4FUQA

Crystal structure of apo matb from rhodopseudomonas palustris
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
503
structure length
501
Chain Sequence
MNANLFARLFDKLDDPHKLAIETAAGDKISYAELVARAGRVANVLVARGLQVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPKIVVCDPSKRDGIAAIAAKVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSTGRSKGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPKFDPDKILDLMARATVLMGVPTFYTRLLQSPRLTKETTGHMRLFISGSAPLLADTHREWSAKTGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGKELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGATIDEAQVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
molecule keywords Malonyl CoA synthetase
total genus 153
structure length 501
sequence length 503
chains with identical sequence B, C, D
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4fuqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fuqA01
4G37A 3WVNA 5D6NA 4FUTA 3WV4A 1MDFA 5BSVA 3NYRA 4GR5A 4GXQA 4R0MA 4DG9A 3A9VA 2QVZX 1BA3A 3KXWA 5IFIA 3C5EA 2QW0X 3O84A 2VSQA 2P2MA 4GR4A 3RG2A 4ISBA 3U17A 4RVNA 3IPLA 1V25A 3L8CA 2QVXX 5BUSA 5BURA 2P2JA 3E7WA 3T5BA 5K8FA 4E5DA 4FUQA 3ETCA 4G36A 4DG8A 3DHVA 4RM2A 5BSTA 4PZPA 5BSWA 4ZJZA 4D4GA 2D1QA 2D1RA 3E53A 3G7SA 3T5AA 4M46A 1PG3A 2Y27A 1LCIA 3TSYA 5DV9A 5K85A 4IZ6A 4R1LA 3O83A 1MD9A 4RM3A 3LGXA 3CW8X 5GTDA 3VNSA 3DLPX 4OYCA 2VZEA 1T5DX 4EATA 3IEPA 1AMUA 5BSMA 3T5CA 4RMNA 1MDBA 4IR7A 3PBKA 3NI2A 5BUQA 2D1TA 4D4HA 4R1MA 2V7BA 3E7XA 3R44A 4RLQA 3WV5A 4GXRA 3VNRA 4WV3A 4RLFA 3NYQA 3IESA 5BSUA 3IVRA 2QVYX 4OXIA 1YJ7A 2P20A 1PG4A 2D1SA 4W8OA 3B7WA 3QYAA 3LNVA 1T5HX 4D4IA 3DAYA 3EQ6A 4D57A 5DWVA 3RIXA 4RVOA 3VNQA 2P2FA 5KYVA 3A9UA 2Y4NA 5KYTA 5JRHA 3FCCA 2WD9A 3U16A 3O82A 5E7QA 3LAXA 3IERA 4D56A 5KEIA 3ITEA 2P2BA 3FCEA 1ULTA 4U5YD 2Y4OA 1RY2A 2P2QA 5BSRA 4LGCA 3GPCA 3CW9A 1V26A 4GS5A
chains in the Genus database with same CATH superfamily
2EG5A 2CL7X 3JV7A 4P92A 2WAMA 4G56A 1CUAA 1Y4SA 4BYMA 2C9DA 4MROA 3HACA 1IBCA 2CFSA 1S9HA 1SA0A 4ZI7A 1ZJ6A 2ZDQA 3HVHA 3RQIA 4BYGA 3CINA 4PRLA 4MH4A 4K0KC 1WUJS 2WK1A 2C1EA 4LGVA 1G5FA 4Y9UA 4M38A 3SDSA 4AMGA 3H4TA 2NSLA 2YDXA 4FNAA 3BZWA 1FF9A 2WEKA 4DV6B 4PYRA 2NAFA 1DS6A 1L6IA 4RC9A 4DLAA 1UBUS 1BOFA 4O4IB 1SQ0A 1B23P 3CKMA 2C1ZA 3NKFA 2YJ4A 4GI1A 3DCIA 4XDGA 4D80A 4WS9A 4U2CA 3IBFA 1NXPA 3MGGA 2FVXA 4KPYA 1KO5A 3AEXA 4R3NA 5KOYA 2XYGA 2CFCA 1WBBA 2CJFA 5HPYB 2QI9C 3DMTA 4Q9JA 4CXMA 2XQJA 1KMMA 1US8B 1V9CA 3PUJA 1ACJA 1OV4A 3RG8A 4ARBA 4RE6A 2Y1LA 4EG6A 1U4SA 3IURA 1Q6YA 1E7RA 4Q24A 3GN2A 1NBIA 1MABA 4OJYA 1YTLA 4M46A 4UDNA 4B3DA 2R8BA 1F0KA 4ENSA 1JWBB 1SVLA 3D8RA 5IAEA 2ZIUB 1KMHB 1FPMA 1JHOA 4Q3OA 1GVNB 1IDN1 2BCJQ 3IQHX 3ODGA 5DGTA 5DXJA 5JMPA 3TX6A 5B58T 3LMKA 5K7SA 5HX7A 4RM3A 1K88A 1V8DA 2E0GA 2EGUA 5F2EA 4DRYA 1E79A 3GLRA 4KRYA 1U0EA 1YAHA 1ZESA 4AXBA 4MVYA 3TW0A 4HGZA 1DO0A 3CEJA 7MDHA 2B4QA 4GKJB 4E2FA 8ATCA 2X8BA 4BZWA 1OYYA 3SR4A 1SKBA 2HXSA 3GYBA 4QTTB 2IE0A 4I2VA 5EIAA 5DLDA 2NG1A 1P18A 2ZYUX 4IOKA 4RY9A 5DK4A 4B6PA 4DJTA 3SXUB 5AVTA 3O8LA 4H0FA 1D6SA 1O8BA 3AEUB 4LHZA 1K6JA 4QTYA 3HSKA 3JQ7B 4TVBA 3I28A 3H9JA 5GIPE 2NADA 1JG1A 2C7VA 2LTAA 2BZSA 1XMQC 4ZEOA 1PGJA 5LPNA 1U9CA 4DWVA 5IANA 4LISA 2IUSA 4Y0NA 1H2BA 4JUBA 4FYXA 1PL8A 4P6VF 2P9BA 4ZICA 1NRJB 2JJ2A 4XIGS 4N0PA 1M8FA 4DR1C 3E9MA 5FHRA 4Z1OA 2QL5A 1M1YE 3P2JA 3AESA 3SI7A 1ZOPA 4UCWA 2R5FA 1SCUB 3PTLA 1FTYA 2FPPB 4C3OB 3PQ4A 2O5EA 4JVLA 4LZAA 5EE5B 2BGKA 4OXRA 1VKZA 1SOAA 3RKUA 1IVSA 4OHYA 3K0CA 4ALJA 1FS6A 1GZVA 1LBQA 4RJKA 4EZIA 3V1LA 1QQ7A 3KTAA 3OZCA 4KO3S 1HRDA 2B61A 5DHRA 1SQFA 4X85A 5I9MA 2PSHA 3EPPA 2PSFA 5LD2B 3PFNA 4KQJA 4N12A 2CYAA 5B55A 2ZBGA 3TLBA 1VE5A 1YONA 4AK9A 1D3AA 4GMFA 4GVLA 3AIIA 3PR3A 5DGDA 3OQOA 3WVNA 4QSHA 3ESRA 2CFTA 2JJ8A 4X65C 2BJVA 4OO3A 2I80A 4F3CA 3S28A 4NPCA 3FWZA 4U7PB 3TQHA 3ZWOA 4EM6A 3BRWD 4NIMA 3RF6A 1Q14A 5HYVA 1JDUA 1MFZA 5HK9A 1OX4A 1IMJA 3NETA 4GXQA 2ZRCA 4OX9Y 2HQOA 1MV5A 2VPYA 2BL4A 3E7FA 3OSZA 3QOWA 4M1EA 1L1RA 5JSYA 3USCS 5BMVA 5BR8C 1DHRA 1JSRA 5CT4A 2NN3C 5TNXA 1DDOA 1ESEA 2JKVA 4L07A 3V3TA 1EFHA 4KLRA 2IITA 2OQ2A 1P9NA 2YZ2A 1JFLA 3OE7A 1B14A 2Y1OA 1LK0A 1NT4A 1VJGA 4K6OA 2PSJA 2FPKA 2ZVQX 4FJ1A 2XT9A 2D5BA 4P3NA 1R4ZA 4FHCA 5DP2A 4MLCA 2I71A 4QYMA 4DBVO 5T41A 2BBSA 3CZ5A 2YRWA 2BBOA 2CNDA 2VPTA 1GAJA 2ZUEA 1EFKA 4KZPA 4NYMQ 4IJWA 2XZTA 5CM8B 1L5GB 3BSFA 5D00A 4JJ4A 3RANA 3WNCA 1YR7A 4GX1A 2JC3A 1MOQA 2FMKA 4TN5A 2IYLD 4MVXA 4Y1RB 3OZFA 5B57C 1GNQA 1SCIA 1GHTA 4G1FA 1J2JA 2Q1SA 3NS7A 3FVTA 3OY7A 1O89A 2YHAA 4YWHA 1OAOA 4K81B 1F0PA 3SP1A 3T5GA 3EZ9A 4PICA 4UVDA 4W6ZA 4CM4B 4EAAA 4RD1A 5IXYA 3CRZA 4YLYA 5FI0B 4KHPB 1J0BA 1Z22A 2M6SA 2SKCA 3COJA 4GDFA 1VQ1A 3HXPA 3D7NA 3FYDA 5CEJA 1OAKA 4KG7A 2XYPA 2F1RA 1JGTA 4RVGA 2XB2A 1E2IA 1BE1A 1M10A 1N92A 2C2KA 5A7HA 3ESQA 1W0JA 2Z58A 4ITVA 5ALEA 2HFKA 3OCXA 4Q3BA 3MWDA 4E32A 4J3FA 4YJFB 1V3VA 2HQ1A 3PXEA 2ZSJA 3OUUA 1N8KA 4CU2A 1HNXC 5E4YA 3TUFA 3NHBA 3E1KA 2PMWB 3ZWBA 2F4NA 4WXMA 4CDMA 1FTQA 4MHSA 4JI8C 1T5SA 4YV7A 5I8PA 2CY1A 1I7NA 1XAIA 3ZUGA 1A77A 5JALA 1O5OA 3LAWA 3HXTA 4KX5A 1AGRA 3WV5A 5CFLA 4GYKA 