4FUQA

Crystal structure of apo matb from rhodopseudomonas palustris
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
503
structure length
501
Chain Sequence
MNANLFARLFDKLDDPHKLAIETAAGDKISYAELVARAGRVANVLVARGLQVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPKIVVCDPSKRDGIAAIAAKVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSTGRSKGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPKFDPDKILDLMARATVLMGVPTFYTRLLQSPRLTKETTGHMRLFISGSAPLLADTHREWSAKTGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGKELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGATIDEAQVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
molecule keywords Malonyl CoA synthetase
total genus 153
structure length 501
sequence length 503
chains with identical sequence B, C, D
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4fuqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fuqA01
2P2FA 3IEPA 3O84A 3C5EA 3KXWA 2P2MA 1LCIA 2Y27A 4GR5A 3R44A 4FUTA 5DV9A 4GS5A 4DG9A 5GTDA 4RVNA 3T5CA 2Y4NA 3G7SA 3U17A 4RM2A 3IPLA 5BSWA 5K8FA 4RM3A 3E53A 2D1TA 4GXQA 1RY2A 3GPCA 3A9VA 3E7XA 5KYVA 5KEIA 5DWVA 2QVZX 3O83A 4D4HA 4OXIA 5IFIA 1ULTA 4RLQA 1PG3A 3TSYA 4IR7A 3DHVA 4R0MA 4W8OA 3U16A 3VNQA 5BSUA 2QVXX 5JRHA 3WV4A 4G37A 3IERA 3RIXA 2V7BA 2P2QA 5BSVA 3T5BA 4D4GA 2P2JA 2VSQA 3FCEA 1MDBA 3NYRA 2D1QA 1MD9A 5BSMA 5BURA 4U5YD 3VNSA 4RVOA 1YJ7A 1V25A 3WVNA 3ITEA 3LAXA 3B7WA 4FUQA 4R1MA 4RMNA 2VZEA 3NI2A 5K85A 2WD9A 3LGXA 2QW0X 3EQ6A 3T5AA 1T5DX 2QVYX 5BSRA 2D1SA 4ISBA 4LGCA 5KYTA 4M46A 3E7WA 3NYQA 4PZPA 4R1LA 3O82A 4DG8A 4EATA 3WV5A 2P2BA 1BA3A 3CW8X 4WV3A 5BUQA 4OYCA 4D56A 3IVRA 3IESA 1MDFA 1T5HX 4G36A 3DAYA 4GXRA 5D6NA 3A9UA 3CW9A 4IZ6A 2D1RA 5BSTA 3PBKA 4D57A 3FCCA 2Y4OA 3RG2A 1AMUA 5E7QA 3ETCA 4D4IA 4ZJZA 2P20A 3QYAA 4E5DA 4RLFA 4GR4A 1V26A 3VNRA 5BUSA 3LNVA 3L8CA 3DLPX 1PG4A
chains in the Genus database with same CATH superfamily
2DWOA 2ZSFA 3VR3A 3EPRA 1C2TA 3B2NA 1RJ9B 2FFAA 3W5BA 3SQNA 3CEPB 5HHTA 1F4LA 4XPIA 5IJAA 1N2CB 3R7DA 5KTKA 1HLPA 2RC6A 1ZBQA 2N1MA 3EIHA 4RKEA 5BRJA 1PSZA 4GH5A 2QLLA 1EDEA 3TSOA 3ZIAD 4PFJA 2VUSA 3CF6R 4BXOB 4RW0A 1M33A 5EINA 1EUZA 1VHTA 1W36C 4Q66C 3F3YA 3EPJA 1LZKA 2F43B 1SXQA 3IBTA 2OXCA 1OLSB 1PG0A 4CDNA 4LYFA 4R3UC 1IY1A 4CF3A 5BP7A 4TYWA 3OZSA 4MEJA 3R2JA 5KVVA 4ZQBA 5ES4B 1GD1O 4JUDX 1RLOA 1PZFA 1Q11A 3PHLA 4I1YA 2HNAA 3P9QA 5I7WA 5F9MA 4C21A 4A7PA 1L7NA 3UHJA 3U4AA 4BO8A 1OI3A 1P7CA 4DR4C 4RVHA 3BFJA 3GPBA 4LNUA 4F85A 1XN4A 4MW6A 5FB3A 3D0OA 2OT3B 2BC9A 2VI5A 1XNRC 3H04A 2YC2C 3EN0A 1ODJA 2FWPA 2BMFA 4NZOA 2XRFA 3VOTA 2DLCX 4EA9A 1NI3A 4UHFA 5C7YA 1X1DA 4REOA 4NECA 2YWFA 4E21A 2IBTA 5I9BA 3SHWA 2AEFA 5KUTA 3Q7SA 3NWOA 2K4MA 3QG1A 4NCJA 4RMJA 4E09A 2AZXA 1XR3A 1YRWA 4ZOBA 1FB5A 3KEFA 1W96A 4U5YD 2JFOA 1BWRA 4JODA 4UXHA 4DTIA 3CCBA 4F3YA 2CDRA 4OB8A 5CVVA 2VXOA 5K3SA 3L1UA 3L0DA 3NT5A 3AM1A 3OT5A 3D8TA 3O2JA 3SBEA 5ALNA 3D6MA 2J30A 3RADC 3B13B 5LP6F 4CEJB 2PMDA 1IBKC 2HF8A 4QU8A 4F7WA 2NYRA 4MWOA 3TR0A 1J0XO 3G0DA 4RD2A 2X0JA 1V8FA 1PZEA 1A2OA 1ZOLA 3IPXA 3DBRB 3ED5A 3KXLA 4JVOA 4QBFA 5K51A 3U13A 3GHYA 3U4HA 2BEVA 2K7FA 1Z12A 3OQIA 1Z8HA 1R12A 2H0QA 5SYNA 1JH9A 2Q3LA 4CNBA 4DLSA 3F4KA 1ZNWA 2GPSA 2OB1A 4BJHB 5C8XA 1HY3A 3LK7A 1NKSA 2EP7A 1OCEA 2ZSDA 3PR3A 3ZJ5A 4AVYA 1KOJA 3CM0A 4EQ6B 1V6AA 2G80A 1DKQA 4GPEA 4ALJA 1TDJA 1H94A 2Q28A 4NL4H 1Z4LA 4LMAA 3S2FA 3GJ8A 3OU7A 1U9IC 2Z98A 3HBLA 2ACWA 3INGA 4C0WA 3JQEA 5HCNA 1WIWA 5CA0F 1CHDA 2CLLB 1MZPA 2XGSA 1I0LA 3REQA 4R7ZA 4MX8A 5HQJA 1M6HA 5ECDA 1U7DA 2I62A 3CZRA 4ZV7A 3K70C 4KXVA 4FOLA 3SQOA 4RAQA 4G07A 3V80A 5JCXA 4EF4A 3ABIA 4YRDA 4FI3C 4H7FA 4H1VA 4OMDA 2P6RA 2W58A 3SOZA 2IELA 8LDHA 2BJWA 3Q98A 2JGNA 4IKPA 1KFEB 5AJTA 4B3TC 5B4TA 1OXKB 4DBVO 2DFTA 4CUKA 2AJ8A 1A4IA 3LT0A 3EXHC 4I8IA 1RM4A 5B1HA 4Q9HA 1OT5A 1ZUHA 3Q9LA 1FTQA 3ES9A 1M2VA 1CR1A 1SO8A 4XZ3A 3V1KA 2REXB 3RC1A 4RUKA 5J2TA 1XV5A 4I9NA 5GZ6A 4QG3A 2UUAC 2HDOA 1RXSA 4IIYA 3G9XA 1SKYB 3E22B 1TGYA 2D27A 3MTIA 3CF0A 4XH9B 3HN7A 2WD7A 4D4JA 1K4KA 2WYOA 3AUSA 2C78A 5IKOA 1AV6A 2QYTA 4QYWA 1DWOA 1GA4A 2OYCA 3DE6X 4EVSA 2VDWB 4JBLA 1QM4A 1NI4B 4GD3Q 1KEEA 5I7SA 4AO8A 2HMUA 4QM7A 4CEIB 2JVJA 5THQA 5I4BA 3B9RA 3TQTA 3N28A 4MWEA 4CQLB 1L5SA 3DKPA 2GESA 4C2BA 3AI7A 3RT1A 4XOIA 5FEUA 2ECQA 2CL7X 4JZKA 4OIFA 3EVZA 1DCTA 3GMSA 2YXPX 1BOFA 3QNWA 1NW9B 3MXOA 2IOYA 5IG2A 3D5QA 1T0JB 2H92A 4OI1A 2GXUA 4HB0A 4YLEA 1QH8A 1PIWA 2ZJFA 2ZYVX 2B2XA 4TMTA 4AWAA 3AFGA 5I45A 3F3KA 3ZBQA 3OPYA 2H06A 4PW0A 4RQBA 2HGSA 1VQ1A 1X8LA 1G2QA 2RB4A 2H7YA 4ZZ0A 3TLBA 5AOVA 2CL5A 2QR3A 3VO2A 4AURA 3UJPA 5LMUB 3ND6A 3F4LA 4X45A 2VEOA 4BVFA 1P45A 4M55A 1NE7A 5ETJA 4IQ4A 5B3KA 5I3CA 1KO1A 1OKKA 4JGBA 4XX0B 3G7NA 1DXQA 4B6OA 1XRPA 3WL8A 1P2TA 1NU6A 1T5OA 2ZE5A 4HVAA 4Y2UA 4RCVA 3ETNA 3VVCA 3RSQA 4Q7KA 3IBFA 2QQGA 1DJOA 5K0JA 3GAZA 2ZZNA 1CUFA 1Y80A 1QO0D 1W88A 2FETA 2WI8A 1DC4A 4TTRA 5DBOA 1L7QA 4R2MA 3HFGA 4ZU1X 1KYWA 2VYNA 5J43A 3N6RA 4U2DA 5EQFA 1XMPA 2CY0A 2Z4RA 1T5DX 2XNKA 1KJZA 3BEDA 1PT8A 3ZXUB 1HT0A 1RWWA 3LSYA 4KRYA 4YJ2F 3SVLA 3DE5X 3FGNA 4X7PA 3SDBA 5JQGA 4H31A 4FDMA 1LNZA 4Q3LA 