4FUQA

Crystal structure of apo matb from rhodopseudomonas palustris
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
503
structure length
501
Chain Sequence
MNANLFARLFDKLDDPHKLAIETAAGDKISYAELVARAGRVANVLVARGLQVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPKIVVCDPSKRDGIAAIAAKVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSTGRSKGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPKFDPDKILDLMARATVLMGVPTFYTRLLQSPRLTKETTGHMRLFISGSAPLLADTHREWSAKTGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGKELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGATIDEAQVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malonyl CoA synthetase
publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
total genus 153
structure length 501
sequence length 503
chains with identical sequence B, C, D
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4fuqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fuqA01
2D1TA 2WD9A 4G37A 3A9UA 5BSUA 5K85A 2D1SA 1T5HX 3U16A 2D1RA 4RVNA 4D57A 2V7BA 3G7SA 2QW0X 3LGXA 1ULTA 4GR5A 3FCEA 3WVNA 1V25A 5BSVA 1YJ7A 2D1QA 5E7QA 2P2MA 3LNVA 1LCIA 3GPCA 3ITEA 4IR7A 4EATA 4U5YD 1V26A 3O82A 3U17A 2P2FA 3B7WA 4RMNA 2QVXX 4OYCA 3O84A 3IPLA 3VNRA 4GXRA 3KXWA 4WV3A 2VSQA 3RG2A 3RIXA 2P2BA 3O83A 4FUQA 3E7XA 3VNSA 4GS5A 4ISBA 3E53A 2VZEA 5BURA 4IZ6A 2P2QA 3NYRA 2QVYX 5GTDA 4RLFA 3QYAA 1MDBA 4RM3A 4DG9A 5KEIA 3WV5A 3T5AA 4RLQA 3ETCA 3WV4A 3PBKA 4W8OA 4ZJZA 4G36A 5BSRA 4E5DA 4D4GA 2P20A 4DG8A 4LGCA 4FUTA 1AMUA 3T5BA 4R0MA 3A9VA 5KYVA 2QVZX 3C5EA 3DHVA 3CW9A 1MDFA 3DAYA 2Y4NA 3FCCA 4D4HA 3E7WA 2P2JA 3NI2A 2Y27A 4RVOA 3DLPX 5D6NA 5BSMA 5DV9A 4M46A 5K8FA 3IERA 3TSYA 1RY2A 4RM2A 3R44A 5BSTA 5IFIA 3VNQA 1BA3A 1PG4A 4OXIA 4GXQA 5BUQA 3L8CA 1T5DX 5BSWA 3NYQA 3IVRA 3T5CA 5JRHA 3CW8X 3IESA 4R1LA 3LAXA 4D4IA 5DWVA 3EQ6A 4PZPA 4GR4A 1PG3A 5BUSA 4D56A 1MD9A 3IEPA 4R1MA 5KYTA 2Y4OA
chains in the Genus database with same CATH superfamily
1FFHA 3KB8A 3NBFA 2HWYA 1ZVJA 2D1SA 3NP7A 4QNMA 4AD8A 3DD5A 2HWKA 1HNXC 3I1YA 2BRUA 2PX2A 3CHYA 1SIOA 2JA2A 2PJZA 4FXOA 1ZR2A 1VHLA 1ZITA 1B8UA 4IDCA 5CHEA 3FPBA 1DTWB 4RA6B 2HQOA 3RF7A 5I4KA 4FGLA 3E9MA 1JBKA 4KO2S 3TFWA 5ITVA 1G59A 4GOMD 2NU9B 2ODAA 1EUYA 4XD7D 3REGA 2ZRHA 3S7TA 1FXWF 4AS1A 1TJ5A 1TLTA 4FPXA 2JFOA 4JVMA 2PBLA 4AMUA 4LXUA 4E14A 4YRGA 3QWFA 4BJ6A 2NYVA 3DVAB 1I7DA 4WACA 1NX6A 4X97A 1OYYA 1YFLA 4KVZA 1HDIA 2OPBA 3A4YA 3BK7A 5HZMA 2CCGA 2NTNA 1KIFA 2AOVA 4ZGBA 5LQKA 2I66A 4RUKA 4EHFA 1C4OA 4IMIB 2XD9A 3WRYC 3URMA 5B6IA 3RIXA 3L6OO 3OIDA 5L3QB 3BEDA 2JIMA 2FPRA 1T6BY 3D8BA 3M1YA 5SZJA 1Z25A 2IYSA 3D7SA 4RETA 3GLFB 1GRCA 2JLXA 2P1DA 1MDBA 1Z29A 2AYZA 1UMCA 2QAGA 2QUIA 4GFDA 5I4CA 1DAIA 3DJFA 2VA9A 3OHSX 4JYAB 5DN6A 1E2DA 1T2FA 2J3LA 1M33A 3P94A 4QYTA 4WZBA 2PZLA 4ESHA 4M8SA 2O19A 1EK0A 4JU9A 1DWUA 3W5UA 3AF2A 3UB2A 4BO3A 2ZRGA 2M9MA 1TE2A 2CJFA 2G76A 1WXIA 1CEQA 4I99A 4CFSA 5JCPA 3GN2A 5K8CA 3OQ6A 3MBOA 2FVXA 2HRZA 2AF3C 4PPQA 2B4AA 3ZWQA 2BJWA 2Y1GA 4MUGA 3RNLA 3R3UA 5K3BA 4BNWA 3T38A 3VA7A 4O6VA 4K0RA 5B1EA 1IB8A 2BWJA 2R5NA 1B00A 1X9GA 1ETHA 1SQ0A 5C4GB 2DFPA 4D7AA 3QIVA 2OWEA 5JH7B 4F06A 3LUDA 3AKCA 3RC7A 3O4JA 5KWVA 3FLAA 4HAXA 4WBSA 3LG2A 4QODA 1OD6A 1T0PA 4YO8A 1I30A 2HPZA 1T4DA 2ZBPA 1WQ3A 1MO4A 3B5EA 4G8CA 1C8BA 3LXMA 4ZEOA 5BW5A 2JGIA 3IMEA 4AZ0B 5KU7A 5IDVA 3M6VA 1M7BA 4U9IS 1W8IA 1E9AA 3KTFA 4LGYA 5DWDA 3C45A 4GYYA 2NXJA 3DT6A 1XAIA 3UK0A 5AHRA 3HRKA 1T8UA 4KHZA 2NU8B 1IN7A 3QA3E 2PGOA 4AL4A 1RZUA 2AW3A 2ISCA 2O6HA 4TXJA 2W2LD 4EG6A 3VR2D 4D8TA 1PG4A 1IBCA 1NASA 1U3WA 1A76A 4O4JF 1G4AE 2JEZA 3GH3A 3WYBA 4LQDA 1DBSA 4LYAA 4AS2A 1FNDA 3NUQA 5EIBD 2PKQO 1BIFA 3M6UA 3MWKA 3QZUA 2J59A 3HSYA 1EVZA 2E4YA 3M4YA 2GAFA 4DR4B 4HNAA 2UZ1A 4X85A 2P6PA 4JY7A 5GZ3A 1L3CA 2QTRA 3FMGA 3G2MA 3RSCA 2KZFA 1OX4A 1F38A 2E7GA 4IWXA 5AVSA 2MSLA 1XVTA 3FOAA 3GB9A 4K8RB 5LZ5A 4FNAA 4MP8A 1XN4A 4EPVA 1T3ZA 3ZW7A 3O7MA 1J5PA 2I87A 4Y1GA 5AI4A 2X3YA 4KXFB 4A6PA 3C70A 4IOJA 5EP3A 4D0NA 4TKVB 2W90A 4GKKB 4E88A 4LAFA 2BEUA 3ADOA 2OHHA 3EG9A 4GR5A 2XDQB 4JEHA 4QYIB 5AJTA 2VDUE 2W5UA 3RS4A 2UVPB 1XP8A 5HS6A 3ZBTA 3K8YA 5GV8A 4LSGA 3OOSA 3SZMA 5A9SA 2DETA 4H2DA 2I6QA 3N2GB 4HRAA 2OPLA 4J0EA 5GQSA 5CRIA 3FJYA 5BOSA 2RJOA 2PUBA 2UZ4A 1B1AA 4WLFA 5CYPA 2IJGX 3CUYA 4DCPA 4V0SA 4PVDA 2AMLA 2G28A 5F1PA 1HTBA 2ZG6A 2GPAA 4RJIA 4E5YA 1IBMB 1HO3A 2GAAA 2VUHB 3BUSA 3KJZA 3PDIA 1Y5NA 1WW2A 4UVEA 1YFJA 1AS0A 1GYQA 5AHXA 1UOPA 3DC2A 4IDEA 4LF9B 2HWWA 2WKQA 4U7PB 1KAQA 1QMPA 1XZFA 2RK3A 2ZSJA 4O4LB 3THSA 3ZZTA 3ZXIA 4D92A 2CSXA 1ZINA 4IH9A 4W1PA 1WL8A 4A2QA 4KRYA 2CBGA 4KXWA 3VC7A 1QDLB 5JT1A 3GFPA 2AX3A 2XUPA 3IUEA 5HFJA 3OWHA 1O96A 1D0SA 4QVKA 4B7ZA 2GX6A 1UQTA 4M9ZA 4XJVA 5IK2D 2IYWA 3QP9A 5CDUA 3DMYA 4L07A 4NENA 2VG8A 3H11A 1YJQA 3A6GA 5C32A 5LZ8A 2FQYA 2XQFA 2C78A 4BC1A 1CUSA 4ND4A 2X7HA 1ORHA 2R1TB 3LT0A 4ZV9A 3IV9A 4UXJA 4AJ2A 4UQLA 3BE6A 5DWQA 1XWWA 3VPSA 1IHXA 1G5IA 1OI3A 1UQRA 4HN9A 2ZVPX 5EUCA 3QG1A 2ANBA 1DCFA 2ZJOA 1LLQA 4ID9A 2DFTA 1N1MA 4DV0C 1PR6A 3MJHA 4P7KA 4X8MA 5BSGA 1RQ7A 5IP5A 4DY6A 2I78A 5ER6A 4DLBA 4JJGA 2XNSA 3L4SO 4QOSA 2AXQA 5KNLA 