1WBDA 4XARA 2PGLA 4DSTA 3IOBA 1TTHA 4RPCA 4C6TB 3TCNA 1VJ1A 5KC9A 4AQYC 2A9PA 3K9QO 2Q3LA 5EXDA 1N8NA 1AN0A 1N33C 1XCOA 3G3EA 5DYWA 1DV1A 2BI8A 3NEAA 1SKUA 3K53A 1ATZA 5H9VA 4DILA 2NU9B 3OTOB 2EJBA 2GPYA 4L8VA 1OXMA 2V8OA 1LNSA 2ZIWB 3IHTA 3PL1A 2RBEA 1XMOC 1RNLA 1H2HA 1V7PC 1P3DA 5JPIA 4U7FA 3PXDA 1UXHA 4IVRA 4LE2A 1WPRA 2X0KA 2BHSA 1M1XB 5BN1A 1FTGA 1O95D 2VHJA 1XSEA 1RD4A 3E81A 3G0IA 4BRUA 1L5HB 3A1NA 3CW9A 2AOWA 2G36A 3GU3A 4GC9A 5GZ1A 3VPBA 4FM9A 1UOQA 5GV7A 1PZGA 1ZJ5A 1XCMA 4F85A 1XQ9A 1H5QA 5EQFA 1E1QA 2RJ3A 3QJ5A 4HQKA 3T34A 2BEVA 3UJBA 3EZ6A 1H93A 1CIJA 1CLUA 5FOUA 4YQEA 1H9CA 4E5NA 1VMKA 4GRAA 5LWQA 1VKHA 4EAQA 3ZHVA 3CJQA 1FLAA 2FR8A 4G0YA 4CQMD 1VP3A 3FNEA 4GNRA 2W43A 1M54A 3N2KB 3KKNA 4IRXA 1MAWA 5FUQA 2QL6A 1EX7A 5AK0A 3ZU6A 4XUEA 4RY8A 1YE3A 2YC2C 4LJKA 1K63A 2H51A 2XYRA 2ZZKA 3PUVA 3PDCA 2ZJ3A 3G5LA 1V25A 2IUEA 3P32A 4RABA 3VYRB 3EDQA 1U9IA 3GGOA 5LLDA 3NYIA 5HOQA 2BFPA 3IT0A 3M1AA 3BEOA 2NXCA 2W2LD 3CLUD 4F4UA 3FGNA 4G1EB 2Y1WA 4KXQA 3VVCA 4CQMA 4JR2A 1C8VB 3VHLB 4TKVB 4UTOA 4WCVA 1JSZA 4JLKA 2HF9A 2BMDA 4HVCA 2R68A 5SY6A 3AHCA 3WIVA 4ZJZA 2JD2A 1E6UA 3PYLA 2D1RA 1CP3A 5FPHA 1CY2A 3ZCSA 4BNWA 2H63A 4B6GA 1Q7EA 3EEFA 2QD1A 4GZ6A 3GJ0A 4V3BA 3PQ6A 1KYQA 4LSWA 5LCIA 1KO1A 2OWDA 1RQLA 1V41E 4TLMB 4XJXA 5D87A 3VPFA 4MPJA 2P40A 1ZM7A 2PRSA 1HE8B 1RTKA 3HRHA 2VK4A 3ELYA 2WTXA 3KLNA 4BP9A 4YCSA 3KFVA 1CUCA 1PJCA 1XZ8A 2ZE6A 4HLDA 2XUHA 4KC0A 4YYEA 2XZLA 2XD4A 2OV4A 5TQJA 3HGMA 2IPOA 2P69A 4GSLA 3U80A 2QTGA 3P45A 1HSZA 3P9CA 4QGGA 4GP7A 4WMLA 3TLZA 4DR4C 1NE7A 2OV6A 3CQ1A 3GCWA 4NLLA 1PVDA 4ZMRA 1P2TA 1FQJA 3NHJA 1KSGA 3ZVMA 3GGCA 1U3WA 1NF3A 5KHAA 1OILA 2UZ1A 3UMJA 1F8YA 3Q8KA 3CRW1 2DR0A 3VSBA 1JU4A 2IA5A 4NF2A 5T4BA 4MCHA 4AZTA 4DV0C 3IOMA 3OKPA 2C4WA 4W63A 1OB2A 4EY8A 1YI1A 4RLFA 1FQOA 4DA9A 1P4HA 5JVDA 2JGIA 3LS2A 1Y7IA 3EVAA 5I7HA 5L6MB 2H29A 3M5CA 5J4YA 5KQMA 5DVZA 4LVOA 5HIKA 4KCGA 2WMDA 4ES6A 1LV7A 3K1AB 2ZTVA 4NZOA 1JDZA 1G3UA 1P7PA 3KWMA 4Q19A 6REQB 1H4QA 1S6YA 4LHYA 2EYUA 1IHDA 1N5JA 2KLBA 3LKDA 1X80A 3A9WA 4YLEA 3IAS6 2AR9A 2PS9A 2WICA 3ZHXA 4KFUA 4DAEA 3ZLJA 1RI4A 1EUCB 1UP7A 4KYVA 2JAOA 4TTIA 3ITEA 1E5TA 4PZDA 2CHGA 2BFFA 3OO1A 2HJVA 4WY2A 3DCJA 3SYRA 3BXGA 4WK6A 3I62A 1YAJA 4QNRA 2AC2A 4QPNA 1U3TA 3ZDEA 4AUMA 3AIKA 2R6R1 1OPRA 1SHUX 4MITA 3ZW7A 1W35A 1IZ0A 2X42A 4NL4H 4RV9A 3C41J 3MOGA 1N32B 1PX0A 3BFXA 1M1YA 3ER6A 1UEXC 4Q7JB 5DHQA 4CKBA 5BYKA 3MS4A 3AETA 1SU6A 1ZC4A 3D4IA 5BSKA 1J2EA 3WGIA 4C87A 3ED1A 4LGMA 5ULLA 1DX4A 3GR0A 2VDQB 5LNK6 5LZ9A 4U2EA 1INLA 1X39A 3QUCA 1N5DA 1OFUX 2CXCA 1UKZA 3S5UA 4D4MA 3DFZA 2WJ4A 2UUBB 3G5AA 3OPYI 5F9MA 3G0BA 2FOLA 1E3DA 3I0NA 2YHIB 3H9CA 2OZEA 5TLSA 1K06A 5DN9A 4BAUA 2FQWA 1Q5PA 3D5EA 3ADDA 2XWSA 2W2XA 4J0DA 2H08A 3KEFA 4MIEA 3GFVA 4RCYA 3TM5A 2CLDX 1C1HA 4ND3A 3G23A 1GITA 3DFUA 3KTFA 1MRSA 2CGEA 5ABPA 1T9AA 2UUCB 2CJXA 4J7AA 4BV3A 1ARZA 5A04A 2WIGA 3ZCQA 1WU7A 5JOQA 1HT3A 1VSVA 1YKSA 5TQ2B 1DBWA 4Y1GA 5MF6A 2C0PA 5IXJA 5EEHA 5JU6A 4Q03A 4AY3A 5BSFA 1EDOA 4JP3A 2OD2A 2YOFA 3BD6A 3K9GA 3NGMA 4RJTA 3UH1A 5LXTF 4D5GA 4EHLA 3FFTA 2J9RA 1SQGA 3LYHA 3M1LA 3ZE9A 3PV0A 1E0AA 1TU3A 2AUTA 3QE3A 5F52A 3OPYA 4JLWA 2WZQA 2JAXA 4CKZA 2GXUA 1CDDA 3F0TA 3I61A 1JFTA 3MS7A 4AG5A 3I1FA 5EP4A 1A72A 1I6MA 3UFXA 4EG5A 3HTXA 2G1KA 4XSVA 3GNLA 4FEEA 4OPMA 1G20E 3UJHA 3N0RA 1L7AA 2RGGA 4GVPA 1ZK0A 4KVZA 4B83A 4D4LA 3C3BA 1AMUA 1NBHA 3CCCA 3MVEA 5EOVA 3I83A 4ARIA 5KVSA 1X3LA 1EK1A 4XSGA 1NXOA 1E6EA 3SVZA 1RMTA 1LJ8A 2FFHA 2ZU6A 4LF7C 2PZFA 4BLRA 3M6MD 3UMGA 3MFQA 2XGSA 3STWA 3TE6A 3KJGA 5LZ2A 2QN6A 3WJ1A 3QBJA 3IQDB 3RSOA 2D5LA 5LOVF 2UU9C 2GBFA 4O8CA 1V0JA 1HDOA 2WWIA 1FMFA 5I4CA 1SOMA 4ER5A 4XCQA 1JE1A 4RD6A 3HRIA 1LRLA 3LZ6A 3EF1A 4UPDA 1P0FA 5EEGA 4E4YA 5KJCA 3QU5A 1IXRC 2JAUA 3ETNA 3B1FA 2XCUA 1JDBB 2BBWA 3Q3IA 4O4LB 4RNDB 2IUUA 3VOBA 3ZC3A 3ZXIA 2W2PA 1CZUA 4ABYA 1BMFD 1U94A 4FOPA 4F9FA 3R7LA 1PEDA 5BSHA 2OCKA 3A06A 5EZYA 1AHPA 2BY4A 1Q1EA 3KAPA 3U40A 3SFVA 2XJ9A 3U7FB 2FSUA 2WAOA 1TE2A 4FC6A 4HGOA 1OWNA 1U7DA 5AXAA 3WNBA 2IZ6A 3OM8A 4JP5A 1UXOA 2BONA 2AFHB 3DDUA 1DRVA 2HMYB 3H5TA 3PJEA 1G5RA 5EJMA 5K01A 2DLCX 4S1NA 2JGFA 1NLYA 1QPBA 2HMSA 2DPHA 1BXGB 2QGZA 2YHUA 3J80A 4X8OA 3LD9A 3U81A 3B1YA 3KPUA 3I92A 1TMGE 1NLFA 2PMEA 2XT0A 3HKDB 3I32A 1D03A 3W5CA 1NMYA 1HWYA 2F4VC 4R2LA 4O2AA 4UASA 5LLSA 5KQSA 4W8HA 5IASA 1M34B 4A6PA 3K7EA 2QX6A 2GNPA 5DXFA 4N41A 4ARSA 1J5PA 3KAQA 5FFMA 3PLAE 4ENRA 1J49A 4BKQA 3TZ6A 4EG7A 3OU7A 4UCQA 3V9AA 1YDEA 2J0UA 4XD7D 5JQGA 1RYZA 2GNAA 2GJSA 3PGA1 1RM3A 5KTKA 4DNXA 3H5LA 3NB0A 3WIUA 2O0KA 2HSEA 4FYWA 2ZSKA 5L3QB 1UZMA 1GPAA 3D0OA 1B4DA 4FW8A 4YLGA 5E6UB 2ZW9A 1I7QB 1EESA 1XNQB 2EQAA 2VF4X 3EGCA 4HDMB 4P4SB 3OFJA 3LFHA 2X77A 2D2VA 2ZUCA 1QGUA 3B51X 4PLVA 3MHPA 1NI5A 3SBEA 4FNGA 4FOSA 4H6XA 3V42A 5HBGA 3QMVA 1P1CA 3BGSA 3HABA 5J23A 4OXKA 1GDTA 1VBNA 2OHGA 1JDJA 1FFGA 4NFLA 2H5IA 2O8VA 4HMOA 4OG2A 1I4DD 4JLVA 4RDXA 2FETA 1RWPA 3O1IC 4MKXA 1WUKS 1Z25A 2FSIA 1U0TA 1P31A 2R87A 4HYEA 4EHIA 3ZVNA 4WESB 3MGKA 4YMLA 1XLWA 3PXBA 2G4CA 4I2NA 3M3HA 2WIAA 1FIUA 4N7BA 1V60A 1ETUA 1Z6XA 2GH1A 4MS1B 1D0SA 2YQZA 4HB0A 1ZUD1 