5CBPB 3DXYA 4GX1A 1UWKA 2NN3C 2PY6A 4R8MA 5CTJA 4BHTA 5HNKA 5CT8A 3MMSA 1TX4B 1YRLA 1T29A 2Q2QA 3F3MA 3U62A 3IOEA 1FQWA 2MMGA 3MLAA 4LDAA 4RGVA 4WOKA 2BGMA 5ABPA 1LK5A 4D4LA 5C9ZA 1C7EA 1ZN2A 1ICEA 1XRNA 4I9FA 3EZGA 4IXDA 5D6NA 4O0MA 3QX3A 4EBBA 1R0ZA 2HCRA 2X5XA 5D3QA 2YCBA 1AF4A 2E6UX 4RY0A 2PGDA 1N57A 1Z16A 1FJGC 5FORA 4YR7A 1OE0A 5AKLA 3ZJVA 3X2EA 3DT6A 1Q0QA 3FVTA 1DUSA 3FA2A 1EG7A 3ZDQA 821PA 2VAPA 4X62C 3RLFA 3U48A 1T2AA 3WNQA 2GPYA 3TB4A 4YXWD 1WV1A 3L92A 3GGGA 3FE2A 4WL0A 3N8NA 4L85A 5T3UA 1Z08A 1UJCA 2N0SA 1I2DA 1XPJA 4N9QA 2QYSA 3ICWA 4RSHA 4XIIA 2XCSB 2GUWA 1JEDA 2BGIA 3DBHB 2KSQA 3NCHA 1MENA 1WP9A 5CG2A 3U5ZB 1B3BA 4OYHA 3KVRA 3C8MA 3ETLA 4I50F 3ENNA 1VE3A 4RJJA 1QHYA 4CF4A 1FFBA 2FPXA 5LYJB 2QM8A 3EVTA 2VAVA 2R1VA 3IT1A 2NXCA 4WEQA 2IY9A 3TS1A 5K7SA 2WUWE 2B2CA 1PWEA 3PC2A 5DCYA 1GNLA 1T35A 3T5TA 2RAPA 3UJCA 1M2NA 3P20A 1AUOA 2G5GX 4ZIRB 5JMOA 1YHYA 2HY7A 2WSYB 3L7DA 3PNPA 4F3CA 3C3XA 2IIVA 4BY9E 1FUKA 2UZ1A 3N5CA 2M6LA 3AB8A 1ENOA 4X9XA 1QP7A 2C4MA 1RPAA 2GN8A 1O5OA 2ZREA 4JJGA 4R31A 3RK4A 2XRZA 4MINA 1C8BA 5J5VA 1NQ5A 5L3ZA 2GT1A 3X43A 1H2AS 3RHSA 1UDWA 1CQXA 2XQJA 3DMPA 3QVGB 5ALEA 1I2CA 1UBRS 2ZG6A 2BCEA 2BVNA 3TLCA 4I1SA 3UXHA 1TCVA 2AN5A 4GQAA 4PEVA 4ZAGA 1KPGA 4E3WA 2FYTA 2BJHA 2GYYA 3K32A 5CB4B 2BKEA 2IYEA 3JQ7A 3EDOA 1WZUA 2H9IA 4R9SA 1YT5A 1TNDA 1G8AA 2V58A 3PX3A 4RWZA 1RXUA 1NP7A 3VR6D 4BQOA 2R0QC 4ZK2A 4PGMA 2GRJA 1M75A 4BO6A 1BDHA 2PFGA 3IP5A 1YB7A 3RHTA 1MEEA 2GEBA 2VFAA 3D02A 3HG7A 2GM9A 2A5GA 1JHUA 5LMNC 2VQ3A 4HQOA 5DP2A 3VR6A 1LQTA 4WBXC 1EB9A 1D2EA 1Y4ZA 2WAOA 4L07A 1G0OA 4DMGA 4ALKA 1ZU4A 4FSDA 4PGAA 4Z9BA 5KDLA 4D02A 5ICCA 2P6MA 3W3AA 5FUBA 4YRGA 2OWDA 5BNZA 3MWEA 4FCTA 1TYDE 4MPRA 4QQKA 2ZIVB 2ZRAA 1N6KA 2XD4A 2A5YB 2ZUSA 3RTAA 3VOSA 5CFMA 4KP7A 4MDYA 5FH9A 3K2EA 3H4IA 4I5DA 4D4MA 1D1QA 3HFSA 4PYJA 2MYTA 1FS6A 4QDJA 3UAZA 4BLSA 4PRLA 1JE1A 2YNMD 1P81A 3NHUA 1J33A 3H18A 3LW8A 4N8DA 2YV2A 2UYOA 4OHZA 4L74A 3RSZA 2W42A 2FH5B 3E3MA 3QX7A 3QBEA 1SXIA 4KSYA 4EG6A 2INGX 1FCJA 3JZMA 5FBWB 2BFBA 1XZNA 1ZRSA 3D4PA 5IKEA 2BFNA 1SUBA 4FDAA 1N5KA 1P1BA 5G0TA 3R7AA 4AN1A 1LI7A 4G01B 3CCCA 3OCCA 4X93A 1HDOA 3E2PA 1IJFA 3PUYA 2DHCA 4QOSA 4RACA 4E94A 1FLAA 3BIFA 1XTUA 1QS0B 1Z0SA 2AF4C 2D00A 1EXVA 1A7KA 3NUZA 1J25A 2OBYA 4J1NA 1M6YA 1T2DA 4G9BA 3BD9A 4OHUA 2NYAA 3FPLA 4TMXA 4YBRA 1R0WA 1XLTC 1ZD9A 2P2ZA 1KU6A 1XCGB 1TGVA 2OQIA 3D3EA 4RKYA 5CDFA 1DQSA 1UXOA 4OOFA 2A9FA 5GZ1A 3KUUA 2Z0MA 1MTOA 5HCIA 4GOLD 3T94A 1S4QA 1X19A 4F6CA 2OCKA 3GDGA 1GUDA 3G1UA 4I9HA 5A03A 1E2DA 1QANA 2TECE 2ZLBA 5CJ2A 4PY2A 4UAUA 1Q1EA 1J09A 2YRWA 1RI1A 2O07A 4KQ9A 1HLDA 2DT5A 4LGVA 4N0MA 1KI2A 4TUYB 3O2SB 4F92B 4ECAA 1PVOA 3IDFA 5H3HA 7AT1A 4IOMA 2Q6LA 3I6QA 5L3QA 3A2MA 2FVYA 1ORIA 2FDXA 3MT9A 2PNJA 2VAWA 2BGLA 3LOPA 2P1ZA 3H5OA 3MQFA 4BLVA 1I0ZA 1K7XB 4HEA1 1KFJB 4MVJI 1P6UA 1RJFA 4TZKA 1PX2A 2MSCB 2OCYC 1FZTA 3C70A 1TVEA 3MYRA 3VI4B 3QE2A 2QGNA 4TVSA 4CMHA 2ZYSA 3EGIA 1PNRA 4KKXB 5JRHA 3TH5A 5CITA 3T0FA 1BDIA 3AMVA 4DRXB 2GN4A 2AJLI 2J32A 4UMVA 2AW3A 2CVHA 3E9YA 4DR2B 3M6XA 2AKYA 2HPHA 3D6FA 1SCDA 4M0KA 4AJ4A 3I8SA 3O7WA 4JBWA 4D8VA 3WK4A 1M34E 1N2JA 2P3QA 1KC3A 2ZOSA 4Z2AA 5F9FA 2OM6A 3RBAA 1U4NA 2JVKA 1Z34A 1QIEA 2O2EA 2W6QA 2C4KA 1VKRA 1G6Q1 3VR3D 2A33A 3H9CA 4P7JA 3L8ZA 1C8VB 3ISVA 4IMPA 3K1AB 2G70A 4LJ5A 1YJ7A 1ADJA 1HKHA 3PEUA 5KDDA 3M89A 1K5DA 4JSRA 4CUJA 3NDIA 3M8KA 4R1MA 1U9CA 3N2YA 4P3NA 1C1DA 4L08A 2EWWA 4WXMA 2HHHC 1YZ3A 5DTQA 5FUXA 3WNBA 4CF7A 1T36A 4LV6A 1NQAO 3PLAE 4KOEC 4C78A 1CF4A 1C14A 3M6AA 1M1NA 4Q15A 1U7TA 1R18A 1Y98A 3WZLA 1LBTA 3R9KA 2X3FA 3LDUA 3MHTA 4Y8VA 4C0LA 3VC2A 5CVDA 3ABZA 3T7RA 4YI5A 5EERA 4GHWA 1LNSA 5BR1A 5DNDA 1ZISA 1E8DA 3BK1A 3NDRA 3OQPA 5DI9A 3GAAA 3I9LA 3OEHD 4XB2A 2X0DA 1V6CA 3RAGA 4N3BA 4LPSA 2GZ3A 3GAMA 1JE0A 3CNOA 3JAWB 4HYTA 4Q5IA 4V0MA 3RW9A 4BKMA 3AF6A 1IHXA 1QPGA 2YMPA 2ZJZA 4MQFB 1M8JA 1IHPA 1ES9A 3B6KA 1WZCA 3CU5A 3HB5X 3FKSA 3I37X 1HPLA 4EJMA 5IJZA 5IT4A 4TWZA 2R2GA 3V32A 1FTGA 3G8DA 4HUTA 1ABFA 4HTFA 4RA6A 3OF5A 3BXEA 1QP0A 1BC5A 3PDIB 1DC6A 1VE1A 4IZIA 3ZPXA 4DIBA 1OIVA 3ACDA 1JAYA 2ZIXB 4LZOA 4BBJA 4FN4A 1GNPA 1E3LA 3N0RA 4CMJA 4U63A 2IEZA 1B0UA 1WVMA 3MN1A 1C3OA 4B6GA 1U5CA 3KDPA 1D8TA 1XZCA 2V5AA 4NJMA 3QFRA 2WJ3A 2PL9A 3UAGA 1FU8A 2IV7A 3H17A 3IQZA 4EBFA 4YAUA 2DJ5A 4DZTA 3LNVA 3VTFA 2HZBA 2JRCA 4KE9A 1W4LA 3IC5A 1Z6YA 3ITDA 5A2QD 4JI3C 4IH4A 1C29B 4PCVA 5J2UA 1J5EC 1GILA 1W0JD 2O3UA 2QOEA 2WZQA 3PEWA 2E4YA 3W78A 2D28C 2CSXA 1CR2A 2HU7A 4NLLA 1WMSA 2V6GA 5J1SB 4KLNA 2HFKA 4O4JF 2AK3A 1UT8A 4RVNA 2XE8A 4F3KA 1VLHA 1IM2A 1GKLA 1C3XA 3UX2A 1IN6A 2OPLB 2DAPA 3CJRA 5ARCA 4PG8A 1ECJA 4HN2A 4BQSA 1XTIA 4HDRB 1PJTA 2EAUA 4MWGA 4AU1A 1CFZA 2JI7A 5EP2A 2JBAA 4L5IA 5C3UA 3FM9A 5JNLA 1VPLA 1PKEA 4WZBE 1MT0A 5J4LA 2FTKE 4JNKA 5F2EA 3ASVA 1G7RA 1OV6A 1MRSA 1QC5B 1BG6A 1V3QE 1JW9B 2G8LA 1YOVB 2W2TA 1NW7A 1DXHA 1A4XA 2H51A 4IQ8A 3QA9A 1L4KA 4L8FA 2B7LA 2WQ6A 2F8TA 1QAMA 4PIVA 4L8LA 2R6AA 3BXZA 5BQOA 4Y2JA 4DR7B 1LXCA 4DV3C 3E5RA 3L1VA 4HWSA 1T0IA 4FXPA 1JL3A 2A5JA 2V55B 2DSNA 2KYRA 2XSZA 3CHYA 3ZE0B 1RPZA 4YT2A 1MQSA 4IGAA 4JQOA 4TMWA 5TQ0B 