4FUQA

Crystal structure of apo matb from rhodopseudomonas palustris
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
503
structure length
501
Chain Sequence
MNANLFARLFDKLDDPHKLAIETAAGDKISYAELVARAGRVANVLVARGLQVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPKIVVCDPSKRDGIAAIAAKVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSTGRSKGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPKFDPDKILDLMARATVLMGVPTFYTRLLQSPRLTKETTGHMRLFISGSAPLLADTHREWSAKTGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGKELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGATIDEAQVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malonyl CoA synthetase
publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
total genus 153
structure length 501
sequence length 503
chains with identical sequence B, C, D
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4fuqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fuqA01
3PBKA 4GR5A 4IZ6A 1BA3A 3NYRA 2D1SA 5K85A 3IESA 5KYVA 3O82A 3T5CA 3C5EA 2Y27A 2V7BA 1YJ7A 3RG2A 1RY2A 3EQ6A 5BUSA 2QVZX 4GS5A 4E5DA 4ZJZA 3E53A 4ISBA 2P2MA 4D56A 4RMNA 2D1RA 3WV4A 4GXRA 4GXQA 3L8CA 4WV3A 3VNRA 3NYQA 4RVOA 3RIXA 4D4GA 3G7SA 3KXWA 3NI2A 2P2QA 4D4HA 1MD9A 5BSUA 5K8FA 4RM3A 5BSWA 3LAXA 4GR4A 3ETCA 3LGXA 1MDBA 5DV9A 5JRHA 3IEPA 2WD9A 3IERA 2P2BA 1ULTA 3U17A 4FUQA 2QW0X 4D57A 3A9VA 3E7WA 3DLPX 3B7WA 4R1MA 5BSVA 4G37A 3T5BA 4OXIA 3R44A 1T5HX 3QYAA 3CW8X 5GTDA 1V25A 3TSYA 1LCIA 4G36A 4RLQA 3VNQA 4DG8A 5BUQA 5BSMA 3U16A 2Y4OA 1AMUA 4IR7A 3DAYA 2P2FA 1T5DX 5KYTA 1PG4A 5BURA 5DWVA 4R0MA 2P20A 2QVXX 1V26A 4W8OA 3IPLA 3GPCA 2VZEA 5E7QA 1PG3A 5D6NA 4U5YD 4M46A 2QVYX 3O84A 3VNSA 2D1TA 3WVNA 5BSRA 2D1QA 5IFIA 4RLFA 1MDFA 2Y4NA 3IVRA 3FCCA 3ITEA 3LNVA 3E7XA 4PZPA 4FUTA 4R1LA 4RM2A 4DG9A 4LGCA 2P2JA 3T5AA 4RVNA 4D4IA 3O83A 3A9UA 3WV5A 3CW9A 4EATA 4OYCA 5KEIA 3DHVA 5BSTA 3FCEA 2VSQA
chains in the Genus database with same CATH superfamily
3QBDA 4U2KA 3FPBA 3B12A 5C8YF 3IT2A 2J3LA 1Z62A 5ELXA 3PEWA 1E1NA 4KACA 1UMCA 4I4TA 1PGOA 3R2JA 3IE1A 1T8PA 2GUWA 1A50B 3P9KA 4DABA 5C8DA 1NQAO 3ETEA 2A1TR 2HX1A 4RVCA 3T9DA 1EINA 8ADHA 4WH0A 1YFJA 2ZYGA 1TJ4A 1RADA 2VDPB 2OBXA 2B5OA 4WRRA 3TLEA 4DR6B 5EYPA 3EQ6A 3FTCA 1K5PA 1VE7A 4LGVA 4RABA 3DZ8A 2OBMA 5EUMA 1OIVA 3D7SA 3SHWA 2J46A 2QRKA 4ARUA 1YK1A 2W22A 4Q4HA 3N39C 2PHZA 1J5EB 4W7SA 2P9FA 4CM9D 4RVUA 4NAVA 4ZK2A 2R97A 2DCUA 4B6OA 4KNWA 4UMEA 1WBJB 4V0LA 4ITUA 1TM1E 3GN2A 4P4SB 1SCDA 4EW3A 4Q0MA 1YB4A 3VDQA 1PS9A 2OECA 1T4GA 3ZWMA 2OXIA 4XD7D 3UG6A 5FPKA 5AUNB 3DDWA 1BO6A 3RC7A 3O73A 2MCFA 4BNDB 4BP1A 3FR8A 1P0MA 4O4HF 4Z1MA 3FWPA 3EGWA 5CDUA 3GO4A 