4NS4A 4MWBA 1S1MA 3F5SA 3M4JA 4IMJB 5CNJA 3BORA 3ME5A 3PEVA 1UM8A 4RD3A 3BIFA 4S24A 2OP1A 4C7XA 2VDOB 1WKCA 4W9RA 3HL0A 1BQ3A 5K45A 4ZCIA 4RW0A 2P3OA 2GDJA 3NVKI 2QGFA 4RMGA 3HU5A 1FX0B 3UC5A 2AOUB 4P86A 4V0KA 3V1NA 1Z26A 5EE0A 2PT9A 2O8BB 4M4SA 3NBKA 4Q1CA 4XGQA 5HMLA 3NTUA 2W00A 1D8AA 3NEYA 1J09A 4BC1A 1KYVA 4G5SA 1GZHB 4EHHA 5I9TA 3N7UA 1W93A 4EA7A 2D2EA 4MR7B 3QLTA 5KNDA 3G68A 3U49A 3IJ5A 3IQEA 2C84A 5AVVA 2UZIR 3E8MA 1JEJA 1TJ3A 2JJYA 3IFSA 2PX2A 2VYVD 6YASA 1WVIA 2ET6A 4GT1A 4UQLA 3JR3A 1DG9A 4ZAGA 3A7DA 3WWDA 1J7JA 1R10A 1NQTA 4XFDA 3DFKA 4BX9A 5KYXB 2PD3A 4PG5A 2BKVA 3PD0A 2AKYA 4ENWA 1LS1A 3FVQA 5E7QA 4WA7A 3VXKA 1S3FA 4UMFA 1BDJA 4JFAA 2HMVA 4EB0A 3OLWA 5CCXA 2BSAA 1IHYA 2AG0A 1ULTA 1FCJA 2O8DA 4HVTA 4K1XA 4DLZA 4JXJA 4L3WA 3FDZA 1CJMA 4BCDA 1FP4B 4N5IX 3CSSA 1FS5A 3QKUA 3RGGA 3A1WA 4ZHQF 1CCWA 2PROA 3JQ6A 1U8TA 1DARA 4LXIA 5I9BA 3W8RA 5JS7A 4QGHA 4TX1A 5K8IA 1J99A 1NBAA 4URYR 5BN4B 4E15A 1NVMB 1EKXA 2H7CA 3BZBA 4FMDF 3QLJA 4UQPA 1YRBA 4EO7A 3H75A 1GN9A 2BF4A 2BKXA 2GSDA 2ZBRA 3JD0A 4ODIA 1TC1A 4R41A 2PFKA 3G2HA 1KP9A 2A0FA 1KIMA 3KAKA 3OZAA 3QF7A 3SX0A 4FPXA 3RVLA 4DG9A 4FGSA 1PDOA 2EGGA 2YXEA 3VO9A 1F4LA 1G8MA 1Z37A 2J85A 1XMPA 4GSKA 4XWAA 1QHGA 4MGYR 1WW2A 3NGXA 1Z2PX 4NJMB 2G8LA 2OYCA 3G7UA 4NK4A 5DFAA 1OIVA 3KKMA 4F97A 2Z9CA 1HMYA 2SKDA 1YHZA 4BJHB 4XRGA 4C4PA 2JLXA 2AFIE 2HV9A 2QKYA 4OP1A 1ZN7A 3GCXA 4WKBA 3FOWA 3EBOA 1YB2A 3I3SR 5E3HA 2I3DA 3B6MA 4TVOA 4K03A 2ORYA 3F46A 1BO6A 2ZSFA 3FTCA 3O1JC 4MS3A 4RS3A 1NVKA 2WDZA 4PC3A 4RUKA 1QAMA 4RDIA 2IV2X 2A9VA 3CXUA 1OH6A 4TT8A 5F98A 4HOYA 4AYTA 3STYA 3SF8B 5PGMA 5GADl 2JLWA 1A76A 5EKDA 1ZH6A 2WM8A 3RT9A 3AOEC 4XPIA 2UYGA 4EH1A 2RHBA 3RV4A 2QMHA 2PX5A 3LHIA 2I1QA 3IMCA 1YK0A 5KDDA 4O02B 1AKQA 2MYUA 3V2UA 3TEFA 1LPBB 1XNGA 5JNVA 1QE5A 5FAKA 4JAVC 2QTCA 2FTKE 1F60A 1RRCA 3TTUA 2FHPA 1SVKA 3OESA 4CM4A 4EA6A 3FETA 1WULS 4CL0A 5AW7A 1M6NA 2I3AA 4J3NA 3DDCA 3P2MA 3V8EA 1U2PA 3O4VA 2O4UX 3PEUA 4CN8A 3MBIA 1UWLA 2ZT8A 1U3FA 2IJGX 3U7EB 3VHXA 2YIJA 4WKPA 3TQIA 2G77B 3K6SA 3OE4A 3BT7A 3AL2A 2PZMA 1V9LA 2ZVPX 4WV3A 3OBBA 3W8DA 3O4FA 1VXOA 4PCVA 3W2IA 1B7GO 4GOOD 4G0QA 5CLFA 4A4DA 4FMCF 2QGNA 4OH7A 4YJHB 3MJHA 3WWEA 1U28A 4EYSA 1X1SA 1V96A 2BGTA 3RRBA 3KHTA 2A92A 2HFJA 3DE3X 3FVWA 4KQKA 1XU7A 2DFKB 3K5WA 4Y2YA 3VU9B 2FF7A 3HDJA 3PFHA 4BO3A 5DWVA 1L1QA 4RVOA 5DF1A 3X2SA 1NP3A 1YR6A 3UATA 4W5OA 3L5KA 1VJ5A 3EUAA 1SXJE 4UFNA 4WOBA 2PKQO 5JRHA 2FEMA 3LWNA 1L5YA 4K28A 4CEHA 2VAXA 5IZCC 3HSYA 3I45A 3L7MA 1DAPA 3T7EA 1C80A 1Y9ZA 1TL7C 3TW4A 2PKEA 3F5DA 2NXJA 1BD3A 3OMLA 3AXTA 5YASA 4EHFA 3M49A 4HQOA 1RG9A 3M4XA 4M0MA 3VPSA 1D2RA 1Y6FA 1NF2A 2G9UA 2V3CC 1GQRA 3E8XA 1L5ZA 1J2TA 1ZKDA 3A3NA 3JQQA 5MN6A 5DX1A 1Z13A 1T24A 2HPHA 2XUAA 1MR3F 2BBTA 2HUNA 1SHZA 4TM7A 3OWHA 5EG5A 1E1CA 3NTRA 2H0RA 4CM9A 1MA3A 5E9AA 3D2LA 4MUAA 2HSJA 3ZVRA 4DY4A 4ZCMA 4TRNA 5FPPA 3UJDA 4CEJA 1P80A 4GPIB 1KEEA 4IEFB 3OETA 4IKEA 3BJEA 3QI2A 4QPZA 3U48A 3G17A 2I6TA 3OFVA 4J7XA 4NZNA 5JSKA 4R0VA 4P7GA 1ZK2A 4Q3KA 1G41A 3QW4B 2C3UA 1IXZA 1O7JA 3A1CA 3ABQB 1N8TA 3VDQA 2J9FB 2G9RA 1LY1A 2BP7B 1R0LA 3FZEA 2H9YA 3DL0A 3STVA 2IUTA 1JG3A 2CVFA 3QMPA 1QUEA 3BXXA 1ZGZA 2NV6A 4KNWA 1SRQA 5FA8A 1RZ3A 4YRJA 5G0UA 4BWVA 3QVGB 3GJ3A 4OXXA 1ULUA 1LDNA 2PGNA 1C0KA 3IR6A 3PL5A 5TC4A 3ROEA 1Q91A 1LF0A 2XUFA 2IS4A 1ZSYA 2FW0A 1JVBA 3MM4A 4HUQA 4MR9B 3VX3A 4BJ3A 3ADCA 4P7BA 3Q3VA 4PSVA 1TYEB 1A8SA 2P30A 1IG3A 1OYWA 3COVA 3EGDB 2HA6A 5JSZB 10MHA 3A6EA 1P4AA 3LCUA 3P7MA 3REFA 1T2AA 3O8OA 3R7FA 4TV8A 4BNXA 5K0TA 4LSMA 3OZEA 1NRIA 4BX0A 2VPWA 5GVRA 2PA3A 3FZGA 1CVIA 1RJWA 3KD2A 4YCJA 3LBHA 2CHEA 2A5DA 2PTGA 2PZLA 4Z1MA 5J9FA 1XN4A 2ZZMA 2G8NA 2YWGA 1JMVA 1UJ4A 3D3NA 1YCGA 3WRVA 3T0GA 4D0GA 3QYFA 1JQEA 5JXGA 4EYKA 1KAQA 2VYFA 2JI8A 1TU4A 2VUTA 4YMWA 4NZYA 4CNBA 5IFLA 4L5CA 4P22A 3R7SA 1N3YA 2ZSBA 1QFXA 3JWEA 1B0AA 4KWHA 3T1QA 2WILA 2ZJ2A 4ND4A 1NVXQ 5EJGA 3TNJA 2F55A 3EGDA 1X86B 3W7VA 5JSZA 2DULA 4FKMA 3DOEA 1Z9BA 1QWIA 3AK4A 3QKRA 2HL6A 1GTG1 4W7HA 2FQYA 4HUQB 4MR9A 4WY5A 2FFJA 1I94C 1OA1A 4EPTA 4YCMA 4C20A 1QCCA 2C58A 2OPLB 2LZ0A 3KPJA 1YHYA 1FNCA 2CYCA 1G5IA 2GK4A 3B1WA 4MGKR 4IXWA 1P62B 3EXFA 2JLZA 4MRAA 2IPAB 3GEEA 4DSNA 2I87A 4MHOA 5ECDA 3SMVA 3I9JA 2O1SA 4LSGA 2E55A 1FVHA 4QU8A 3GLKA 1NVWQ 4RELA 3BMNB 1H23A 1IZ8A 4ROSA 1PR0A 2GZ1A 2X2EA 5AKYA 5GWXA 5LOVB 2XVMA 2AN1A 1CVRA 2Q0QA 3JD4A 1X70A 2JGMA 4DXAA 1XRSB 1T8YA 2HPVA 2WWHA 4GKVA 4DVGA 2ZQZA 3N39C 3STTA 2C59A 1H2RS 4LC0A 5F76A 3UM9A 2E87A 3CFYA 1J5EC 4LYAA 2POCA 4LFAC 2HSWA 2WJJA 4GP6A 2QTLA 3P52A 3GVXA 4WGGA 2XEDA 1I5OA 4M8IA 3WSVA 1JHMA 4M0FA 1OYVA 3O92A 1JSLA 5LUBA 9MHTA 5DASA 4QZVA 1S01A 3G0DA 4NABA 2ZRHA 3IXMA 1L8AA 4QBHA 5TRTA 4TYQA 2XRMA 4IOMA 2DPGA 1VA5A 2FJUA 4LECA 5GV8A 2AE2A 4JMLA 1JSCA 3FGPA 3Q3GE 2V03A 4JUCA 2HCTA 4KAJA 2E6UX 1QFMA 1C1DB 3PPXA 5ALRA 4AYWA 4D81A 1VG9B 2WA1A 3VR2A 2A7XA 3JQRA 1TJNA 2VDLB 4IQGA 4L5BA 1SUFA 3V4VB 4Q7MB 3O91A 4CEHB 4D3YA 2IIBA 1QYIA 3SKVA 4NKRA 4TXLA 3UWOA 3A6PC 4P1ZA 4YUVA 3ZDBA 5EP2A 3U1BA 2G9NA 2HCBA 4BNNA 2G6BA 4OCZA 2SBTA 4NOLA 3GVIA 1QZXA 2ZRNA 1QG2A 4EL0A 5CW2A 4WX2B 2DQYA 5EL0A 3CUYA 