1Z7KA 1EZQA 1C1NA 3A8AA 3V3MA 3NRLA 4GPGA 1TX6A 3AW1A 2ZHDA 1AUJA 1O2XA 3F6UH 2XBWA 3MO9A 1WDIA 1C1UH 3RXKA 1DM4B 1OSSA 2XBVA 4K69A 2IPQX 2HLDD 1QB6A 3BTTE 3T62A 1F5LA 5HGGA 1GHVH 2ALPA 1SHYA 1A61H 3RXEA 1QRWA 2ZHWH 1OPHB 1Y8TA 1J15A 2KX4A 3ZVEA 1AZZA 3GDVA 3ZZDA 1HUTH 2PUXB 1HLTH 1LPKB 2R2MB 1HAHH 2DE8A 3ZZ5A 2HRVA 3RXPA 4D76A 2ZPQA 3GY3A 3RXIA 5DJ7A 1AU8A 2V3OH 1TALA 3RMMH 1BT7A 2C8YB 3SGBE 1O34A 1K1NA 1PPEE 4JZIA 5B6OA 1TYNA 2H6MA 4YT6H 3TU7H 5KGOA 1H9HE 4H4FA 1ZYOA 1QY6A 1CA0B 1DWDH 3S0NA 5A8YA 1CA8B 2TRMA 4J1YA 2J92A 1SGIB 2B7DH 3SJOA 1GJDB 6GCHG 4O3TA 1LVBA 1C2KA 4TWYA 2NWNA 1MBQA 2SGDE 3TPIZ 1XUJA 1E1RD 2BY8X 1AHTH 3UWJH 3BEUA 3V0XA 3STJA 1O3PB 2J95A 1TLDA 1RIWC 1OP8A 1XM1A 3MO3A 1DICA 2FYQA 5FBEA 2GVFA 1SGEE 1KDQB 2CMYA 5JDUB 5DGJA 4NIXA 3F68H 2BY7X 1P11E 5EU8A 3T26A 1C2GA 3LDXH 2THFB 3M35A 1C5NH 1DT2A 3R3GB 5C3NA 2ZCLP 4JK6A 2EY4C 2WSSD 4BAHB 3OFND 1G37A 2BD9A 2GDDA 3ZZBA 2C3SA 4UFEH 1T4VH 1J14A 1GMDG 1BHXF 1IQLA 3U1IB 4U32A 1YCPM 4BNRA 2QIQA 3PMBB 4D9RA 2ZG0H 3MI4A 2V7QD 3UAIC 2GMTC 1QL7A 2ZU3A 2XNDD 1SOZA 4XBDA 3ATWA 2HNTC 1XXFA 2A4OA 1P04A 4OS6A 4F55A 1K28D 4Q4LA 2TIOA 3O8RA 1GBEA 1G36A 1O2GH 4Q2KA 3PMJA 3Q3YA 3S69A 1VITH 2C90B 3BEFB 1ABJH 1EX3A 5EOKA 3SUFA 1GL0E 1O3HA 2F9OA 1S6LA 2C8XB 3D49H 2H1UA 3HATH 1BRUP 2IN2A 1T32A 1GVKB 1HJAC 1DUAA 3GCTF 1YCPK 3A7YA 4JZEH 1ETSH 1TABE 4FETA 2Q6FA 3ATKA 3A82A 2LNCA 1O2IA 2EEKA 1O3OA 1GI4A 4O9VA 1EPTB 1BMNH 1GG6B 1LQEA 1T8MA 1UVUH 1CGHA 4R0IA 2VB0A 5EQQA 1NRQH 2K1QA 3SU6A 1CHGA 3UB0A 4K1SA 2ESTE 1YGCH 2QE7D 3PV2A 3HK6B 2GZ8A 2QCYA 2RG3A 2VWMA 1TGSZ 1V2VT 5HM9A 3GYMA 2ZHFH 3HGPA 3SU4A 4NZLA 1V2PT 1Y3XA 4M7GA 3PROA 4X2YA 4INLA 3GS9A 1KXBA 3L6PA 4LZ1H 2V35A 3SV9A 2XRCA 4IN2A 4GVUA 3SJ8A 3A83A 1VGCC 1BMLA 3WW7A 1O2NA 1UHBB 1MKWH 1O3GA 1BTXA 1CHOF 1N8OC 3EE7A 1SGPE 1AB9B 3SJIA 2HNTF 1FI8A 2BVRH 1NFYA 1O39A 1P9SA 5CDFE 5DP6A 4MTBA 4OM9A 1IQNA 2ZU5A 3HPTB 2ZC9H 1PQAA 4MNWA 1BMFD 2OINA 3VB7A 4ISNA 2BX4A 2UUYA 1O31A 1ABIH 3M7QA 3S7HB 1TPAE 1P3CA 1AGJA 4BOHA 2A7JA 3MU4A 1SI5H 2ZO3H 1C1QA 4GSOA 