1L4EA 3NT4A 1M2OB 3HZHA 1VHWA 3N0WA 4PFQA 2I2XB 4CU2A 1P1RA 1RRCA 5F78A 3VRHA 4YJ3F 3CLUC 3UATA 1GG9A 2PGLA 5CZVA 4FCWA 4ZOLA 4BKMA 3JWIA 1Y3FE 4EG6A 4R68A 4YJ2A 4GLFA 4M8SA 5KWIA 2JLVA 2HJGA 1L5FA 2XMSA 1M2GA 1UPTA 4Q3EA 5EZ6B 4JELA 1MIHA 3UT5A 4GKBA 1KHHA 5FEMA 4E5NA 2YJZA 1HQCA 3I5MA 4FDUA 4L8YA 1X0XA 1Y3CE 3I2HA 4LOKA 1Y81A 1WUJS 2NZWA 3P2MA 4YUWA 3GRZA 4B75A 1WB5A 4E2WA 1MVLA 3AUSA 4QUDA 5BQXA 1WV1A 3F74A 3SFZA 2XW6A 3OZAA 1JQBA 2OCXA 4HATA 4D1YA 2BKEA 4D4JA 1Y7IA 4G9BA 1L5QA 2UKDA 3KKLA 2Y4OA 5GMOA 2EKPA 1NLYA 2Z5GA 3SZLA 2F17A 3V55A 2EP8A 3ZKWA 4ZKDA 3RC8A 4JIGA 4LVOA 1EEHA 9MHTA 4P4LA 1Z4IA 2IXFA 2CDCA 3HKEB 1VOTA 1RXSA 1TW2A 1CJKC 1SVKA 2EF1A 3QLTA 1PG0A 3HA2A 4JI4C 1GNLA 2BBWA 2J33A 3K1AA 1FLVA 4ME6A 4TMXA 5FRDA 4MVJG 4XQEA 4DVJA 1KEKA 1KGDA 3DGEC 3BXGA 5J2UB 3DVLA 2I6FA 2VUIB 3GFTA 4N5MA 3L9WA 3RODA 5C5IA 4X65B 3W6OA 4XFKA 1O94D 3ZKAA 4F38A 2VBGA 2QN3A 2Q8QA 1J2EA 3B20A 5JHHB 2Y1XA 3GZTB 1FLAA 1P4SA 2E5WA 3AFIA 1H23A 5CT6A 3R8CA 5BY2A 1BHSA 3PC3A 2O8EB 4ATNA 1V71A 3Q5DA 5KU7A 4D25A 3IKVA 3FY4A 3OZ7A 1QVWA 2C94A 2Z9DA 3T7RA 2Y1GA 5JQWA 1T1JA 5KEIA 2Q5OA 3CH7A 4PNPA 2JAUA 1XEAA 5JWOA 3I83A 1Z6YA 4JC4A 1BG6A 1Y9ZA 4DLZA 4NH0A 3S81A 2NPIA 3BDAA 3V4PB 3GUCA 4GC5A 4QDUA 1TQ4A 2NV6A 3AILA 2VT7A 3CRNA 4S1NA 5L3SA 3H5WA 4MKHA 4F2GA 4Z4IA 4L4RA 4P3OA 2R66A 4TLAA 4A9AA 3LF1A 1NLMA 4X0EA 4ACBA 2WSYB 5L3ZA 4MIEA 3E0XA 4LJSA 6YASA 5CT4A 1GADO 5DGIA 3ZCQA 2JG3A 3PDJA 3NATA 3CVJA 1X19A 3WJ2A 2IBSA 4EA6A 1ZUHA 3ZZ1A 3KKZA 3KWMA 2JAQA 3IIMA 1E1CA 2AYAA 1SCQA 1U3VA 3DE7X 1V1RA 4GWKA 4IF4A 2EW2A 4KH1A 4X8HA 4RIFA 5DXFA 4D2IA 4UNRA 4GGMX 4JLWA 4C0AC 1C81A 3DEYX 3IP9A 4BZPA 4XUGB 1VMIA 1R15A 3ILVA 5B4TA 4ZVSA 5DLPA 2Q6IA 1UKZA 2Z0MA 3H5LA 1E7WA 3R8FA 2Z04A 4G1CA 5KX5B 3CUSA 2IU0A 2J3JA 3LBNA 3RSSA 3TVTA 4JEIA 3LSYA 4ZYXA 5BW5A 4D81A 5JUWA 3DE2X 4D7AA 1A8HA 1Q1QA 3ABIA 1PWZA 4RH1A 1SUWA 5T41A 1DL5A 1U5BA 1MR3F 2FFHA 2MYUA 4CQJA 1E98A 2WJYA 3V8PA 2P4EA 5ARBA 5IXJA 3H11B 3ZEIA 4IXWA 2PN1A 3GFOA 1MB4A 2VQFB 2N42A 3OLWA 4QARA 2BONA 1RD4A 3GR1A 3B2EA 1XCGB 2E3JA 3BERA 4OQMA 4C04A 2FZWA 1H3EA 5FI5A 2HYIC 2VTEA 2X2PA 3BGVA 3D0QA 3EVTA 4LSZA 2PZAA 4F8YA 1C0PA 1R8SA 4P53A 4JB8A 1JPUA 1JR2A 2V6GA 1EUDA 3PUXA 3MRVA 4P7BA 3KLNA 1IN1A 2B2CA 4LIPD 2BAGA 1ECBA 1UC4B 5F51A 3SHFA 1ZIPA 5CDGA 4KWEA 1I5EA 2OM2A 3AF4A 3JD0A 2XUPA 1EP2B 4FEYA 1XNHA 1H2HA 1L7QA 4RD6A 1ZCJA 3S8EA 5ALQA 5J5VA 4CM8B 5C5DA 2E89A 2ZITA 1I6WA 3P9RA 2FOXA 4NMHA 3VKWA 1UT8A 3FXAA 1INLA 3GPCA 3TZQA 2NU7A 2XRZA 1EVIA 4LF5C 1N7JA 1W75A 2C03A 2E18A 3PFNA 3IPAA 1IK4A 4OHUA 4FB5A 2PZBA 2X14A 3HB9A 3CEAA 4J16A 4AC9A 4HOYA 3NHUA 2XUOA 1F17A 2UV8A 5HZGA 1J8DA 1XAIA 