4AQYB 4DLLA 3GEPA 1JKJA 2GYYA 1Q1QA 5L3ZA 1EFVA 1OZAA 4DJDC 3HR4A 5JJBA 2GF2A 1FXWA 2YMMA 1M34E 2HX1A 1Z2OX 5HZGA 1R6TA 1P72A 3EY9A 1CUXA 2JHCA 3EHEA 3CUEF 1XTVA 4PSCA 3RFUA 2A0WA 2ESRA 3DAPA 3QPDA 1BXRB 2JGEA 3O9VA 3HA3A 5FUYA 1DKNA 3KUKA 2ZRLA 4RFSB 3HKEB 2NX2A 5A3SA 1EQ2A 3R74A 2XX3A 3GELA 4QELA 1Z18A 2AFRA 1Y9DA 2JCSA 4NATA 2JKYA 3OLYA 1G5QA 1YA8A 4TM8A 2WR8A 4D6XA 1SBHA 4XIYA 3QM1A 1WQ3A 4R0NA 2QLBA 3KPWA 3F97A 3NR2A 2OA0A 4NU0A 1DBQA 1D6NA 1ZDMA 1NXQA 4L3OA 3VO8A 2LUOA 1NBOA 4INAA 3U13A 3AILA 1NN1A 4DFDA 4P80A 3GVCA 1FRFS 1FFAA 1JNXX 2X5NA 4LI0A 1S2DA 1HR0B 2MSDB 3GGDA 5I5GA 4II2A 2C2ZA 4P7FA 4FIZA 1QYXA 2Y71A 2C9CA 2OFPA 5CLQA 1XHFA 4EVSA 3BHIA 1ZCAA 3SHVA 3M9XA 3ESYA 2BFEB 4NJOA 5CNKA 5C4GB 4HB3A 1S02A 1BDHA 2RGWA 5FNVB 1WUHS 4PM4A 4EEKA 2MSCB 5KHOC 2VHXA 3AJEA 2EIHA 3TE7A 1AZTA 1IWPB 1YOVA 1E6LA 2FWAA 2LIVA 2PVPA 4C7JA 4DPMA 2G1PA 1TO6A 3AONB 3QOFA 1DIHA 3S7TA 1N2CB 3T7DA 5A7GA 5KU1A 1SELA 2RH9B 1LI5A 1YIOA 4RZUA 2QE7A 1WTAA 3O38A 5FWXA 4K6MA 5B3JC 4CLOB 2A8YA 2BIFA 3BERA 3EXIA 1GADO 1IN5A 1MT0A 1PFVA 1FJXA 4PLHA 4BRZA 2CMKA 2CHQA 4OHFA 1UZUA 4K40A 5AHKA 4Z49A 2GN0A 4H0NA 3RIGA 4LY6A 4OIMA 1WXDA 3LRXA 4KPUB 3JQAD 4LRTB 4MOWA 2W2QA 5FXMA 4DW8A 3CTPA 1M1ZA 3V7YA 2OKCA 1CUSA 1QR6A 1KJ8A 1E2EA 3ZDAA 3PX2A 5IT4A 2OK8A 4QNNA 3ZJ5A 1UAAA 1VSUA 3O7MA 3W3AA 1Y98A 5KX5A 1FTSA 5HS6A 2GJ4A 3D7LA 1ZN2A 1IPFA 3W4JA 2FDRA 5D01A 3QUTA 2W42A 1FP4A 2H11A 2W4IA 3ES9A 4Y6OA 2ZIXA 5ALQA 5TEVA 4M88A 3ZQJA 2I29A 4OVKA 4RCZA 1QM5A 2Z8YM 2NNWB 3KTDA 3L7OA 4R8LA 4XDYA 1Y34E 4PG4A 3V4RA 4DR4B 1NW5A 2IYVA 3OEHD 4K0RA 3EF3A 3CB4A 3NDRA 1XMVA 4KN9S 1ZNZA 1I4WA 9GPBA 4ND8A 4F11A 4LWQA 1UBMS 1RPAA 1TJPB 5E6RB 3RVBA 1M5TA 1G6HA 1XAGA 3U31A 1Y9AA 2GPBA 3KQUA 3H0CA 3V4PB 4AX8A 4BMSA 1G8YA 5C5DA 2J07A 4H15A 2H1OA 4UHCA 5G4KA 4DAOA 4JI8B 1N0VC 3MIIA 5JC1A 2R25B 4DEXA 4HF7A 3DM5A 4MR7A 1KY4A 1MB4A 3OCCA 4L1KA 2Z5GA 3B8EA 3IP6A 5FPYA 5LVAA 3QBDA 4OOEA 4MYTA 5TGDA 4YMTA 1T5OA 2YZMA 4BIIA 1PT6A 4MGEA 4CM8A 1WXQA 1GFIA 2HJRA 3DD1A 5JAUA 1MX1A 1T1RA 2J6IA 1OTYA 3GXOA 3AH8A 1VCMA 4L50A 5JD3A 3BK2A 2JATA 3C74A 3KZCA 4OQEA 4QDTA 1O57A 1KTIA 4NULA 1AQYA 4ANFA 3A14A 3D1JA 2VK8A 3PHBE 3OTHA 3OAAA 5I7WA 1KOGA 3AM3A 3AVYA 4COKA 2B8NA 1LRKA 4M54A 3VDRA 2XODA 4QEZA 1E69A 3AHFA 3IXLA 2NPOA 2AWNA 4IFEA 4F12A 2R1TA 1TXGA 3EXIB 3H2HA 3ML1A 1XOIA 5L7TA 3N8NA 2RHWA 4QPDA 5C8YF 4YI5A 2JW5A 3PE6A 4LDNA 4C7OA 2VRBA 5DW0A 3HDYA 1Q1AA 2WUDA 5LBUA 4MS4A 3ROFA 4IQ8A 5C7LO 1NXXA 2DTEA 3N53A 4WCFC 5LQCA 3FHLA 5F7JA 1H9AA 3M4YA 3N7TA 2WZBA 4OMDA 3AI1A 4ESVA 5DHSA 3M89A 1Z74A 2LCFA 4KPFC 4UD2A 1GGFA 4ADSG 2XDYA 1SIUA 4H1TA 2ERCA 1RQPA 1VIYA 5CGZA 5J4VA 3R24A 3WQRA 2VEOA 1R8JA 3OZDA 3EISA 3O26A 2XWPA 4NNOA 1VHJA 6Q21A 2D1TA 4L85A 2HA5A 2PGOA 2QLNA 2KSQA 1DQPA 3H8WA 1A04A 2IK8A 1FNMA 2NNLD 5DYNA 5CA1F 4F93B 4DV5B 2WWXA 3OLCX 1H85A 3UANA 3VPCA 1L3BA 4QUEA 4D9FA 1ZI9A 4ZEVA 2R8XA 2IEAA 5LB4A 2ATVA 3GLGB 3ICVA 4KXLA 5ESRA 3NTVA 4U1RA 8MHTA 4RH0A 1YU9A 2CEKA 1R5OA 2I9PA 4ZA2A 1ZI8A 1KQPA 1MG5A 3KBBA 5JNTA 1GQOA 1O5IA 2IU0A 4QBIA 3FCYA 1BX0A 3AEZA 3O3NB 3PNLA 4RDCA 5AE1A 1C4WA 2Z08A 3KKEA 2PNFA 3DE6X 4N4AA 4ZGGA 4WRRA 5I01A 1XVTA 3HKEA 2AXQA 2EEPA 4MEBA 4FX5A 3OTIA 4KMRA 4ZYTA 5B6IA 3V55A 3CPSA 1K6IA 5CXSA 4UNRA 5DIFA 1QRTA 1LPSA 5DTRA 5F2NA 5B1HA 1AMNA 3OM1A 1GUZA 3ZDCA 1UDAA 1L8QA 4AJ2A 2KQUA 2P3LA 3UV3A 4LYFA 5K3AA 3K96A 3WJ2A 4CCYA 4ASUD 1YIAA 4AY6A 4X7PA 4ESOA 4WOCA 1NLZA 1ZB9A 1ZJWA 4R8KA 4LV5B 1ZMTA 3OEWA 3R7WB 2AMJA 1ZOLA 4YAOA 1M0WA 2P0EA 3WV4A 1G6OA 3A11A 3NALA 3HJAA 3MOIA 4GKJC 2BEWA 1KJYA 5EIOA 1R4AA 2P5UA 3FUUA 5EZYB 2GM9A 3ETDA 4JI1B 4A5OA 4G1IA 4ZI5A 1MORA 3LTEA 4RF5A 4EEXA 2GHRA 2Q3JA 1QIFA 4R31A 5C3MA 2X2OA 2WE8A 3BPSA 3STUA 3D7RA 3IQWA 3Q6IA 4L22A 4DYVA 3QK7A 1A3CA 1JPVA 2BFEA 3HUEA 3B1ZA 4N65A 1HRKA 5L7YA 3F71A 5LM3A 3HVIA 3F74A 1PR9A 2QLJA 4QEDA 2CEAA 4QXMA 1WDKA 4HX9A 4RCVA 2WUWE 4WN9B 4WASA 4BKMA 5FWNA 1Q0SA 4ZWNA 3TO5A 1RIFA 3BRSA 1M0EA 2ZUVA 3WLLA 1RHQA 1EM6A 3LVBA 3HPRA 5FO1A 3SJ7A 2ZSDA 3D2CA 1J90A 3QA9A 3HVKA 1X1CA 3LX4A 1JHPA 2J30A 3AW9A 2VDWB 1YXMA 4J6EA 1E3MA 4UC0A 3AV3A 4MP6A 2VT3A 3NHZA 1UQRA 1HNNA 3X1XA 2YW9A 3QNMA 4Q7EA 4C4TA 3AVWA 5FLXD 1X9HA 2OFOA 1WBJB 4LE5A 1KOFA 4O29A 4YUXA 2ZI9A 2CJWB 3NHSA 3ZV6A 1KH1A 1V4NA 4Y0AA 2Q7DA 4XX0B 2OXIA 1R2QA 5KSOA 3DOIA 4BNGA 1Z06A 1J06A 1Y9EA 3KBOA 3LP6A 2GT1A 3IBSA 3B52X 3WKBA 3ZU2A 1BA2A 2A5YB 2R1VA 2NSDA 1BXRA 3CO5A 3FMOB 3M4NA 4FQ8A 3D8UA 1NTOA 2QRHA 1U80A 4BO2A 3EZLA 1N6LA 2AGVA 2GD1O 2V7XA 1FVFA 3EZGA 3SX2A 2RGRA 2B94A 4IHAA 4ZVQA 4FWIB 4UD6A 2Q1WA 1QP0A 3FSRA 1O87A 3BILA 3IX7A 4MW1A 2VJQA 1P1RA 4Y9SA 2ZSUA 3PQDA 3R0VA 2ZIGA 1OOEA 3JALA 1F2UA 1HX7A 3LY9A 4J2TA 4YGXB 2VYND 1K3FA 3UMSA 3ZQUA 2M6RA 1GNSA 3GAFA 2QT0A 4ZO6A 4DGSA 3REOA 3R0IA 3Q9NA 4EPYA 5EPUA 1IN1A 1N25A 2ZJBA 2OM2A 3VNRA 3GT0A 4L7VA 4NICA 3N8DA 4OYLA 3JASB 4Y6LA 3R7AA 4IEIA 4I4LA 2PUVA 1SCAA 5A9SB 3NBYC 3DEKA 4ZGBA 4TLDA 4M9XA 1WXFA 1C1DA 2VO1A 3IAUA 1R5JA 4IJUA 2RGBA 3RRMA 2X76A 2E2WA 3FPJA 5IUJC 3T95A 1ZVMA 4D4IA 3JZAA 3DZGA 5BWLA 1L3CA 5KOIA 3LCMA 3FPGA 2YS7A 3IEXA 5C7YA 1Q17A 4HGQA 1N1GA 2Y4NA 2NZ2A 