3A8CA 3FO8D 4IS5A 1U6QA 4DW2U 5EXLA 4F4OC 1EB1H 1QRXA 4YTAA 4E7NA 1A46H 1SGRE 1KYNA 4LK4A 1KXAA 1O5GH 1FMGA 1W7XH 3NWUA 3RC5A 1OOKB 1X7AC 4B71A 1A1RA 1B0FA 3T5FH 1XUGA 4Y10E 5AHGH 3MNSA 3T2NA 1ZRKA 3MMGA 3LJJA 4AGKA 3OEED 2ANWA 1HAXB 3SV8A 2HVYB 2ZEBA 1IQEA 3KYFA 3DHKH 5T6GA 1PPFE 3M5LA 1VGCB 2P8OB 2AGEX 1WTGH 4JZDH 2G4TA 4WVPE 4JK5A 1TOMH 1SQRA 1GGDB 3L33A 4RKJB 1GGDC 1UK3A 1C5WB 3RXMA 2ASUB 3FP7E 5FPYA 5TCAA 2QV1A 2GDEH 3P92A 3SV7A 2OUAA 3GY8A 1GBTA 1VCPA 2FOEA 5TCCA 1SB1H 3VB5A 2PGBB 2PUQH 5A09A 3SUEA 2FOGA 2PHBA 4K2YA 3BV9B 1JIMA 3LOXA 1IAUA 2QXHA 1TPOA 2XCNA 1DFPA 1EJNA 4YLUA 2J4IA 1SVPA 3ZV9A 2R2WU 1BDAA 4ISOA 3S9BA 1S83A 2K0QA 1LPZB 1P02A 4F49A 1C9PA 4ZXYH 1TGTA 3DSPA 1DWCH 1VCWA 1N1LA 4OGXA 4FUIA 1FN6A 1S81A 3F2FA 3DT0H 2TPIZ 4QT8C 1IHTH 2HOBA 2OP9A 4ZMAH 4BTIB 2UWLA 1VITF 1S0RA 2EQNA 1P0SH 1Y3WA 2L6OA 1IQJA 2J5UA 3GCNA 2J34A 3HK3B 2A5AA 4AZ2B 1Y5BT 1GJBB 1GI9B 2VVUA 3QN7A 4ZUHA 3V13A 1HRTH 1GI1A 5AFZH 1AIXH 5JPMH 5LPEA 4A7IB 1A0HB 2ZGHA 3PV4A 2PSXA 2GMTB 6ESTA 2VIQA 3A87A 1ZGVA 2GP9B 2Y5HA 1LHGH 1SGQE 2OK5A 2EC9H 1GBJA 1B5GH 1TFXA 1FPCH 3PO1C 3SYJA 2WPKS 4IN1A 1SOTA 3UR6A 1C2IA 1MH0A 4K3JA 4D8NA 1IQKA 1HAYB 2A4QA 3FANA 1HDTH 1J9CH 3GY5A 2W7SA 4Z1MD 1OP2A 2M5TA 4SGAE 4AX9H 3I29A 3KIDU 1A0LA 1H8ED 3ZZ9A 2L74A 1P09A 5EJLA 1K1JA 1GI7B 2ZTXA 2XOKD 1GHBF 1E36B 1O2MA 4I7YH 3VB6A 2ZDKA 4BAQB 1FIWA 2EA3A 3A7XA 4H6SB 4NA8A 5GXPA 3RXDA 3A8BA 1NM6A 2QXJA 4FVDA 1MTSA 1WU1A 3SOSA 2BDHA 3T25A 1WV7H 1ID5H 4CRGA 2VH0A 1ZLRA 1D4PB 2BX3A 2ZGJA 1QZ8A 1TRNA 1O32A 2CXVA 1ELBA 4WY3A 3VB3A 3DA9B 7GCHG 9ESTA 3U8RH 4GLYA 2FESH 2GTBA 4JZ1A 4TY6A 5FXLA 5DP3A 2VIOA 2SGQE 1UMAH 3W1EA 3NZIA 1O3JA 1JXPA 2Z94A 3GCOA 4KKDA 1GVZA 1Z8GA 4AYVB 1Q2WA 1TPPA 2WYJA 2BLVA 1C5XB 4B6FA 4OS2A 1HB0B 4FUEA 1LHFH 3RMOH 1P2JA 1DOJA 2G5NA 3LPRA 1F0SA 3H5CB 3VFEA 2UUJB 5GCHG 1EXFA 1QR3E 1QTFA 3SI4H 4XD7D 2QF4A 3LH3A 1D6WA 4K8BA 5DN6D 5IYTA 1GDQA 4CRBA 3BTWE 2ZF0H 3MNXA 2AH4X 2B0FA 4AORA 5C0UA 4Y0ZE 3JZ1B 4FUDA 5EQSA 1ZMLA 2GGVB 1KY9A 2BDIA 2BLOA 3OTJE 1ELDE 1YBWA 2BVXH 