3W6PA 4E30A 3ODGA 1WOMA 2WE7A 4O2AA 1QSGA 3KKKA 3HMKA 1CDOA 3RV4A 1HSOA 3UIEA 4LBYA 1XF1A 1ZXXA 2A92A 2YFQA 4WXYB 3DDCA 3MFYA 5GY7A 4E2FA 4L4QA 3R6TA 2JI9A 3TFOA 3FLMA 1UK8A 3HY3A 1VXOA 3T7DA 4IFTA 4D8WA 2QZSA 1OLOA 1DL5A 1TTQB 2QMZA 3ONFA 4IUCS 1JJ7A 2VPTA 2C9CA 1XG5A 5EP1A 3B3AA 3UCFA 3ABSB 3GLFE 2IDKA 4EI8A 3MINB 2G0TA 1M1NB 4LC0A 2WYUA 1LTKA 5CTAA 3RLIA 4P54A 4F86A 5B1SA 2REQA 2R5FA 4P9NA 1PNQA 1I3OA 4E5KA 5K5EA 1U4SA 2F3TA 3BTSA 4TMYA 2ZI3A 4BNVA 4KYTA 2XJ4A 4ENPA 1ZBDA 3ZWPA 3N9IA 4J7CA 1AUVA 4DJJA 1CY2A 1QONA 1RYMA 5KO2A 1FTYA 3H4VA 1TEHA 2PA3A 3E1KA 1B2RA 4PLWA 5T5QA 3UYLA 4A82A 4AS2A 2QNBA 1FU7A 2PXAA 4OGLA 1VYUA 4ZPXA 4M0MA 3PGKA 2BMWA 2PQ6A 3G8AA 1XKXA 3GRRA 4UPDA 4B6PA 2PCJA 4HMOA 3JYHA 4F8EA 4EG1A 4YONB 2EATA 3EUFA 3HI6A 3MCAA 1KH3A 3R76A 2QRHA 4UHBA 3GCWA 3RUDA 2ZTUA 3IE2A 1RWBA 2VDWA 4IY1A 9ABPA 3I08A 1WCIB 1QQ7A 1QYXA 3KQWA 2DFVA 1L1QA 2AX3A 3B12A 3NTUA 4LSWA 5TMDA 2JFNA 3K6SB 3JCZA 5HRUA 1RWMA 4PZYA 2EJVA 3M5CA 4QJIA 2P9YA 1IEQA 1NNI1 3FIJA 3HJBA 4J94A 5C5DA 1PI3A 2IBSA 1W5TA 2NVUA 3OUZA 3MCZA 4EARA 4DV5B 2BP7B 3S1AB 2BDEA 2ZEJA 4R2WA 3AR5A 3PWZA 4NIMA 1XMSA 3P19A 2EV9A 4WLNA 2QNIA 1XAHA 2ZQYA 3P4YA 3AUKA 1J5PA 1JKJA 3JRNA 1GYPA 1VRVA 2HWUA 2FMTA 1WHTA 3G0HA 4R5MA 1UJNA 1GCIA 2AQHA 1OPXA 1R66A 1UBCA 2XB9A 2VZ9A 2VDMB 3ELDA 3JQ8A 3G2KA 2AMJA 4CETA 1XIVA 3FBGA 4UHCA 4W7SA 2M6RA 2HSDA 1F0PA 1WTAA 5B1IA 3OJEA 5I5GA 4RIHA 4EG4A 5FX2A 4TZ6A 2VEDA 4XVQA 2M5OA 3WHKA 1CEEA 4CQNA 4B2PA 4F4CA 1RC1A 1B0AA 5FL7A 4F6RB 4BV2A 4RE6A 3TKYA 3USCS 4HXYA 2MYUA 3V42A 3NRBA 4LF4C 4J49A 2GAJA 1MB3A 4MV7A 1MFZA 1DC5A 1T3HA 1XSEA 10MHA 3DMTC 3HYTA 5DI3B 3SYMA 1NN3A 2JDIA 4L3VA 4BMPB 2FZKA 3R5KA 1A5AB 3HXOA 5IHPA 5L53A 3BRWA 4DVJA 3WYDA 4RV9A 3EGEA 1R8XA 2AHRA 3T1YC 3MCUA 4IDNA 1OKKD 2J3EA 2PKXA 1BE6A 2YJ3A 1OXSC 1Q6YA 4DQKA 5CDUA 3A1WA 4F84A 1Y9DA 3BTVA 3T1HC 4J1TC 1WUJS 4NC9A 3LUFA 2QPTA 2TSYB 2OMKA 4GOMD 4QRDA 4E51A 3LBFA 1VZ2A 2QV7A 3UJNA 3OTOC 4AICA 4DMUB 5L3SA 2YQ4A 5IFLA 3FPSA 1TQ8A 4PYRA 2QTRA 1Z4MA 3DNMA 3RWOA 4RTJA 3DKKA 3EW7A 3U3JA 4BWGA 1KR2A 2FG6C 1Z29A 3Q8WA 4WXHA 5EJAA 3KOYA 1CC1S 1AKVA 1Q1AA 2PRZA 4ID3A 5HJEA 1FSFA 4QOIA 4Z9YA 2X15A 2J0SA 1VYHA 2V9PA 4KH0A 3N7TA 4LWPA 3TQSA 3VR4D 4C7JA 3LSTA 5AVWA 1B23P 1RWOA 2H4XA 3VYUB 2XOKD 2RHRA 1NMXA 5EZYF 1JHAA 1MNQA 4C4PA 5EXTA 3H87A 3ODPA 3AT1A 4Q1CA 4E2XA 1CUJA 5B1YA 3L7IA 4ER5A 1X3LA 5TEWA 5IHXA 1SQ5A 2G17A 1WNFA 1MFPA 3VC3A 3EXG2 3IV9A 1AS3A 3Q4GA 5JD5A 2Q3BA 1KEZA 3FMFA 4DC9A 2QXYA 1Q21A 1TVCA 1QV6A 2C99A 1FVFA 5TS3A 4ZTBA 2JD0A 2HYDA 1DC7A 5C4MA 1SIBE 1D9ZA 2IU3A 2AYZA 2XIQA 4B3TB 3GN1A 3KQVA 4GXRA 4DA9A 3QF4A 2QX9A 5FRDA 3TB6A 3VU1A 5JNTA 3PFWO 1AVTA 2ZM6C 4UCFA 4IZ6A 3UC9A 3ZNNA 2C1ZA 1B74A 1K92A 3KB1A 4XCXA 4TKZA 4BO5A 1OFTA 2WV7A 4BQPA 3IHLA 5KS2A 1N77A 1WB6A 3HPQA 1M5UA 4Z99A 3WL6A 2HMTA 4E4YA 3CIOA 3NO4A 1OA1A 3OLQA 4G5FA 2TRSB 5CVEA 4ALLA 4BNYA 5HQ3A 4YY3B 2G76A 3ER6A 2QW1A 4O4HB 1FP4A 1U04A 5IT9A 5AJYA 1GPUA 1BSVA 2OQRA 2J1LA 2QYHA 2R6JA 3D8UA 3ZDFA 1BKDR 1CY7A 1I6MA 5JLAA 4OPMA 2XMSA 5FADA 5IJ9A 2ICAA 1BTOA 4MV3A 1IY2A 3HXMA 1YRBA 3V8BA 1P1CA 5CGQB 2VOJA 4GP9A 5HBGA 2PU7A 3E9RA 4WH0A 5AW4A 4DNXA 3RM3A 2QLFA 5F4BA 1QB7A 5AQEA 3CZ5A 4C0QC 1FP6A 3IPLA 1C50A 5IP5A 3MGBA 4XFDA 3AH8A 5BVGB 2WICA 1EX1A 4X65B 2WU8A 2RI0A 3CRMA 4IINA 4QYTA 2OAQ1 3DFIA 3WAKA 3KOWA 1RQ7A 1YZQA 2DVMA 3A27A 3E9NA 3P0FA 5IFIA 3HR4A 3ZU2A 3SNKA 2V5VA 1XRSB 4XSGA 3UK1A 2OZKA 3GRKA 4W9RA 3WGIA 2XMGA 1FYEA 4CT4B 4DV7B 3LPAA 2QUIA 4B7AA 2EFDB 3N2QA 1D3AA 4ZAWA 2LNDA 4F2GA 5JS6A 2ZR7A 3AEQA 4MUKA 2B37A 1FDIA 1G18A 1THZA 1OH7A 3LTNC 3HY4A 5CLLA 5GJVC 2Z9BA 3LVBA 2ZJ6A 3L41A 3L04A 3SSOA 3W05A 3PICA 1XJWA 4MI6A 3CJEA 4ZI5A 3KS9A 1QZTA 3RVSA 4BV3A 5BWCA 2H18A 1JG1A 3I9V1 2D1YA 1V45E 3ZWNA 3ZV7A 4DSZA 1K27A 4IX9A 1EGQA 2B0JA 2C83A 5TPWB 3PXXA 4JFAA 1L7XA 4UDOA 1DMSA 3QJ5A 1YDWA 4JKOA 1VEHA 3ADPA 4A91A 2W2QA 2Q49A 2REBA 3IQDB 1JDTA 1EVIA 1MXBA 3STVA 1X1EA 1HFKA 2R751 4HSGA 4K2AA 1FJ2A 3NI2A 3UPUA 4LYHA 5ERXA 4F93B 4IH1A 2BV3A 4RMIA 4BEWA 5CAEA 3X0DA 1K2WA 2HADA 2HJRA 3OU2A 3OOJA 4Z2YA 3GNQA 3OC6A 1L2TA 1F8GA 1PVVA 3KR1A 4OAPA 4X41A 4EY4A 3RTBA 1U2TA 1G7CA 5DH9A 2W2LA 3AP2A 1G5RA 4K6FA 4YP6A 1O9BA 1ZJ5A 2ZBUA 4U7JA 5JNWA 4CM1A 2NSJA 4E5UA 5IWAC 4N4AA 3HKEA 3C3KA 4J4HA 2JLCA 3RHFA 4BWVA 1Q57A 3A26A 2DHDA 4HLNA 3D6UA 3EXIB 4HUQB 4MVJG 3TTXA 3GLGB 5JWRA 2OBLA 2IV3A 1P5ZB 1FVHA 1HFJA 1R5BA 3OX4A 1U3DA 2E8FA 1U7OA 1PLLA 3EARA 1V11B 3R3YA 4Q01A 5AP9A 3WNCA 4KFCA 4JJZA 4YBZA 5BN5B 1CE8A 3RSOA 4QLBA 3AVTA 3OQOA 2O8NA 4AB1A 2Z8ZA 5CBKA 2A0FA 3ETCA 1QOZA 3Q87B 3LC7O 3GJXC 3JQBC 1QJ4A 3LVFO 2LIVA 3Q3VA 2ZWIA 1FPQA 1GTL1 1YHZA 2O4CA 1EUCB 1XYGA 4UNIA 4YK7A 3OY2A 4BNDA 4M1ZA 5AYVA 5KQMA 1XL1A 1JA0A 3EXFB 5BSHA 2OAP1 4FYKA 5BYBA 1GVNB 2E4XA 4CEHB 1H0RA 4M8NE 3RU3A 4BJ6A 4UQOA 4L5YA 1L5GB 4B73A 2ANBA 4LDRA 4XVCA 4OQPA 3D2AA 2C0PA 5K3FA 1R6AA 4BN4A 4CZ2A 1ZEJA 3DJYA 4HJRA 3QE4A 2QP9X 1YVPA 4CI9A 3D2CA 1NT4A 4K9RA 2ZAMA 3KJGA 4U7WA 3UC5A 4LXXA 3SGLA 1NIJA 2I3BA 2QY6A 3DFUA 2BDUA 4N0EA 1Q74A 2CXHA 2R8OA 3IR5A 1XPRA 3KP1A 3TE7A 1YONA 1W6RA 3OEEA 2FW6A 1QGZA 2Y1DA 3PIDA 4MV9A 