3SZUA 2VI5A 4EDFA 5K6AA 2FLKA 5H1YA 4O1HA 2PMWB 2XQKA 1C3LA 3HCAA 4KE7A 1VTKA 1ZGGA 2ZT6A 4TWAA 3COVA 3G13A 3V4VB 1N78A 4RD6A 2QRUA 4FMCB 1RHRA 1MF7A 3VO9A 2P6RA 2O3TA 3FCOA 1ESMA 5IAEA 4B0PA 2GO1A 4Q9LA 4XQEA 3K9FC 1ACLA 1KJYA 4FHDA 2V7QD 2M6LA 4CI0B 1X94A 4NMMA 2IPOA 2Q0XA 1C0EA 3PJGA 5FPPA 2M1ZA 3WOVA 3KZNA 3ZWWA 1EXNA 5IWAC 3MOIA 4RANA 4W5JA 5IBPA 1QG4A 1MHTA 1M2OB 2C2ZA 2VQDA 3DW3X 4G1BA 1QFXA 3B38A 4O25A 2R11A 4RSMA 4V1CB 1U6JA 1N5RA 3FYTA 1YASA 1Z45A 1GUZA 2OAP1 1NVGA 4MUYA 4PPGA 4MR9B 3WISA 5DCYA 4V0KA 4YV2A 3HVJA 4ZT7A 4I8XA 3ZWCA 3EHEA 3L1UA 1FX1A 2V8OA 4RZ3A 5FHQA 2VJOA 4MGHA 5KBYA 4U6SA 1T4CA 3D4PA 5DBIA 1QF7A 3BD6A 3PVZA 4G56A 2PT7G 1W4AA 2GK7A 1QYCA 1VRWA 4JQOA 1O03A 4ROTA 4JJAA 1OV4A 4NCIA 3NHZA 4GRDA 4BVKA 1GARA 2A4MA 2BGLA 2XRFA 2CUZA 2YDYA 4A5SA 4BFSA 1VG8A 2KE5A 2P9JA 3F1KA 3UTCA 1VL6A 1QYVA 4K0KB 3U6BA 2J9FA 1Q1EA 4B48A 1D9XA 3TJRA 3DKVA 1TYCA 1BKSB 1X19A 1JQ3A 3I6QA 2ZIEA 4FS8A 2PMCA 4KWEA 4OFBA 3OZEA 2WFLA 4JQSA 5SZIA 1FMTA 4N03A 2JNVA 4O4HB 3TM4A 1C29B 3KB6A 4BMPB 4GOXA 2R84A 1JLRA 1WZEA 4JR2A 5HDQA 1G8FA 3UH1A 3ZHOA 3BBLA 2CNLA 1PRYA 2GR9A 3KQPA 3A6FA 1FRVA 2VYNA 4Z4FA 2FI1A 2QPAA 2XVXA 1AA9A 4XYEA 1JX6A 1UBEA 1ZH8A 2H2HA 2PLRA 3N2KA 2NADA 3S1AA 4C01A 3ELWA 3A6HA 4URYR 3KXLA 5J2UA 4MDEA 2X8LA 2OV4A 3M34A 5ELMA 5T6BA 3QHQA 4B6FA 5E4YA 1AKWA 3F4BA 1RXEA 2OUIA 2WHXA 4B40A 4LC9A 1U28A 1TTHA 1PTKA 5CX1B 4MKHA 3KUCA 4MQUA 2FPXA 2NVUA 3NXKA 5EA2A 1YS1X 4EP1A 4ZV4A 1NMYA 1LC3A 1SURA 2P2LA 4MQ6A 2BMJA 1NVAA 3JU3A 3Q6NA 4EF5A 4E70A 5CCXA 3LUGA 4DMRA 2BH1X 3ADPA 4GI1A 1QU2A 4GC5A 4RTMA 4GMHA 3QW4B 4QL3A 2ZYSA 4DNOA 3HY6A 3PFKA 3IDZA 3RSGA 3G02A 1JEJA 2CF5A 1QIKA 3KPWA 4MB2A 3UJCA 5KMGB 5J1SB 2AJCA 3KWFA 2ZETA 1DEKA 2YWHA 3PDJA 1ZJZA 3UCEA 4LMRA 3B82A 5JISA 2QX7A 3C3MA 4EY7A 4ZVSA 1NY8A 5TJ9A 1IAVA 2QVZX 2JGEA 3PTAA 4JI3B 6PFKA 3GEPA 3V4RA 4YRCA 4XWWA 4DA7A 2C3PA 3N2YA 4DM3A 1CNFA 2Y68A 1MDFA 4NJOA 4BQQA 3RQSA 5K7SA 3FCCA 4KUGA 4ZU1X 4KAJA 5GZ6A 5JQGB 3A31A 2ZI5A 3QE0A 1NP7A 5ERYA 1II8A 5IYZF 4UTRA 3N2LA 3RC8A 2RH5A 3PB3A 3GCGA 1P0QA 4QUIA 3HCRA 4JBYA 2X6RA 3M89A 1NVFA 1XZNA 1U4SA 4EW2A 1QGZA 1Y7PA 3OJFA 3SEQA 2P7HA 4EUKA 1DO0A 5B4UA 2AS0A 4EKYA 1UDCA 2WIJA 2QVBA 4DWVA 5K2OA 1WF3A 4TX1A 5C31A 2DBVO 1U6KA 1SM4A 3GJ5A 1KMQA 1QMGA 1R4NB 2ENUA 3ZBQA 4ZCMA 3D5EA 1XE3A 3W4KA 1E58A 4ON9A 4R7TA 3WLPA 5EQFA 3L6UA 3MCZA 4ZT3A 2FAXA 2Z83A 5BW6B 1OCEA 5BV7A 3WAGA 1AK9A 2ZJ2A 2UUOA 5AM5A 1X7YB 4UBJA 2BJVA 3W6NA 4JBWA 4FHFA 3V6MA 2A4KA 2BFBA 2DWCA 5F64A 4BJHB 2XNCA 5FPHA 1XVIA 3LRXA 3QWIA 1P0IA 4PAGA 2PUFA 2RC6A 3DG9A 3LVFO 5JZBA 1N6IA 3PQCA 2WTBA 3UUWA 4BMZA 4UBMA 3JD2A 2ZOSA 4PXAA 4A9AA 2HPVA 3UUFA 4EYKA 1VLAA 1NBHA 4F11A 1UP6A 1AQIA 3LY7A 1T8YA 4Q3EA 1YS4A 3FR8A 3AWDA 4D9FA 2C7RA 4GPD1 3AR7A 2C2WA 4DSNA 1WB5A 5INTA 3L6RA 3WGVA 3KLMX 1RSZA 5FNVB 1NTRA 2ZRMA 3IC5A 3DBRB 1RJDA 1Z4IA 3DQQA 3HZOA 4H4DA 3LYUA 4ARVA 2BKLA 2JJ1D 1VI5A 4EK9A 1IN6A 1K2WA 1JMYA 1KEWA 5IKEA 5ARCA 4C4TA 1I01A 2H5EA 4LVUA 3KR2A 2FW8A 4S3MA 2GBIA 5GM2A 3FF1A 2I91A 2Q1WA 4RHYA 3TLAA 4QJIA 1Z2DA 2PGLA 1WY7A 2P5UA 4INZA 4TM7A 3GLHA 3LOPA 4L5BA 2AIRA 4XTRA 4K0BA 3KZOA 5EZSA 4DYHA 4ZRNA 1OX5A 1T36B 2OKGA 4DUGD 1J2EA 2O8FA 3DS8A 2QOEA 1ZD8A 2H2AA 3UV7A 1F4VA 2WTUA 2FX5A 1TC2A 2CHVA 4KQWA 3SFZA 4MWBA 4E1AA 4FM9A 3DWEX 1WSBA 4WNYA 1EVYA 5AVKA 2PGJA 2ZS7A 3ABSB 3K32A 1FTSA 2VZEA 1MXFA 2P1RA 3PWSA 4FEEA 4JLUA 4YCMA 1T9BA 3C5CA 5BQFA 2HMTA 3MCWA 3WQBA 5HCUA 3DZHA 2P78A 3MWDA 1DG1G 4EWLA 5JBQA 4KHPC 1HUQA 2CFIA 2FPGB 3L8YA 4R5HA 4AIRA 3NB0A 4AJKA 4FMBB 4FFLA 1V7QA 1VI2A 4OBWA 2FUG1 2Q29A 4HX9A 1MNQA 4GIBA 3ZDRA 3Q8MA 5DLEA 1LGYA 1QH9A 1X9IA 2JAWA 4C78A 5LA6B 3UAOA 3CLSD 4EFNA 4E4TA 4EYOA 4C0WA 3TKYA 1KO1A 4RV4A 3TMAA 2XBMA 3KM0A 2C9CA 3KQLA 2AI3A 4YQZA 3A3YA 3ESZA 3WNCA 1QZUA 1NXPA 2WILA 1LNSA 5TMBA 4K26A 3OZCA 3IDFA 2DJIA 2GCIA 4HV4A 2GCOA 1GRVA 2BGNA 4OXKA 1F1BA 2A5YB 1QB7A 3K1JA 2AEJA 4WW0A 2WYOA 2WYUA 4I4CA 5DNWA 5M7EA 5BR1A 1W48A 4LPKA 1ATZA 1IN5A 1I4EB 3BIOA 3CCBA 1G5QA 4GL4A 1V16B 5KWEA 5HTOA 3ANSA 2BBOA 3IDOA 1W0CA 4YIHA 3TTSA 4GBMA 1CRZA 2O0JA 2VHQA 2WWTA 3W78A 5LMCA 4YJ3A 4RACA 2C0PA 3ENWA 3T0GA 4BJ3A 2LIVA 3HI6A 4QELA 4F92B 2R2GA 1TF2A 5J43A 1YTUA 1J2TA 3TZBA 1S3FA 4ZVUA 3NAMA 2FN7A 1V8BA 4MV3A 3NQ41 5I47A 3VO8A 4IF4A 1IK6A 1W75A 4RL4A 3GQBB 3BHNA 1QR2A 4P7GA 1TA9A 1SBQA 5LWQA 1ST2A 3ETEA 4RDXA 3T34A 3IILA 1H9AA 1NMQA 1IJFA 4AY6A 4EY8A 1G7RA 3DAHA 2I3BA 3QFRA 4TL8A 4F9GA 3HTXA 2PYZA 3I6IA 3DVRX 3DTVD 3NBKA 4HLQB 3SS9X 4Z2YA 3PFCA 5KYYB 1LKZA 4R1MA 5J23A 5KYTA 4MA5A 3E22A 1YF3A 2ZE7A 1XZIA 2QNIA 3PRKE 2BR4A 3A3OA 4JGGA 3CZ4A 1SOVA 5EINA 1E79D 5G41A 3E8SA 2RKOA 1RIIA 3TINA 1KH1A 2IE0A 2JANA 4BLSA 4YBZA 1G20E 4KIJA 3EPRA 1KQGA 1NLZA 1JHZA 2XVYA 2PRZA 3T9AA 3CO5A 2CV2A 2A0UA 4PYLA 3THOA 3RD5A 4XVRA 3RYHB 1A27A 3S29A 1O92A 1ISSA 1O6GA 3OPYA 3K0HA 2Z30A 4G8BA 3WL3A 3ETJA 2QROA 1UJ2A 1J0CA 4WOJA 1XXHB 1RI2A 3B48A 2IX3A 1GKYA 2OO7A 3T9EA 4CIDA 3PNLA 2ESRA 5FV4A 1UKYA 4JUDX 5FL3A 3QW2A 1ZIXA 3PKZA 1P1HA 5BQPA 1QU3A 3HB0A 4HUJA 2IYAA 4UBNA 2RJNA 3G0DA 5F76A 2GLXA 3WO1A 2FFQA 3CZMA 3L0BA 1E0DA 5SYMA 4RIFA 2ORED 3EFHA 