1EAXA 2IJOB 1N6YA 1A4WH 1KXCA 1UK4A 5C1UA 3W95A 1ZTLA 2BB4A 3U98H 2W5EA 2BLWA 3RXLA 3MU1A 4OGYA 5J4SA 1MD8A 1O3IA 4MPVA 3VB4A 1XUIA 3KQDA 3FP6E 1HXFH 2DUCA 3PTBA 1GJ6A 3QTVH 2ZHQH 4J2YB 1O36A 1BIOA 4CBOA 1V2TT 4AOQA 1DWEH 4Y7AA 4K1EA 4YESB 1WTHD 2GCHF 5HYOA 5FHTA 1G2MA 1AVWA 1CA0C 1O2SA 3A88A 1W14U 1GCTB 3F9EA 4FUHA 3UNRA 1NU9A 1AY6H 1Y5UT 3SNEA 2XWAA 5ABWA 4B76A 4Y8ZA 4CBNA 1KDQA 3QTOH 1C5PA 1SGDE 4X2VA 6LPRA 4ZKSU 2FEQH 4NSYA 1A5GH 1C4V2 2DE9A 2R3UA 3ZVBA 3D65E 3RDZA 2WUBA 2EI8A 3D62A 5G4BA 1YPKH 2XC5A 2BVSH 1W7GH 5EXMA 5EODA 1LDTT 1OWJA 1YPGH 2TGTA 3UWIA 1A5HA 1UVPA 1O0DH 2F91A 4XDEA 1EZSC 1SGNE 3IG6B 4BANB 4CR9A 4X2XA 4BTTB 5C1YA 3RXAA 3NPSA 1TGCA 4NWLA 1GHXH 1GHAF 4TWWA 2BD3A 1SL3A 1GJ4H 4FUFA 1C5TA 2FIRH 2ZFPH 4ZKNU 4MPWA 3SORA 2JDID 2UUKB 3ZVGA 3V7TA 5F6MA 4YO9A 2ODYB 3P8FA 2XW9A 4X8UH 1THRH 3LKWA 1VZQH 3U1JB 1SLVB 4NIWA 1B7XB 1OWDA 3RMNH 3E0PB 3SQHE 1AD8H 1P8VC 3QK1A 4ZHAA 1PPCE 2G5VA 3DUXH 4I31A 2OD3B 2GT8A 1SMFE 1ZZZA 4TT3D 3RXOA 4X6NA 1MKXH 1VCQA 2P93A 3TH4H 3EGKH 4X6OA 4A6LA 1NRPH 1QBOA 5DP7A 3UTUH 3ZVDA 4AGJA 2ZFTA 2YOLA 3KHVA 3RXBA 4X1NU 2Y80A 1NRSH 2F9NA 1SKYE 1O2VA 3ZZ7A 4A5TS 1MU6B 1TQ0B 1DPOA 2LP6A 4DCDA 5CE1A 3KCGH 2ZPSA 2VINA 3MU0A 1C2JA 3U69H 1DSUA 1FDPA 3GY4A 5C5NA 1GBMA 2BZ6H 2ZA5A 1EAWA 4YOJA 3RLWH 1O2LA 1O3AA 2I6QA 3ZZ3A 1OS8A 1SR5C 1TA6A 3S9AA 2FOBA 4LOYH 2FM2A 4H42U 2F3CE 4NIVA 1Z71A 1O37A 5EPYA 1TA2A 4TSFD 2QY0B 3CS0A 3OYPA 3PM3A 4JZFH 2H9HA 2Y82A 1E38B 3UREA 1BBRH 8GCHF 4BTUB 2HLCA 1ESAA 2M2AA 1MKXK 2VIWA 3V12A 1Z6EA 3RUOA 2ZGXH 4B75A 2ZU4A 1GMDF 5E0HA 2ODQA 1HFDA 5KECA 2ZFQH 4U01A 1O5FH 1ZGIA 3KGPA 2J98B 4OS7A 4FUGA 1EAIA 1SGCA 2BHGA 3DFLA 3VXEH 2FMJA 1PPGE 3FZZA 4Y8YA 2AMQA 2CHAB 5DP8A 2BLQA 1DY8A 5E0JA 2J9NA 3TK6A 3BTEE 2BMGB 5GPIB 2O8WA 2UWOA 3BN9A 5EW2H 2ZIQH 1TONA 4DURA 1ANEA 4TYDA 1TX8A 2W3IA 3GDUA 2RA3A 3P8NA 4WJG2 1HAPH 1T4UH 4WXVA 4YT7H 1E35B 1ANDA 1UTPA 1QHRB 3KNXA 3PWCA 3RXUA 1IQMA 3BTME 1PQ5A 5IK2D 1XMNB 2ZPRA 3DSGA 3ELAH 2A2XH 4MNXA 1Z8IB 2C8ZB 1MCTA 3OEHD 1ZHMA 3FKSD 4MDSA 1BTPA 4Y76A 1K1MA 