1YHYA 4RD1A 4IIHA 1OFHA 3WMWA 2IV2X 2F4VB 1I7LA 3NIFB 3QWIA 4ID3A 3WLMA 1Q1AA 2QTVB 2TMGA 3QJYA 1IMJA 4L73A 1WCYA 5K3CA 4KVFA 5C1PA 2OO5A 1WX1A 1EGVB 1KZGB 3RTGA 5BSHA 1F3OA 3MXTA 2GBIA 3QP9A 4JB0A 2PAAA 4G8CA 4C0HA 1X3SA 4PO9A 5E3HA 1I5OA 4X3PA 1ZH6A 2WRZA 3LXRA 3L04A 3SYLA 1JQLB 4JUBA 1PSDA 1GUDA 1T9CA 5HA5A 1WDMA 2GHQA 3WLIA 4ZCTA 1JLSA 1FNCA 2BTQB 1XL1A 4JN6B 4BU1A 3R0IA 1T5TA 2C4NA 3M1YA 1FSSA 4KVZA 3CRQA 4E94A 1NNUA 1P6UA 1ZD1A 1B93A 1PN3A 2EG5A 4ILEA 4HRAA 2WF5A 3P94A 1U0NA 1YBMA 2LCQA 3FDZA 4S0XA 4IGAA 1N2CA 2X3UA 2XHZA 3TNYA 2H07A 4Q21A 5CGQB 4CLRB 3RHZA 4Z4QA 1QGDA 4JUCA 1JZTA 3Q3GE 1OBFO 2H8KA 3BXOA 3RDPA 2YWCA 2CNNA 5J2TA 4JT4A 3E9RA 4N8DA 3CX7A 1KO7A 4O4LB 3ETHA 4MRNA 1FJ2A 2GDJA 2BFBB 1OPXA 2PZMA 3LL7A 3W4IA 1XZHA 3WGKA 4OHMA 2MSWA 3LDHA 1D6MA 3O5AA 3H6KA 1SOAA 5CBPB 5KTYA 1YTUA 4ON9A 1QK4A 4K26A 2VUUA 4KKVA 4XWAA 4ZK6A 1ILWA 4BX8A 3CNQS 1FP1D 2ZPAA 4TM8A 5CW1A 3GROA 1A9QA 3W3ZB 4CDGA 3FSEA 1UKEA 1YE8A 3AOEA 1Y5LA 1RE0A 4NZNA 1R27A 3QA9A 1BGVA 1LTKA 1WDKA 5DN9A 3W9BA 2QPAA 3TG2A 4KV9A 2XUZA 1TDJA 3M6UA 1ZVJA 3TB4A 3QVXA 1RKBA 1SU6A 2XNDA 3QLUA 4RA9B 4WSOA 2PUWA 1RZVA 4PHHA 3TH5A 2EF0A 1M1UA 3K0SA 3OLYA 1NY8A 3ZZUA 5DYGA 2J67A 4GOOD 4UM9D 3V6LA 4YI5A 3RBVA 3QE0A 3TKLA 1LPBB 1BWPA 4JYAC 1DLJA 1B00A 1WIWA 2DT8A 3AFOA 5I3CA 3BVPA 1N75A 4NU8X 4PCVA 3UVEA 2B34A 2HQBA 4RUKA 1WW3A 2J31A 5FYDA 2BFEA 5EUCA 3ZY4A 3GA7A 3JQ9A 5JR3A 3SJUA 4D8VA 2G9NA 4GYJA 4K2HA 1UH5A 3GH3A 3BJZA 1M7HA 2WJIA 3WYEA 3CW8X 4RADA 4NPHA 5JSKA 5IWAB 1H9AA 3PSAA 1X7XB 2GR9A 2QV7A 3QPDA 2DFNA 4Z9XA 1E5DA 1MG5A 3TNJA 3MJSA 4U2FA 3VSEA 3DAHA 2HLHA 3ES9A 1X86B 3MN1A 5BURA 5IMBA 5C31A 5L40A 3TAXA 2QPTA 2O2YA 4N6OA 3A4YA 2R1TA 1K06A 1QFZA 4O2BA 2X5KO 2VXCA 3DBHB 4EUKA 4RH3A 4F7WA 3W5CA 2O19A 4LJKA 2C3YA 2JI8A 3QMWA 4S3MA 4QXQA 3S27A 3QXSA 1KY3A 5IX8A 3VOTA 1QIEA 3P97A 3ZWYA 2BH2A 3HXQA 1G60A 3OWHA 4DV0C 1J7JA 5HTOA 3VR5H 821PA 2AX3A 3FZEA 4XYGA 1TYCA 5FHQA 1CZNA 2GCPA 3JTEA 3TUJC 3KETA 3MUNA 1U5CA 1E18A 1ZA2A 1X7WA 2VDWA 4C9BA 1ULZA 1OHHA 2AOWA 1K9SA 2G40A 2IOQA 3STVA 3TLKA 3VHXB 1P18A 1Z7WA 1D8TA 1YQQA 3EISA 4E5MA 1J2YA 2IQIA 3CQ9A 1AURA 1D2RA 1D4ZA 2WIKA 3W3AA 1S2OA 2BMEA 3UTCA 4J0DA 5AM2A 3FNBA 4BV3A 1FNBA 1P8AA 4DA4A 4HNSA 5LQAA 4LS3A 3E8XA 5FPHA 2F62A 1T4DA 3V8QA 5TF4A 1G4AE 1IY8A 1ZI6A 2D3WA 2H52A 3JYQA 3KUCA 1EA5A 2OL4A 3NOOA 1Q1GA 3JRWA 2VDJA 4UW9A 5AKJA 2IIPA 3SJAA 2XMDA 3ZW7A 4XYLA 1KJWA 3IQWA 1L0BA 3NYRA 1MABA 5CD9A 4HN9A 3HYLA 3ZYZA 1ZOPA 4DJDC 3ZVMA 4TYPA 2OYCA 2WW8A 4D74A 4FKBA 1DQPA 5EJAA 1RYFA 4WK4B 4MUMA 5ER6A 5B6PA 5K6RA 4M53A 1W2GA 3WWCA 1NF3A 1XE3A 3LW7A 1U4OA 1I3NA 5COBA 4LFAC 5HIMA 3T6KA 3AUUA 2ORIA 1RIFA 