3BXEA 3LP5A 2GILA 2NU7A 1KKLA 2O7QA 1PQUA 3VC2A 2WWRA 2HF8A 4LC1A 421PA 1IE3A 1UZNA 3WLAA 1EHIA 1Z39A 1USUA 2JIBA 1DPGA 1M1YB 3BD7A 1HT0A 3QXHA 1W1IA 2WT4A 2ZWVA 4M87A 2PY6A 2WVGA 3VKVA 2LP4Y 3DF9A 2EFYA 4BAZA 3HY3A 5ICSA 2JRCA 3KX2A 3QPVA 3UX2A 1T34A 1N2IA 2Q4EA 3JSAA 3IKLA 4KREA 2V3WA 2CXXA 1MIHA 2FZEA 4LYGA 4DKXA 4IXDA 4E51A 2OCPA 2IGBA 4Y6QA 3G13A 3VC3A 1WB9A 3H3JA 3F3KA 3MPUA 2IQ5A 5AJUA 1ECGA 2QQ0A 3EF0A 2G3YA 2FWJA 4N03A 4QXOA 5IDVA 3PSHA 4R98A 4CIXA 2G1AA 2KLHA 1AHNA 4J0GA 1DC4A 5JO0A 2ZI7A 4X91A 3TZEA 4PRKA 1XP8A 3AB7A 4IJMA 2ARKA 2L0XA 4KO1S 2R7AA 1KK0A 1P5RA 3CONA 1CS0B 1FJGC 1DDGA 1ZEMA 3ND5A 4Q3LA 3SE7A 3WYEA 3JZFA 2AK2A 1U5AA 1A9XB 3FYSA 3GKUA 3D64A 5JVDB 4XGNA 4DV4B 4NEGA 3UB4A 4U2KA 5EZSA 1NKSA 5C1OA 1U1GA 1PQPA 4R3WA 2OAEA 2O07A 4DUGD 2FEKA 2GPNA 1LWNA 5H7XA 4DABA 1LRJA 4YDRA 4F60A 1G21E 4PO9A 1L1FA 2QIOA 1XDBA 4LJRA 3GA0A 1HNZC 1JDBC 1ZNWA 1QGAA 4L95C 3KYDA 2QBYB 1EX1A 1Y3CE 1P4EC 2MSKA 3OEHA 3PCRB 3KUUA 4E1AA 3GEHA 4ZAFA 5AW1A 3FF1A 1DWPA 2VPPA 2PH7A 3FTQA 3NIBA 1ZD5A 4TQUS 4BZPA 1JG6A 4TTSA 3AI3A 1D2AA 2JH8A 4LYDA 5A4MS 4A8PA 4NMLA 7ADHA 3RTEA 1ODCA 1K6EA 1T3TA 3QNWA 2J3DA 3F4BA 3GRVA 2F3RA 3ENKA 1XRAA 4FYVA 3O0TA 4PHHA 1Y33E 3TEJA 1T25A 2IL1A 1MX3A 3ORFA 4CG3A 4MR8B 4UARA 3IOCA 4DR7B 3IEPA 3G2JA 4Y0VA 5GZ6A 2P90A 1GTMA 2H2HA 3G7NA 4ZALA 4ZQHA 4LDJA 1J00A 1A7JA 1THGA 5BVGA 4YA6A 5C18A 1XV5A 4MCAA 4Y9TA 3T5PA 1SG6A 4WZ6A 2QSJA 3VNBA 1V2GA 3PIIA 3R6DA 3WXMA 5IK2D 4HTFA 1H4SA 1JZQA 4M76B 3HB7A 3CUTA 3ONFA 1MQAA 4G5RA 2BI7A 1WR8A 2IUYA 3UT5B 5C1BA 3E7XA 1YZQA 1LB1B 1GQFA 4JEUA 1YS4A 1YO6A 2VBFA 5T57A 1TMKA 5EXSA 5E4FA 4LFCB 1J0DA 5LMCA 1E7YA 4JBXA 1RWWA 4JASB 5GJWC 2IDKA 2O8FB 1C2TA 3DM9B 3L93A 4MMZB 4Q6BA 4WY8A 5IDWA 3DZBA 1UXJA 1XN1A 5KINB 3P4XA 2HDHA 4L72A 2PG3A 2JJMA 4B3IA 5HQTA 3BJIC 4PW0A 4QPJC 2XXJA 2OCBA 4QOJA 1ISGA 3DE1X 3RFCA 1KORA 1J33A 5T8KA 5AD1A 3ITKA 4CIBA 2I8AA 3U16A 2BGGA 3MW8A 1ABBA 3QVSA 1ISHA 1H0KA 2J7PD 1QV9A 3AF5A 3BCUA 4TLLB 4WERA 4YHBA 4YCCA 4JB8A 4D6YA 1JJFA 4AMZA 4MR8A 2HW8A 4E22A 4J2OA 1P74A 1RPNA 2D5IA 2FZ4A 2OBXA 2DLNA 4GXNA 3SYMA 4KR7A 4A0FA 4ER3A 2HNBA 1BEZA 4Y7CA 4NYJQ 1DVRA 3OIYA 3HGTA 2QL8A 4CDNA 2PS0A 5JH7B 3WHIA 1OZHA 4OQYA 2JFGA 1EZ4A 4YAIA 1XG5A 1ZZEA 3WGTA 4IJQA 3AJRA 3DF7A 4PO3X 2GCPA 5A2GA 2B6NA 2FY8A 5CJPA 3HXKA 3L0YA 4IKPA 3K0SA 3BXPA 3I07A 1THTA 2C5GA 1WD5A 2W2VA 1DKPA 5LA6B 4HJRA 1ZL0A 2C07A 2H4JA 2IX9A 2XRFA 5J4KA 1T2NA 1ND5A 4G5YA 4LZJA 4AKTA 1XMJA 2FCRA 3K2IA 3PFKA 1RXSA 3PRKE 4IIVA 1TCBA 5EYPA 1HNWC 1MXHA 1RAFA 1XZGA 1CR6A 3ABZA 3CJEA 1ZWLA 3LF2A 4Y2HA 5DBGA 5DKFA 4UVHA 5EC8A 2WNIA 4ZVKA 3SM3A 2FPMA 4GD3Q 2NT3A 1FDWA 2Q5FA 2V9PA 4N9QA 3ZCRA 5JD5A 1KRXA 1XR3A 4IIXA 4S12A 5H1YA 2YCLA 4IHJB 1SC9A 4JROA 4RO0A 5TR9A 4TLEA 5DBIA 2BGMA 3OH8A 3OAAD 3PZRA 4J49A 4A0SA 1M33A 2QUBA 2FWPA 4NOJA 5HIAA 3ORRA 1SUIA 4CDGA 1MGOA 4DSAA 1O0BA 3H5VA 2CLKB 2IP1A 3C85A 2E82A 1KDVA 1P81A 5DNDA 5BR8B 2J08A 2ODAA 2VS1A 3R5FA 4AG3A 4PHTA 5DV9A 3EJWA 4RKYA 4A73A 1IULA 1M7HA 1MW9X 1QUFA 4BNUA 3OC0A 2J1LA 3LBAA 4IJVA 3K0AB 4UM9D 2PXXA 3ZG6A 1EUZA 1T0IA 4PYLA 3TLMA 3QEOA 4L8YA 3ZNPA 4CMKA 2DMRA 1VFPA 4HATA 1B16A 2MINA 1HEIA 3I5YA 5H8WA 2WJ3A 1NIJA 2EQ5A 3RSGA 1MX5A 2FUEA 2JBWA 3JQEA 3DFMA 1FUIA 1QKKA 3PQ2A 2E4UA 5JJCA 3W06A 2WWFA 2GBLA 2G76A 2V7QD 2WPNA 1KXJA 3LDHA 1LXCA 4DMLA 4UEKA 1DXHA 2ZR8A 1FDOA 2P02A 2JIPA 2W70A 2MSEB 1UWKA 2AMFA 2ZZNA 1M2VA 4YUYA 2IYSA 5BVGB 4J0JA 2COKA 2RFLA 2IIPA 3M6UA 4XB2A 1GGJA 3L6UA 4D0NA 2JIRA 2QPTA 2X9GA 3BCSA 3D0QA 5JLAA 4KQ2A 2X4GA 1ESCA 4JI5C 1ZG3A 2VH5R 3ADBA 1FZTA 3R3VA 4ZIRA 2JA2A 1R00A 2IZ7A 1IAVA 4FFLA 1I7PA 1UMBB 4NI5A 4TKZA 3HEBA 4KLCA 1P5HA 3K8OE 4RGVA 4Q9LA 3RU9A 5B4TA 1ZMOA 1C4KA 1UWCA 3WIEA 1EINA 1M1UA 5T7BA 3D3JA 3I04M 2FEWB 4QDXA 1YGPA 2GQ0A 3Q2IA 2E4ZA 1NJGA 2IDJA 5EJIA 4PY2A 2ECPA 3RLIA 4B4KA 3GHYA 1Q92A 1HOXA 1FW8A 3CS3A 5E1DA 3WL8A 1DBPA 5IMSA 3A2KA 1E1MA 4I9UA 1ICEA 3B3GA 3KXKA 3QKSB 3UXMA 1QGUB 4IDDA 1NMEA 4WCDA 1V1MB 2WUEA 2M6KA 1R0KA 5BWBA 2E4YA 2B37A 3CEMA 5EVCA 5JWOA 3PXGA 1HG1A 2XTZA 5KTOA 3UNXA 1RXWA 4E14A 4QJBA 1PDWA 2I6SA 3EX7C 4Z1MD 1HE4A 2R7LA 2GA8A 1M6YA 1U65A 1XQWA 4I1UA 4IXMA 3U7QB 5JQGF 2JGRA 1RAEA 2V7QA 5M7EA 4C03A 4KL8S 1QWSA 4JWKA 1CXZA 1GAEO 2H4YA 4JOBA 4HXFB 3VR5A 4DUYB 1JS1X 5E2IA 1W49A 4WCFA 1IQRA 3EGEA 3GDWA 3KSRA 4GOND 4TXNA 1K6MA 2PXCA 3KTAB 4KP7A 1JFVA 4V03A 1CF2O 4B6SA 5KTNA 4DMCA 4R7ZA 2V5AA 4LBVA 4RY0A 4E2XA 3W5AA 4FYPA 1VKNA 4P4NA 1T2EA 5H70A 1FSZA 5EIXA 2JH3A 1KJZA 3E23A 1K98A 2QVZX 1WKBA 1XTIA 4Q3CA 1UQUA 2UZ4A 3DB2A 2GNOA 3ZY6A 1Y82A 4PPGA 4GR4A 2ID9A 4Y30A 4X62B 4AQ7A 1DC7A 2E49A 3I8XA 1WZEA 4QBGB 2A78A 1RLTA 1XEAA 4MS1A 3T9FA 5ALOA 2Y6UA 4G4SP 2VBIA 3LXUX 4Q4CA 1R0YA 1PFYA 2ZB8A 2G9ZA 3EB9A 1IQUA 4H77A 5ED0A 4HDRB 5ICFA 3NHUA 3BHJA 3H5OA 3WLNA 3KOUA 3ZGZA 4RU1A 3ZI7A 1TKRA 3OZRA 4MICA 3ER9A 3MYRA 5IAJA 3SXUA 2VUUA 3QX8A 1E1DA 4DG8A 1KAEA 2BV3A 4ENTA 3B38A 3CH5A 4MVCA 1HDGO 2OOKA 1C0IA 2VBGA 2ZTSA 3L77A 1EGHA 4M8NE 4RANA 3SK0A 4DLTA 1DC3A 2RGCA 2XGGA 1CUYA 1G6Q1 4M36A 4ZVNA 4IMPA 4IJ5A 3W05A 1K5DA 2ODEA 3WYGA 3IV7A 4EI9A 3O21A 4E0BA 1TA4A 4NV1A 1NYEA 2AYZA 