4AG2A 1O5CB 4Q63A 2BZAA 4DY7B 2YMSB 1G3BA 2A45B 3TGJE 4DT7B 2PKAA 4K1TA 2VWOA 4ISHH 3A7TA 2QXIA 1DY9A 2WPLS 2A1DB 2G55A 1F92A 3EYDA 4MQAA 1N6XA 1O2QA 2ZP0H 2EI7A 1YPHC 1C5OH 1QB9A 3PLPA 1YP9A 4X1SU 1BTZA 1V2QT 5F8ZA 1FONA 2OC8A 1CHOG 4X1QU 5GCHF 1ANBA 1D6RA 4UE7H 1SHHB 1GJAB 8KME2 5CMXH 5K0HA 3LT3A 3P95A 2GKVE 2PTNA 1CT0E 1O5BB 2ZTYA 1WUNH 3QZQA 3SQEE 4ISIH 1S6FA 3P8OA 1H1BA 1QJ6B 1V2RT 1SLXB 1KLJH 3U8OH 3FAOA 4JYUH 1BRAA 5FCRA 2IPHA 2QF0A 1YYY1 5LPFA 1FY5A 4XRNA 1EPTC 1GI5A 2BM2A 3ATIA 2BQ7B 2SNVA 3URCA 4I32A 2VGCB 1CE5A 3RU4T 1MAYA 1AWHB 1GHAG 1L2EA 3SNBA 1NPMA 2SGEE 1P05A 2JIZD 3FP8E 1ZHPA 1MQ6A 4XBBA 3S9CA 2QAAA 2GJGA 1FPHH 4E06H 1GHYH 2P16A 2PR3A 1O2YA 3PMAB 1KTSB 1P2IA 1EJAA 1XUKA 4I33A 4TPYA 3TJOA 1GHZA 1D9IA 4XOJA 4AG1A 2STBE 1WCZA 8ESTE 1TNGA 3A80A 2Z7FE 1YF4A 3VGCC 1O2KA 3ESTA 1F0TA 4UD9H 1HIAB 1QURH 4Q80A 1KLTA 1WQSA 2G52A 4INHA 1ZPCA 3N7EA 1CBWB 2A4GA 3Q3XA 1GDNA 1K2I1 2GV6A 5GDSH 5GJ4B 1TQ7B 4IW4E 2Z6BD 4XE4A 1EJMA 3M5NA 2HPPH 5J4QA 1SQOA 2BD4A 1ESTA 5JB8S 1V2WT 3GYLB 4UFDH 1ORFA 3SJ9A 2KAIA 1C9TA 2P3TB 3M3SA 1RD3B 4AFZA 1OYQA 1Y3YA 4NA9H 1FN8A 3RXTA 2C93B 1FIZA 1EOJA 1TNIA 3F2GA 3LGWA 4D9QA 2Q6DA 2V0BA 1NT1A 2V3HH 4GHTA 2BXUH 2SGAA 1RRKA 1FY4A 3ITIA 2WYGA 4NFEA 3ZVAA 1V2ST 1MABB 2B5TB 2RDEA 1XVMA 3JZ2B 4X2WA 7ESTE 2F9UA 1BCUH 3F9HA 3SGAE 2PV9B 1MZAA 3RU4D 4B2BA 4ACBA 1C2EA 1TRYA 4Y11E 2Z9LA 1C1TA 5F03A 2JKHA 3W94A 2G51A 4IC6A 3FVFB 1TMTH 1G3DA 2KCYA 1THPB 2HWLB 3HKIB 3VGCB 1COWD 2AIPA 4PROA 3QDZB 2Z9GA 1P2KA 1ZJDA 3E3TA 3WWBA 3M5OA 4Y6DA 2BD8A 5AFYH 1O2HA 1ACBE 1KTTB 3GCHB 2RDLA 2WV4A 1F7ZA 4ABDA 1UW7A 1CT2E 5T1VA 7GCHF 3ZVFA 2GCHG 3AVZA 3D23A 3GISB 2VWLA 3BF6H 4IBLH 3UQOA 1ELGA 1LVOA 1ZTKA 1C4U2 2HNTE 1MD7A 3DD2H 4X8SH 2V6NA 2WUCA 1E1QD 1VKYA 2BY9X 5GIBA 3UFAA 4P00A 3TJNA 2A0QB 1C5ZB 3LGUA 1SSXA 2QGRA 3M37A 2VVCA 2B8OH 4NGAH 3RXCA 3SU0A 4MG3A 4NFFA 4AFUA 3BTKE 3PO1B 1VJ9U 3AAUA 1C5LH 1GBIA 2Q1JA 3ZZAA 1C5YB 1FAKH 2RA0A 2ZFFH 5JBAS 2ZFRH 1O2JA 1THSH 3ZVCA 1LCYA 2IJD1 2CK3D 2OQ5A 3E16B 1TGNA 1O5DH 1GJ7B 1YC0A 5IDKA 3G01A 