1ZVMA 2WJPA 2NO4A 3FWKA 1G1MA 3OEYA 4G9EA 2DHRA 1YZGA 4RXTA 4D8YA 2CXOA 3L84A 4ISBA 1MTZA 5DLEA 3PUYA 2QTBA 4RQAA 3UFXA 2QRNA 5C46F 4MYRA 1RXUA 3ISTA 2AN1A 3A4LA 4PTZA 3FOAA 2E5LB 4MS3A 5LC1A 5D00A 1FFGA 3C5HA 4KR7A 4E22A 3GUHA 5JAHA 4HDMB 2GTIA 4HNHA 5H5JA 3V8VA 2VVTA 1B0ZA 2WICA 4IDDA 3DHNA 4NHEA 5EFZA 2EHDA 4C0JA 4DMLA 1V5FA 2EV9A 4L4YA 1RCFA 2PWZA 2J0UB 5TVGA 3UPTA 2QXYA 2WHXA 2ZR7A 2OPLB 5A2QD 3DLCA 4K03A 4Z0PA 4WOPA 1O6CA 4YRTA 2LV8A 3F8SA 3GJTA 3D2LA 4LHVA 4PHCA 4GD3Q 4JL6A 3ZIAA 1Z5OA 3A9SA 3K4QA 4ZT7A 2J7KA 2IITA 1O1YA 2P0EA 1OAOA 3F47A 1XTJA 3KOUA 2GO7A 4HHEA 4Q3OA 4G97A 2NACA 1W8DA 4JI0C 4HDKA 5F9MA 3ZLBA 3UX3A 3BGOS 1XAJA 5DBFA 1R6UA 2OB1A 4DKJA 3ECAA 3H8WA 4BCBA 1QGUA 1W52X 2X1LA 2OZLA 4PGAA 4MUGA 5CPBA 1PZEA 3V8NA 1U11A 5FWXB 2HMWA 2VPZA 4XLLA 3R44A 4GKAA 2YDYA 2YJ6A 3ZE1B 4M9SA 3E1GA 2DFTA 4DG8A 2Q7XA 4MGZR 3V1UA 3ZW8A 3E61A 3ZDCA 3PFCA 1XNRB 5LZ8A 4LYGA 3K32A 4H3VA 1IU9A 2NTNA 2FUG6 1Z25A 2J9FA 1FQJA 1HXHA 5A03A 2A58A 2PGXA 4FBLA 1VIVA 4GL2A 1O58A 3UCFA 1XX6A 2D3TA 4QXOA 1T6YA 2D5BA 1UKVY 1V35A 2G77B 2XB6A 3KEGA 3NWEA 4G84A 4EABA 5IMSA 2JLYA 3FYTA 4WIAA 3FLMA 4PHGA 2FV8A 2ZW9A 3U81A 1MHTA 2Q4TA 1OVMA 4NYJQ 3ZE6A 1WMSA 4JYZA 3M4JA 1A5SB 1KR2A 3UA3A 4O59O 1T34A 4JSTA 2PIDA 5L7TA 3Q3EA 3NPAA 2W6QA 3B52X 5HF9A 4LZLA 3ICEA 3LUDA 3LX5A 3GAZA 1ZKMA 2O0HA 5C8YA 4IIJF 4Y6OA 3TPFA 4B32A 2P78A 4AY5A 2BBOA 3V97A 4OX9Y 5KREA 4D0RA 3A9TA 1KY5A 1Y9DA 2PUJA 2FMXA 2GAIA 1Y8RA 3HKDB 3QU7A 2FWIA 4I5FA 2VT3A 3KHTA 4NDAA 3U7GA 4WKNA 3P5SA 2FZKA 421PA 1T6BY 1US8A 3WY9A 3IIEA 3L41A 2I8LA 3GK3A 1CUZA 10MHA 1QLHA 1EXWA 3PBKA 1PJBA 4BMXA 1TI7A 2ZBEA 3PIRA 1WZIA 1WMBA 3LAWA 4IFBA 3VHQA 4AKTA 5CU7A 3JYLA 3FVTA 3R7LA 2WHRA 2H0AA 2HREA 3DEFA 1Q1NA 4TRNA 1XD2A 3VZQA 4WA7A 2O07A 5H81A 4C1NA 4MO9A 4UHJA 1NI4B 2HIMA 2OK7A 4B3RB 2IZ1A 3CKMA 2JNWA 4PAMA 1XTKA 5ESRA 2ISSD 3KR1A 3AFMA 3HSSA 4TMKA 5EMJA 3UHOA 3V00A 3LO8A 5FBZA 3H5OA 3SQXA 4EO9A 2E4ZA 4NDNA 2JLXA 3ZBPA 3FN4A 1XVLA 2Q2WA 3VVCA 5GY7A 4FXOA 4R69A 5E6RA 5AHKA 3L18A 5M29A 2AFIE 3NOVA 5ALIA 4HO1X 2IYPA 3OIVA 4F6CA 3AUKA 4PC2A 2YV4A 1GQQA 3CUVA 4LI0A 2IS6A 2PMFA 1LK5A 4X7RA 2JAPA 2OZPA 1DEXA 2AFIB 2QN1A 4FMCB 4DT1B 5FEUA 1MN6A 2VDKB 4D4HA 4PANA 1HT0A 1QHEA 4Q82A 2Y6VA 1PVVA 3W3AH 2XCRB 3VI4B 5KOJB 4IEEA 4NFSA 5DV9A 1ZUWA 3RV3A 1HZJA 1YDMA 3H6HA 2RAFA 3SLKA 4DR2B 2BMJA 4RTPA 3KJQA 3TL3A 5DM2A 3TTVA 1SXHA 5I9BA 4YP5A 3CVXA 2I2CA 3CVWA 4IV0A 4CM4B 1ADYA 1W44A 3N87A 2L2QA 3RU3A 2G88A 1H6AA 1G98A 3O95A 1T10A 2H7CA 3K4PA 4IRXA 4TQAA 5BYAA 1ZH8A 1FP4B 1CDDA 1Z08A 3COZA 3IR7A 1B73A 5EHIA 5ICGA 1E7YA 4E5YA 2WF8A 4H59A 1GQRA 1L4NA 4WOKA 3QNUA 4RLQA 4CM7A 5HKAA 3R0QA 5FNVB 