3NGXA 4QD3A 3JV7A 4UE6A 4CKXA 3KPUA 3ADDA 4G5FA 1JEDA 3GFVA 1OZ0A 1YUMA 2R8OA 5JXGA 5KTMA 4BX9A 3B1VA 1XTKA 3DR5A 4ZO6A 2OXRA 2PO7A 2WHRA 2C54A 5B30A 3LBAA 4E32A 4UTPA 4TKLA 1Z0SA 3PXGA 1K4MA 1RJEA 2H3HA 3OO1A 4YJKA 3FTFA 1AZSC 4TLEA 5SV2A 4ZIRB 3FYDA 3OEEA 1USUA 2PYDA 4EUHA 4M8IA 4C4PA 2IPAB 4HTAA 3S0JA 2A88A 2JFPA 3CUWA 2I7XA 4MW0A 5KNBH 2GTPA 4WGFA 1E96A 4KLNA 4N3NA 3A0UA 1HE5A 2CNDA 2RGAA 1PZMA 4MUHA 1TUBA 2QRNA 5K09A 1A50B 4CM4B 2RGDA 4IF6A 3A1SA 3RAEC 1W29A 4LF8C 1I0IA 3D3EA 3UJBA 5BMVA 4HF7A 1E5VA 3GT4A 3OX3A 4I3HA 5JXHA 1NDUA 2CFRA 4ZYLA 2DXIA 4R8VA 3STHA 3DT9A 1V1JA 2FJUA 1ABEA 1B8NA 1T26A 2I4RA 2Q21A 3TRKA 3JQRA 1RWVA 3HB4X 1Y48E 3QEMA 4KBFA 3V4LA 3VJLA 1PFGA 1OXUA 2ATVA 2POQX 3AW9A 1MJGA 2CKMA 2QSYA 3T7EA 4WMLA 1OGYA 1H1LB 3I2GA 2IUFA 3AUFA 2OD7A 1Q1NA 3RKRA 5D87A 3CVXA 3BWCA 4LRTB 4JJ4A 3IMKA 3PQ5A 1B6SA 2IOFK 4N8EA 5BSEA 3TNYA 3O8LA 3QNWA 3V3TA 4X9XA 1QE5A 1G8GA 3IBFA 4J0HA 5JSZA 1YL5A 5DBGA 4XKJA 2C9BA 2VUTA 3E9QA 3N2NA 3X3HA 3ZHYA 5B7PA 1G3RA 4BU1A 2YNMA 4OMCA 3B89A 3INGA 3EQ9A 2HC9A 2XUAA 1VIDA 1CS0B 3AU8A 3EJWA 1VBFA 2NUAA 3JZIA 4RK7A 3SVTA 1H2FA 2BFEB 2PUWA 3C43A 2ZLBA 3P2JA 4ATNA 4CTMA 1GAQA 2G4VA 2QPOA 5DNDA 1QHSA 5JEDA 1ZK3A 2NNWB 1GLGA 3FH0A 5C7YA 1USPB 2XVAA 4H7IA 3A4NA 5AJHA 3LWBA 1RQ2A 4JL8A 1DC8A 3VPHA 1HF3A 2JG3A 3KL2A 3AEQB 1ZM3A 2PH1A 2RCYA 3C97A 3LPNA 3ZYZA 4RK6A 3GA5A 3T95A 3OTOB 1L3BA 1TK9A 2AK2A 4EKGA 1ZBQA 1UC5B 1DCMA 1Z5VA 3GRFA 5DP2A 3WLSA 3WGGA 5AKHA 3VNBA 2OMKA 3FYUB 1DOZA 4HGQA 4YP5A 3ROTA 3DFIA 1OLUB 2JLQA 3B78A 1WCIB 3WKAA 2C5FA 1GLVA 1U5CA 3ZU6A 4B4KA 1AHIA 3JCZA 3IP6A 4OTZA 2DUWA 1RWMA 1SXJB 5LZ2A 3EVFA 2HZBA 2WE7A 1U7TA 4ZDJA 2J3HA 3ZE8A 2PQ2A 4C5AA 1IU9A 5BYAA 4BNDB 1VHQA 2PG3A 1VJGA 2GVNA 4QOIA 2HSZA 3BCHA 4NEGA 3K8ZA 2FU5C 4BQOA 5JJLA 1G8JA 2ID8A 5J2TF 3AU9A 3C3CA 4RH3A 2AYXA 2PRIA 1G21B 5I8ZA 4CM8A 4NZMA 2JC3A 5J2UF 3TTVA 4CMGA 3QVLA 1IZYA 4N48A 1LJLA 1KAMA 1W0JA 2DHRA 2E4VA 2GN9A 2HI0A 5FH9A 2CHFA 5TIIA 3ADBA 2D62A 1H8HA 3MPOA 2Q1UA 1H9BA 1QG0A 2H8GA 4I9GA 2D5BA 3L1VA 1M2VB 1Y7HA 2ZIUB 4FDUA 3HDYA 5BY2A 4CIWA 3HRIA 2QR5A 3KT3A 1GGEA 3SLRA 3UOGA 1Y7LA 2VBGA 4OYRA 4D0GA 4CKWA 1UBTS 4IDOA 7REQB 2ZQYA 4HQFA 1Z6YA 5F1YA 2YQZA 1CJMA 2NXNA 3DUFB 2G77B 4QDJA 4QGGA 3IDAA 3LFTA 2R5FA 2ATEA 4GBGA 2AR7A 2O5EA 1XHLA 1QWOA 3GZJA 1J9EA 3JQ6A 1HGXA 1MEJA 1I1NA 2ZS9A 4TZ0A 4O2RA 2ODTX 3UMRA 1HWYA 1FP4B 1XAJA 2Z3VA 2QMHA 5EY5B 2Q50A 2E0IA 1C2TA 1J20A 1G8HA 1U8YA 4K9QA 3WIUA 3NC0C 2QAIA 3OZXA 3CNLA 2PFGA 3MD0A 4LOLA 4FYXA 4P38A 4RKRA 3COSA 1S0UA 5JDCC 5KB3A 3QXCA 4WJLA 2Z5FA 4NI5A 4MVYA 4R8LA 1JLKA 3KFVA 4TVKA 2E2WA 1HDXA 2WG0A 4IDPA 4PFKA 3VRHA 2OM2A 1C3VA 3ROEA 3K1AB 4FJ2A 3SS8A 1CZKA 1NLFA 5AI6A 2ZB3A 2H4JA 5B1SA 3FMIA 4MHTA 4G1VA 2NU7A 1NUSA 2Q2NA 2CMGA 3FOEC 4AWAA 3PFIA 1RMQA 3H83A 1N6NA 2FG5A 5F2KA 5KHOC 1Y5LA 2O8BB 4UM7A 2QN6A 5CZVA 4AY3A 2HIHA 3Q8KA 1P1CA 3A14A 3NJ8A 3PPYA 3ONWA 3AR2A 5IARA 2PLAA 4E7PA 4L8FA 3SR4A 4AECA 5JRHA 2CF6A 3TE6A 1KO4A 1W52X 4BFUA 3LX8A 2H0AA 5D85A 3LAXA 1JVNA 4M4SA 1GM5A 3OZRA 1TM7E 1D7OA 2XUFA 3QBJA 1T2VA 1QM4A 3RLFA 1GPLA 4DB2A 4IIBA 1VB5A 1ISGA 1TIPA 1FY2A 2WWGA 3C6ZA 4TQAA 4Y30A 3F5QA 1M2KA 3RHZA 3CG0A 3WZLA 1WQ1R 3FXAA 3OQNA 4EUNA 4FILA 4MWOA 2X4LA 5EZ6B 2GETA 3CM0A 4Z49A 3IEUA 1OY1A 4G24A 4HEHA 3GQVA 1WD7A 2DY0A 2HRRA 2XUHA 4P80A 1VE1A 1AA6A 4HNUA 2JA1A 1JJIA 1L9XA 2N0SA 3NC4A 1T91A 3KPJA 1I4OA 1SBNE 4XD2A 5KSPA 2AFIB 1GU7A 1AUOA 2W2VA 3IBCA 3D6HA 4F1JA 1RG9A 1I7LA 4P98A 3K30A 4X61A 4NIMA 1J1IA 3E5MA 2RAPA 5FTJA 4C4AA 2XE7A 5BV8A 2GYWA 4MR8A 1LV7A 4PR3A 3M6MD 2I2CA 4KP7A 1W4LA 3ZWXA 2IXDA 1VLHA 2JAXA 2XHEA 2ZJFA 1NW8A 1X7ZB 3O31A 4GMKA 4I50A 4TTAA 3WHKA 3EVAA 2EW2A 3D7KA 3C3YA 1COWA 1OTXA 4LE0A 4JB2A 1VYHA 4MIOA 3MSCA 4MLZA 4UE3S 1ZB9A 1O4WA 3GRZA 1HQCA 2C3UA 4NABA 1IL0A 4KSCA 3RBZA 3NEJA 3PDCA 1A4RA 1L5FA 3PA8A 1E1RA 2F2TA 1KMNA 1DQZA 2UYQA 1E2NA 2Y6UA 3JSXA 2Q5QA 1QGYA 1KWGA 4KXMA 3I9JA 1EFUA 2Q7DA 1NP3A 1CV2A 1URPA 3BXGA 3D6VA 3UHOA 2FXIA 3UAYA 2BW0A 2ONJA 3QYAA 2Z6QA 1M7GA 5C51B 5KEIA 3FOFC 3TOXA 2J3MA 3GWGA 4GXTA 4HEQA 4GDFA 3NGLA 1O97C 2OV1A 2V58A 4OU5A 4GYKA 3GLIB 2FPSA 2UUCC 4GLBA 4FKZA 4U9HS 2Q99A 2VP5A 3B3GA 4X54A 1Q3KA 1L6RA 1N6RA 2ODNA 5LDHA 4Q4JB 4BX3A 4KUEA 3JAMA 3KKMA 2A59A 3ZDCA 3KQTA 4PPNA 2B30A 3L05A 1OAOA 2QAGC 5D51S 4CV2A 4JYMA 5AJYA 3HLTA 4IXWA 3GLSA 4CV1A 5IYZB 5K0GA 5L7TA 1YR1A 4BPBA 1SU7A 1ES9A 4PRYA 5JFTA 2F3SA 4QBHA 4B5KA 5CIWA 4EGSA 3N0RA 5KQRA 4OX9Y 1GV1A 2GBCA 3H4MA 3RU3A 4J4BA 4D43A 1FTNA 1B74A 1IG3A 1CP2A 2XNDD 4LG1A 1NXOA 1T9AA 1W87A 1E7WA 3HNOA 4MRVA 3FSRA 4BNNA 4DDKA 2Y27A 2ZRAA 2GBLC 3A6LA 3O1LA 3RO7A 3V1LA 4F91B 4BB5A 4EHAA 5CVVA 3OKCA 1R66A 1AKYA 1N0VC 2QLJA 2XZTA 3H4TA 3VYTB 4IOLA 3UK7A 5JMTA 5T4EA 3KQKA 1Y1PA 1ZFNA 2W6MA 5CEFA 1D2GA 4WUVA 4EFDA 3DTYA 2ZRBA 1WV0A 4LRXA 1OIVA 4YJ3F 4XEHA 1DKPA 1XYGA 2M1XA 2VXYA 3UK6A 3VDMA 4B17A 1ABFA 1YIAA 2BOVA 2XQIA 4NWIA 2IBSA 4CEIB 1GG8A 1Q3HA 1ZRNA 4AQYC 2CFSA 3CLKA 1FA9A 4JP2A 3QE2A 4LN1A 1NFRA 4U2CA 4X1KA 1SULA 3F6BX 4ZWNA 4BFYA 5BUQA 1YZLA 2PX5A 3JQ9C 4QPCA 2TMDA 1VRVA 1M7HA 4PBRA 3FZNA 4YK7A 2OCLA 3DGEC 1QS0B 1HOTA 3AI2A 5K6RA 3CVJA 