4B3BA 3UMBA 4RYLA 1SQFA 1Y6JA 3TXAA 4RL6A 1E2UA 4D3ZA 4YUZA 5JARA 1AN0A 4H1WA 3A3PA 4ARZA 3H11A 3RF7A 2E4VA 3W5VA 5ELXA 1WXQA 3UT5A 1FFWA 4G4IA 1GCOA 1UBOS 2FN8A 1KMNA 2MT9A 4RU1A 3ZWMA 2P67A 3RSSA 3U16A 4C7MA 4DEXA 2OD9A 5JE8A 3CRNA 1ULUA 2J7PD 2O7QA 1AM4D 2IZ0A 2ZDHA 2V0GA 4MQ5A 4Q4CA 1WMFA 1XCMA 2ZJYA 4QUBA 1TFUA 4UTXA 4RY9A 1E5LA 5HKLA 2Q9CA 3H65A 3Q88A 5KWEA 2CNOA 4IWYA 4WY5A 5GONA 1VLZA 1ZGHA 3H2GA 3PP8A 4PF1A 3LV8A 1MDBA 4H4EA 1NJSA 4O3MA 5E6UA 4JI2B 4M8IA 3W8DA 1Q3HA 4WCDA 1P3JA 1GTMA 1H2HA 3I9V6 4DMRA 3ON5A 2PHZA 3CLTD 3SSNA 3VR5H 2G9NA 1UM9A 3BSSA 3JQAD 1RKXA 2Q4EA 4UD2A 3SC3A 2DWCA 1FXWA 3ZHRA 4IJKA 2FR8A 1EXWA 1E99A 3BRWD 1X80B 1Y37A 3S29A 2J0UB 3IEIA 5DM4A 4YMGA 1D0SA 4LTMA 1Z3CA 2DP4E 1V37A 2WHRA 5KKNB 1VZ3A 4AZTA 2CCKA 5TVKA 1CERA 2JVIA 2YHBA 4IGFA 3ZUGA 2C92A 5AK0A 4R40A 1JKMA 1JZSA 4TYNA 4HQ0A 3GJYA 5ICGA 4BCAA 2OO5A 3JU3A 3DO6A 4RDXA 3B1KA 2PX6A 4PFQA 3WRWA 1D1PA 3S5UA 2Y6VA 3KTFA 3DWIA 2NTYC 2Y0DA 4FBLA 4NBNA 4UM9D 5BUQA 2NXNA 3CVJA 3HB0A 1O5TA 4RPJA 2G1PA 4C2TA 1RFLA 5ILOA 3Q8KA 3N7UA 2CHGA 2VDOB 4IDAA 1O87A 4XX2A 2QRMA 3LL4A 4TL6A 5ALXA 3SJ7A 4F06A 1FYXA 4HAIA 4S24A 1GSIA 1U6KA 3NRJA 2PMEA 4YX9A 5LQUA 3NBYC 3PQFA 3ERCA 1TECE 3PCRB 1Q2UA 4GI2A 2I2WA 4PVDA 4KNVA 5BSTA 4BVJA 2GAIA 1YXMA 3FCCA 3KQHA 1GL6A 2V7VA 4C76A 2A5FA 1HWYA 1GEEA 2HA3A 2JHGA 4G1VA 5I9MA 1G8PA 2GH1A 3BJZA 4NBWA 3CQ2A 1OU0A 2C2XA 4JY7A 5WRFA 2QVBA 1UAGA 1XDBA 2KB0A 3N07A 4TROA 4UMEA 3ZGVA 2LD4A 4Q4AB 1UIMA 2H3HA 1U28C 1VYVA 4QGFA 2EEPA 4WCFC 4XCVA 2Y0PA 1EWYA 3V8VA 3SZMA 1IQPA 4Q18A 3RHZA 5IVDA 1YACA 3CJQA 4HQNA 1I4EB 2FCRA 5I9IA 2A58A 2WIFA 2XYVA 3V8EA 4MXDA 3QXJA 3ZN2A 4D6YA 2VJNA 2ZU6A 4IRXA 3SP1A 2XOXA 3R7NA 1T0PA 5BW8A 2J3JA 4QPZA 4XYMA 4D8UA 1Z75A 4CIYA 1DZIA 2QZ9A 3F8SA 3N8DA 4J07A 5CK5A 3RFTA 4B0OA 4BYMA 4BLTA 3B9QA 1ZFNA 2EARA 5F1PA 5LR6A 2GCOA 1NOKA 3AJ9A 4PFKA 4F8YA 4A8JC 1YE8A 4G0NA 3PPVA 5BW5A 5DEIA 3AU9A 5CNKA 3CT4A 2WDPA 3OE5A 4AP5A 4PG7A 3RVOA 1Y5MA 1H05A 1QG4A 2PIAA 5EWMA 4YEDA 2J67A 4COKA 1OV4A 2JGIA 1SXJE 3F9CA 3IQWA 5AR1A 3ZWBA 5CHYA 4ZT5A 3ZVKA 2QTTA 4KYUA 4HD8A 3KFXA 5JYEA 4WNCA 3IP1A 2MU1A 4KK4A 4Z9AA 4CM3A 3TLJA 1RWQA 2JHPA 1U0LA 3AM5A 1C9DB 2QQFA 3QVKA 3V3TA 4FPXA 1BHJA 3C3YA 2R7MA 4HWKA 4NG5A 1ESNA 4O5AA 1NP3A 2QL6A 4DUGD 1E4EA 1QQTA 4F91B 4JDUA 2V9CA 3FCEA 2W90A 3HVHA 3LBYA 1KGSA 4Q21A 2W0MA 1RRCA 1Y42X 5SY4A 3WXBA 3C3CA 1EP9A 3IIEA 3DDSA 3NVDA 4RVFA 3BMQA 3GJRA 5K6AC 1TCCA 1N0VC 4PAOA 3QUTA 2G9VA 5A5VA 5CB8A 4GGMX 2H16A 4B4KA 1EFVA 3CG4A 1JEYB 2Z8YA 1AUQA 3GJ6A 3TW0A 2EJTA 1FYFA 3AGQA 2AJCA 4MOWA 4LFCB 3M1IA 4Q1VA 4M8KA 1RDFA 2GWRA 1Z5OA 2WD9A 5C0OE 3WWZA 4Z4FA 3I52A 3QLVA 1E2MA 3UKOA 2H9AA 1CR6A 1RYBA 3EZFA 3G59A 2WOJA 4RGBA 2Q27A 2JAXA 2W2MA 1XU7A 4LX8A 1Q92A 2ODAA 1I4LD 1Z7GA 3NEYA 3T34A 1Z8NA 2PSHA 2FPOA 1M1XB 1ML4A 2VQFC 1XDWA 3DEHA 3O4FA 1VMEA 5EJ8A 2NZ2A 3I1IA 3L82B 5JW6A 4OF4A 1KQ3A 3FNFA 4NF2A 4UZSA 3KYBA 4R5HA 1T4CA 4UEOA 3TD9A 2Z6AA 1O6GA 4PHCA 3E1GA 4FR2A 1JLKA 5E9AA 2X5JO 4LV5B 2NUAA 4TN5A 4BMOB 4JGGA 3GR1A 3Q8LA 2ZSIA 1T1RA 2PBFA 2YOGA 3A1TA 5LM3A 1WS6A 4A0QA 3WIEA 1YO6A 2R47A 1R5OA 3TLGB 3OCVA 3ZE9A 5ITVA 1SVIA 2XOEA 2WT8A 4ZDKA 2AKEA 3VA7A 1A7JA 3LZDA 3T7KA 1EUDB 3K09C 3C16C 3RG2A 2VKTA 1WDLA 3L02A 5EIOA 3F6RA 3T15A 1SVKA 2CBXA 3X1JA 5M2QA 2NO0A 2PT7A 2OY0A 5A1IA 3DL7A 1EVKA 2VDLB 3GUYA 1FNNA 4XA8A 1XVVA 3GLHB 4EM6A 2A1TS 2QUHA 4ZO8A 4TZ0A 1PFKA 3KAKA 3CNEA 2ONFA 3EQ7A 5KSYA 2CE7A 3F96A 2VQEB 3FZEA 3OZVA 2B4YA 4G0QA 1KO5A 4F5WA 3G5MA 3MOSA 1NVVQ 2OXRA 2EP5A 3LWDA 2Q6IA 4JEHA 4DAOA 4TKUA 2CCGA 3ROXA 3JQFC 4I50A 5JAMA 1I7LA 4UBOA 1F6DA 4LYDA 2QX6A 4J2OA 3WWDA 1VHLA 4KFTA 5BQPA 3TSZA 2ZITA 3COSA 4HAOA 3VO1A 4I2NA 4D3FA 2WV9A 1W87A 4R8LA 4ZMBA 4ED9A 5HK9A 1UJMA 4A8JA 3OSUA 2VT6A 1OWOA 4P36A 1CLEA 1E2NA 1WW8A 1R4NB 2Y1XA 1MX5A 4GX0A 3PFGA 5FD8A 3AVWA 3LMKA 3ZDRA 5LU9A 4Q7QA 3KWMA 2J9FA 2D0PB 4LJ9A 2O8CB 3B3GA 1USPA 3DZIA 3UV6A 5A6SA 3TBHA 3UG6A 4A10A 3VO9A 2OD2A 1SPXA 3HJGA 1JAHA 2JI6A 2UYHA 2FZ5A 2ZBRA 1VMIA 4WCFB 1UDCA 3VHXB 1G3QA 1I6WA 5CH8A 1QK5A 4DV1C 2LDXA 4Q34A 5DHRA 3AIKA 6PFKA 2OFFA 5CA1F 4NZ9A 2QMYA 3ZV6A 5DK6A 1E94E 3QEBZ 5KJCA 3WLMA 1IWPB 1EM8B 1L7PA 2R86A 2GWHA 2XNDD 3MMPA 4GBMA 4EY8A 3T7AA 4J90A 6ADHA 1BX1A 2BEKA 1QO0A 5GINE 1I3MA 1U7PA 2A94A 2BH2A 2RIPA 3AUYA 4DV0B 3M82A 3A06A 1YKGA 3FFXA 1O94D 1TM5E 3RGGA 4DY4A 1DIBA 1U8XX 4OJKA 2QEQA 5EZ5A 2FWRA 2ZB8A 5D8DA 2XCLA 4FLMA 3MZ0A 4L27A 4AUKA 4ZN6A 3BL6A 4JT8A 4FYJA 8MHTA 4GL4A 4CMEC 4JI4B 4WINA 4YMSA 1EVJA 2CUZA 3DXZA 2FE4A 1YS2X 4UFOA 3RUEA 5JXHA 4RMNA 1VCOA 2PFSA 2W6MA 2WF8A 4R6XA 4BN0A 1CY1A 3T3DA 2JZCA 5B2EA 3FR8A 5CB6A 4RJ2A 1RAHA 2PN1A 1CZLA 4MIOA 2AIRA 2QLMA 1H2ZA 3MQ2A 1U2RA 3T8YA 4CLEA 3FUTA 4MVJP 1P18A 1SD2A 1IB6A 4L3OA 2WAAA 1YZYA 4A27A 4WZAE 4DRXA 4DXAA 1LPNA 2BKLA 3RAEC 4ZHQB 2CDCA 3DL4A 4JBNA 1DAPA 1FL9A 1EWTA 1EVEA 5AUNB 1A71A 4IF6A 2VH1A 2AFRA 1H0KA 4K46A 3EC1A 1NYLA 1AO0A 5JCPA 1UPFA 3HZRA 1L4FA 2QJOA 2GZDA 2ZE6A 3VZPA 2BYTA 1FRZA 3OJWA 3OQVA 4LFCC 1DO0A 3DLAA 5CD1A 1U8UA 5AM3A 2KMLA 1E63A 4PAWA 3CONA 4NZYA 4HTAA 1AN9A 4B5KA 5D5QA 2C31A 3AP1A 2WWVD 4JLVA 3V8RA 3KC2A 4KN8A 