4PG6A 3WKCA 1P0MA 2WFZA 4YB8A 4KUGA 1U3DA 2OHFA 1UBTS 4LRUA 1FTNA 4EHDA 4NZZA 3NTOA 2D5AA 1DSSG 5HHTA 2XMQA 2F3UA 2XIJA 2X0JA 2AR7A 2VZEA 3ZV4A 4D9IA 4X65B 2EFJA 2DUNA 1RP7A 3GB9A 3HBFA 1XO1A 2X0NA 1THMA 4FGJA 1L9KA 1PSZA 3JVVA 4FYYA 5FUBA 1A8UA 3AUXA 4C2AA 4ER7A 1LFDB 2ZRPA 5AVSA 1I3CA 4ZYYA 1U4OA 3N87A 1EBUA 3MUEA 2ZJ0A 2XXBA 1WMBA 5THKA 1U0HC 4X84A 1TK2A 4CYMA 3FXAA 5EMKA 2VH1A 2QMQA 5HKOA 3DKVA 4MV9A 2BN4A 2PQ6A 4F4CA 5L6LB 4QXRA 3GDHA 3OPQA 2N75A 3BGVA 3KXDA 4YRTA 4HRAA 1IXKA 5AOVA 3GEIA 3V46A 3ZCTA 1M6VB 4IH1A 4DJJA 1E5LA 2YWJA 2ZREA 5IKEA 3PEYA 3WADA 3AP1A 5B30A 3UHPA 1VCNA 1TLFA 2Q3EA 1DOHA 2NZ8A 1J56A 1GL9B 2ZTLA 4R54A 3L0DA 1V3TA 4CNQA 3D6JA 4MGZR 4CIAA 2OAQ1 1HYGA 1ML8A 1R3DA 1NW8A 4KN6A 3NIGB 4B79A 1DKLA 2PKRA 4GI3A 3WJAA 5IT5A 4NAHA 2Z6QA 4A2PA 1XZDA 3CZ4A 4NC9A 3FGZA 3HE3A 3JTEA 4DG5A 4D96A 5CLLA 3B3JA 3U3DA 3MRXA 2NU7B 3IVGA 3SG0A 1NVTA 5BV2P 3WWOA 5GGXA 1Z4QA 1HFWA 1U2RA 1EVEA 1Z8NA 2OUIA 4F2GA 1WXGA 3C6BA 1V8PA 3EW9A 4DMKA 3YASA 4LF5B 3B1JA 3OZTA 3UMFA 2F1KA 2GLXA 2R1TB 2QR5A 3PS9A 4A16A 3HKBB 3N8KA 4B80A 3TCKA 1O6CA 1G3IA 1ZD4A 2H1SA 4KQHA 4TT3A 4CF6A 5TQVA 2QAGC 3BE4A 2GPSA 3MJTA 4H1UA 1FMTA 4A27A 4E46A 4Q39A 3R7WA 1QIKA 2JLBA 1TW3A 4Q05A 4WI1A 4LDAA 3SU8A 1Q0TA 4YR7A 3MMZA 3UEOA 3FRJA 3MA0A 3CZCA 5AHWA 1BC5A 1XTTA 3OIWA 3ULKA 1KEWA 3FCUB 4UE3S 4DV7B 2Z4TA 3EIFA 3V8VA 4EB8A 4ZRDA 1M8GA 3LUDA 4YMGA 3PHJA 3S7ZA 2G70A 3KQHA 1Y3HA 4TT3D 1UBEA 1L4YA 3C5VA 4HLUA 2VG8A 5K4HA 4HS4A 2QRNA 3FROA 4P35A 4CCWA 4F56A 3PF8A 2QZ4A 4BFXA 4HNQA 1S3IA 1XK7A 4IGEA 3L9WA 4D8UA 4LRWA 4YCAA 1NI4B 3SIXA 4IS3A 4AWBA 4S1VA 1RYYA 2TMGA 2QVGA 5J5AA 1NA5A 1EG2A 5KSPA 4BDTA 1C1YA 1GXSA 3ID6C 3ESXA 3IBCA 3NVAA 4WZZA 5TT1A 3L1HA 4ACAA 1JH9A 3NWBA 2ZKLA 1QHYA 4RA6B 1WL8A 4JA2A 5ERGB 4WNYA 2D7DA 4RZXA 2WD7B 1Z0DA 2F9MA 4IP0A 5EZ5A 1PKEA 1Z45A 2IXAA 4TTTS 3TAHA 5J2UA 3Q7PA 3QF4A 1X7WB 1HT2E 3T3HA 1DCMA 1XCGB 3PBKA 1OFGA 3I04A 4OQMA 2QMZA 1SXIA 3E61A 1FFWA 1ZVKA 2RK3A 1QSGA 4H7KA 4X8MA 2I76A 3S1AB 1M2JA 5HXAA 3DHEA 4PS1A 4JI3C 4E21A 4E12A 1DU4A 2YV4A 3UOGA 3MMXA 2R47A 2EKZA 2BEWB 1CETA 2XMDA 2MIIA 4AIIA 1F12A 3UUFA 4L4RA 5U4QA 2FMXA 4BBAA 3WJ7A 5DP1A 3CKKA 1C3OA 4MQFB 3QPBA 4JR1A 1F51E 3DDOA 1L4LA 3ANTA 3G1UA 1QFJA 3T3GA 2J67A 2FPIA 4G8CA 1FLNA 1RVV1 1YASA 1NC3A 1GTZA 3TTXA 2W11A 4LG1A 1HK7A 3CNLA 3IRUA 1U90A 4IDFA 5C31A 1CRPA 4TKVA 2Q6LA 1Z62A 3EQZA 3G0OA 3MGCA 1FUUA 2REXB 3CF6R 2C0CA 4DJEC 3CSDA 1JF8A 2FG5A 5EE1A 5EUQB 2BE7A 3LVFO 2GLUA 2R1UA 3H1FA 3ZD8A 5AW2A 4BNFA 5BMOA 4BN4A 1DO8A 2GN8A 1QCDA 2I6GA 3ZU4A 4C01A 4DGQA 3DMDA 13PKA 3AW8A 5HIJA 5JZOA 5DRTA 3S2UA 5BV0A 2IP4A 1FXSA 4BV2A 4O4JF 1DC6A 3OLVA 4D1YA 5DNVA 2NPIA 2WOJA 5JS2A 4YRRA 1F2VA 4YT8A 1A1VA 4YRLA 1P4GA 1XHEA 5K2MA 5BQFA 5G0TA 4FWTA 1BQEA 1UJ2A 1W88A 3BKXA 3EIXA 4HAUA 2QJRA 2P6MA 1YR8A 3FMIA 4MUJA 4AUEA 4MDEA 1HNXB 3U4AA 1LKZA 1JLLB 4WADA 2D06A 5DMHA 3QKSA 3FBTA 1ORVA 3IQIX 2ZSIA 1G4AE 3MK31 1GYRA 2GM5A 1BKDR 4W5WA 3Q3JB 5AK6A 3CF0A 1V48A 2C95A 2E0IA 4E2WA 2C88A 3WRXA 1SZDA 4IX9A 1Q0RA 3RVQA 3O9MA 1JKJB 1AO0A 4BJ1A 3HS3A 5ANRB 1L7VC 2HRBA 1W73A 2P1RA 3OA2A 3VISA 1BKSB 3D8HA 4C4ZA 5LFAA 4HH0A 4YP7A 3VKUA 3UGKA 2HYIC 4GUDA 4BFUA 3TW6A 4IXNA 3RS2A 2GVZC 1IBMB 2QYTA 1B1CA 1QTNA 3AYZB 2O2JA 3OFNA 3GNSA 4LZWA 4MPDA 1ND6A 4R83A 4JT8A 1PFKA 3QUSA 1SEPA 4QX6A 3VJMA 1TUEA 2A0UA 2EL7A 3B5JA 4Q4AB 2HEGA 1NQUA 1XYVA 2QOEA 1G21A 3OF3A 3N58A 5TPZD 5GJBA 1AJEA 4X64C 3G5TA 3BMCB 3RWOA 1CUJA 1LU9A 3FYTA 2QTWB 4XUDA 4EMTA 4F1KA 2YJ3A 5KWJA 1WM1A 3SEAA 2DP4E 3UMYA 1TO2E 1WZCA 3MIZA 2Y0BA 3PVCA 1KQGA 2DKOA 1Y6RA 4FKBA 1DQZA 3JATB 4M21A 1QK3A 2JKZA 1U8ZA 1N0IA 2WM9B 3BGIA 4FGKA 3FE2A 4MRSA 5EGSA 5LBTA 2Q46A 4KO8A 1LLFA 5EPEA 2PCLA 4BO8A 1Z4IA 2FK7A 4LVCA 2O06A 3N0WA 3ORYA 3I9V1 1TZ2A 2GPWA 3EGXA 4GI5A 4ID3A 3N2KA 1HE5A 1NE2A 2NQ2C 4XLLA 3CR7A 4HWKA 1PS9A 3RIYA 4M3NA 5F3RA 1CEXA 2C2XA 5LBIA 4KJZA 3P2EA 1N2EA 4HWOA 3WKDA 2PT6A 3ZVLA 4ND1A 4E3WA 3HJGA 3JQ8A 2AXNA 4J07A 2YINC 1VSTA 2JZCA 3QYAA 2CSXA 1BVRA 2QPLA 4RTNA 3RYFA 4EJFA 2C20A 4NAVA 2NTVA 2VUIB 4TYMA 4WDQA 1SVNA 2JJ1A 1A2OA 3P27A 4Q82A 1H1LB 4ZVLA 3U3MA 3EERA 1E79D 1C8LA 1VYVA 1BMTA 1G5TA 2W0SA 1KEVA 3ETJA 4HTAA 2I4OA 4MRVA 2CNKA 2GPTA 2MTBA 3VYUB 5IPFA 3RC2A 2VOEA 4QOGA 5COQA 3CUWA 3R7BA 4BO5A 3DA8A 3NV7A 3UF0A 2Z1NA 3E5NA 2YIVX 1R6UA 1C7JA 1XX6A 2G5PA 3K20A 2DHDA 1F0YA 1JXMA 4D3SA 3VNVA 4U02A 2AQIA 4P4TA 4AXXA 2HHAA 2WZCA 3KQYA 4KGVA 1SJ9A 5TY0A 2QTNA 4W9MC 2WWYA 3ZY2A 4FMCB 1FFBA 3N2GB 1HQDA 3R0QA 1Y8AA 4DEYA 3M6FA 4I6EA 1JB1A 3V00A 1ILEA 3AKZA 3LBNA 4H60A 3U3RA 5ALTA 5AVJA 2Y9PB 4H7FA 2PT7A 2PK3A 1OX5A 3EC7A 4JU8A 4YAWA 3TDMA 5KNBD 3IPAA 4PHFA 2PUWA 3GLVA 1APBA 1V7CA 4P08A 3S2EA 3ZDZB 5A1IA 3GLTA 5ECYA 2PBLA 1N5RA 2FZ5A 2JK1A 1AT1A 1RXYA 3DB1A 4G84A 5IVPA 3NCTA 4L6IA 2UU9B 4J0KA 2CBZA 4BX3A 1IHUA 4DV5C 4D0RA 3L0PA 3U1TA 2Z5LA 4G0NA 3IRVA 1V8BA 1B6SA 3RKRA 3CLRC 2PUGA 1B2LA 4IQ0A 2ZS7A 4UXHA 5I9NA 5H5JA 4LXHA 3RRNA 5I9SA 1F3LA 2PAFA 2BP7A 1JAHA 1GUDA 1R64A 2DTDA 3L0IB 5DBHX 1EVIA 5M5BA 2EZ4A 2DERA 5C5IA 4LE0A 4NCXA 4F9EA 2O50A 1TD1A 3AUSA 3JPWA 5IKPA 2OO4A 3KTOA 3L46A 3SHFA 3TD2A 4CR8A 