4QRHA 5F3DA 1ACMA 5C1OA 4PAWA 4DCOA 2YMQA 4MV9A 4AO8A 3JARB 2AT1A 4E5MA 3DBOB 2QD5A 1PG5A 3E0XA 4J07A 1JZSA 2QW8A 4WKOA 2C3YA 1IY0A 2OVBA 2ET6A 3A4TA 4I5DA 4K6HA 5AK6A 1NW7A 2JLBA 5F23A 1NI3A 3KZ1E 1RQNA 2K7FA 4D3SA 1UODA 4OL9A 5ELXA 3JQPA 4YP1A 1NXTA 5KHAA 3RT9A 2PH5A 2XMCA 5T64A 4BMVA 1A97A 1RJ9A 3VC3A 2RGBA 4JUAA 2FZKA 1SB9A 5J5CA 3PNKA 1U80A 4ALNA 3URKA 4X1YB 5C1DA 1SHTX 4N54A 5F7OA 2VCEA 4E5KA 2EYUA 2BGUA 3PPWA 3SX4A 3BH7A 5TF0A 1APBA 1CB7A 3A1TA 3KJXA 2X7XA 5JHGB 1TTPB 1XDBA 2ZJ7A 5FLXD 1F8FA 4D98A 2RHBA 1PHRA 3EVGA 1MEOA 4DCNA 3LK7A 2GUGA 4FE4A 3QI7A 3KB1A 3L41A 4J1TA 1KHTA 2QSJA 3WKEA 3SU8A 2YXEA 4EQ6B 4B3RC 4MCIA 4MWTA 3PXAA 2BIFA 5HWSA 1C30B 2EF0A 5LXTA 4QYXA 3VDQA 3QEKA 2OA0A 1YV9A 3DWIA 3K6RA 4DNPA 2A7QA 1TVEA 2CB0A 2F8SA 2OYSA 2WUDA 1YL6A 2CUKA 1W2HA 2Q3JA 3QM1A 4G86A 4TUYA 3RWMB 3KYBA 4FUQA 4WZBB 3N2QA 1E89A 2QX8A 3CF0A 4E0BA 1SVKA 3UAGA 2I22A 3V8MA 1NSYA 4KN5A 3HP4A 3P9XA 4TSFA 4JLWA 4X5OA 2AXNA 4ZQFA 3Q2IA 4EITA 5ALTA 1NXSA 2R66A 1JQKA 4F6CA 2P8SA 3IPRA 4MTNA 2Y71A 3AW8A 1Q0PA 3ED1A 2ZREA 2O59A 4P3XA 3MUNA 4YJFA 1EP2B 3AESB 3RB8A 1NBAA 4JVNA 3BHJA 3Q1KA 4FN5A 3UYLA 1G8SA 2BI8A 3HABA 3FKJA 1XWIA 1RZVA 2DHMA 3W5SA 1TW2A 5BMVF 3KOYA 2ZUFA 1K7YA 1HI9A 1RJFA 3I37X 1BJKA 4WESB 3A4IA 1SH7A 1MBZA 1IBSA 4RBNA 5TQ2A 4I1SA 3PPXA 1FYEA 4K9PA 1CHDA 3PEFA 4X94A 5BW8A 2X3UA 3E6AA 4NCNA 1KE2A 5TQ0A 5BR7A 1F3OA 3GGDA 1GTG1 4UDOA 3SZ3A 3ANNA 1EA7A 1XMIA 3UQYS 4U7WA 5DV9A 2XT9A 5LP6A 1DXYA 1JDBC 5HOEA 1PLKA 1FJXA 1JR3A 3LHKA 1VSUA 1QH1B 2HBRA 2LZ0A 2ZUUA 1F48A 3D8HA 2O2ZA 5E1DA 5U1PA 4CF7A 2O2IA 3MB5A 4RKWA 3N05A 1MORA 4HS4A 4JCCA 3H4IA 4J03A 1SQ5A 5AVRA 2H0RA 4X95A 5EVJA 4ZARA 5I7AA 2ZTSA 3S99A 3UFXA 2UZ1B 3R5SA 3V8EA 2XEDA 4FSHA 3IRUA 3L8CA 4A8PA 4YJ2A 1I1OA 1OX4B 1WVGA 1YAHA 4N8SA 1E3QA 3BIFA 1YKFA 2JL1A 3EPPA 3SQWA 4ZO8A 2AF4C 3M4JA 1FDSA 2H29A 1P74A 3C7CB 1UK8A 2HXSA 1K3TA 1QHYA 2NO0A 1OASA 1UMDA 1IDOA 2ID4A 3GLHE 2I71A 3MRXA 4CG2A 2OFXA 4BVHA 2QTZA 1K7CA 2JFHA 3EQ8A 1OTYA 2BEUB 4MWZA 1XJ0A 4YGYA 2WUVA 1A4XA 3B1YA 2I29A 4D8XA 4F2GA 5KYXB 1G8KA 3O9ZA 4BWYA 1X86B 3CUSA 1UH5A 2P6OA 2OPLB 1PJCA 1Z34A 1M1NB 3L8ZA 1D4AA 1RXSA 1IOZA 3LQYA 4QGHA 1WG8A 4CCYA 1CUJA 3JTMA 3Q72A 4QJ5A 1ULTA 2D1FA 3F71A 5BWMA 3GG9A 3X1DA 1P75A 3ADKA 3G2OA 4POAA 4YV0A 4WNAB 4JLAA 1AXGA 3PDIB 4ZQHA 5ALOA 1P19A 3NTVA 4K9KA 4CU2A 1ULHA 4MGZR 5CIQA 1RXYA 2EKDA 1SZJG 1SC3A 3GJZA 1SUWA 5IMSA 1X7WA 5EQTA 4QG7A 3TGLA 2CK3D 4N9QA 4U5YD 4Z4IA 1R8JA 4HRYA 2H2GA 1P6UA 2YV3A 4MIKA 5HFNA 3OA0A 1KK1A 2R6FA 4X20A 4RZUA 1EHYA 2C2YA 1JFSA 4L9AA 1O96B 1VP9A 3IAXA 2NXEA 4WXHA 3DTVB 3L2OB 3PC7A 1Z8NA 2Q5IA 4F7WA 1NP6A 1RP7A 1YDWA 4FYVA 2J33A 4NENB 4O0LA 1YS9A 4DV2C 5AW8A 3EMBA 4TZ6A 3AUKA 1E5XA 2OHGA 4HK4A 1OWOA 4MW2A 5AOCA 4N41A 6YASA 1Q3TA 2VNKA 5MN4A 2EIHA 4WCVA 1AQUA 3WGLA 2F3TA 3EJ6A 2GOYA 2FWRA 2AFHE 2ZBEA 3B9QA 4H1HA 3BB1A 4YAWA 1PDVA 4A2CA 5LUBA 3WS7A 3T1HC 3BWXA 4DDVA 4JJEA 1TEZA 5KOIA 3STXA 5DASA 5LDGA 2G0TA 2XMGA 1AMUA 3P9CA 5FTKA 4X62C 1HDCA 1QRDA 2COEA 4R0MA 2IE8A 2J31A 4HMOA 1R9NA 5EIAA 3Q4GA 3TOVA 4CTOA 2Y99A 1V7PC 1HT2E 3L01A 4TWBA 4WY2A 4WGGA 3C5EA 2NSHA 3QXHA 1A88A 1N0IA 1N0UA 4HUQA 4Y6PA 4CQLB 1PSWA 4N3BA 4C14A 2VAVA 1Z0UA 3DAOA 2VYCA 3COYA 4BVLA 3AXSA 2Z04A 2P0EA 4NK5A 1HNNA 3L7IA 1N6PA 4ED9A 4DIBA 4NXNC 3HWX1 4KGZA 1W7AA 4ZALA 4C0XA 5AVJA 5E7JA 3TB4A 1U8EA 1T0JB 1TECE 4KRXA 5DHTA 4BKPA 4DEVA 5AUOB 3L8MA 4AY2A 1TU0A 3CE9A 3RIHA 5EXTA 3W9BA 1WW3A 5B7NA 2H2WA 4ZZIA 4LFBB 4M46A 3L9XA 2DQKA 1I2CA 2O48X 1M74A 3DV0B 3FAKA 4HVTA 3T5GA 2MMAB 4KO8A 2CYCA 3GPBA 1U8ZA 2BPOA 2CZQA 1OXMA 4GLOA 4GUAA 3NWPA 2HK9A 4NS4A 4NZNA 2TMGA 1YZUA 3KSRA 421PA 1Y33E 1U3CA 4K6FA 3MWLA 1ZK4A 4IO1A 1RXIA 1ISPA 4O5AA 4C29A 1QOPB 2HH9A 3JZAA 2PPVA 4S12A 4C0AC 2NV6A 5IT0A 1FU4A 3ETGA 2ONFA 4UAUA 3SX0A 1XFDA 1B3RA 1MRSA 3K2IA 1W30A 1UAAA 2X0NA 4RTJA 1WUIS 2ZKIA 4FX2A 5FBHA 4YX9A 5K8IA 1X38A 5T8KA 4H6VA 3EXAA 2WHQA 4HDNA 1G2OA 1HDOA 2OK7A 2ODQA 4BY9E 3W9SA 5FOXA 2EFJA 4ZRDA 3RRMA 3EEYA 5DP1A 4L4ZA 3I9KA 2J9FB 16PKA 3DBIA 3EXG1 3ZVKA 1TA0A 2Q5FA 4QU8A 3C85A 3EEIA 3SJUA 4ZYVA 2VTDA 2OORC 1ZI9A 5EKTA 2E89A 3K72B 3HPRA 3T35A 1EGQA 2B25A 2X76A 4TROA 4YUXA 1D1SA 3VJMA 4A0GA 2TMYA 1EYZA 5J2TB 5FEUA 3JVIA 4P3OA 5THQA 3E2MA 2HU2A 4TSKA 2UAGA 4P86A 4DADA 3N2KB 1SHJA 1EVQA 3LF2A 5AKEA 3LOQA 5J2UB 4DV1C 3BE8A 5A7GA 1YQEA 4I50F 3MBIA 1Z36A 1G6OA 3CNOA 3TVTA 2L17A 2PKYX 1P4GA 2P30A 2X2FA 3BJMA 3OECA 3ZEAA 4DZZA 2NVUB 1GA6A 4GNRA 2C2KA 3U7QA 2VP4A 2WDPA 3GD5A 3HN7A 1YZ3A 3LXRA 2VZ8A 1VE9A 3TLKA 3TVDA 1CY1A 1CY2A 4JX9A 1ZA2A 4F9TA 1Z83A 4L75A 1U0HC 4ZZ3A 4ZMBA 1R00A 3TW4A 4B2PA 3VR5D 4FB4A 2OBYA 2VOJA 3X44A 5LYYA 1NIPA 3SICE 4AF6A 5AM3A 2NYAA 5ISMA 5LMUC 2R8ZA 2IYNA 1UBKS 3DE4X 4HAIA 5CNKA 5K0LA 3U7EB 3KD2A 1P7VA 3OHPA 2VSOA 3Q3GE 3ZH9B 2LIPA 1DKOA 1THTA 1UC8A 5MDHA 4CKCB 2QR3A 1DKLA 3HXLA 3R7WA 1B42A 4NARA 1U2SA 3OZ7A 3PCRB 3UJHA 1QGED 2REOA 1BWQA 1G19A 1II8B 1I2MA 3AGPA 3D4OA 1SC4A 3HV0A 4OQ4A 3TTXA 1SC9A 5IN4A 5BR8B 4OMUA 1XAHA 1A0OA 4EG7A 2VWPA 1WDMA 2QLMA 5EI5A 4W9MC 3EXEA 2Y4NA 3RBAA 4XDYA 1ZMRA 2YHBA 3RFCA 3EVCA 3SJZA 2XE8A 1IC6A 5CBKA 2A9RA 2XXBA 