1HT3A 2WG0A 4AJEA 5E7QA 1TU4A 1N8SA 2HI0A 5FBRB 3GLGE 1ZVVA 1SRRA 5EXSA 4A2PA 1CQJB 1OLUB 1Y8QB 5EWLB 4Q02A 1ARZA 1GT91 5EGSA 4BUJA 1JDZA 2HRQA 3P4XA 4F8JA 5JC1A 5LDGA 4G1IA 2DFLA 1FFGA 1FS5A 1HDXA 3COVA 2WF5A 4LNUB 1CYEA 4Y1RB 1YF3A 4OCZA 4DCTA 4K9MA 3M1LA 5FNZA 4ZYLA 3EUAA 4M1TA 2PO7A 1GTJ1 2IQ5A 4AFNA 3V8MA 1TE2A 4PUIA 1P1IA 4IWNA 2X5NA 4ZQGA 3HYCA 1VLJA 1IN4A 1J24A 4H7DA 3C4JA 3Q0TA 4QUJA 5TLSA 2HRRA 2WT9A 4KNYA 3I2YX 3LCMA 1NMSA 3TJMA 2YFYA 3UJ6A 1QIDA 5BQFA 4JYMA 1B41A 2B1RA 4YCJA 3IDOA 3GPIA 4U3JA 1SQ0A 2I2CA 3MWDA 4AMGA 1Z68A 4UQLA 3CLRD 3FNHA 2ZJOA 3TVYA 5TPZD 4IIJF 3F6CA 2I87A 2ZSJA 3ORHA 4MS1B 4QQNA 3VKHA 2IU6A 3CY6A 3M0EA 4M7OA 1DG1G 1T9GR 2WQ7A 3PQ4A 5F7ZA 1IN7A 2PX0A 5DTRA 5DYNA 4RA9B 1XLUA 5CX1A 5BOSB 2B7CA 5JXJA 1EFCA 2WFLB 5EWLA 3DAFA 2GPNA 2WFAA 2ZT6A 3RIXA 4BNWA 3THWA 3AB7A 4DQVA 4DCMA 3T1TA 1MAWA 2PZMA 4HQRA 4RBNA 1SWVA 4OMCA 1KEUA 1PJQA 5HA5A 3V1YA 4HNVA 1XQ1A 1NBOA 3VPGA 1U2EA 5EL0A 4HGQA 2G8NA 2VDPB 2QAGA 2QG9A 4RMHA 1I7SB 3PEYA 4IHAA 4DIEA 4HNAB 1LI5A 2A1UB 2L0XA 2NSYA 4HDSA 3IGFA 4G1MB 2DFDA 1RAIA 3K6SA 1ZZGA 3IAHA 5TF0A 2PJUA 3WB1A 3WK6A 3CUVA 1Z35A 3H5TA 5FBVB 1Z9BA 1OY1A 1WZIA 1YKSA 2JJ1A 3DG9A 2FDCA 2XKJE 3OZBA 1JHMA 4J7UA 4B76A 1XK6A 4KO3S 5H82A 3H7IA 2E6KA 4UUAA 1JAIA 3BCHA 2E4UA 2A3RA 1TO1E 2OESA 3AJRA 2P1RA 3ZQ6A 3U1BA 3MWDB 1IM8A 3DZFA 3IA2A 4EVRA 3C8ZA 3ZQUA 3ZCTA 2Y1WA 2FMFA 2VUHB 2WA1A 2WHPA 3PKIA 4XX1A 3AW8A 3LKDA 1B8OA 1JKJB 1S8AA 4Q7JB 4YT8A 4E5VA 3DE2X 2CV0A 3CBGA 3N53A 2X2PA 1U8TA 2QV0A 4TTJA 5JD3A 1BMFA 4AAYA 1ZK1A 2BF4A 4I4TB 3OJFA 3HDYA 2NGRA 3PQEA 5CT5A 1AHIA 2J9XB 1BA3A 1M2WA 3VI3B 3E5HA 4CKBA 3KZMA 2E1RA 2HLHA 1ZGJA 4KFSA 4EUSA 1XLVA 1V7ZA 2FQ1A 1JR3A 1MDFA 1U3VA 4KHPC 1B8PA 1P9WA 2GFQA 3FPJA 4POOA 4KITB 1Y3DE 1YFZA 3NTXA 2ADFA 2QU8A 2AA3A 2I2AA 3G89A 3Q7RA 1QIFA 3IDSA 3NBUA 4LAFA 1D7OA 2NV6A 3WQHA 2ZT7A 3I2HA 1CDDA 1OFGA 1WJGA 3ZWAA 2UUBC 2GILA 3TDKA 3WYBA 3VPCA 3H11B 2VYQA 3DFZA 2ZS7A 5IJ0A 3EBOA 4X7MA 1HR0B 4BPBA 3D59A 3PFBA 2G1KA 1LSOA 4MQ4A 4POAA 1Q19A 2FFRA 3CNLA 2BMJA 3W3AD 2AEEA 4GRAA 4GYKA 3KHTA 3S6JA 3O8RA 4ZU6X 4IOLA 1OX4A 1YZTA 1ZWKA 2X8AA 1YC2A 3JVUA 3PQCA 5DSZA 1BCSA 2A7XA 1G66A 3SXUB 1IUKA 2RAUA 5A0TA 3DTTA 5EJ9A 4ZIRA 1XTSA 1CVLA 1PG4A 1K6XA 2NQ2C 3WY9A 2LZ0A 5FYDA 1GUAA 3KHSA 4BZWA 5MHTA 4PROC 2QLTA 1MRNA 1IDOA 2DH6A 1WAMA 4J4BA 3O2EA 2CYAA 4EHDA 5KOYA 3UK7A 4GR5A 3ZBUA 3LS2A 4NFLA 3JQGA 4XPZA 4RS4A 4HXFB 4BNDB 4R05A 3AVQA 3FNQA 2OHXA 3GL9A 1U0NA 1LX7A 4GZ6A 3TAHA 1UM9B 1XEWX 3JATB 4I99A 4RM3A 4JEUA 3A6HA 3HGMA 4LMPA 4DV0C 4GPAA 4B75A 1D1SA 2GD1O 3UXMA 4LTDA 1ZAYA 5CB4A 1KYVA 1U8AA 5DWVA 3SHOA 3ZCUA 4RAOA 3SM9A 2WF7A 2QN8A 2AZMA 3JYOA 2FMIA 4KMSA 4AUEA 1EDDA 3DGFC 3UGJA 1OXUA 2FSSA 4NNOA 2A6PA 3F90A 1HRDA 2XGJA 3TVDA 3MIIA 5T8KA 4R6WA 4JIGA 1K9SA 3R3UA 4F11A 3WV4A 1V7CA 3D8BA 7MDHA 5JS8A 5LD2C 1UP4A 3IBCA 1X7ZA 1WMBA 2ISQA 1PWZA 3CZQA 3NT2A 1YQGA 2QTLA 4WK0B 2IWRA 4LXHA 5AK6A 2HJHA 5CB4F 5LB2A 5BUCA 1HE4A 1USVA 2BFWA 1OFUX 3QGMA 3TL3A 4Q9AA 4BFSA 1WDTA 2GCIA 3FW1A 3GIWA 1RT9A 1DKUA 4RF4A 2WVHA 5D00A 4EZBA 2FWBA 1ZM7A 2CK3A 3LAWA 1DFIA 4WFKA 5BQ3A 1XK7A 2OO7A 4DLAA 1Z6ZA 1N2BA 1MIHA 2WYVA 2BGGA 1U2QA 3R41A 3SHFA 4X66C 2AI2A 4OM7A 3RRFA 2ADMA 4D1YA 1KRHA 1H6CA 3U7IA 1LU9A 1OUMA 1QFZA 1ZD1A 4WZAA 3RFCA 4AMVA 3ZVLA 4D7AA 1ODTC 2V1XA 3RIYA 5IKPA 4B2LA 3GGDA 2OPBA 2TMKA 1MXCA 4KTTA 1JI0A 1WDKA 2C7GA 4PNZA 3B1FA 2G5TA 4QQRA 4DR2C 1RAEA 4KO2S 5HVNA 3O93A 2LBPA 3SZUA 1HX7A 1NNUA 2MDTA 5E4TA 4PWZA 2OYRA 2A4MA 1TH5A 1N5DA 2FUKA 1SQSA 2MINB 4TXMA 4ZI7B 5JSUA 2C29D 4BJ5A 1GY8A 1USUA 3N2LA 3OZEA 1SGWA 1XTVA 2Q0XA 3R3WA 4HUJA 4KLZA 4RNDB 5FLYA 2Y0EA 3H8WA 4CKBB 3U7FB 3G17A 1QHXA 1XYYA 2H4HA 1RD4A 1WPXA 2HAEA 2O1WA 1K1EA 3JQAB 3HBNA 2HDWA 4AN0A 3OUTA 2ZXUA 3JVVA 4QOEA 3N2ZB 1H8HD 5CDYA 3PNQA 3FDFA 3OFNA 3HJUA 1FA9A 3UMCA 1E1DA 1WSAA 3V5NA 2C88A 3KL2A 1JDSA 2CD7A 4YYZA 4KQXA 3E81A 3MBIA 1S89A 1RM0A 4H7JA 4PX5A 2WU3A 2YW9A 2B4TO 4BL5A 5F51A 3AEUA 4G97A 5IANA 4O2BB 3R3HA 3LO5A 4DC0A 5HCUA 2DRIA 4BQFA 3H5VA 1UBJS 4CG0A 3FTEA 4B46A 3TG8A 4DR5B 1X1AA 1XO1A 3QKUA 3IILA 3D6AA 3P9RA 4J3FA 4ZQHA 5JJ5A 2HKIA 2PT9A 4BNLA 3IAXA 5K6TA 4NG4A 5TPWA 2DWQA 4Z4GA 1IY0A 3HA2A 2IIQA 3A0UA 3AKEA 2Q9AA 1RQXA 5J2TB 3ILXA 3DC7A 2E0GA 1KJNA 3KRTA 5AUOB 5LQMA 2JKYA 4PSCA 4R01A 4W8GA 2Z6VA 5DWDA 2BBSA 2R8EA 4TMVA 1YDFA 2GS9A 3WKEA 2ECOA 3M83A 1LVHA 3UF0A 1KQOA 5L4NA 3DCYA 1U81A 1DKPA 1O0CA 2IOQA 4KPYA 1LLDA 4DLWA 1YR3A 2PM8A 4I0WB 1WNTA 2NV0A 2I9PA 4XIFA 2WF6A 1NP6A 3H1GA 4OI0A 3ZHYA 2CMDA 1CKEA 1W93A 2VVTA 4L51A 3WG9A 1V16B 3ZGOA 1QZZA 4NZZA 2X8BA 2AJBA 5FWDA 3V8NA 3O47A 4YGXB 1MO3A 4YDSA 5EG5A 2GEFA 1QK3A 4FMBB 2DT8A 3B8HA 4H1TA 3WX0A 2QP4A 3QFFA 1MIOB 4Z0PA 2I6GA 4GKBA 4LYYA 2X8WA 3A4TA 4U39A 4WNIA 2JJ2D 1RVV1 3CISA 5EKUA 3TD6A 3BMCA 4U7DA 2NM0A 3NANA 1C1DB 3IRUA 3FNIA 2ODNA 1IN5A 1FDOA 1UWCA 1CP3A 5A9RA 3TSCA 5IJ9B 1SKUA 4JI7C 3KTDA 2XNJA 1VKHA 2O2ZA 1CY6A 3NM5A 3D7LA 2AYXA 3HY6A 4QDTA 2HFJA 3H4TA 4UM8B 1L8QA 3I0NA 3U7QA 5H9UA 3D8RA 4ES6A 3UEOA 3SX0A 1ZGBA 2G7MC 2BZGA 1EFTA 3T41A 5EIFA 1P5JA 3EUEA 3QFTA 4NMHA 3JD1A 3WVNA 1NNEA 1T0HB 5AKHA 4Q37A 2F90A 