1AKSB 3HKJB 1C1RA 1MTVA 1H9LB 1P57B 4FVBA 2A4RA 4XBCA 4OS4A 1TE0A 1UTNA 5E0GA 2PFEA 4INKA 3T27A 2W6JD 3TH2H 1EB2A 3M7UA 5LH8A 5F53A 2QN5T 1JBUH 5C5OA 2ODPA 4ABGA 2BOHB 3F2HA 1YWUA 3UY9A 2PW8H 1EP5A 2SGFE 4CH2B 5PTPA 4YZUA 1C1WH 1DXWA 1HCGA 2JH6D 4NCYA 5EJZA 3S7KB 1DWBH 4ZH8A 2Q6GA 1GBDA 1Z8JB 1DS2E
chains in the Genus database with same CATH topology
2SGPE 1EP6A 2D2DA 1SLWB 1P06A 1RFNA 3QX5H 4MPUA 4JCNA 5DG6A 3OX7U 1VITG 2F9BH 2BTCE 1BITA 1SFQB 5E2OA 1GBFA 2VIDA 1LQDB 5FX5A 1G3CA 1O38A 4FU7A 3K9XB 3EE0B 1ZSKA 1AFQC 1IHSH 4I8KA 3ZZ8A 3EAJA 2HPQH 1XUFA 7KMEH 1ZOMA 1SC8U 1O3MA 1ZRBA 2Y5FA 3TK5A 1O33A 3SGQE 3A85A 3BG4B 1J8AA 2AGIX 3E6PH 1SGTA 1W0YH 2GX4A 6CHAC 4Q7YA 1BBRE 2ZECA 2Z3EA 1GBHA 1TNKA 1JRTA 4KP0A 4B2AA 3F9FA 1DITH 1YPJH 4D7FA 1V6DA 2O8UA 4ZKRU 1K22H 3QO6A 2JETC 1C5UA 3E8LA 2CV3A 4I8HA 1RTFB 1K21H 3TGKE 1UVOA 1WYKA 5DO4H 1T8LA 2FLRH 4MPXA 3RXGA 2R0LA 5TJXA 1NFXA 2QC2A 3UOUA 2VWNA 1DUEA 4AYYB 3KN2A 1TWXB 1DLEA 2FLBH 3LONA 1AKSA 1FZZA 1Y3VA 4FU8A 2OC7A 1DSTA 1NN6A 1YPLH 5EG4A 1Q31A 1GDUA 1D3DB 3H7TA 2AEIH 3ZZCA 2FDAA 4ZAEA 1ZTJA 1QJ7B 1W3CA 2BD2A 1KLIH 1BOQA 1ZSLA 1AB9C 1RTLA 4ESTE 1BTUA 3SBKA 2BDGA 4NZQA 2Y6TA 2ZWLH 1GHBG 4R8TB 5ESBA 2HGTH 4AB9A 4A92A 1SLUB 4UDWH 1AE8H 2OTVA 3CENA 3ZZ6A 1ESBA 3F1SB 2NU3E 2FPZA 4VGCB 1HNEE 3TNSA 1MKWK 1BBRK 2TBSA 4UFFH 2OBQA 3A7ZA 3MNBA 1E37B 4ABFA 2ZGCA 2BDYA 4ABEA 3MWIU 2PSYA 4ABIA 3KQEA 1H8DH 3TIUA 2JH0D 1LO6A 4HFPB 2FI3E 1QL9A 1O2UA 1K1OA 1PPHE 1QA7A 1LHCH 2XYAA 1PYTD 3PLBA 2BDBA 3VXFH 2H9EH 1DXPA 5L2YH 3M3VA 1LTOA 2QA9E 2NU4E 4TPIZ 2Y7ZA 1GMCF 2CF9H 3SU3A 1IQIA 2EI6A 2QYIA 2VU8E 2A31A 4KGAA 5L2ZH 1NC6A 1JMOH 5DP9A 1PPZA 1O3BA 3T28A 1GI8B 2FO9A 3TK9A 1NZQH 5C1XA 4FXGH 3LU9B 1C2DA 3LGYA 1E34B 2CGAA 3RXHA 1NRNH 5LGOA 2BDCA 1D3PB 3SNDA 1F2SE 4CHAC 2ZU1A 3UPEA 2BOKA 1NU7B 1BTWA 2FXRA 1J17T 5BRRE 5EPNA 2Z9IA 1UTJA 1TNHA 5DP5A 1MMJN 4DIHH 1QGFA 3QZRA 2H9TH 1LVYA 1TOCB 2P3FH 2GT7A 3BG8A 1YCPH 1OX1A 2ANYA 3EA7A 5A0AE 2BD7A 3MU5A 3MOCA 1SBWA 1W13U 4CH8B 1OWEA 3AW0A 3ZZ4A 4A1VA 1QCPA 4AFQA 5T6FA 3RC4A 