4UHCA 3Q2OA 4OLHA 1AHNA 2W6JD 3I5AA 2H9YA 4N0PA 5FPYA 1BNCA 4KI0A 1XEAA 1ZL2A 5JYBA 5ECWA 3D7MA 2EKLA 3ORQA 4XOUA 1UINA 2H4XA 3T3MB 3ETLA 4C4RA 1JHMA 2W6QA 2WFAA 1H6AA 2ZWIA 4RV9A 4L6IA 1OVGA 4MI9A 4WZAA 1YVEI 5DTMA 1XVVA 1DJOA 3FZGA 1YTLA 3OM9A 1OJLA 2BFDA 3PGLA 4Q3OA 2E4XA 1R6BX 1SEPA 4L5IA 4ZTBA 3V00A 4LZOA 4BNUA 4IDFA 3O8BA 2ZYHA 3OIFA 1P7PA 4PC2A 4KZPA 9LDBA 3PVSA 1O4VA 2BFBB 1XZJA 1AU9A 1XQYA 2AD1A 1TK3A 1CIPA 1P7ZA 3CH5A 2FMHA 3G0IA 2O0HA 3D8UA 4TMFA 2QP9X 3IKVA 2XEXA 2WUGA 4PZPA 4OXXA 3J7AC 2C1XA 5KSYA 3G8AA 4P5DA 3SJBA 4D46A 2EFHB 4TKUA 4ZZ2A 3HLYA 3LNCA 4KN9S 3E84A 4K46A 1TCAA 3L6CA 1BHSA 3GR0A 1IIBA 1ZA1A 2FPKA 4G4GA 1ZCJA 2R7AA 4DJJA 1E2HA 2XMPA 1ZUD1 3OM1A 4IG4A 5FTNA 5LQAA 3VHRA 3A9UA 1H2AS 4JOQA 1XZBA 3IEMA 2OHVA 3H1PA 3LVRE 1TJNA 1ZHOA 1J22A 1UFRA 1SKMA 1A72A 1RHQA 3AF0A 3FWKA 3PHIA 4P4TA 5ULLA 1MZVA 4QOEA 1N3BA 2Q3FA 2XLCA 4FEYA 3QG5A 4JWTA 1EGMB 4N6OA 4Z9BA 3SYMA 5JSQA 2NSJA 3I1FA 1U9IA 5AW2A 3IAHA 3PF9A 3LC0A 1FTQA 2WJ6A 2TS1A 3GFRA 4MX8A 5EP4A 1TUGA 1CHNA 2PGDA 2P9QA 4OBXA 3AHJA 3UWSA 1OXKB 1O54A 4LDJA 4BVJA 4D6YA 3I76A 4JSYA 4JV5C 5JJBA 2IUYA 4CLRA 4B83A 2VAMA 2WMYA 4IIGA 4XSGA 3LXUX 1L5OA 2FNAA 3SY8A 5LXTF 2IOFA 1PT6A 4PHFA 5JD4A 2UXBB 4MPTA 2VSQA 1E2QA 3EA5A 3MWDB 1WU8A 1V3TA 2W2OA 3PUHA 2QRMA 2ZYTX 2ACKA 3KLNA 5L40A 4G0WA 2ODBA 2JGLA 2R97A 4KKVA 2XUZA 2Z1NA 2Z56A 3H2ZA 4RY2A 4GOKA 4I1PA 5BORA 3OT1A 2DR2A 4AG6A 4E6PA 1LS6A 2BKAA 4HO1X 5A3RA 1F0KA 3FIJA 4IV5A 3WLEA 1M83A 3HVKA 2ZWMA 4DVGA 3IEIA 2GCNA 1IN8A 1KDZA 3VNAA 1Q2UA 5LMZA 4NTZA 1Y5RA 3GAFA 4LYHA 2EC5A 3I9MA 3L0SA 1QCDA 3C6KA 4PUHA 1ZPDA 2VDRB 2FOLA 3L8HA 3DSRA 4ZAZA 5BUZA 4RL6A 4CDNA 4GOND 2GCOB 1PK7A 2OKCA 2J4CA 1LW6E 1NYEA 1R7RA 4US1R 2BSXA 1KC3A 4TT3D 5LJIA 5FD8A 4CMJA 2PD3A 3EMDA 4MOWA 2GK4A 2WWHA 1WUKS 2JATA 1A4UA 4M0LA 1Z0IA 2F3RA 3PQ3A 2VBIA 3NR2A 3BICA 1O6CA 2CMKA 2ZBQA 1PGJA 5E1OA 4KQKA 6LDHA 3QOXA 4JASB 1WMDA 1U5AA 4Z1MA 2JEOA 2F8MA 1BE1A 3COPA 3MMPA 4RF4A 4MUMA 5TX7A 5T6MA 1QFZA 4QXAA 3JWPA 1QFJA 4Y6QA 2W0SA 5AKXA 4L6CA 3GCWA 4DIOA 1E64A 2VPPA 1A9PA 3H9EO 3HDHA 5LP6F 2G1JA 4UUNA 1UPUA 1KYZA 4TWIA 4AMVA 3Q3IA 2PS0A 2R65A 3PJEA 3U6KA 4J3JA 4Y2YA 5DGDA 4Q4CA 1NVXQ 2Z57A 1YZKA 3SC3A 1BA3A 1MB9A 3GJ0A 3EGWA 5AMXA 5A71A 8LDHA 1Z4JA 4MUXA 2J7PD 4A8HA 4ERNA 4B3MB 3AEYA 1OGJA 2YWGA 4OG2A 1FNSA 2ZYUX 3AVVA 1S8FA 4YJ2F 4V0MA 1K3UB 3HA5A 4Z8YA 4RF3A 4OFXA 5IANA 2QQGA 2CJWB 3ZHZA 1B3BA 3QPWA 1J21A 2J3JA 4DA8A 1P9RA 1FP1D 1I3LA 2ZAGA 1FFBA 4QYWA 3TW0A 1BE6A 5IF9A 5MFZA 4LFAB 4TQGA 4X7PA 3SN6A 1CQIB 1XA3A 4L78A 2AJ8A 5DNAA 3HPQA 1Y4SA 5KSWB 5DZSA 5JNVA 3PUVA 4G0ZA 4H7EA 2C5AA 1ODCA 2VF5X 3INRA 3WWYA 1QHHA 4DV3C 1OI7A 3JYLA 4J29A 3ACDA 5JWRA 3D6TB 3G2IA 4B7XA 2HLPA 2IYLD 5KX5A 2HO4A 4H6PA 5EGSA 1G1AA 2GTHA 3TNLA 3UVEA 2EAUA 1JF8A 1TQ2A 1UBUS 2J67A 2PV7A 4RFSA 4Q93A 4YBRA 5DGXA 1D4ZA 2QMZA 4HFRA 4Z0TA 5K3DA 3K4PA 2XA9A 3RC2A 1ZUHA 4ODJA 4OGLA 4R51A 4XWYA 2XGMA 1P60A 5JDIA 3KALA 2ZM6C 3AUTA 2BFMA 2UUBB 5FWAA 2R4UA 1ISMA 2W2TA 5LQJA 1DV1A 2CL0X 1K7EB 5HIAA 4TTQA 1KK0A 2DC1A 4KOEC 1RPNA 3CQ9A 4DVJA 3PV0A 3R77A 1YHNA 2J07A 2F67A 3D6MA 1SUFA 2HHHC 3CCFA 4CMIA 4E5PA 4AKIA 3H99A 1LW7A 1Z5GA 2YY7A 3VC2A 2RIPA 2YOFA 1ORWA 4K9LA 4RD1A 4C2AA 1GQFA 3IS3A 4QPNA 4EFKA 4L22A 1U7OA 1RNLA 1MRNA 3PVCA 1ZONA 5M34A 3PLNA 1KPGA 2IEYA 4RLQA 1YI0A 1HMPA 5JW6A 1IHUA 1I5RA 3TWOA 4FB5A 3D81A 1PEAA 1SXIA 2PWPA 3B7GA 1TUBB 3GCDA 3NHFA 4HWRA 1IHDA 1WUJS 4LV5B 4OREX 2WSLA 2HB6A 2Z95A 1P4SA 2JI7A 3ANYB 4J8PA 1QIIA 5BMVB 4TLBA 3TRJA 1FFSA 5AW3A 1UBNA 3O4GA 3A6DA 2F7SA 1XCJA 2DP4E 3JS5A 3ZLTA 1JFLA 1K5GA 2E4ZA 2H4FA 3ZWNA 5IABA 3THWA 1DBPA 2XMSA 4AJ4A 3RHSA 1QTRA 4YAKA 4DJDC 5K8LA 1ZOSA 1G55A 4X8OA 4HEJA 2ZJAA 1R74A 3UJ8A 4Z2AA 5LBIA 1TDJA 3AC0A 4Z0PA 1FRNA 3K20A 1E5DA 1Y3AA 4KGVA 4P0TA 2V4MA 3BL6A 2X14A 5C46F 4HEA6 2ACEA 1VG9B 1XCBA 2EZTA 3AVXA 1NBWB 4QDZA 2P2JA 2JBAA 3COWA 4UAGA 5A03A 4C0LA 1RYMA 3I4FA 3LDHA 4I2VA 5BQ5A 1BFDA 3S55A 4JP5A 2B8EA 1K4YA 4ZQCB 4Y18A 1L8QA 4D96A 2PR7A 3N7TA 1DAOA 2GA9A 3RSLA 3DV9A 4B3BA 3MERA 2O2SA 3O2EA 2J09A 5MGBA 1W6RA 1GNVA 5FI0B 1SOUA 2G0NA 2R68A 1U2ZA 5HFAA 3UMCA 1Y8ZA 3NOOA 2VWHA 2C2MA 4P5EA 1KO8A 4NZOA 4B3JA 4E2ZA 2Q6TA 1ZG3A 1L8AA 5KC9A 3VYSB 5JY6A 1E3EA 1S5PA 3PP8A 3QJ5A 4FWBA 1W44A 2Q5EA 3NRCA 1BCSB 1EWKA 2XF8A 1KQFA 3G7UA 2QY6A 5FPQA 4BQPA 1XF9A 2QMQA 1EUDA 4GGMX 1VJ0A 4D80A 5KVQA 3WYNA 4DWWA 2H9IA 3PSAA 1NAIA 1HE1C 3CRZA 3G2LA 1CY4A 3P4UA 4MJ7A 121PA 3N74A 4R98A 3ZY5A 3L6EA 4A8JC 3EQ6A 1JU3A 2PUGA 4ZDIA 2VHWA 3AVPA 2FB9A 3M5PA 5CBPA 1L5ZA 2X23A 3HB9A 3F73A 1NKTA 2W6ID 2AZ4A 3R3YA 4ISCA 1MXAA 1XMXA 1PVDA 4YT5A 1SD1A 5AW5A 3RTGA 9GPBA 4L16A 3UT5A 3K71B 1NN1A 3B1WA 3GFQA 2JIZA 3SS7X 2QMYA 3HCPA 1CUEA 2E82A 2RCNA 4GM0A 2C9YA 1OXTA 2L42A 2P3OA 1TADA 3OFNA 3CVYA 4N3AA 1LB1B 5C9ZA 5BQXA 4NMWA 1N32C 4PZLA 2O3QA 4ICIA 2IP2A 4D99A 3ONFA 4P36A 4JP8A 2FHSA 1QLJA 4RW0A 3FBWA 4XASA 3KJNA 1A9SA 1U9JA 2ZR8A 4LV8B 4CF3A 3Q2KA 3ETHA 3PUYA 4RMIA 5HJEA 1XPUA 2VQ3A 2V5UA 3P9KA 2PTHA 4CM8B 5GMOA 5HKOA 2OV8A 4IV8A 4FYWA 5AVVA 1OLOA 4PLWA 5EIFA 3I3OA 3RUEA 4ETNA 2WSIA 3O82A 3QLVC 3C14C 2E5WA 2ZXEA 3P20A 1ODSA 3B1FA 3GGSA 