3NMUF 3C98A 1JZQA 1P60A 1U2DC 2G17A 3K31A 1UJMA 3S1SA 1Y89A 2PYDA 4KAJA 1YNSA 3HO8A 5K8VA 3GLGE 1CJVC 3K0HA 3MPUA 3LNOA 1Y80A 4QQ8A 2CDBA 2YWRA 3KT6A 4UOQA 3L1JA 3S4YA 3U48A 4DY4A 5JBIA 1NXXA 4HZGA 3IPLA 4ZXFA 2FEWB 1YS1X 4TVSA 2V5UA 4ALIA 3DLAA 2O2DA 2J5BA 4Q7MB 3GCWA 3G8YA 1JMYA 4GE0A 1OU0A 1GA6A 2J4CA 4LW8A 2X1VA 4L0MA 1AUVA 5GOZA 3FZNA 2IPNA 1YBHA 4WUTA 4XB6B 5L7YA 4B6GA 4LVCA 3QBTA 2BM9A 3AU9A 4HUQB 3JRNA 4I66A 4S1VA 4TSKA 1W1IA 1N5JA 3FVRA 3URKA 1D2GA 1XHJA 2MR5A 5CLLA 2JDID 4M3NA 5FLXD 2P77A 4DSUA 2O2HA 2ZJOA 3CCFA 4QXMA 4B40A 5C18A 6CHYA 3TD2A 4AUEA 4NOKA 3NQ41 1VYUA 5DK6A 1M83A 4EHAA 3KJXA 1DDGA 3EHEA 1P7YA 5ITZB 4F6LA 1P4HA 4C4ZA 1BXGA 4ND3A 4AUNA 4PTYA 1COWD 4ALNA 2F48A 4UVEA 1UWKA 2QRQA 3DCNA 3GIWA 1E66A 3L7YA 4NAHA 1Q0ZA 3Q8MA 1ECGA 3UF0A 2K7ZA 5IKPA 4KTVA 3O8QA 1R6XA 5ALGA 1P33A 4JJFA 3NVDA 1Y3BE 5IM4A 5JAMA 5KHLB 3D3WB 1ADBA 1VB3A 1XN1A 2WJ4A 3FYHA 4FJ0A 3SVTA 2ZK7A 3D7KA 1QPBA 2NSJA 1DJNA 1EVJA 1YFKA 3N2NA 3F3MA 5HJ5A 3I28A 1ZK0A 4JT9A 4U5QA 3HM2A 4J0CA 1W4RA 4RGYA 5DW0A 4IBOA 4TUYB 1ZOLA 3OETA 4M1EA 1L7XA 2VTVA 4FB4A 2CLLB 1CFJA 3WB0A 4JAVC 3FOEC 4OAQA 1TTQB 1ZISA 2X6QA 3WIBA 5CK4A 1U31A 2AR0A 1KVQA 2XBMA 1A1VA 2FN8A 2HMYB 1T26A 2R4UA 3BMCB 4F46A 3M7IA 1XWFA 1I9CA 3PR2B 1RPTA 1MAAA 3FKSA 4QO7A 5HM6A 3ROMA 3RVMA 4R4JA 4UHHA 5FLYA 1E2IA 2YHAA 1M2VB 2A9RA 3Q12A 4RXMA 3SNHA 5CJJA 2BGWA 2Y6UA 4IXNA 3RKUA 3RIXA 1M76A 1USVA 3EVGA 3JQGB 3DZDA 1V5GA 3P4UA 3BMXA 4MYHA 1G1AA 3PQEA 1ESNA 1R88A 1LBIA 4NOJA 1NLZA 2XCSB 2IU6A 4UKDA 5G2OA 1JLMA 4BV8A 1DRUA 4ND6A 5A6SA 2QAIA 5JAUA 1FU8A 3CLKA 3DNPA 1ZB8A 2ZSIA 3IRUA 5CYFA 4YP1A 4ZEVA 3S2ZA 2DSTA 3SF8B 3W1VA 1NL3A 3TR5A 1KJZA 2G9UA 1BE8A 1E89A 4I55A 4EWLA 4UMDA 3OX2A 2A88A 5U9CA 3GLHA 3ZVRA 1TRKA 3T7KA 3FGZA 2XRMA 5K0CA 1PE0A 1Y1PA 2Z2ZA 3GLRA 2HRQA 4KXUA 5KNBA 4DCUA 2BF7A 2SECE 3P0IA 1IXSB 1YD7A 2PN2A 3DQZA 2C1ZA 1OJLA 1SXIA 3KTAA 1QVRA 1YIAA 1ACMA 1EE2A 1NV8A 2HA4A 4UU1A 1Y5RA 3UC5A 3UJHA 3W5HA 2BBTA 2C4UA 2I22A 2BGMA 4PYOA 3C3BA 4HDSB 2N0SA 3ENNA 5CVJA 3SG0A 5LQCA 3MTQA 4DC0A 2QLFA 1HX7A 1KKUA 4MB0A 5JJCA 2H9IA 4NJMB 3I45A 4X5OA 1T5DX 1KMQA 5FCDA 3PUWA 2W71A 4UTRA 2VSOA 3VU9B 5B3KA 4KUGA 3AG6A 5THXA 2ZJ3A 1N32B 3Q9SA 1LDMA 1O3YA 4MUFA 2H16A 3B51X 1U65A 4AVYA 2Q1SA 2VQSA 2WP8J 4FFBA 3SKXA 1YS6A 4IJMA 4FILA 2WTUA 3RVNA 3BL8A 2D2IA 1G21E 3L7JA 3O47A 1VCIA 2XUIA 4BVBA 1E2FA 1KEZA 5HRAA 1YJBA 2VTBB 4KOEC 4LBYA 4G5RA 3QKWA 4E2YA 1FDSA 3U31A 4ZDIA 1OC4A 1T3SA 5BXYA 4QVIA 4FPXA 1I3CA 3PTZA 3ED5A 1ZVKA 1FCJA 1AC5A 1W35A 3DO6A 5CA0F 1XPOA 3T3MB 1CIJA 1TYDE 5AJWA 2WOJA 4IVNA 1OIWA 1NE7A 1E3WA 1FUKA 4BHTA 2PA3A 3P9ZA 3FD8A 3HB1A 3RTEA 5JQGA 1TCAA 3GJ8A 5CVUA 