2XNDD 4RLHA 4CMBA 4F4HA 2QP4A 1NZFA 4Q4JA 2P75A 1OFTA 3DE7X 2ZRDA 1ZLYA 2IHUA 3IILA 4GLFA 821PA 3KJHA 3C2QA 1YT5A 1C9MA 3H6HA 1A9PA 1CKEA 1RCUA 4G1MB 1L4FA 4J9VA 4KR9A 3WSWA 4E1VA 1LDYA 1SD5A 2GASA 1FYXA 2B4TO 5C4IA 1W36D 3RHSA 1G66A 4BJ5A 3EK2A 4M1MA 3U7QA 3AGPA 3Q15C 3S99A 4RQUA 4BQIA 1NBME 1HG0A 3BRQA 3T5DA 3DMFA 1I4OA 2AJCA 3QSYA 5EJ9A 2C29D 5K6AA 1Y8QB 1PEKE 1DXQA 1CFZA 3DPIA 3MRTA 3ZDFA 1QFYA 4LF9C 2O8NA 2WE7A 4FHGA 2H9AA 4Q5IA 2HIGA 5FOVA 3RBAA 4XVUA 1FNBA 3RTBA 3QVTA 4D3XA 3QKIA 4UE6A 3EFBA 2MYTA 3JAMA 1MQ9A 4JLJA 3R44A 3NM4A 3WK6A 4DUPA 4HSEA 5JDIC 3IB6A 2ONZA 4AQDA 3ZWKA 5DM60 4F3YA 2QLTA 3PDHA 3HBNA 4U39A 4UTPA 4GQBA 2IGTA 3EYWA 5D3MB 1FMLA 1A88A 2ACKA 4ESEA 3GGGA 2G9QA 4DA7A 3KEMA 1KMHA 2JGJA 4A26A 5CFPA 3D4BA 1U8UA 2K5UA 4FGUA 2RGNC 2IU3A 2PGIA 1GCUA 3F98A 5A5GA 1NASA 4XAQA 2BYTA 2J3MA 1COWA 1GKKA 1NRWA 4MI6A 3DTYA 4RZ3A 1BFDA 2VJYA 3VHXB 1I24A 3K9FC 4IIJF 3ESCA 5IJ0A 3F3YA 4MRNA 5IU6A 2C5HA 2WWTA 2YY7A 8ADHA 1TMYA 1H42A 4QULA 5EINA 4H4DA 2OYSA 1LEHA 4X20B 5EKSA 4MA4A 3KQQA 4PTZA 4EYOA 2EYQA 3KZXA 3WGZA 2X0FA 1JLKA 3G2NA 4DMUB 5LYJB 3F2IA 1SHLA 5FO0A 4IUDS 1EHYA 4LC9A 2RHJA 2ZJYA 4NU5A 3VDMA 2VJOA 1J8FA 1JI0A 4JZYA 2RIRA 4QYXA 1P17A 2XVXA 3HCEA 3STXA 3N6VA 1C9DB 4F71A 4Z4CA 2QTZA 3CMCO 1E59A 2JS7A 3F6PA 3K3PA 3UCXA 4DIDA 4CIWA 4QGFA 1V7ZA 2YL2A 3EGXB 5CCEA 1CR0A 4EB6A 2Q3BA 2FPGB 2Q21A 4MQ6A 1IBLC 5DGIA 4FKZA 3T3OA 4FMPA 4I9HA 5LZ4A 3ZE8A 5BPFA 3A70A 2ERXA 2FLKA 4W7IA 3AHJA 2HNKA 5G0SA 4D8XA 3NCHA 4JT4A 4ZEXA 1EXNA 3NANA 2JIDA 4MWTA 4CMJA 5BQ3A 4PC6A 2WIDA 4EKIA 2BWJA 4QJ3A 3UICA 5IBCA 1ZHOA 4DR6B 2O2SA 2Z1MA 2R6ZA 2Z30A 3I6YA 5FA5A 3VJRA 2O54A 4C29A 4UZFA 3DBVO 2HTFA 3AZQA 4XTRA 5CURA 3DDHA 1I6KA 2ONYA 2B8TA 1TW2A 3K0CC 3HR8A 3IIMA 2QRVB 1K7YA 1NBEA 1ODSA 1CJCA 2HWWA 3BJRA 3G2IA 3AF1A 3O8OB 5JJIA 1MTZA 2QDKA 5ELLA 1FLOA 1Z5PA 4GU5A 1D09A 1VI5A 4HNSA 3OJCA 2Z43A 3ADKA 3MPOA 3G1WA 4LOLA 4UPVA 4E03A 4L15A 3WK5A 3ESZA 1PJQA 3KJIA 2BFWA 1OASA 2GEVA 1P5FA 2YXLA 4IFIA 3EUEA 3TPZA 4EK9A 4NXMC 2I2FA 1T8SA 1MVLA 1UMCA 5E6SA 3AQIA 1RM5A 2XLBA 5FRDA 2ZPUA 3O75A 5B5SA 5LJIA 1O4VA 4FLFA 1FJ2A 2OXCA 3SEZA 4AM8A 4BRSA 1TCUA 2WF6A 1JLLA 2PEYA 3FM9A 3L2OB 4TL8A 1SZCA 2Y76A 1MLDA 4RTPA 1QH8A 4RJ2A 5BP7A 4REOA 1FDTA 1UODA 3R3WA 1BGVA 2GKSA 1S1CA 5F21A 1JHDA 3M5WA 5AM1A 3U0VA 1JLMA 5IM4F 2A3RA 3GLIA 2YV1A 1CF9A 3TBKA 3H9QA 4IBOA 4Z9FA 4L8GA 4O2AF 4Z4EA 2YMQA 1JECA 1D4AA 4XTCS 3H0EA 4HH4A 3V5NA 3TNLA 1RACA 1UKKA 2ZVDA 4NOZA 3JQGA 3C1TA 5F2KA 1OD6A 2AVNA 3B7WA 2BT4A 3BX1A 1JHUA 1L5FA 2JB9A 4K6KA 3NT5A 1G3QA 5F51A 2O8BA 2NZVG 1B0PA 1FY2A 1AOXA 1QG6A 2I55A 3WB9A 4YT2A 2JL1A 1NMZA 1XTSA 5CH8A 3H2KA 4ZQCB 4DR6C 4U7TB 3RYCB 1G21B 1IUPA 3A3YA 3OZUA 5HNKA 1DQRA 3LNCA 5FBVB 3G0CA 1YRLA 3QXXA 1W8DA 3Q87B 1YQWA 4F2WA 1E7MA 1VLHA 5CCDA 3I6QA 4EVIA 2Q2VA 1XP5A 2XOKA 3I6IA 1RS0A 1PT5A 2H59A 3KR0A 4CV3A 5KSYA 2IPXA 1VGVA 2D28C 1K4YA 1LPNA 1UH5A 2X0IA 3PI7A 5DYIA 1A9YA 1XZFA 4JP2A 1MO3A 4IF6A 3NBUA 4YJDA 4TKMA 1OFUA 1GLVA 2ONKA 1V5EA 2XYHA 4NHOA 4OQFA 4PANA 4Z86A 4JM1A 3FHOA 4MRPA 1ISMA 3CUVA 1FUEA 4CCYB 1UBOS 2QI9F 3OMXA 4KMOA 3SICE 3NRCA 3VNUA 3W3AH 1ULAA 3ZTTA 3F9IA 5BSVA 3JWHA 4WOKA 1DG1G 1Y1PA 4WH0A 3NHWA 3FKSD 5FNZA 3MTIA 1BJRE 2W48A 1DAGA 2FEXA 4HRVA 4EPVA 3GPLA 1DIAA 3EPLA 3FN4A 3RRYA 4QAJA 2QVBA 4RHTA 3QI7A 1D2HA 1MUUA 3HB5X 3DMTC 4BZQA 4NXNB 1G0OA 5FLYA 2Q2NA 1G7SA 5FI3A 2VSQA 1OQAA 1WW8A 1VHQA 2PX3A 2WD7A 3I37X 4GBGA 5CDUA 1J25A 1VGRA 2B4RO 3V9PA 4NTZA 4AD8A 2Y1KA 1CRLA 4CKWA 4RA6A 4Z7JA 2ZUDA 3GO4A 1KGDA 2FW7A 1HFJA 3LI2A 3LT4A 2QP3A 3PHLA 4A8JB 1FK8A 4DDMA 4EKEA 3DZJA 2O8DB 1CS0A 1ISIA 4UMEA 5DH9A 1QGED 1GXSB 3FAZA 3G79A 3WWCA 1NC1A 4IHKA 4LY9A 4DQVA 3LFTA 3RIHA 2PJUA 4G5OA 1GEEA 4KXUA 1EM8A 3WGJA 3CYFA 4Y9DA 2BAGA 3NW9A 4D82A 3SF8A 1II9A 3UA3A 1LLDA 4BNVA 1GV1A 1TU0A 2EFHB 2GAAA 2P27A 2P2SA 4E70A 1BS1A 4FZRA 1XRRA 4H17A 2AX3A 3RAGA 3W5UA 5FQOA 3V8MA 4CR6A 3VGPA 1RYNA 5BWOA 1T15A 1GD1O 2I66A 2R4UA 1T6BY 4AN4A 3LUJA 5HRUA 4OH1A 5IJ9B 4XUGB 2H7XA 1NY6A 2BHRA 3TKLA 2CLHB 1G9SA 2IPLA 4WKNA 1T0JB 2Y77A 3JATA 2AJLI 2BFMA 3TI9A 4XQCA 1VDZA 3TQSA 2F8TA 1UADA 4FQ7A 4YXWD 1XD8A 3A7EA 3A1FA 3P5SA 3K5HA 2NZUG 4LBWA 3CX8A 3MZ0A 4C7OB 1FRNA 1GPLA 1QLHA 2ZIVB 1EG7A 4YDHB 5ADZA 3T5CA 5CH5A 4E13A 4N39A 4K0KB 1QE0A 3RR2A 4IIEA 4U6SA 4ZARA 3KYJB 1Q12A 3M9WA 3WYAA 5JDCA 2ZULA 4FN4A 2CF6A 2OG1A 3VYSB 4YRBA 4I3GA 2DVMA 2JJ2D 3UZ0A 4FXOA 1SC3A 1RXEA 1NWHA 1UKVY 2HCJB 5FH9A 2DJ5A 4MW9A 4HVAA 1PLJA 2JFVA 2TMKA 4L57A 5AK4A 1I2BA 4TPSB 3NV9A 2QYSA 4N3CA 3SLKA 3WSTA 4A10A 3ZGOA 4JC5A 3RFFA 3T6KA 2CF5A 5CK5A 1Y1TA 4UAUA 1X13A 2JANA 1QOQB 2ZSAA 3DLTA 4HBGA 3ICEA 4M9ZA 2CLFB 4PRYA 1CVLA 4YASA 4TMYA 4RULA 3IBTA 4FE7A 4N8SA 5A0TA 4BVJA 4B76A 1GSIA 4RK7A 3FDZB 1XCJA 4XYBA 5DI3A 2AMVA 4ZV4A 1DJQA 4V0ME 5E9QA 3S1LA 3T1NA 1HY3A 2RONA 5ADVA 2G1JA 4N49A 3JALB 1ZUWA 1Z16A 5A9RA 5EMMA 3IERA 4P4SA 1XS3A 4HDMA 5P21A 2BJWA 4F6LA 1P1JA 3JQAA 3ZQ6A 4JGGA 4AUKA 5BNWA 1NI4A 5HCNA 3NOVA 4F0JA 2L69A 1QHEA 3EXHA 1AB5A 2ORED 3ND6A 4R16A 3EMVA 4N7JA 2D59A 3G2LA 1DFIA 4R6XA 5JVDF 1C9JA 3VR1A 4ER0A 5MN5A 1I7DA 5I7VA 4FFVA 2GCIA 2MT9A 1XCLA 