4UEHH 5HM2A 1MTNB 1UCYE 2FX6A 4KELA 1AQ7A 1D3TB 5C67A 4WF8A 3UQVA 1C2HA 2Z3CA 4A1TA 4Y8XA 3OY6U 3UUZA 1SQTA 3KL6A 1T8OA 1MTWA 1TNLA 3RU4E 4NSVA 2ANKH 4K60A 1PYTC 4MLFB 1FQ3A 1YPEH 1HAZB 1P2NA 1B0EA 1DANH 3A7VA 2VJ1A 2ZDAH 3GCHC 2FOFA 2O8TA 1RIWB 1BZXE 1NS3A 2P94A 2VIPA 5HMAA 1EATA 2OQUA 1WAYB 3EQ0H 1CU1A 1RGQA 2D26C 1J16A 1Z1IA 3A7WA 3LIWA 4ZHLU 1AO5A 1ETTH 1GHWH 5I25A 4ABAA 1TPSA 3NKKA 1EPTA 1BJVA 4WMFA 3K65B 3A84A 4DJZB 1O2WA 1FNIA 2G8TA 1YLDA 1O35A 1C2FA 1S84A 2CF8H 1CQQA 2P3UB 3QWCH 3QGJA 1RS0A 1EZXC 2ANMH 1T31A 1KXFA 3U9AH 1HPGA 2OCVB 2C8WB 4ZKOU 1ZR0A 2OC0A 2R9PA 4HGCA 3BTQE 4OS1A 2ZDLA 1LPGB 1H9IE 1MUEB 3U8TH 1Y59T 4Z0KA 1O30A 4X1RU 1YM0A 5DP4A 2FS8A 3K6ZA 3ODFA 2GCTC 2ZZUH 5JBTA 1O5EH 1W11U 1ZPBA 4U30A 4AFSA 4WMDA 1ELAA 2YNAA 2P95A 2FODA 1JWTA 1CBWC 3SUGA 1GVLA 2NU2E 1ARCA 1HBTH 4X8TH 1PQ8A 1GI2A 3ZV8A 3SO3A 3SJKA 1ELVA 4CHAB 4Z6AH 3EDXB 1WQVH 4I8GA 1C5QA 1C1VH 3BTGE 1IQHA 2NU1E 1O3LA 1HAVB 3HGNA 3SU5A 1HV7A 4WH6A 1G9IE 1XKBC 1AN1E 5SGAE 1GBAA 1Q3XA 4I8JA 1XUHA 2FS9A 1UTLM 1ZMNA 1Z6JH 1A7SA 3ODDA 1FAXA 4DG4A 1QJ1B 3O8CA 2A32A 1P9UA 4IMQA 2XTTB 2KAIB 3RXSA 1XX9A 2VGCC 2YNBA 2D1JA 3PTNA 2STAE 4WH8A 4FUJA 5HXFA 5FAHA 2FTLE 1DLKB 2G4UA 5DKMA 4ISLA 3O8BA 3SU1A 3LGVA 1GBCA 3MH4A 3SI3H 1UVTH 4YM9A 3R0FA 4RN6A 4CRFA 5A2MH 2XCFA 3GCTG 4O97A 3RP2A 1LHEH 4ZXXH 9LPRA 1WOFA 5FX6A 2FZZA 1IOEA 2H5CA 4DVAU 1TBZH 3SV6A 1BHXB 1C1SA 3LGTA 2H2ZA 1LVMA 3BIUH 2XXLA 1AFQB 3KQBA 2SNWA 5DK1A 3EA9A 3PYHA 4CRDA 2ILNA 1FV9A 4AB8A 4DIIH 1EQ9A 1QQUA 2PTCE 3TH3H 3KQCA 1AFEH 1AI8H 1UHBA 2ZDNA 1AE5A 2OBOA 4A1XA 1BQYA 1QNJA 3LC5A 3GICB 5FPTA 2HALA 3CS7A 1D3QB 3M7TA 3L3TA 1TNJA 1BA8B 2WPHS 4LXBH 5AF9H 3N7OA 5FPSA 2I6SA 4Q7XA 2A7CA 4YOGA 4Y0YE 4TY7A 2W26A 3I78A 4GUXA 5ESTE 1ELTA 4U2WA 3KF2A 1OP0A 2PKAB 6GCHF 1GI0A 4B2CA 4Q7ZA 1S82A 4Y7BA 1O3KA 1ZPZA 1E0FD 1C5RA 3STIA 4CRCA 2FOHA 2UUFB 3RM0H 5A8ZA 3E0NB 4XFQA 1O3FA 2XBXA 3A81A 3AASA 1A3BH 2GV7A 1P3EA 2ZTZA 1A0JA 3NCLA 2VVVA 1Z8RA 4E05H 2A7HA 1YLCA 3M61U 4IGDA 5DPAA 1NTPA 5FCKA 4ZROA 1MTUA 5LPRA 2ZDMA 3MH5A 