4ZREA 3GVPA 3RVPA 3DHWC 1I33A 4EGQA 3OZWA 1TVKB 1VDMA 2PIDA 4YCLA 5EHNA 5E95A 5GOTA 4DQUA 2R48A 1LK0A 3AVOA 3N07A 6AT1A 3F5DA 3GUUA 4JFAA 4QUHA 2IS6A 3LW8A 3RYIB 1C9DB 2G04A 4U00A 1S4MA 2CY1A 2QD1A 5DYTA 4CKWB 1YBFA 5KNCD 4LBZA 5KAMA 4DCGA 2B69A 2G67A 1ZVKA 3H1EA 3LX4A 4FKMA 5LLDA 3BD9A 2RHCA 3OQHA 4DAEA 4CGZA 3UGTA 4B3XA 3IPAA 2XLBA 2YXDA 3IE2A 3DF7A 4PTZA 4QGSA 3BMXA 4W8OA 3QENA 3UY4A 2EVWX 4EY5A 1RZRD 1F7UA 1SBCA 2ZRJA 3E3NA 3FNQA 2FMTA 5K0BA 2UXCB 3EA4A 4C0KA 1XMPA 1KARA 2O9JA 3JWEA 1KFJB 1L2TA 1XXLA 4DA4A 2PKCA 1P4JA 1YBVA 3F0TA 4G9EA 2H31A 2XYGA 4EFMA 1RRFA 3B6JA 1F5SA 4KMSA 1GZ3A 3QEAZ 4NZ9A 4KJZA 4QUKA 1M2EA 3N8GA 1FW8A 4RZ2A 3KXKA 3PFGA 3T94A 1JU9A 1E63A 4FBLA 2YIDA 3OFSA 2V3WA 4I81A 4RXUA 4YJGA 1KAHA 5FFNA 1OXVA 2IQ5A 5ALGA 5IJXA 1OBHA 4AF7A 5A19A 3NVAA 2FEWB 4JHXA 1UJNA 4U1RA 1MGPA 3UB4A 1C4XA 2TRSB 4PC6A 4CM9A 5EQDA 3GC6A 2BISA 3GJ6A 1ZJ4A 4PSAA 1MKYA 1E1KA 1UKBA 1NAHA 2H08A 1U81A 3FPLA 1Y9AA 3JYQA 3ONVA 2CDBA 5EJMA 3LA6A 2NTVA 1JIQA 1MOPA 1L6IA 3IP7A 4Y2RA 3TSYA 3WGZA 4WS9A 1S8NA 2I4MA 2QP3A 3BERA 4YMLA 2QM3A 1DQRA 1T1SA 2PLWA 2YVLA 4IZOA 5KKAA 2QJTA 4WINA 2GZDA 5IU6A 1V96A 1U1CA 1QIMA 2WR8A 3CEMA 1QIDA 2EWWA 3HGTA 4RADA 4XDZA 4RIHA 3VNVA 1XRMA 5ALUA 5DXFA 3GRKA 4N1AA 2I33A 1JJBA 4GPBA 2EGUA 1XF1A 2FCRA 3AO0B 4MQMA 1NDQA 2PZ8A 5K4HA 3IVCA 2JAQA 4DREA 3K4HA 2DWPA 3ZHTA 1JAYA 3DONA 5CH8A 5BWCA 2RJ3A 3H1TA 2WJYA 4NYIQ 4ABTA 2KJQA 5K85A 3IRVA 2OHJA 2E5LC 4XOIA 4MR8B 5DTEA 3INTA 2OAEA 1F8YA 3GMTA 3R0XA 4ARZB 1Z63A 3IEVA 1X1BA 2QW0X 5IWAB 5AE3A 3VZRA 2QV0A 1T0HB 4I50B 2QLFA 4OQZA 2V4UA 2XOKA 2J6BA 4UNIA 1YZFA 4MLCA 1NVVQ 3LP8A 5IKOA 1RKXA 1Z15A 1ZJYA 3ICEA 2MYNA 2VRWA 5I9NA 1GL7A 3LQRA 1T0BA 4Z99A 2NZ8A 1R5OA 3GYBA 4I55A 5I9BA 4MKXA 4JBNA 4Q9AA 3A0RB 3WWCA 2HXYA 3IPXA 3S8MA 5AUPB 1KZ9A 4AG3A 2WBLC 4OBEA 2CE2X 3FJOA 3U5TA 3B8HA 4C05A 4OH1A 2PX0A 2XCSB 4H3HB 3KIPA 5AVOA 1LRKA 3UANA 4L76A 3H0CA 3LQQA 1TGVA 1IRIA 1SUCA 2QTWB 3BKXA 3MWFA 1KH3A 2W9XA 3CIOA 4YCAA 1OC4A 3HUFA 8ATCA 1Z3IX 2F64A 4MUNA 4BLVA 2GN6A 1SG9A 3K2QA 2QBYA 2IOHA 4J1TC 2FWBA 3RVKA 4ZHQA 1O97D 2VRNA 3FGOA 4HSEA 1XI2A 1XKLA 4RTPA 2VHJA 3VXKA 3CU5A 1U2DC 3GFSA 1N5KA 2BKVA 3L7YA 4JC5A 1XA4A 4URZR 4DUYC 1GOTA 1EDOA 1MAAA 2FFJA 2EQBA 4L7VA 4ZQEA 5KQPA 4HDOB 4C7VA 3REOA 3F6CA 5B7GA 2Q28A 3H2YA 2B36A 1VMAA 1KEPA 2RGNC 4G0NA 3GUZA 4P58A 2DTXA 1LBQA 1T2CA 4LJ7A 2HHAA 2X0RA 3H1BA 2V6IA 3EDOA 2O8FB 1PTJA 2LVBA 1XS3A 4XX2A 2PCLA 2IUSA 5CYOA 2XKAA 3ZWOA 5JD6A 3T5PA 4MV7A 1R5BA 4Q1FA 5IH7A 3LF1A 2PZGA 4P83A 4TOIA 1MT3A 1P31A 2IKSA 4KYIB 4O2AA 5DFAA 2ZRLA 1PI3A 1U3VA 4I5EA 3U26A 1WW8A 5E6RB 5TPZD 5DW0A 5BQ3A 4FMPA 4M60A 4NOZA 2CXNA 2I8LA 2FSVC 1W85A 1G3QA 3CQ3A 1J06A 1R4AA 3BH0A 3EK2A 3OD1A 4XX0A 3VU8A 1XL1A 4R0VA 2P9CA 4X1KB 3NHPA 4M8LA 3LT4A 4ML3A 4LWPA 2L82A 2C9ZA 3JQEA 2VKQA 1SNYA 4B3SC 2QX9A 3B1ZA 3MJCA 1KF0A 3O91A 3ZHRA 3CNQS 4X8HA 3W5IA 3I01A 4AZTA 3H4VA 4F4IA 3LBNA 3EIXA 2WIAA 1GSAA 2C8VA 5G4KB 3EVZA 3TW8A 4OQYA 5TVGA 3MCUA 1W46A 4QNNA 2PSDA 1XHJA 1B2LA 2WINI 4GRAA 4JI2B 4OQQA 1JS1X 3TX2A 1MNAA 2JLAA 1OX6A 2L2QA 4F97A 3IVRA 1UK7A 3FBGA 1CWUA 2QT9A 3PCTA 1L1FA 2JVIA 5EIXA 4AZSA 3E9NA 1C7RA 1VKNA 1JG3A 1XX6A 2R85A 3GX1A 4XYLA 1E1QD 3DOOA 4KQHA 3AHCA 1RJ9B 4UTZA 5JJCA 4GVXA 2AN9A 4R40A 3QV2A 1MVNA 4LFCB 1ZM4A 1SCNE 4H1WA 3CC8A 3AXTA 5F78A 4AG5A 1C80A 2PKRA 2GYVA 5E8JA 5ESWA 2BGGA 2XCOA 4OUDB 1U5BA 4DLPA 1OKKD 3QKRB 4GX1A 3SQLA 4PLGA 4HWKA 4LXIA 2Y0PA 3WNVA 4EG1A 3IL2A 1Q1GA 1QIEA 5KNBD 4H0CA 1RTTA 5F1OA 2WKPA 3CCCA 3W9YA 1L5NA 3EC1A 4MVJD 3WGHA 5B3JC 4CG1A 4W5WA 4JJ6A 4D3XA 1HKHA 5KX5F 4WCDA 3HACA 4D26A 1YD7A 2IY7A 1OFUA 4G5YA 4JSTA 3B9BA 2Z2XA 3ITEA 1CVRA 1W36C 1WXEA 3QLUC 2R6ZA 5LXTB 4KW7A 1SJ9A 3WWZA 1GCGA 2WF9A 3KAJA 4ND8B 4LCEA 4CG3A 3SBEA 3OJLA 1JHYA 4R1SA 3ZS9A 1YR3A 2PQ0A 3TL2A 1DADA 4JL6A 4YP0A 2UUAC 2BJHA 3NDBB 3NBYC 4O3MA 4XUCA 4LCBA 3QF7A 3SIPA 1LVHA 4BVGA 4CLHA 2OOKA 3G2HA 1X8KA 2PU5A 4ZN6A 3ZHSA 2GLUA 2Y1FA 3OUTA 4RCVA 2H4HA 3BGVA 1GPAA 4QXPA 4R0NA 3G9TA 1YMUA 3SQNA 2MSCB 4QTZA 3UWPA 2B20A 3EWSA 2ZJYA 1CZLA 1GG9A 2O07A 4OYHA 4QBKA 4LY0A 1V37A 1T1EA 3HKDB 3L5KA 4NEQA 4PAOA 4MW5A 4YJFB 3RREA 3W6ZA 4R8KA 3I2YX 3RV2A 1H2HA 1GR0A 3SC2A 1KP3A 4XYBA 3VBEA 2Z8YA 2IP1A 3LCMA 4YV7A 4F5WA 3IEKA 3IQZA 2VC2B 1U31A 4QHSA 5KPJA 2QUBA 2VYQA 4RKEA 1SK8A 1YMQA 1QK4A 3K9GA 4ROSA 4BUCA 4C76A 3H0KA 1VJ5A 3FE2A 2WWWA 2Z5VA 4RHCA 2FYTA 2BEVA 1XRBA 4KVGA 5TQ2B 2NGRA 2YIVX 2NTEA 2OB2A 1BVUA 4UNQA 4HJRA 5CGQB 3ICOA 4M1QA 1GAJA 2P4SA 5TQ0B 3CVWA 5FOWA 1TT5A 5LQNA 3H2HA 4H35A 4JC8A 5LP6B 1QF9A 2P5SA 3PE4A 1BJTA 1W4BA 3OE1A 3ZCSA 3OFND 1GNSA 5J4LA 1I24A 1PQYA 1KY2A 5IXYA 1LDYA 4M0DA 3B6IA 5K8UA 2G7ZA 3WX0A 2WF7A 1HFJA 3BMNB 4E3ZA 2V97A 5FPKA 3L0CA 3A9CA 1FLOA 1XEWY 1PGQA 1CR1A 1E7MA 3UFXB 1TEXA 3UJ7A 5KO2A 1BDHA 1J25A 1QORA 2GVZC 2WZCA 4C2BA 3OZDA 4KHPB 1I14A 2AR9A 4YJ2B 3EE6A 3UMJA 3BDIA 3CURA 2VTVA 4RIIA 1R9MA 3LKVA 2RC5A 3KOWA 3CPSA 2OG2A 5I7SA 1NW5A 5F4ZA 1OB2A 1QIGA 4GWLA 4R1UA 4BECA 1E4OA 1H1TA 5CP8A 3IKLA 2YJ5A 1FFXA 3VTKA 2BELA 4B44A 1KVUA 2Z2IA 4WOKA 3OH8A 1ZI8A 2IUEA 3BA6A 4TVSA 2FWIA 3AUUA 1NYRA 3JVDA 3IESA 3OOWA 3EISA 1RPZA 