1IJKA 2UUOA 2EKDA 2H00A 1Y3HA 4I3FA 3T1QA 1PGNA 1ZLYA 1ISSA 1T1JA 3GUHA 2O2CA 4KN9S 1D09A 4S05A 2G5PA 2DKFA 5LP1A 3WZ2A 1JT9A 4JP5A 4AP9A 2W2NA 5I7AA 1W2WB 2Y92A 4WK2B 4P22A 4LOLA 4IW3B 3IUBA 3L79A 4UZFA 2UYQA 2Q1YA 3C7TA 2HJGA 1FOEB 1WCWA 2VPYA 4EABA 5F1KA 1PFQA 2IXAA 5CIQA 1K7YA 4HAYA 4YFVA 3TIXB 4JEMA 3W3ZB 2VJOA 4AZ0A 3O8DA 4FYXA 3QOXA 4PPQA 1R10A 2AL7A 2GBPA 5F5NA 4B35A 3ZE1B 1ZC3A 2NWQA 1XTZA 2Q2NA 2PZEA 4W5HA 4Z7OB 2FPLA 4C05A 5BV0A 4R1SA 1MVOA 1T3LA 1FX0B 2GFIA 2O3SA 2YZ2A 4UCQA 2EEZA 4FCCA 4QARA 1YE5A 4N8SA 4J16C 4Q3NA 5A3RA 1B76A 2FPSA 2CVZA 1TZMA 1EJ6A 1S0UA 1EVYA 1KI1A 2G0AA 3GVXA 4LI0A 3S99A 4Z7NB 5KWIA 4AG3A 4UPVA 3LOQA 1DAKA 3E5NA 1VL1A 2QAJA 3QXHA 1GZ6A 2PSSA 4LFBC 4WSOA 1X7YA 3OHPA 1GHTA 1BHO1 1XBTA 1UT5A 1SKBA 3FTDA 3NLLA 1QIMA 1RHKA 1I9GA 1SXJA 1WUTA 3IUEA 3OLZA 2PTGA 4FE3A 2B4AA 3I2FA 5E3JA 2WHXA 1VPEA 5DGTA 1P2SA 2GJ8A 3HCAA 4G0OA 1ODFA 1WG8A 2E8EA 4YYEA 4RZXA 1XS3A 1AZWA 1BO6A 2C4NA 1WABA 3GW8A 4J6EA 5E6UB 1Z4NA 4ACAA 4BNJA 3EFHA 1EFPA 1QV9A 1QTIA 4NFHA 1KE2A 5ALVA 2W0SA 3T9CA 4PTZA 4LDQA 3WGKA 1GTSA 3MGGA 3DPIA 2BI7A 2ZETA 1J9GA 4D9HA 4E2WA 5EJ7A 4YRPA 1FJGB 1PV2A 2H1RA 5CHEA 2J0UA 4EGCB 1UPCA 3WLOA 2VWGA 2XMRA 2WDZA 5BSWA 3OJXA 2APJA 3C0KA 4IIUA 4Y0NA 5HKAA 3ASZA 4Z8XA 4A6EA 5LZ2A 4RPLA 1LC3A 2EGUA 4YI3A 5AW9A 3M4NA 4P84A 3WQRA 4C6SA 2ODWA 4C7BA 5KNLA 2GI4A 5K3OA 2X0IA 2JRLA 1I10A 1YMVA 1YRHA 3DBLB 4Q6WA 1PTKA 4ZOCA 4D4HA 3RUCA 5JAHA 5H02A 5JMWA 3L8YA 3LX5A 1YRQA 3CQ1A 1IXZA 1M0TA 3D6JA 3IQIX 1YK1A 4N39A 5F78A 2NU8A 4JI5B 3BE5A 3JAMA 4FVTA 1MKYA 4UBJA 1ZK3A 2JZOA 2OCBA 4H3KB 3NPMA 1ONPA 4HH1A 1A2BA 2OZVA 3RT9A 3B48A 3PGVA 3PROC 2FEWB 1F5NA 1IE3A 1L7RA 4TSRA 3RSCA 2MR6A 3S0JA 3L8MA 3JAKA 2IITA 3SX2A 1ZH2A 1UBFA 1ZJWA 5CA0A 1DX4A 3U19A 3VKGA 2AFIB 1AKYA 3ZLUA 3A2KA 1UKBA 4JZYA 2ERXA 3R5HA 1PZHA 3ICCA 3WTBA 2FW7A 1HTWA 1ACMA 4W7IA 2CJWA 2PK3A 3DUFB 3I6YA 5K2OA 2IUYA 3BE8A 2PQ0A 3D5TA 5LQAA 3ADKA 3M81A 4V38A 4LWQA 3ROZA 1K5GA 1GXSB 4PRKA 3CKKA 4IRMA 4MV8A 4TQAA 1A7UA 1CIPA 2C5AA 3CUWA 2OSBA 3MGKA 4K03A 3V33A 5DX1A 2GHTA 2NXEA 1C8KA 4OHBA 1RYYA 2OFXA 1B2LA 3IVCA 4ND8A 1W36D 3WLQA 1UC5B 3O26A 3T99A 1JILA 2JFWA 2JAQA 5FPTA 3UNXA 4LF6C 2B83A 2QW8A 1N9GA 4C5BA 2PRKA 4Q6BA 1N25A 2FZLA 3HN2A 2B1GA 1P80A 2G82A 3L9XA 2IEDA 1AXRA 1KY2A 3I0MA 2PPLA 1ZJ4A 2QORA 2P2SA 1LQUA 2CZGA 3KKOA 5C52B 1T26A 3C5HA 1EINA 2C2OA 2YV4A 3LM8A 1H9BA 3CR3C 4UUBA 2C58A 2PCLA 3VV3A 3FPGA 4F9TA 1W94A 2UUAB 1XHEA 2BH9A 4FEAA 4LJ7A 4M76B 3G88A 5DYWA 1ZR2A 1P3Y1 3PXEA 3ITNA 1KBZA 2GO7A 3IAM6 2YQZA 4EUHA 3EK2A 2I54A 5TY0A 1F2UA 621PA 2E4ZA 3OM1A 3U56A 3J80D 4OV6B 4RVDA 4RFSA 1SIUA 4B8WA 1NHGA 1DADA 1ZCBA 2XECA 2ZIUB 4QPDA 4DARA 2C1XA 4RPGA 5KWSA 1GXSA 2O6LA 4ZRNA 1E64A 3QPAA 4KHPB 3EHEA 4B3FX 4YCSA 2G4LA 3DVAB 3DQPA 5EQJB 3ISTA 3BULA 4H17A 4RORA 4GVLA 1R5JA 3IO5A 3ORFA 5IXYA 3BMNB 1UINA 2OOKA 2PJRA 4QXPA 1O97C 3QU7A 5EZSA 1PR0A 5BV1A 1NJFA 2QF7A 1E1YA 4R9NA 2Q5OA 4KE8A 1N2IA 3PRJA 1KK2A 3B36A 2SKCA 1JHPA 3BB1A 1DG9A 4FDTA 3NHLA 4H1UA 3CQ3A 1E4OA 2O6HA 2WUDA 1K0UA 2FXVA 3QNUA 1K0RA 4PUGA 2FSHA 4MQMA 1UBTS 1U7HA 1ATIA 2VSOA 4GVPA 4AF8A 1XRMA 3ZI4A 2QHXA 4O4IF 4X44A 2OVBA 1AZLA 2L17A 5KJEA 1W47A 1UAAA 4YACA 4G5GA 2Z6QA 1GFSA 3Q2IA 4CLOA 1BHQ1 1O7JA 4XQGA 4PSVA 5EE9A 3ZXIA 1YVDA 4L6IA 5K20A 3E18A 2BMAA 4J8PA 2DCUA 4JUIA 2O05A 5JDCC 3GP3A 3IS3A 1J8MF 1JIJA 3M6WA 1XU9A 4H4CA 2EJWA 4RKWA 1WZEA 3QHQA 3ZWXA 3ENQA 3WO0A 5KKCA 3CSUA 2VSQA 3KXKA 3ZK7A 5AW8A 2JAUA 2XUHA 1G9SA 5JJCA 1GKYA 2C5EA 1YR6A 1X86B 2V4MA 3CWZA 4P3YA 3RABA 1FDVA 1II0A 3CVOA 2P3LA 3ND9A 5IDXA 5BR8B 3BTOA 4CG1A 3UMYA 4CJXA 4QXAA 5IJ0B 3SS7X 1L5ZA 5AH0A 1FNCA 1I32A 5E2BA 3W2EA 3GZNA 3NV7A 4R8RA 4S3MA 1D0VA 5DGXA 2JFQA 3KT3A 3CEAA 3LBNA 1T24A 4GX5A 1U3FA 2Z09A 2PL5A 5I9NA 5LIRA 3TUJC 3ESYA 5HJ5A 3QSYA 2F8SA 1UJ4A 2O7SA 5JD6A 4KH1A 4ENTA 3D7KA 4PPFA 3AP3A 4Q47A 2VK4A 4K1XA 2MYPA 2OC4A 4Y1GA 2B3TA 4ZVMA 1HTTA 2WR8A 4IVNA 4FINA 8ADHA 5AKJA 1KY3A 4WOPA 2QMOA 4B33A 1PNOA 3I76A 3JAWA 1DAFA 3PC6A 3CB2A 5JECA 4MV5A 2B1QA 1RM5A 3T12A 1Y6GA 2M9MA 1CS0A 3H3FA 2VDRB 3LQYA 2B8WA 2QRVA 2LDBA 3AFIA 3CVYA 2PAAA 1RXIA 2FFJA 3RTCA 3WKDA 1IXKA 4FJ0A 4U02A 1XMIA 2AFVA 4GZMA 4FFDA 1CNMA 1EFVB 1XJ0A 1GZ4A 4DNPA 4DQXA 2YYAA 3NNDA 1RCUA 4OUKX 4W6ZA 1GZVA 1N5OX 1NVTA 1RZ3A 2H2GA 2NUBA 4QHTA 1N32B 5EXEA 4DMCA 5TQ2A 2E2WA 4QO8A 1MOPA 5TGDA 3MWEB 1QIIA 2P4QA 1Y4SA 2AFHB 3QY0A 4U2EA 3AB3A 3IAM1 3IVMA 1PJBA 4MAMA 4PBTA 3CLVA 1E1NA 1A72A 1BFUA 4B44A 4OYRA 1MRZA 3P2KA 5A9SB 1VCNA 1F51E 1XHJA 1IAVA 2V6JA 3O0DA 1AXEA 3UWMA 1E18A 3G8CA 4RD1A 2DLDA 2I29A 3ZZMA 4AD8A 4JKIA 4GKJC 2PX2A 2ZBFA 3LKZA 4Z54A 3A7EA 5LOVA 1YBMA 3UUGA 2IE0A 2J3IA 1E3QA 3KQSA 4BCCA 2FRDA 1FFXA 1QH1A 3N8KA 4EAAA 5PNTA 1LEHA 1F2DA 4LZLA 3B7PA 1JDVA 3EVCA 4YROA 1WZ2A 2ZROA 1Z6QA 4GGOA 2TYSB 4DT1A 3DTVD 4MULA 3RJ9A 3K3PA 5JEDA 2OSVA 4Y6QA 4QEDA 4MNTA 4NPAA 4QASA 3R8FA 2NU6B 3LIPA 1DS6A 3SMQA 1DEAA 3WQSB 4F1WA 1M8GA 3CZPA 3RYIB 1UQRA 5U4QA 4RQAA 4ZHQA 4TV8F 3KPYA 4PC2A 4D81A 3F6BX 1NDHA 1LDEA 4KOAA 3MGCA 2CXRA 4C4SA 3NWJA 1WH9A 3W4KA 1H93A 2KBFA 2XOKA 4JC0A 2VYVD 3VAYA 4D5GA 2ATIA 2G04A 3T5BA 3R0JA 