1N8OB 1KSNA 1GMHF 6CHAB 2O9QA 3OSYA 1C4Y2 2OC1A 1LKAA 4B74A 1Z1JA 3A86A 4O03A 4UONA 1GI6A 1F5RA 3RXRA 2AMDA 1MU8B 2FOAA 4BAMB 1P10A 1BB0B 2NU0E 2D8WA 2XC0A 1P2MA 1S6HA 2VIVA 1GL1A 1C1PA 1XKAC 3QUMP 3UR9A 2GD4B 2O8MA 4BXWA 4BAOB 5L30H 2Y7XA 3BTFE 1HXEH 1O3EA 3TGIE 3TJUA 3ATLA 4GAWA 1DVAH 1GCDA 1JIRA 1TRMA 1O2TA 3FZDA 5CHAC 3RXVA 1A2CH 2Z3DA 3UOPA 1OWHA 1H8IH 1NRRH 3B8JA 4IMZA 4WWYA 1C1MA 4ASHA 2ZHEH 1OWKA 2ZCHP 3RC6A 1XXDA 1SPJA 1A5IA 1T7CA 4RSPA 1K9OE 1LHDH 3MYWA 1QRZA 3TJVA 1MBMA 3MHWU 3VEQB 4ABBA 1GWAA 1HJAB 1FY8E 5C2ZA 1G3EA 4Y79A 1VJAU 2HVXA 4MNYA 4CR5A 2Y81A 7LPRA 3K6YA 1EAUA 2FYRA 2ZQ2A 1GI3A 1AVXA 1UO6A 2LPRA 2BXTH 1KXEA 1C5VA 2VH6A 5GWZA 3TVJB 1O3NA 3T29A 2PKSB 1WSSH 3DFJA 4CREA 1P01A 1CO7E 3GDSA 1ZHRA 3E90B 3NXPA 2SFAA 1GBLA 4B73A 3RXQA 1TB6H 2J2UA 1G30B 4HZHA 3BEIB 1V2OT 1IQFA 1QFKH 1G32B 1L1NA 5F8TA 2WV5A 1UK2A 1VR1H 1HAVA 4HI3A 2A5KA 1EOLA 5ETXA 3RLYH 4X6PA 4FUBA 1BRBE 1PJPA 3BTDE 5L6NH 1IQGA 1NROH 1PFXC 1K1LA 3SU2A 1SGFG 1MZDA 4NG9H 1EASA 2A5IA 1L1JA 4OS5A 3RMLH 1YPHE 3PWBA 1L1GA 2FOCA 1UTMA 3VPKA 1SG8B 1BTHH 2BQWB 5JBBS 1YKTA 1L4DA 1O3DA 3LGIA 5BPEA 1ELCA 3SZNA 3ATMA 1GCTC 3MO6A 3Q3KA 2W7UA 3P6ZB 1CGJE 3F9GA 3FFGA 2WPIS 1QL8A 3EA8A 5FBIA 3RXFA 5A0BA 2ALVA 3IWMA 4GCHG 3MFJA 4MVNA 1BMAA 1UVSH 3BSQA 3WY8A 3M36A 3OY5U 3H7OA 4ZHMU 1HAGE 1YPMH 1MTNC 2PGQB 1W0ZU 1ELFA 3PMHB 4LZ4B 4H6TA 4UFGH 4XSKU 1HIAA 4Y71A 1GJCB 1O3CA 1P2QA 4GHQA 1SFIA 1GBBA 1W12U 1CSOE 5A8XA 1ZSJA 2XNIA 3MNCA 2PKSC 2ZFSA 1FY3A 1AWFH 1ARBA 1DDJA 1DE7H 1SGYE 3E91A 1TIOA 4K5ZA 1GBKA 4JMYA 2TGPZ 1UTOA 1CVWH 1V2JT 1NFWA 2ZDVH 2G81E 2FWWA 1QBVH 2H5DA 4KTSA 5A0CA 2AERH 1UTQA 1LMWB 4I8LA 3TITA 2FOMB 3LC3A 2XC4A 1GMHG 3TLOA 1SQAA 3MH6A 4B1TA 4X1PU 1FUJA 2TGDA 2Z9JA 2WPMS 1FLEE 1TGBA 1XVOA 3PB1E 2B9LA 1HGTH 3SN8A 2XBYA 3ENSB 3C27B 2BQ6B 2FX4A 3A8DA 1Y5AT 2AMPA 1QA0A 5EXNA 4FUCA 1OYTH 1V2KT 1K1PA 4IC5A 1AZ8A 3GY2A 5K7RA 1QBNA 3LJOA 5CHAB 2ZCKP 2GZ9A 3UNQA 2R3YA 2VNTA 5I46H 1RXPA 3BTHE 3O8DA 5JBCS 1A3EH 2FP7B 5EQRA 1Y3UA 4SGBE 2FTMA 2OLGA 1NFUA 4MNVA 1KIGH 2F9PA 2W3KA 