4UUBA 4YJHA 8OHMA 4ANFA 4DR4B 1E2UA 4PZEA 5JS2A 3HEMA 1PKXA 2P7IA 5JW6A 4POAA 1BTOA 3LC2O 3R3SA 4YRJA 3V7WA 3A4TA 4BTEA 4BZQA 3ZWOA 1EP1B 3O82A 1CJSA 3NTOA 4JR0A 1NQXA 1VLJA 1ZJYA 2W2OA 3K5WA 2H3HA 1PEAA 4BIIA 2PH5A 3WX0A 4JYBA 4KG7A 1K3UB 1X77A 3V1TC 4MJXA 1LLFA 4B79A 2C00A 3RFTA 1B76A 2QVLA 3D7LA 4RZXA 1J90A 4TV8B 4G0PA 4HQ6A 3O1HB 4CHGA 5G53C 2GEUA 4DRZA 1UBSB 4Q19A 4NCAA 4FCTA 1MMFB 2XQKA 1J8QA 4RDIA 3L8HA 3ZHXA 4UJ5A 4UMVA 5EKXA 4D44A 5ED4A 1W2WB 2BGNA 3KYCA 2AOUA 4GWGA 4IMJB 3HVUA 2HLDA 4YCAA 3WYDA 3A1DA 3IPRA 4N3CA 4L7IA 4I5DA 3GL9A 4GPIB 4NESA 4YT5A 5DCWA 3EPJA 1U8XX 1TKBA 4RQUA 1F2DA 4IIFA 2J7PD 4OKIA 1XVIA 4I2VA 4YALA 2J5XA 1OWMA 1UAAA 3UOWA 4RY2A 4YCLA 4PSUA 3NHPA 2PPVA 1XYVA 3TVYA 2IYUA 4EJSB 3H18A 1LU9A 2GAJA 1GA4A 4F2PA 4WFJA 2CXPA 1J56A 2C0PA 2NOAA 3WLHA 3GJYA 1QAMA 2Y1DA 3MLAA 3DOHA 1BCRA 3LUPA 1ORIA 4ABYA 4C01A 2G09A 4PSDA 3MHTA 4LC9A 4L8VA 3N8KA 4ZGGA 3K6RA 1QGOA 4LXYA 1I94B 5A4JA 2DYKA 2Z5LA 4NABA 2NN3C 3GGDA 1L1RA 2ZBDA 4BEBA 3DCJA 4GLOA 1X42A 3ZI7A 3S2GA 4PW0A 1NF8A 3DLPX 2QP9X 2VCHA 4P32A 3AF0A 3KQKA 4MQFA 2ASVA 3MFYA 4I36A 4Q01A 3SF0A 1DLIA 4MJ3A 1QH0A 4FFMA 5C32A 3G9UA 3K9WA 3GT7A 1FSPA 1ULUA 2H57A 4TZTA 2V6MA 2D59A 5I7UA 4ZGWA 2XCQA 1T13A 4W5WA 5D1HA 3INGA 4BN4A 3NYIA 4TZKA 2O48X 2ZR9A 5LVAA 2F8SA 3KD2A 4ZO4A 5AVUA 1VHTA 2KBEA 2I29A 2X8LA 3FB4A 3DMGA 5C35A 2NU9A 3AQ4A 1OPRA 3NONA 2P20A 4YRIA 4UCWA 4DV1B 4C07A 3RYCA 1UDAA 3E9NA 3GVCA 4DDMA 1PQWA 4Q3KA 4R6XA 4LE1A 2J9XB 1RXIA 3HU3A 2GTPA 3E3LA 2NYVA 2D1TA 3ISVA 1F9AA 2A0XA 2G9ZA 5DGDA 1VJTA 3M2PA 1C3EA 1M0EA 2RGCA 3M9XA 5DI3B 2OBBA 2XD9A 3DDZX 4CM3A 1UDXA 2O14A 3NNSA 2BFWA 4QXAA 3RFUA 8LDHA 3GGCA 3VJRA 4NOLA 1BH2A 5KINB 3ZVKA 5H8WA 4NAUA 4LOIA 1D6JA 3PF8A 4QGGA 4QJ4A 4BP8A 3D4PA 4Q1EA 2NSDA 2ZQZA 2B7BA 5AVKA 4TVOA 2JGLA 1IN6A 4OLFA 1U0SY 4EMBA 1JG6A 5KNBH 5LIPA 4IHQA 2XCTB 4G56A 2VYCA 3DCIA 3HBJA 3W9YA 2P4HX 3WKEA 2O2SA 1MRZA 2POCA 3LRPA 4LNHA 1O8CA 4Y6LA 1HT3A 2VHXA 2XEDA 1F8UA 2F6RA 2REXB 4F6RA 1Y9AA 2GNPA 3G9ZA 1ZXLA 4RK0A 3SSOA 2BEUB 2GX6A 1EUCB 4GZ3A 1PDWA 2UZ1B 4WVLA 3IEUA 5KC9A 1W5BA 2WJHA 3GVXA 1V11A 3Q5EA 2WB2A 1QWSA 4EMTA 2UXBB 1PS0A 3H83A 4PC6A 1Q0TA 3U3KA 1ZMRA 2C2KA 5CYPA 4EB6B 3VI3B 2DFVA 4B3MB 4M0PA 3DL4A 1MV5A 3F5FA 4TMWA 1GPYA 3I8SA 1O5OA 3KUKA 4QTTB 1P2FA 3QVOA 1GTVA 4FMDB 1CXZA 1GITA 2ZTLA 3F0TA 2I7TA 5KNCA 5TMEA 2R751 4KIGA 1X1AA 2OBVA 1TFUA 5ALFA 5AP9A 3EY4A 1RQ2A 1KYWA 1OLXB 3MWGA 4UU8A 4J0KA 5FR1A 5LR6A 1YQEA 2G1JA 3LP8A 1A9XB 3SO4A 3PWSA 1KKLA 4IGFA 3IHLA 3V8MA 1C0KA 4IIDA 1NRIA 1WCJA 3ZWCA 3VX4A 1U8YA 1YNOA 2EIXA 3I3OA 3O3OB 2XWJI 4RY9A 4AD8A 5CDTA 4B0OA 5HWSA 4JI8B 2O8DB 1M7BA 1OA1A 4U2EA 4HZIA 1SNYA 