1CRPA 3UOGA 3OOEA 4I7EA 1NLYA 1XVUA 2QMEA 3PTLA 4KAJA 4HDMA 4F6RA 5I4KA 3UPTA 4U8GA 3PJRA 4CMIA 2OECA 3QF4B 3O1LA 3GIDA 3X2SA 3AU8A 4CL2A 2BEVB 2NNWB 4TRNA 1GAXA 3RH0A 1R7RA 1KSHA 1NBHA 4FKZA 2AN1A 4TLBA 3X1ZA 3BKWA 4XR9A 2C07A 3GZNB 1JHYA 4HNGA 3MUNA 4OQXA 3K1ZA 1LWOA 2NACA 1DP4A 1YZNA 4Y1RA 5ECYA 2VZEA 3TTVA 5A6SB 1NVVR 2H11A 4DA0A 3CNHA 3U7GA 2SICE 4YMLA 2C61A 1Y6ZA 4UVGA 3MWFA 1JECA 4JLDA 3RYFB 3BZUA 1TM3E 4W6QA 3T35A 4FFLA 1SCKA 2FEXA 4AKSA 5C5EA 1U2ZA 2CF5A 3L0YA 4G9EA 4BKPA 4RE5A 4IDOA 4CTJA 4GDFA 5E6RA 1VG0B 3CG0A 1NMEA 3WWPA 4F12A 1BCRB 4P7KA 2BW0A 4PZ0A 4URXR 5C8DA 2MYNA 4FI3F 2VT2A 5AT1A 1KAOA 3E8MA 4I3HA 3X2FA 5AW6A 3OKPA 2D5BA 3EDRA 4EUFA 1VB3A 4ZI3A 3Q0EA 3W1VA 4RXUA 4KRGA 1P62B 1O6CA 1QTRA 2ZK7A 2ZRPA 4OHWA 4FS3A 3L5OA 4QAQA 2FAXA 4GBED 4M1MA 4JI4C 4LDPA 3DAYA 5DF1A 1Z25A 4ENRA 2XBUA 1YCDA 1PLKA 1HG1A 1EZ4A 2AYYA 2PZJA 5JDIC 3MTGA 1YZUA 4EKDA 1AKTA 4KW7A 1WCIA 3EXHA 1CZHA 5T4HA 3HL0A 2Q7OE 4OL9A 3OTGA 5FPKA 2X19A 2QK4A 2NAPA 4NE2A 1MC8A 1C3LA 1JHXA 2QN3A 1W9MA 1U7UA 1KK3A 2BUAA 5TQ2B 1T91A 3ICVA 2A8YA 2OGUA 3PRKE 3B5IA 1M34A 5IC4A 5EWJB 4GXTA 2XQVA 1HBJA 3CBQA 3NM6B 3VU3A 4BNNA 4IDPA 1R8SA 1Q95A 2A0XA 3GU3A 5KHOC 3ETHA 1I7NA 3OY7A 4XUGB 3CZ9A 5DULA 1IXSB 3D7MA 3GNTA 1Z2NX 2LKCA 1QGOA 3HBMA 2C7VA 3E3LA 3CA8A 4Y2XA 2JBHA 2C2HA 1TK9A 1TEXA 1CFJA 1EFKA 1V9LA 2VOEA 4HWGA 5FOXA 4DV1B 4HNSA 4XWYA 4MPPA 1HQYE 1LCIA 5I7VA 2OCAA 3IQHX 1KZ9A 1NVBA 3JQ8B 1JWAB 1B43A 3GPLA 1N6OA 4ZKEA 2HUPA 4PQYA 1CUAA 1GGJA 1X7XB 1Y1LA 3Q12A 5CG1A 3F5MA 4LCEA 5ALYA 1BDBA 3O4JA 1AKRA 3JQCA 5EJ4A 5LIPA 5GIOE 4KGDA 4QNRA 1QRAA 2E48A 1XMXA 1UBSB 3Q7IA 1K08A 2YVLA 1MVNA 1VB5A 2ZR0A 3JATA 1WLSA 4M1QA 5FL3A 1H6BA 4C4RA 2OILA 3R20A 2BUCA 1YCHA 1OTXA 1NUQA 1M7GA 1G7TA 1N2CE 2EJBA 3KZCA 4OXIA 3NX4A 3PDIA 3B2EA 3RTGA 2PSJA 3L1JA 5IARA 4D97A 3ER8A 3NTLA 5K4GA 1JFFB 5FR2A 2C3UA 1AU9A 4MCAA 2DCMA 1GRNA 1KYXA 4PSDA 1C3OB 4G0ZA 4L76A 4ER6A 3WGMA 4BQEA 3O92A 4X20A 1M34B 1Z7YA 2WWHA 2XCOA 1YR9A 4LWZA 1FMTA 3Q6NA 3CPSA 3CX7A 4ZJYA 4L2IB 2JF0A 221PA 1XX6A 2F9LA 3FVQA 4H7HA 3WYGA 1KO8A 2CUTA 4OVKA 2SKDA 1C9NA 4X54A 3S28A 5IYZA 3BL8A 2QPAA 4UAVA 3H1BA 5AKIA 1XRBA 3FHCB 1PGOA 1H85A 1TVKB 5HK8A 2JGDA 3A6DA 4FYWA 3FYUB 3T3MB 1PSDA 2RH9B 3A31A 4CCSA 2DR2A 1H2RS 4MO2A 5F1YA 1Q83A 4WN3A 4CWAA 3K1TA 4ZWNA 2JJ2A 2NG1A 2CEAA 4TXJA 4HGZA 2H4ZA 3MSXA 2PH1A 1WX1A 2WJAA 2FWJA 1TA0A 3L8GA 4MUAA 4Y1EA 3SXUA 3W8RA 2VK1A 3CB4A 3DAGA 4WVFA 5HF6A 5AW2A 1G4UR 4O4HF 1K5PA 3VKUA 5AVRA 4RYDA 1FDRA 2MR5A 5FO0A 1I8TA 4E08A 3OZWA 3FSRA 5TSDA 3WICA 1VSTA 1WU7A 3D0QA 2IHZA 2WB4A 4JP3A 4LGCA 1IBLC 2Z08A 4ZAFA 4CHGA 2JFHA 4PZPA 4EX6A 3BH0A 2GEJA 4WN9B 2FEKA 1ST2A 3ND8A 4FHDA 3L49A 1G63A 4PINA 3IUPA 1OH5A 1NRXA 3AWDA 3FR7A 5IEBA 4M1EA 2WD7B 5C8YB 1P31A 3SSMA 2BGKA 4TTVA 1RMTA 4YMTA 3BF8A 3AJ8A 2ISCA 5TQ0A 2RKOA 3EXHB 3FCYA 3WO1A 3QE3A 3D4IA 2B6HA 2Q5CA 3JWHA 4EITA 2I91A 4N9WA 4A2QA 3UMMA 3WMEA 3GVHA 3HYRA 2ZTLA 3G13A 4CV1A 2F9MA 1RS0A 4M4SA 1JNYA 2CVQA 1XQWA 3K94A 4LXIA 1SBZA 1GPLA 2JGDB 3WDLA 4HWTA 2QM3A 4RESA 3M2PA 5D3KA 3HPRA 3LY8A 1G7SA 4AJHA 4CM7A 3THYB 1Z0UA 1PK7A 1XVIA 1YZKA 2FN3A 4QDKA 5JI3E 2FGJA 2C9ZA 3GK3A 1ESMA 1QOPB 4BV8A 4FGJA 4E5DA 1V41E 3WRYA 2ID8A 5C7OO 1DJMA 2GCOB 2V5UA 4BLPA 4OBXA 1IZYA 4XQ9A 5BUSA 5HGXA 4IEEA 1DKOA 1O8BA 3AZQA 3DDHA 1TU0A 3GT7A 3NJ8A 3UFXA 4DCPA 5AESA 4MVYA 2F1KA 3JAKB 3B3QA 4FGKA 4REMA 3FAKA 2YVAA 3B1YA 1I3LA 1NUSA 2V6MA 3TFQA 2AYAA 5JXGA 4J0JA 2FNAA 5E1OA 1I6KA 1TJYA 2QTMA 1APBA 4H6VA 1FBNA 4KAAA 4UM7A 1FSGA 4ZDWA 1NSTA 1WXDA 3ECAA 4XXHA 4AQYC 5HX7A 2MSNA 3C3PA 4GICA 1SXJB 1ZKMA 3KETA 3K70B 4O2RA 3KQKA 3GEEA 4JI2C 1SHLA 4N0PA 5KB3A 1DFGA 4UVHA 4MUHA 4QBKA 3HSYA 3D4LA 2XF8A 1HSZA 2WM9B 4NBTA 1FFSA 3GD7A 3UJ9A 3TJZA 5DNCA 2FJPA 1CQIB 4BB0A 3TSYA 1XZKA 2QKYA 3CH4B 1ECBA 3T0GA 4ZVQA 1KNQA 1QH0A 4TZTA 5EIXA 3LC1O 4HGNA 1C3EA 4DYDA 1PP4A 1L3BA 3J7TA 2ZIXA 4NK4A 2R8XA 2I3DA 1KDTA 3TRHA 4UTNA 2P9ZA 3PNLA 3PPXA 5FLXD 4G5QA 4MRSA 4DABA 2QBYA 4BEJA 4IO0A 3I01A 3OZAA 4NQZA 2P2JA 3AHJA 3UJ8A 1PZMA 1GSOA 3EJWA 2O52A 1VG9B 4I46A 4OG2A 3SI7A 1ZSNA 2I65A 2CLFB 5I48A 3LCVB 2QUBA 3BC1A 4IG9A 4AY3A 1TIPA 4ALIA 1JNXX 2I7VA 3EZYA 4DMLA 5L40A 4GOND 1OT3A 2B8NA 5EFZA 4FGZA 3RARA 2PQMA 3SR4A 5B2FA 1NVEA 2QT1A 3R7WA 3UJAA 3I72A 4WOBA 3HKBA 4I8XA 1NJGA 5AOBA 3NBXX 1Z0FA 4EMUA 3V4OA 5J47A 4HPXB 5HXAA 3UAXA 2OXTA 2IW1A 5CUQA 3RKUA 4AJLA 2PWAA 1AQIA 3CKYA 1JB1A 4Q03A 1JAZA 1RADA 3GA0A 3QX8A 4F46A 2NTJA 1VIAA 3AYXB 4G86A 3AYZB 5D85A 1GPH1 1KC1A 4DPKA 3FX2A 1MN6A 1NDUA 3GGJA 3LYUA 4QDZA 3ZDDA 3IHTA 4EDHA 3P1JA 1A50B 4ZI7F 5TGTA 4PTYA 3CN7A 3UG7A 3ESRA 4OSOA 4XYGA 2HIAA 5B2ZA 4KQWA 1QS0A 3JD2A 1CLUA 5ADHA 1ZKDA 4Q3DA 5K0GA 1CYDA 4MKRA 4URZR 3OWHA 3C3AA 1PA4A 4H7KA 3NETA 1MHTA 5E4FA 1MG0A 4TWRA 4AF6A 2OZPA 3BFVA 3TPCA 1P1RA 2RGNA 3OZDA 2GEUA 3N2IA 1AE1A 5MN5A 2HR1A 3JPWA 4TXLA 1IBKB 1OYVA 1FX0A 5CYFA 1QE5A 1Z74A 3GQBB 4MUFA 1G41A 3ZV5A 3T5PA 3T4PA 2IEYA 2YY5A 5IVIA 1DHTA 1LJUA 3THYA 4F21A 3AEKA 1I33A 4Y67A 5BXQC 4CF6A 3I53A 1V95A 3B6ZA 3PNBA 1VLLA 4XTCS 2WSSD 2IYVA 1HT2E 4O2BF 4X71A 5JATA 1WUIS 4LCBA 3SXPA 2GCGA 1XEXB 2WKSA 3M6VA 3RTEA 