1TAWA 1ANCA 1DX5M 2ZI2H 2CJIA 5AVDA 2ZQ1A 4E7RG 5C20A 3P8GA 1GJ8B 3B9FH 1UCYH 1UTKA 3SHAH 1W2KH 1GJ5H 1W10U 4X0WU 3M3TA 4JYVH 1BUIA 3Q76A 1W8BH 2G00A 1V2UT 3C1KA 2WPJS 4ABHA 3RXJA 1BMMH 1NY22 2UWPA 3MTYA 1NESE 1CGIE 1AMHA 4NA7A 3SNCA 4VGCC 1V2NT 1MAXA 1JRSA 1OXGA 3TNTA 3UIRA 1S5SA 1PQ7A 1OWIA 4X8VH 4O3UA 1FJSA 1GPZA 1V2LT 3GOVB 3NUMA 4DOQA 4RKOB 3B23B 1FY1A 1WBGB 1P03A 1ZJKA 2AS9A 3AAVA 2O8LA 1HYLA 2XWBI 1ELEE 3SHCH 2J94A 1EUFA 1V2MT 4THNH 3SV2H 3MH7A 1AVGH 2TGAA 1QQ4A 2ULLA 1GMCG 3SW2B 2WINI 2P59A 1O2ZA 4WMEA 1MQ5A 1BTYA 8GCHG 1AUTC 2AYWA 1NO9H 1RTKA 2BD5A 2ZGBH 2A2QH 1C5SA 2QXGA 1PPBH 2JH5D 1F5KU 1C1OA 2BYAX 2OXSA 5JYIA 2F83A 1EZUC 3M5MA 1TX7A 2BY5X 2CHAC 2F9VA 3LH1A 1KXDA 1QIXB 1FXYA 1V3XA 4NIYA 1HJ8A 2JETB 1G2LA 5H4IB 1BRCE 1EKBB 2RCEA 4HTCH 4KTCA 3I77A 1F0UA 1O2OA 3K2UA 1TBQH 3ZYDA 2J38A 3IITA 4GCHF 1K1IA 4WXIA 3CP7A 3QLPH 1M9UA 4YLQH 1S0QA 2AGGX 4D7GA 1SGFA 1HAOH 3PLKA 1LKBA 8LPRA 3BG4C 4JYTA 1P2OA 1O2RA 1C5MD 3P70B 1P12E 1MCVA 2C4FH 4CRAA 3KEEA 1HAIH 3QGNB 1L0ZA 2PWXA 1HJ9A 1TMBH 2R0KA 2BY6X 2P8OC 3E1XB 2PLXA 5EGMA 2AFQB 5T6DA 3Q77A 1ZMJA 2FI4E 3MU8A 5E2PA 3P17H 1QB1A 3NK8A 2ZNKH 4DGJA 4K8YA 2QF3A 2FI5E 3UNSA 3A89A 5F8XA 4FU9A 1BJUA 2GZ7A 1TBRH 1GG6C 3GY7A 5T3HA 2BDAA 1RJXB 4ABJA 2CN0H 4YOIA 1H4WA 2ZU2A 3RM2H 1T8NA 3GY6A 1UJ1A 3BIVH 1UCYK 2Z9KA 4KTUA 1L4ZA 1INCA 3OU0A 4X6MA 3SNAA 5E8EH 3Q00A 1TMUH 4BXSA 4NWKA 1GJ9B 3ZYEA 5EW1H 1O5AB 1C2MA 1ETRH 1O2PA 5JB9S 2ZKSA 3SUDA 1S85A 3URDA 2Y5GA 1JOUB 1C2LA 1OKXA 2GCTB 1F0RA 1CT4E 2AIQA 2IOTA 4AN7A 4BAKB 1Z7KA 1EZQA 1C1NA 3A8AA 3V3MA 4GPGA 1TX6A 3AW1A 2ZHDA 1AUJA 1O2XA 3F6UH 2XBWA 3MO9A 1C1UH 3RXKA 1DM4B 1OSSA 2XBVA 4K69A 1QB6A 3BTTE 3T62A 1F5LA 5HGGA 1GHVH 2ALPA 1SHYA 1A61H 3RXEA 1QRWA 2ZHWH 1OPHB 1Y8TA 1J15A 3ZVEA 1AZZA 3GDVA 3ZZDA 1HUTH 2PUXB 1HLTH 1LPKB 2R2MB 1HAHH 2DE8A 3ZZ5A 2HRVA 3RXPA 4D76A 2ZPQA 3GY3A 3RXIA 5DJ7A 1AU8A 2V3OH 1TALA 3RMMH 1BT7A 2C8YB 3SGBE 1O34A 1K1NA 1PPEE 4JZIA 5B6OA 1TYNA 2H6MA 4YT6H 3TU7H 1H9HE 4H4FA 1ZYOA 1QY6A 1CA0B 1DWDH 3S0NA 5A8YA 1CA8B 2TRMA 4J1YA 2J92<