1U98A 2C83A 2E4AA 5FWXB 2OBBA 4B6SA 1PQPA 4KAFA 1XJCA 4IJQA 1WSWA 1QLWA 3VVBA 4NONA 3FNBA 4S35A 3H5TA 4LMPA 1N2CB 2UYGA 5D3QA 1P8JA 3TRDA 3MILA 5LZ9A 2N9UA 3ABIA 4R3WA 4ZVQA 3QX8A 2H59A 1TKRA 4XIGS 3CPHA 1K86A 3RS5A 1XNJA 4O4IA 4B6EA 3ZQ4A 5K6TA 3L1HA 2VN8A 1X7WB 4YMIA 3GPLA 3JYPA 2AOUB 2C9DA 1LXCA 1RKQA 3E15A 1P33A 3AM4A 3MINA 3QTTA 4BO7A 4ETWA 5C5CA 4X20B 1FVFA 4MYTA 1UOQA 1Y9DA 4M1MA 4WFQA 3TDMA 3WLJA 2XB8A 3N7AA 4MS4A 2RGYA 4NDNA 1IXKA 3WDMA 3CTPA 4BKOA 1DE0A 4DOMA 1S89A 2JAHA 4YREA 4BMNA 3TZQA 4RSGA 5DMXA 4JT4A 1SC6A 2P91A 3JATA 5DO9A 3FPJA 3HKBA 3ZHVA 4JXXA 1O7JA 3FHJA 2Y1WA 1YJ8A 2PSSA 4RLHA 4C0BA 4LF7C 1Q12A 1QV9A 3T52A 2VJLA 1IRXA 4JKOA 2FSUA 2JIDA 3GLTA 2X8WA 4RMHA 4RX1A 2DUJA 3LTNC 2ERCA 5KYUA 3RDPA 4NBUA 4Q1VA 4KR3A 1ZM7A 1XGKA 1NUHA 1ADJA 2DVMA 3KS9A 4TYQA 3V4ZA 3LMKA 1LQLA 1PGPA 2ZW9A 3AJAA 3KT8A 4GPZA 4KFUA 2D3TA 2EHJA 1ZEMA 3MQ4A 1R6UA 3V3KA 2F1RA 2F1OA 2IPNA 4KR2A 1I51A 4EKNB 1BAPA 4YXWA 3RKSA 2QD3A 1SRRA 1DAHA 1YRQA 1D03A 4BSZA 2QVLA 4LWZA 3UG6A 3R9XA 2JVJA 1Q17A 2RK6A 4PGAA 4D1YA 3CTMA 4ZJPA 4IOKA 2C00A 5BVGA 1WABA 3WLHA 4B3IA 4C7KA 3GMIA 4DGQA 4DLTA 4J4TA 5AVXA 5I9LA 4LHZA 1KRWA 1N6LA 1UEIA 2I5PO 2P6UA 4Y7CA 5HJ2A 3V8NA 2FSPA 2IXGA 4V0ME 2O3RA 3U9TA 3C3EA 3PIIA 2QVGA 4QO7A 1O90A 1JKXA 2C42A 1Q6YA 2W22A 2V54A 3IMFA 3NNNA 5K3AA 5FA5A 3U80A 2FQQA 2B5WA 1A9OA 1XRCA 4TT8A 5JZ9A 1MB3A 2Z8XA 3K96A 4CMAA 3STUA 1TQDA 4M98A 2DSNA 5DI3B 1P2VA 2CLKB 4G26A 4NBRA 5I9TA 3VYUB 4E03A 4DYDA 5KKNB 1QOZA 1L7QA 1P7WA 1Z4MA 3CRQA 3I08A 4BMSA 5HMMA 3GP5A 4MVJM 4QEZA 5EYPA 1MAHA 2RH8A 1N2FA 5FWYA 1HPLA 4MYCA 4MMZB 1PR5A 4U9UA 3T3DA 2WM3A 4PZZA 4Q03A 3SYRA 4ZT6A 5KYWB 1EFRA 3D6FA 3SP1A 5IT9D 3AV0B 4JI1B 2FUG6 4WWHA 4BCAA 3ZUPA 1GNTA 1Z7WA 1WUHS 2GN4A 4L08A 3VNQA 1P18A 2QGFA 4C4YA 2I4NA 1GCIA 3F3KA 1P0FA 4ZO7A 4DNXA 1IM5A 4FGUA 5B12A 4YMVA 2Z5GA 1U3UA 1VC2A 1SN7A 4LI3X 4C0HA 4HDNB 3ILVA 4D0LB 1JRLA 4LF8B 4LS3A 1ZIOA 1TC1A 2WHPB 4ER6A 1BMQA 3TVYA 1PFQA 1QO9A 1PFWA 5DHSA 4NV1A 1PDWA 1MV8A 3WLTA 1ZX1A 4AN4A 3R7FA 4U7FA 3OFJA 3CQ2A 3I6YA 3DWFA 3A2MA 3W5AA 4CZ2A 2I76A 1DXQA 4IRXA 1FYXA 3ZHCA 2JIPA 3H3JA 4GZ6A 3W77A 3AY6A 2FP4A 1ZSNA 1KIAA 1YOBA 5IH3A 1OBCA 4IMPA 4LJ4A 1ZESA 5CDFA 3FJ1A 1C7QA 2NO6A 3AOEA 4QQKA 2IPLA 2I6XA 3A70A 5IAKA 3DLBA 1F1JA 1X1RA 4OSOA 2X5XA 2VHXA 4US0R 1NRIA 4ZOLA 4AJEA 3PQ7A 3KHSA 4DPKA 3JX9A 4QG3A 3IHTA 5JO0A 1NX9A 2W8ZA 1XFAA 3NCTA 1NW9B 1R0YA 3N8KA 3U7QB 4EECA 2HV8A 5J47A 5M5BA 4I55F 5E0OA 4COKA 1CW2B 3LUBA 4FEAA 1QDUA 1FBTA 2BGMA 2IT1A 3MWYW 1H93A 1YB4A 2EKZA 5JSYA 3WGTA 3QJYA 4HI0E 4OKSA 1OLXA 4N4AA 3GY0A 1P4AA 1N57A 3DLIA 1J33A 4QGFA 3BF8A 3OJ0A 3Q11A 3UUEA 3CYFA 3KXWA 5IJ0A 3KSBC 2FEPA 3V80A 2XYQA 1A77A 1UKEA 5GZ1A 4OHMA 4ZEWA 1NI4A 2RIRA 1BVYF 4O59O 4NXMB 4M55A 2QTTA 4CQMA 3KE8A 3CFYA 4ZHQF 3WSVA 4DABA 2YVUA 3O8CA 4MKFA 3R7WB 4A73A 1E61A 3PD0A 1EU1A 4A2WA 4Q3BA 1I7PA 4ZCIA 4YCNA 1J1UA 1EP1B 3KJIA 3LFUA 4X3OA 2P67A 2R25B 2ZBRA 5F4BA 1BJRE 4BMYA 4Q19A 1PJTA 4GPEA 3KYDB 1ZCAA 2X4GA 4TTSA 1V6SA 1YB1A 4ND3A 2E5FA 1XTTA 3E3AA 3EXEB 4WTOA 5HA5A 2Z9DA 2BAGA 3USES 4B47A 4AJLA 3ESQA 3KQNA 4FEGA 3RWBA 3O3NB 2AOXA 2OV2A 2A92A 1EGAA 1TM3E 2I7CA 5EGNA 1Q83A 4K9NA 4F84A 5D8DA 4CU5A 1I2BA 2WWXA 1UM9A 3BGDA 4MTCA 2NXWA 1J90A 4IYJA 5IVDA 4ZK6A 1AKNA 1T6NA 1R10A 2Q07A 1Z88A 2X3FA 3F2IA 2V74B 4O2AF 5AXDA 3T3PB 1EFPB 2G83A 2R6AA 1C1XA 4ZEMA 1SZPA 4ES6A 2ARKA 5JZMA 4D8VA 1T5SA 4DEYA 4RORA 4WZAB 4HLNA 3OF3A 4L8LA 1Q44A 3PUXA 4BXOB 1PJ2A 2BFDB 4UHDA 2VUIB 2O0LA 3DBLB 4U5QA 3AB7A 4CM3A 3NG1A 5E6UB 3VAAA 3OMLA 4YAIA 2Y9PB 3SE0A 4JI0B 2BMFA 1C1DA 2NUPA 2CVPA 2PMFA 3SXJA 1Z08A 4IJKA 3OAAA 1IPHA 4R1NA 4Q9IA 3DL2A 3WP1B 3WMFA 4EW6A 5IFIA 4LHSA 4IGAA 1Z3CA 1ZJ5A 2Y93A 1JHPA 2PL9A 221PA 4TKUB 5A1TA 3IUBA 4H27A 2Y0CA 4B80A 3EUFA 3VR4A 3TXAA 1PGOA 4DT1A 4DCSA 1I36A 4B3CA 4YRKA 1LVGA 1KMMA 3NJRA 4GAEA 3FPGA 4K2AA 2A67A 4LBWA 1P8AA 4KQMA 5DISB 3E3MA 5BRAA 4TTPA 5IASA 2X9GA 3DHYA 4W1RA 1YJCA 1KDOA 1KYWA 2Z6VA 1IPFA 4CCWA 4NS1A 5BSHA 3MBKA 2GN8A 3NPAA 2EOAA 2R00A 3KSMA 2R8RA 2BFWA 4LOAA 1A9QA 3KP1A 2Q2VA 4GG1A 4MHOA 5TPWA 4CMCA 5J4VA 1CY6A 1W0KD 3ZQUA 4FYHA 5I7HA 3WO0A 4MDFA 4X6XA 3SHWA 3KZKA 3KX2A 1DDIA 3GA7A 4KH0A 5I7UA 1CQZA 1XTRA 1DOAA 4UAVA 1MMFB 2J41A 4NAHA 3L6DA 3PC8C 1JEQA 4RHXA 1JL3A 1LZLA 1SOMA 2XNHA 2J0SA 2Q4DA 1OPXA 2ZRPA 4M7WA 1YT5A 3I04M 2BP7B 5MN5A 1Z2PX 1T3TA 4LHEA 4LXTA 4KACA 4G1UC 5HDBB 2X5JO 1N2JA 1XK7A 5FYQA 1CRQA 1BQEA 1D2EA 1P2UA 4YAGA 5I7EA 5ALYA 1OREA 3HA3A 2IVFA 3U13A 4DZTA 2ILVA 1L5QA 2WYHA 3AP1A 4IY1A 5EIWA 3CGWA 3D8TA 3RQIA 5I3CA 1E6KA 1UBOS 1W47A 3ELUA 3TDKA 3V2UA 4RTOA 1Z7GA 2J9RA 3Q3HA 2H7YA 5LB4A 4LYJA 3DZGA 5K3CA 1IJBA 1LVUA 4UOEA 2P65A 1UP4A 4UHHA 8AT1A 2VTBB 2VNIA 5BRNA 3T7TA 2CNWD 2NV0A 4MS1A 1SZDA 3U37A 3R4VA 1USGA 2PGXA 4WXPA 2I2XB 3RT7A 3EMVA 4URUR 3PS9A 3CLRC 1E5TA 3KEGA 4BNJA 3QU4A 2D06A 3GRAA 1UANA 3UHJA 3BXHA 4O1MA 1QQ7A 3M6FA 5CA0A 5KREA 3L04A 1ZI6A 2QE7A 1YR7A 1LA2A 3F98A 4E31A 4RJLA 3AJ9A 4TS9A 1BG6A 1ZOPA 4KR9A 4M76B 4MO9A 5HILA 1FX0A 4OI2A 1QG2A 2ZI7A 1LZKA 3UHAA 4JXZA 4BQRA 2YW2A 2SKCA 4BUJA 1NLUA 4CLXA 3JWGA 4AYXA 1LI4A 1ADBA 1ILEA 2QORA 3DC7A 