5G2OA 4C5AA 4DEVA 2HW8A 4KR0A 1WKVA 1YZLA 2BMDA 2E21A 3BM5A 4GEGA 4MGIR 3ACBA 3IFSA 3MCWA 3HGQA 5NULA 3U9LA 1UF9A 5BPHA 5L9AA 3HLYA 2NU7B 3U7QB 2VRWA 3R1IA 2VK8A 5K3BA 3DTYA 4OHYA 1V8DA 5DASA 2DXIA 1RQ2A 2NO6A 2MCFA 2ZJ4A 3Q40A 4FUTA 3EDCA 4G0PA 1B8NA 1LK0A 1JG2A 2ZYHA 4Q4JB 3U3KA 4DIMA 3T1YB 1F7UA 1Z4KA 5IU6A 2C5SA 2VHCA 4WX2B 5FOQA 3LK6A 1DNPA 1JF8A 3SZLA 3STYA 4A5SA 1GRRA 1KYQA 1LH0A 1RLIA 4OQMA 5GOZA 2DX7A 1SZJG 1PX0A 5ALWA 3WHLA 2HO4A 2X23A 1DDGA 1GG9A 4HRVA 3TTUA 2GPBA 1F8XA 3VDRA 5DGHA 4P92A 2FZEA 2GBIA 2VDKB 5DT9A 3N0VA 5FPSA 1T9GS 3HYSA 5ALQA 1XYVA 1NRJB 2KLBA 2YYSA 3SS8A 3WB9A 3WFIA 4AJKA 3T4EA 1KQFA 3UZ0A 2XE4A 5IBCA 3R6WA 1D4AA 2JJ8A 5G41A 4G25A 2B9EA 3A58B 4ZYTA 3OWOA 4GI1A 3HSSA 4FIZA 1B6SA 1ETHA 1TCUA 2Z57A 3HCRA 3GKUA 1NBME 4NP6A 5AJHA 1U0FA 3EDMA 1CB7A 3UAVA 4NZMA 2HQRA 2I8AA 3D2BA 3UUWA 2QBYB 2MM9A 2JJ1D 5JVDA 1RHMA 3AESA 1DAHA 2CJFA 2VNSA 3TL6A 3DEJA 3RUIA 4F2HA 5IZCC 4NDNE 1HNXC 2QDXA 1QGUA 2WJZB 1IULA 1WXGA 2ORVA 3PD0A 4FBGA 3K6JA 3CRW1 1PU2A 2NCLA 3KJEA 4MJ3A 4BUCA 2Q1TA 5AW1A 5C46F 4PLYA 4XIGS 1NGSA 5DIFA 4P4SA 2YN0A 3AF4A 4IZOA 3T7SA 3FRIA 1NOJA 2HJVA 2ZWPA 3QG5A 5AOCA 1NPTO 3HKDA 3OICA 1P9OA 2Y9PB 3C8DA 2ZAGA 5JSYA 1GFIA 2YXLA 2ZI6A 4M9XA 2GGSA 1FJXA 1P0QA 2D13A 3AIIA 1V3TA 3HKCB 3O1JC 5TVGA 5L51A 3M9XA 4YRTA 1FSZA 3KZVA 3FXAA 4R1UA 4A0SA 2PO5A 1EK6A 1U2GA 3BF7A 1RAGA 4TQ9A 3VH4A 4A6DA 4JUBA 2HIGA 3MMZA 3ZCPA 2WJHA 1L8AA 3EDQA 4ZANA 5TPZA 1BXGB 3GT4A 3GVPA 4IIXA 4JJKA 3JQRA 5IUJC 1RBZA 3GB9A 1EGAA 3QVWA 4I4NA 4M0PA 4P31A 5CXSA 2WIJA 1IEVA 4DM4A 1YAJA 4ZHQF 3BEOA 4WDRA 1L5HA 2EKBA 5A3SA 2GJKA 1F0YA 2ZUUA 3HXTA 3R5JA 4P53A 5DVZA 4TGLA 1M6NA 1EXDA 1DO8A 1JDJA 3WBBA 4HWOA 5HKBA 3OFND 3E0XA 1I01A 4J0DA 3O8BA 4KQHA 3ZCSA 2GVZC 1XEAA 4NEGA 2QUZA 3B5EA 2D4HA 5JR3A 3KEMA 3T4XA 1W76A 3T3IA 3PBKA 2QE7A 4JCCA 4MP6A 5J9FA 5AJVB 4AWBA 3OIWA 1I7QB 4ZAXA 1E62A 3AERA 3BFKA 4Q9IA 5IAJA 4MKXA 4XI9A 1R0RE 1VJTA 2AJDA 3GCDA 4QZVA 3LUPA 3ICEA 4AY2A 1YQXA 4LDNA 2NUAB 4BKRA 3CZCA 3HKCA 5TT1A 1VIDA 4GNKA 1VCMA 5G53C 2AUTA 3AR2A 5C8ZA 1WBJB 2QRGA 3BHIA 3PHJA 4FWBA 3OFVA 3L6CA 2G72A 3I92A 2G08A 4DV7C 1OLXA 3CX6A 1Y8ZA 1XWFA 2BBOA 1OHHA 5GJCA 2Q0HA 3MNFA 4FBMA 1O4WA 2GBGA 5LYJA 1VLVA 1A9RA 1NATA 3OT1B 1YZFA 3Q3IA 4NOKA 4GS5A 4QFCA 4BFXA 3GLGA 2NSLA 2IYQA 4GZ5A 1STOA 4JL5A 1E9VA 5ITZA 1LWNA 4MS3B 3U3XA 4C2UA 2F2TA 2VRCA 2X7JA 1NPYA 3ZHOA 2D1TA 1QLHA 3G9ZA 2B6NA 3GUCA 1PZNA 1T4DA 4YP9A 3PQ2A 1Q7CA 1TQ4A 3OFKA 3JAMD 2P11A 2ZW9A 5EJ2A 2VYFA 1E1QD 1UJBA 3RE1A 1IBSA 5IN4A 2W2XA 3IXQA 4RO0A 3R74A 1O54A 4AJ1A 5HIJA 1MC1A 5CCXA 1HG0A 5JFTA 4NYJR 1S9DA 4HMQA 4IJ5A 4E2YA 3F7OA 3OPMA 2UZAA 3ZHVA 4EZIA 2FPIB 3FF1A 5E6RB 3UGQA 421PA 3B38A 1L5NA 2JH3A 3VVMA 5L7TA 1E0JA 1G5PA 3EG5A 2J3QA 3BBLA 3QNMA 3UY4A 4TM7A 1TMGE 3LY5A 2OV4A 4PX3A 4HAXA 1L3IA 3DR5A 3EMVA 4OQNA 1A88A 1PJCA 3TW8A 3KJZA 4EEKA 2Q6VA 3VMFA 2O8DB 4YCMA 1WQ3A 3MT7A 3MTQA 4M6WB 4JU9A 3CPJB 5DISB 1I2AA 2OGZA 3T7JA 1DTWB 1JTFA 1H5NA 5JZSA 3SBDA 4BZPA 5A19A 3R09A 1KJIA 2NT3A 4CHTA 3PJGA 1X94A 2HSEA 4I5EA 3U44A 4BFUA 3NC1C 1PJ3A 3HUFA 3ONNA 4L7QA 4DIDA 1P0MA 3ZNQA 1YB1A 3RSFA 4MRAA 3AEYA 3EH1A 1JEQB 4RQTA 2R8RA 3PQ7A 4A03A 1JLSA 2CC2A 1T0BA 1E6KA 4OP3A 1QRTA 1JMVA 2FUG1 3RRJA 4YAKA 1FY2A 1BXGA 5J3JA 3T9BA 2BM9A 4NYMQ 7REQA 3HABA 3C45A 3MELA 1SEPA 2BHRA 2OLJA 1NYQA 2E55A 2M6SA 2H5EA 1U9YA 2ATWA 4HATA 4KL8S 1E2EA 1PNVA 1GYQA 1SVSA 1VJ5A 3HLTA 4GE0A 3RS8A 2XUAA 3SE0A 5JJKA 2VNAA 4YAWA 2VJYA 3QMWA 4X97A 4XQCA 5LZ8A 3OCYA 1D0IA 2LTAA 2PUVA 3BDAA 3FUWA 1VDMA 4NCIA 4TRRA 3RVKA 5GVSA 2B82A 4UOEA 5LL6P 4NENA 3DUWA 3DFKA 3KV1A 4XDZA 2PUBA 4L72A 3AF0A 3RYFA 1PR5A 3TJRA 2OHOA 4KR7A 4M89A 1P4JA 3RPEA 5LDHA 1KARA 4D2IA 2A88A 4Q9DA 1M6EX 1W48A 5AI5A 3MTBA 3DUFA 1JSRA 3OD5A 4II2A 4S12A 4TQUS 2WPNA 3S55A 2HD4A 1JQ5A 3WP1B 2X1LA 5GZ3A 4RD4A 3IDAA 1NF2A 3BGIA 1U6JA 3NYWA 1NAHA 4JVLA 3O2QB 2PMWB 3FHJA 1XEFA 2BFFA 4DR3C 3PJDA 4YP7A 3GNLA 3AR9A 3CUKA 5BOSA 4OH7A 2LV8A 3UGTA 1KS9A 4GR4A 4YRCA 3ZH9B 2IZ6A 4LF4B 2XKKA 4XGQA 2RGBA 4Z4CA 2YVQA 3LRPA 1NYTA 3QXXA 5CK4A 3SF8B 1IZ7A 3NNSA 5TNXA 4ZRMA 1EESA 3QOYA 3LLUA 1DBPA 2CNDA 2IGBA 4S1OA 3QEAZ 1SNYA 2W7TA 4ARSA 2IPNA 4WLFA 4YHBA 1BDMA 1RWPA 3TR3A 3EIQA 4JJIA 3NJ4A 3DE4X 3NOQA 3PK0A 5FWYA 4JP8A 3TIIA 2IT1A 2QI9C 3SHVA 1XEWY 4GE3A 1PHPA 4K9QA 2O5CA 1XJ5A 1HOXA 1GLNA 2B8EA 1NYEA 2UKDA 3THSA 3RC7A 3U80A 3CS3A 1C0IA 2P75A 2QRZA 4IHKA 1V7QA 4BO7A 1W85B 1UL1X 3FGOA 4R54A 2IUEA 1N7IA 3RC9A 1I4WA 5J2UF 2IYTA 3ETDA 4LSMA 1NNLA 4M1KA 4OJQA 3LDAA 2I1QA 4E1VA 3DT8A 2K2WA 4MQUA 1E5TA 3RNOA 4MVJF 3BIOA 2XCUA 4MROA 1PJRA 1RMQA 1KMCA 3AINA 4LYJA 1Q5PA 3X3HA 1QF7A 1L7OA 1RYDA 5H1YA 5CRIA 1ZN8A 1YIDA 3AJEA 4L4UA 4GECA 1GQ2A 3HB7A 3O2NA 5HIIA 3C1AA 1C81A 1U0JA 2NZVG 3OZXA 4D0RA 3OVMA 2GK6A 2Q5IA 3IMLA 4B82A 3G02A 4DHEA 1DTWA 1LQ2A 1WCXA 2QQEA 3FUXA 1MABA 1XE3A 2KM1A 4ZQEA 4WADA 3KYIB 4FNOA 1VP3A 1UH5A 1JTVA 3PSHA 3MMNA 3O8OB 3CRQA 1Q6ZA 3ICOA 1SOAA 4Z4HA 1YDMA 2AC2A 4AJJA 3I62A 3UWOA 1DXYA 2XCTB 4OXNA 2FPPB 1J70A 2NVUB 1KDVA 2OAGA 3FWHA 1YQTA 5JO9A 2OD7A 1VXRA 2HV9A 4G0YA 2DLNA 1H3FA 3L7AA 3JRWA 4NS4A 3WOVA 4D0GA 1SK9A 4AZSA 2XYRA