3F73A 4WK4B 2G28A 5TVGA 2O05A 3D2AA 1GRRA 4FR0A 2OQVA 4F8YA 4DNPA 2Q5IA 4OQQA 5A9TA 1NVDA 3LXRA 4EG0A 1BIFA 3DTTA 2CJWA 4JDUA 1LI7A 4PV7A 4G07A 1RI1A 4Q7LA 2AOUA 4MJLA 3VR4H 3IODA 4QRIA 5DHTA 3WWYA 5JZ9A 2VAVA 4KVGA 1U1CA 3B2NA 3H8VA 3KPVA 1W9MA 3D0RA 1KAOA 2E6KA 4Z4HA 1BXGA 4LXQA 2DJIA 1R0SA 2RKBA 4UCXA 5IDQA 1WUTA 4C0JA 3BQMB 4WN9A 2CL0X 1WHSA 3A2NA 5JHHB 3HUTA 3EDYA 5DBEX 3MELA 2WNHA 1TEXA 4EIWA 3D6MA 3RVMA 2C98A 5KTSA 3I2IA 3I01A 5JZMA 3H1AA 2BFNA 3L8EA 3BG5A 3IUYA 4Z54A 1S9DA 3RYTC 4HWGA 1CU1A 3ELUA 3LL4A 5FBHA 2QSZA 4XFKA 3N6RA 3I5AA 4IIGA 5DTEA 2F64A 3LPLA 4DBLC 4P0TA 1IUKA 4ZKDA 3HKCB 4US2R 3SJUA 2EP8A 3MB5A 3DQPA 1NR1A 2ZE5A 5LN1A 3A1UA 4U7DA 1GTL1 1IQ0A 1EGAA 5BWCA 5KIAA 2B69A 2ONCA 4B6EA 2OQIA 2V3VA 4PFKA 4ZVPA 3VR6D 1O0CA 1JX6A 2WA2A 3ICQB 4BMOB 1OC2A 2IIQA 3KFXA 3BYZA 2V6GA 1UBNA 1TZMA 1UIMA 2OTCA 3KYCB 3PD7A 5KKCA 4DZTA 1SQ5A 3PTZA 3W8EA 4C6SA 4DRXB 1P3JA 3CVWA 5K09A 5C9ZA 1T5DX 3LPAA 5ARDA 1R50A 5BNIA 4FI3F 4NBRA 1ULSA 3A1VA 1ZIPA 4G0MA 2A0KA 2ZTMA 1AY0A 4DCVA 4E5YA 1ZC3A 3T3EA 1E2JA 3Q7IA 4N5DA 4PVCA 5DBFA 1EUCA 2BDUA 2IDMA 3EE6A 2J0QA 1X1RA 2O3UA 2ISCA 1ZGJA 2IOQA 4MDYA 3JAKA 1GARA 2YQ4A 5IT0A 5FEUA 3CLKA 4HXYA 5A6SB 3N2ZB 3VR2D 5F23A 5KX5F 4ZODA 4GC5A 5F12A 4KTTA 4OYYA 4RPLA 5J59A 4MHTA 5BWMA 2V6BA 4TRRA 4RFSA 1W5SA 2J31A 4C4YA 1GTVA 2C5AA 5A6SA 2Z6UA 2YUTA 3EWNA 3ETOA 3HI4A 4EW6A 2PYZA 4JL8A 1JQLB 4UW9A 5DW3A 1PI3A 4NCNA 2QPOA 1OFIA 3PWTA 4N18A 1NW7A 2HHLA 3EQ2A 2QN3A 3DHNA 1V37A 4A2CA 5EIBD 4N01A 2JHGA 2YJ5A 3VBCA 1NT2A 1WLYA 4YNBA 4GE3A 4YAUA 3S8YA 3LPDA 1L7BA 1GCIA 4TLCA 1MAHA 3M70A 2JFOA 3KYCA 1IZ9A 2C7RA 1PQ4A 3C3EA 1MF7A 1E1YA 2BUCA 2WB4A 3FJOA 4JI4C 3OZIA 5FBKA 1TKCA 3UMMA 4HD8A 4PAMA 1P75A 5KJ1A 3G5MA 4WNIA 4AICA 1E8MA 1X38A 3ZBQA 1NFFA 2CK3D 4EJSB 3WA7A 2DU8A 3C97A 1AG9A 5ER9A 4AN1A 3H2GA 2C57A 3SDZA 4P93A 1M2GA 2VDRB 4LHWA 3KVVA 2WJHA 3U37A 1VL8A 3AI2A 3CF2A 1Q2UA 2ECQA 1H94A 3EYAA 5KU7A 1ZMXA 4KWCA 4TTAA 4PNEA 4Z6KA 1OJ7A 5JJLA 1A9QA 2MDTA 4TRMA 3THOA 5JI2E 1U5BA 3EA4A 2NO6A 3AUTA 3ESAA 1EWKA 1A5SB 4CMEA 1M2VB 1NYRA 1U7HA 2B4AA 3KS9A 4QSMA 3O2EA 4GKKC 3MWEB 4D9MA 4FJ0A 5AJVB 1I30A 4OBEA 1DLJA 1BE6A 1MHPA 2GK3A 2MYPA 3AXSA 4G8JA 3W6PA 1T9HA 1N7JA 4FEAA 2Y99A 3RS5A 4EY5A 5KWVA 2E4WA 5DPMA 1UPCA 2OXFA 3WL6A 1UT8A 4FSXA 2MINB 4CTKA 4DLYA 1PP4A 1EXVA 2G0TA 3PUIA 1X0XA 1U3VA 1XRJA 2KI5A 1XBTA 3D59A 2JARA 4PSKA 1KO8A 2PZ8A 3ICWA 2PMFA 3IPCA 4Y1FA 3O1HB 3HB9A 3ZWXA 4RTJA 4K86A 2GO1A 4Z4QA 1ECLA 1P4RA 3DDNA 4EBBA 1DJPA 2CVPA 2FU5C 2HZBA 3BMXA 3L02A 2Q4BA 3D6AA 4TTQA 3HMKA 1OREA 1NU8A 2KWIA 2PFGA 1WV0A 3D4OA 5GOZA 5C80A 4JBNA 4C5AA 4F2PA 3P9RA 5JH7F 3SF0A 1DG3A 1VM6A 2JAPA 4QLBA 4ZTBA 2CXUA 3AV0B 1ZM2A 1Q3TA 4G0ZA 4N54A 3MJEA 3LLCA 4IHJA 1EU1A 2R5WA 4QOHA 4A0GA 1O6GA 4MW4A 5K85A 5BORA 1Z5GA 3LT0A 4EJSC 3DHYA 4IH9A 1M8JA 4ZVRA 4W5NA 3IC5A 5LCXA 3RS0A 2ILVA 3C15C 3UV7A 1A2QA 1Z5NA 2QQFA 4B4OA 4CDRA 2VHWA 4ZANA 4W1SA 2VP9A 3KE9A 3U5ZB 4TWAA 1JWAB 2CE2X 1E3TA 1NJ5A 1PTJA 3OX3A 3KKPA 1E2GA 1XLTC 2VJLA 3EPRA 4RMNA 3OF5A 3TQQA 2IS2A 5A4KA 2RK4A 1WF6A 4BCCA 4EGCB 5KDOA 2XKKA 1QJ4A 3VR3D 2OKGA 2YHIA 2VLBA 1Z38A 4H6WA 3HCBA 4HUTA 4GKKB 4CT0A 4CI0B 5FIUA 3ZR4B 1E9FA 4EDFA 1T6ZA 4DCTA 3O93A 2LBPA 4MVJA 3GRUA 1ZINA 1XAHA 4KKXB 5FYQA 4QG3A 3BK7A 5TSDA 5JTUA 4WJZA 3LY5A 1YCFA 2RB4A 2XOXA 3C4VA 2QUIA 4C0BA 2Y67A 3ZEAA 2O7RA 2A3NA 5HDQA 1RDFA 1CNEA 2NW6A 3F49S 2JEOA 3VBEA 4AMYA 2OORA 1F4PA 4WZAE 5GQSA 3KDSE 2JD0A 2IXDA 2XGMA 3LHKA 2IS1A 4MVJH 1G59A 1UKEA 3SWWA 5BUCA 2J9FA 4BEWA 4E94A 1NBMD 1Z6TA 3TGWA 2J09A 1KH3A 4DTIA 2E89A 4XCVA 2Z4RA 3KOOA 4XYLA 4X1YA 3ZHRA 3RYCA 1T3LA 3AT1A 3RFVA 4CEIA 4YUZA 1U0FA 3C39A 4EI7A 5JG7A 5DLPA 1CUUA 4OK3A 3CUUA 2HA0A 3K4HA 1DOAA 1YE8A 2JFXA 2N1BA 1KIAA 2GZSA 4GWKA 5FUVA 4IV5A 3SFTA 5J43A 1IBRA 3EDOA 3ZHTA 4ZJYA 4O3MA 3NRJA 1I2DA 4R2MA 4WCFB 3BL5A 2WJIA 2WJZB 5CXQA 3IB3A 5JRZA 1A8QA 4HRYA 1A5AB 2OCYC 3LUHA 3HA7A 4X0EA 4KIFA 3U26A 2I54A 4G37A 2XCTB 2Q41A 5D1HA 2WKWA 1M6HA 4YQFA 4FSDA 2WIJA 1QKJA 1TAQA 1Z0KA 1JWLA 1TTTA 1XLVA 3JAMD 4B3TC 1KMCA 4ZT7A 5LQKA 4Q9KA 2E5WA 3RUPA 3DO8A 3DYIA 3K9NA 1X1BA 3IBGA 1MXCA 1LV8A 1K75A 1XRLA 4YJKA 3F9RA 3A9RA 1WF3A 2DHCA 2IOYA 4L2IB 1Z28A 4DQXA 1DPFA 1HQYE 1JR3A 1P1HA 1R16A 2DUJA 2PH1A 4M8KA 3CO0S 4WXPA 2FSVA 4R84A 521PA 5IC5A 2VP4A 4K9MA 4UBNA 5KC8A 4DA0A 2DUWA 2HF2A 4FZ5A 1XEFA 4LOIA 3JZIA 5FB3A 2PO7A 1RC1A 3OO0A 3JW8A 2J9YB 1R0RE 2AIRA 4F2DA 1NG1A 1OFHA 1SK8A 4YT4A 3KL2A 4M9CA 4FU0A 2WFAA 3H1GA 3BBPA 4RTKA 1MEEA 3P9IA 2WPDD 3HZHA 1GTRA 4P38A 4QU5A 4UDXX 3KVYA 5AO9A 1P2GA 3HZRA 1NJ1A 2B6HA 3JYLA 4RIEA 5DO9A 3RYIA 1V8FA 4L8LA 2ASBA 2WFLA 4YI3A 3DNMA 1ZSVA 3ZLUA 1BNCA 4OTZA 5H4GA 3C3YA 4JR0A 1Y89A 4LJ4A 4XJTA 5C4MA 4EMSA 1V5GA 4FTFA 2BGNA 2Y2VA 4M1QA 1L5WA 4G9BA 5LA6F 3JQDA 4F5WA 1JG2A 3IKVA 4PQFA 3ZKAA 4PF1A 4KN8A 1SCJA 3RJ9A 5AKIA 1PZHA 2ZAIA 4B4DA 4DIEA 2X4IA 1JIXA 1JR6A 1PJSA 1VCOA 2ZE7A 3EUFA 3I2JA 3MUOA 4HPVA 4OHCA 3PFCA 5ALGA 3TRFA 3ZNNA 3CTMA 2GBIA 3K0AA 5CP8A 3O94A 3TVTA 4IDAA 4AN0A 1SKAA 5KBYA 1VECA 5EJ4A 3K16A 3ZHBA 2Q1XA 3GLIB 3KELA 3PPWA 1XROA 4RHFA 5CB4F 4CKYA 3U4MA 3QPCA 3WBJA 3M2TA 3L8YA 4GOMD