4AJHA 2CNBA 1BRMA 5JDIA 1LPMA 3EGXB 2R87A 3IV7A 2HWUA 5GOTA 1UXIA 3SR0A 4FFDA 3OM9A 5TDHA 5G0WA 1M6VA 3IAHA 3Q72A 4QAQA 3PCTA 2VQEC 2XDQB 3QKUA 5AO9A 4O0LA 1CZUA 1KGSA 2CY1A 3OCZA 2G5GX 4C21A 2ASEA 1XA4A 2DHEA 2QW0X 2XB9A 2B3DA 4LMBA 2ZE8A 3EQ9A 4QDXA 1UPFA 3FVWA 1K7FB 4YY3C 4NG4A 3B1JA 4UM7A 1HNWC 1PD1A 3C5WP 4G1MB 1C1DA 1R4MA 3EWNA 4IDBA 3CJQA 3HHPA 5DCYA 2F1HA 2J6HA 3HBMA 3OZBA 1GKKA 1SQ5A 5FWYA 2JIOA 4J16C 4MWTA 2GEDA 4AMYA 2EP5A 4WBXC 3V9AA 4E6PA 3BH6A 4Q9LA 1ZA1A 4TZ0A 3DXXA 1CDOA 5KYXB 3HQ4O 4BO5A 2XXAA 3OJLA 5E1DA 3X2FA 4K2AA 1PK9A 2PQ2A 2COUA 4WLFA 4KR6A 3OFSA 4AF6A 2P5YA 4EI2A 1AUOA 1W1WA 1PVDA 1EKXA 4PAOA 1LK0A 3K5IA 1FNMA 3P2KA 2OO5C 3R5KA 5LBTA 5IKOA 2OBLA 2MOKA 5ALSA 2PNJA 3WL8A 3HSKA 3DP7A 2WWRA 6Q21A 4H4DA 4PUGA 2RH9B 2FI1A 1KOLA 2FQQA 3PUZA 2A86A 1MOPA 1GG2A 2VTDA 3CR8A 4O25A 5AJXA 4IIJA 1UJNA 2Q6TA 3WGMA 1SWWA 1R0RE 1L5YA 1MENA 3PPYA 3SPXA 1KNQA 2CGEA 1E2EA 3T1YC 2NO5A 1GR1A 4GW3A 4R9NA 3WKBA 4IZHA 2CHVA 1LI7A 1E1DA 2QL6A 4BVHA 4EKEA 1XFAA 1DJPA 4QNNA 1H6BA 4KBGA 2I62A 4C7JA 4LF8C 4M37A 3AYXB 3GLFE 1WA5A 3UH0A 1NKTA 4MUIA 2GYWA 4GQAA 4LGCA 4WN9B 4OGKA 4MUHA 1LTHR 3OOYA 4J3NA 3GLFB 1U7ZA 2I9KA 4EHNA 2Y0DA 1DJOA 4X3CA 3K6JA 1BYIA 3CJEA 3HFGA 4YPFA 1CUIA 1QQ7A 2J59A 1TM2A 1YIDA 1YZ3A 3C8UA 3CY6A 3O8DA 4FDVA 4KXYA 4BGUA 5GJBA 4OXXA 3D4OA 4NYJR 4Q3NA 1R0KA 2W7TA 3AUFA 4R0VA 3ZLTA 4F5WA 3PC8A 4B3CA 1OASA 3QU2A 2WWXA 3OLQA 5H70A 5JS1A 1CS0B 3KC2A 2Z83A 3RRFA 1HK7A 1VKNA 5F64A 2IYWA 1GUZA 4LYHA 1UMDA 2VRBA 3KVVA 3FNGA 4M76B 3UENA 2P1ZA 3WSTA 3HL4A 4BQIA 5AW4A 3SSAA 1KJJA 1XXLA 5LP6B 3B3GA 4URYR 1E6KA 5DMXA 4Y7DA 1QFMA 1WULS 1Y9EA 3BHNA 2WVJA 2MT9A 4BBYA 3PCRB 4YUAA 3VSDA 4WGFA 4MWEA 3BTVA 3I76A 1C7QA 1J70A 1TC2A 3ITDA 5GQSA 1YXMA 1DAOA 1GRRA 1B3RA 3KAJA 3RQIA 1SVLA 2CE7A 4KMRA 9LDBA 3QLUC 1QZUA 2X23A 1U0RA 2IODA 2Q0SA 3DFUA 4FU0A 1YFLA 3HVRA 1LLQA 2CDAA 2AJLI 4J1QA 3K05A 4MW9A 2Q9CA 4ZVOA 4CV3A 3AJ8A 1BJTA 1GZ5A 2IPAB 3C3MA 3O90A 5P8WA 3ZCSA 2BEWA 4PFSA 4E30A 2WUDA 1Z4QA 4Y2PA 3IKMB 1KP2A 1N57A 5HJ2A 4A91A 1YOVB 3OQMA 2ATWA 2I8CA 2I7DA 4F72A 4CG3A 3FBTA 2W58A 2ZU6A 3JQ9C 1L4MA 1RPNA 1IEQA 3PNPA 3FW1A 4MP6A 4PAWA 2WINI 4FX2A 1ADCA 5F5NA 4YPVA 2C4VA 5DH9A 4UVIA 1KVSA 1Z73A 3LFHA 3E22A 1VL1A 4XDGA 4OIMA 1NTOA 1D04A 1RQPA 3IKLA 2PX2A 4DKXA 3EW7A 4YMSA 4KPUA 5IJZA 4YTEA 5KPDA 4CI0B 3AEKB 3PJRA 1WCWA 3FMIA 4I81A 1UL1X 1KDOA 1Z0AA 2WOOA 4GQBA 1YIOA 2C88A 5I9MA 3REOA 4E09A 2BFOA 2IKQA 4YYEA 2DT5A 4B4OA 3IP8A 1A98A 4HI0E 4UUOA 1BXKA 4A27A 1Z6GA 2OA0A 3TKAA 3IAS6 2QM3A 2I4LA 1M1YE 3ZW9A 3K7EA 3H7AA 3PPXA 2KE5A 1U81A 1U2GA 5DDIP 1WDWB 3ESXA 5KNCH 4FD2A 4IF6A 4CKEA 4RV5A 4J7XA 2PZEA 1M1YB 2Q3LA 4LBZA 