2OXTA 4B09A 2F4VB 2RB4A 4CVNA 3I09A 5K4GA 1XQ9A 2ATXA 5FNZA 5E3JA 4RF5A 1OROA 1R0WA 3TTYA 3UWKA 2D3WA 1BX0A 3Q98A 4IZHA 1JIXA 1P77A 3R40A 4PROC 2BGIA 3DNFA 1F51E 2B8JA 3SAJA 4C7MA 4FCCA 5SY9A 3TL6A 3ZEIA 1PQUA 1A82A 2HFKA 3AUXA 2ZUDA 3P2EA 2COUA 3L7BA 4WAUA 5EJ7A 3UPUA 5H59A 4DJFC 1HURA 3MJTA 1FSSA 4RVGA 5CHYA 4CV0A 5CDTA 5ITZA 1HDYA 4P6VF 5CD1A 1FSPA 3O1JC 3FOCA 4ZKDA 1V2GA 3IGFA 3N2EA 3OLZA 4XR4A 1SVNA 2BM8A 4CKYA 3WKCA 1Z18A 1W1WA 4HZUA 4N3CA 1X87A 3IT1A 2VPWA 1Q7CA 5E2IA 1G18A 4NRDA 2HIMA 5IZCA 2H51A 5H0IA 3V32A 3OBBA 3D8NA 3RW9A 3HJTA 1Z2NX 1XZPA 1A98A 2HF2A 2JK0A 4MKGA 1QQ6A 4YDRA 4ZYYA 3T61A 3FTPA 2X5KO 3ILSA 2ZJ4A 5DWVA 4P4SA 1KOLA 2ZSIA 2W00A 4E09A 3T4PA 5EZ5A 5CH3A 3QLJA 3L0DA 1UAGA 3EGCA 3HWRA 3HYSA 4GQAA 4JGIA 2XD4A 3Q40A 4P4LA 5FP0A 3LCUA 4ZD6A 1A2BA 4D9NA 2GZAA 1R0KA 4J6FA 4JI5B 4G37A 1TNDA 5CAEB 3UXYA 3ZBPA 4YUAA 3ZVLA 1UKCA 2B7BA 1TQ4A 1PNOA 2IF0A 1I4LD 3LM8A 8GPBA 5I6DA 1SCBA 3CXUA 1WHTA 3MTAA 4RIEA 4O4IF 1N7JA 3PR2B 3D6NB 4A27A 4ZYXA 1DXHA 4HZIA 3I61A 2HIGA 1UWKA 1B6TA 4N0EA 3JAWA 1IMJA 4FHEA 4G0OA 4R4JA 5GWXA 2C98A 3ANLA 3GFBA 4RXTA 3FFWA 4I66A 1PS9A 2HXGA 2EEZA 4LYYA 4A10A 3PJFA 1OAKA 1VA5A 4JELA 1NFFA 4H7FA 3L4BC 5ANRB 3RANA 4DIUA 4EW1A 3KELA 1SCIA 1SKYE 2HDOA 2FX3A 1YVRA 1DO8A 4CMIB 3KAQA 3PR3A 2QZSA 4DDTA 5F5LA 1JLMA 1TM2A 2XE6A 1VL2A 1TJ3A 4PGMA 1XKQA 4NCAA 3KOUA 4I5FA 1M6HA 4HC4A 3TK1A 5KTPA 4PG4A 4MI1A 2HO5A 5IDXA 1KNXA 3AKEA 2VKTA 3PGA1 3B6EA 3PZBA 2Q9BA 4LZNA 3HSKA 1ISIA 4UC0A 2IXAA 2W71A 2GEUA 2GWHA 1KMIY 4PZ9A 4RPIA 1IZ9A 3B9PA 4W5RA 4PIVA 4KWCA 1O89A 1UT8A 3MJDA 5EUMA 3ERCA 4CCSA 2QRGA 3SHFA 4C6RA 5I7OA 1OHHA 1AUQA 1TL7C 4E2WA 5CJJA 2VR1A 5D3KA 4LDPA 4MS3B 3ZY3A 1MX9A 1LBHA 4G0PA 3OPYI 5IW8A 4YP9A 4P4GA 1RYYA 1P7CA 3CH7A 3GAZA 3ON5A 3IXLA 4AS3A 3TUFA 1JWBB 3EGIA 5HKKD 1LC0A 3F97A 3JZDA 3AP2A 4KOAA 4MAMA 5K3SA 5ILQA 1Y89A 4EO7A 3QSGA 2JBAB 2JS7A 3VPDA 2RBGA 4DQ0A 1CZUA 4YAOA 4AULA 3ESDA 1JHAA 2Z8YM 4JITA 3EY9A 5H5JA 4C2UA 4ZXFA 4UM5A 4Y2PA 1IAQA 3STYA 3KAPA 3QNMA 4QU5A 4AP9A 4Z4HA 3P2YA 4M1KA 1RMYA 4N40A 1L5KA 5AW9A 3UCXA 3SYLA 4LIPD 2BY4A 1PHPA 4HAOA 1XNGA 2Q5LA 3D8SA 5COQA 4ZQIA 4WBNA 1US8A 1XJQA 4AJPA 1GFSA 4AT1A 4EENA 3T6KA 4AJHA 1XLTC 3HCDA 4PNEA 2REQA 2OV6A 4R2HA 5BN5A 5ESRA 3O2JA 4OHOA 5L7YA 1I0LA 1SQ6A 1XR3A 4R54A 1AGYA 3HI4A 3PQEA 1EUDB 3DOIA 3PGKA 5EJAA 2QS9A 3UMFA 2QENA 1TYEB 3IPYA 4N0QA 4DCTA 5DHFA 1GGKA 4ARIA 4FMDF 4E2XA 2PV0A 2Q3MA 4KV9A 4OMFG 1W88A 3PTLA 4HAWA 2VF8A 1FJGB 5JJKA 3C74A 3RH0A 3VHQA 1S2OA 2VVTA 4PHHA 2R86A 1U3TA 2PEZA 2WU0A 4JOBA 2M6SA 3DP7A 2YQ4A 1U2GA 1G9TA 5F9FA 3GJRA 2DCMA 2UUPA 2GJAA 3K9BA 2DFVA 5DTIA 5DBOA 1ULBA 2Y4OA 5G1OA 4RZXA 2H4ZA 3NFYA 5DM60 3HFJA 2B4QA 5FL7A 1R8SA 2HCJB 1JSLA 5L51A 4BEVA 4AO6A 5DLYA 1WRBA 2CHGA 5EJ2A 2Z98A 4V2UA 3HL4A 1DIOB 1Y8QA 4MULA 2M5OA 1VA4A 3A6EA 3GNLA 1XRRA 1TM1E 3HYCA 4MAAA 5G4LA 3VOTA 1CD5A 3K0CA 4RS4A 2OQIA 2ALJA 5IM5A 1F2TA 1JDNA 1ULUA 3D9QX 4F3KA 3HXMA 4AUMA 2DZDA 4OLBA 1W4ZA 1X80A 2C4TA 2QTAA 1I3NA 4LF4B 4MGKR 1D2HA 5DXJA 3RAFC 5LNK6 2K7ZA 4QARA 1B73A 2WVAA 2WIDA 1EEXB 4AVYA 4HH4A 4ARCA 3UHPA 2HEGA 4MEBA 3WLMA 4ASUA 4GI7A 3W06A 4RKYA 4XJXA 1KPIA 2A1TR 2MTBA 3S27A 4D9MA 1SWWA 1YDEA 2FKNA 3QY0A 3R0ZA 4JVOA 1L7DA 1P44A 1SCDA 1U02A 1XZMA 2ZATA 2VAXA 1JQJC 1TJPB 2D6FA 3KBBA 5AK0A 3TTUA 4S05A 1GZUA 1JDVA 1WXHA 2BM1A 1CUXA 4HQKA 4RQTA 3WB1A 3UMMA 3DM9B 3HB1A 4CLOA 2PWAA 4MTLA 1EK1A 3FY4A 1H6DA 3H18A 2G3YA 1QX4A 3P9YA 3NUZA 4NMLA 4IHKA 3D3NA 3GVCA 4NYJR 1CVLA 3BIXA 5FTLA 1QKJA 1IZ8A 3DP9A 1H6CA 1KOGA 5DM4A 3WK8A 2CV0A 2V6GA 2JCVA 4HDRA 2FK7A 1OI2A 4B79A 3RSHA 2P20A 3PLRA 3TLGB 4UCFA 2AYYA 2P2YA 4YJGB 2A86A 1MIHA 1FIUA 5LD2C 5FTMA 3BKWA 1E6MA 2ZAMA 3PUZA 3PXUA 1AE1A 4KWIA 4UKDA 4V24A 4WK6A 1DPFA 1M8JA 2QZJA 1RCFA 2YWXA 2Z4SA 3U49A 2IYRA 6ABPA 1UJCA 2PE5A 3KLPX 3K9CA 4I4NA 2ABWA 2HEIA 3S5UA 1Y81A 4JT2A 2JDIA 4IVNA 1E7SA 4QUDA 3PHLA 4GP9A 4TS1A 4RDHA 3PNBA 3BAZA 4NG5A 2FE1A 5JYDA 2D7DA 4WQMA 2R6HA 2A94A 1LRLA 1V4NA 4BWGA 4TL6A 1RCTE 3RVQA 1OWNA 2DBYA 3N58A 1KJIA 3TZEA 1T8SA 1F0NA 4DSZA 2XB4A 3NETA 5COAA 1EQ2A 5JCZA 1LTQA 3KHUA 4DMUB 4XW2A 3V4SA 2M98A 4AP6A 2UKDA 1M1ZA 4IDQA 2Z2KA 2ZUVA 3B7PA 3TLJA 2FE4A 3RV4A 1DARA 3MGAA 2M5HA 3R3JA 3EEOA 3SHQA 2GYUA 3OPMA 2IWHA 4PSCA 3WBBA 2IBTA 3QWAA 1H5QA 1X8LA 2B3TA 3KDSE 3GV0A 3N6XA 4YDHB 5BVHB 4X62B 4C4SA 1TZCA 1Z56C 3DV2A 1E2LA 4E2YA 1M5RA 2Z4RA 1YACA 1TCVA 1B8VA 3FKSD 1PWXA 4QBGB 1V1MB 5D3MB 4C3OB 1PNQA 3R3ZA 2WJJA 1BMDA 3DE1X 1XNQC 5FJJA 1Q14A 1ML3A 3T7DA 4CEHB 3SSNA 3L46A 2GAIA 1DIBA 4IINA 1RBYA 3CWCA 3F4KA 1RIFA 2F43B 3Q3EA 1XMOC 4L1KA 4L8VA 4MW7A 4Q1BA 3BTUA 1JA1A 2YHIA 1Y8RB 2FOIA 4RA6A 4AU1A 5AE1A 3DEYX 1QUFA 4AZ3B 3OTWA 4LNHA 3HUUA 2NU9A 1RBMA 5IPFA 1YGYA 5KKCA 3CONA 1ZZEA 1UP7A 1WCJA 1UWVA 4DKJA 1RKVA 2JAUA 1MTOA 1LI7A 2QE7D 2V6MA 4G9BA 4WXYB 2CXSA 2MSWA 5DPMA 4DIDA 2B2XA 3Q3CA 4QJ4A 3GJSA 4B1FA 1V5IA 4L3WA 1SIUA 4MRNA 2IU6A 4QBTA 2R44A 4QBFA 1XDDA 1ICEA 2O4CA 3SG0A 3TN7A 4JQCA 4LJYA 1OOEA 2V9PA 1GV0A 3EVNA 4L5JA 1XZ8A 1QB8A 2XTNA 4DS3A 1BDIA 1AURA 5ECDA 2FUKA 5EHGA 2R7LA 5L3QA 1ODFA 3JR7A 3LLCA 2H63A 2B9EA 1KRHA 1PFYA 4QXMA 4QICA 4O33A 4IGFA