1WP4A 2C98A 4TWAA 3QGMA 4JI2C 3RU2A 4LXUA 1GIAA 3PE3A 3GA5A 3G17A 3FE2A 2P75A 4ERNA 1F2UA 3ELUA 4WDRA 2X8BA 2LD4A 2Z09A 2IYOA 2KLBA 3DAFA 4DV2B 3ILSA 2NYAA 2CF5A 4XDZA 2PRZA 3VSAA 2A30A 2VJMB 2YWJA 3WGHA 2DMRA 2FZ4A 2GB4A 2QP3A 4EA8A 3VKGA 4QASA 3H9EO 4ZGBA 3QX7A 2IYZA 3L40A 2OFXA 2UUCB 2HMVA 2LPMA 3OOJA 3GNLA 3OZCA 4XTRA 1KP9A 1ZOIA 2SCUB 4XGKA 3L0DA 1XDWA 2Z1MA 3R20A 4Q7JB 2R48A 1ZN7A 4AN0A 3HO1A 1WBBA 2XUKA 4TN1A 4JKOA 2I6GA 4GMFA 4EG1A 2GJAA 4JEHA 3EIQA 1BEUB 3QEKA 5E7IA 3R7NA 5KYWA 4IDFA 1N3LA 4IH9A 2GN6A 4LKRA 3B5IA 3C3YA 4X1YB 2HEIA 5FOWA 3L0YA 3VR4D 4ZZIA 2NZUG 3CX4A 4OYCA 2PCLA 4H27A 4KMMA 3MGGA 1UFRA 1PJZA 2XD4A 3I2IA 4UCFA 4BEVA 2UYOA 2CLFB 1GL7A 1Q15A 4GI1A 2XTZA 4JT8A 2CMFA 4V1CA 4TZ6A 4MTNA 3V1KA 1L8OA 4F3TA 1U0GA 5BW6B 3UAZA 1POXA 2VSQA 1NJ1A 1TD1A 1A96A 4UMFA 1P44A 1MJGM 5FTKA 3EGDA 1U1EA 1V6SA 3M4XA 4OA5A 3T4XA 4OXQA 2PBRA 2QD2A 2PG3A 1N2HA 1PJLA 1JLLB 1I1HA 3BGIA 4MDHA 4WBNF 1RTTA 4CMIB 1CIVA 1U0JA 4BJ3A 1W19A 3PJDA 3U62A 3U4QB 3UHFA 3Q9UA 1SVMA 2C8VA 4ROTA 1GFIA 3JS5A 4R7ZA 1ZNYA 5JYEA 2EBFX 2RJNA 2L42A 3GQVA 3UAYA 5JNVA 2P3QA 1YHZA 5B4UA 3GRRA 1PFWA 4L0QA 4XYEA 3LPLA 3N58A 4HRVA 2R4QA 3HNRA 1K5DA 2H11A 4TT3D 3WLJA 3BSSA 1OAOC 2HDNB 5H4HA 4J6EA 3VUFA 2JFVA 1L8AA 5EQTA 5DSXA 4BNTA 3U6KA 4KK3A 4DJEC 3MQFA 2GJ9A 3Q10A 1U4NA 2XCOA 2XZOA 3SZOA 5AI0A 1L4GA 2RHRA 3EOAI 3IR6A 4XGNA 4A6XA 2DY0A 2VKTA 1OZ0A 4LJ8A 4KXWA 4LZZA 3PXBA 2ETVA 2RGBA 4PHTA 4X7BA 4BNXA 2IX9A 2WD7A 1D09A 4YT8A 2FFRA 1EDZA 3CNHA 2ZBPA 5BW8A 4PRKA 3FPSA 1Y1TA 2AW5A 3CPEA 2P02A 1T1SA 4NATA 3S1AA 4NCIA 3RSLA 1WDTA 2WKSA 3K15A 4MDFA 3TTWA 2RI6A 3UKDA 1I01A 2O3TA 3KFVA 3FWNA 3L79A 5A9RA 2B1RA 1E6EA 1LFDB 4ZICA 2WMOB 1D2NA 3EY9A 4X61A 1SZCA 1GN8A 3BQNB 4HNGA 5LNK6 4RO0A 1QC5B 3CZMA 3CLSD 3T1QA 1ZGHA 4KX3A 1NBMD 3BFVA 2X9LA 3GG2A 1ADGA 3AI3A 3TL2A 5CA1B 3AGQA 1B14A 2YWGA 3G7NA 1F8FA 3LLCA 4CIYA 1QKKA 2O20A 5C7OO 3EVZA 3A04A 4Y2QA 5FWAA 1AMUA 1PZNA 4P36A 4L4SA 4R7GA 3ANLA 1SOUA 3TLYA 4F9FA 2X8JB 4TS3A 3LSTA 2G3YA 4MS1B 4W8OA 3OIFA 5CYOA 3T1HC 1K6IA 1Y1KE 2AKYA 5BOSB 2AFHE 2IS4A 4CEJA 1Y82A 1ZM2A 4KP7A 5IYZB 5FA5A 1HLPA 4RW0A 3BE8A 3QWBA 1QBGA 3V4OA 4FYXA 1DFHA 3EE6A 4G5XA 2PZ8A 5EUBA 1MX1A 1U99A 2EBUA 5CA0A 1B6RA 2O57A 5F7ZA 3HKCA 1P7WA 3DT9A 1CKEA 1KOJA 1P91A 3LVRE 2FPPA 5E9AA 3UMCA 3I04A 5JYDA 3L4JA 1BC5A 3ANMA 1WCV1 3FUCA 4B3JA 1CQJB 4L4ZA 4RAQA 1Q7CA 1YCGA 3CLVA 2CKMA 4OD0A 4UD6A 4X8OA 1Z13A 4X24A 4NJEB 4W9NA 1GTZA 1XU9A 1DGQA 4JODA 3NEYA 5I9SA 2FU5C 2X3YA 2OAEA 1W4AA 4GR9A 4EY3A 4BE7B 4G85A 1BVHA 3JWPA 1U7WA 4GIBA 5DISB 3WDSA 3MWEB 2CMGA 2EL7A 2Z8YA 1G41A 3CLTD 3HHEA 2J9GA 3OT1B 3PWKA 3QOWA 3R7WA 3WJ7A 4EKIA 5IXYA 3UWDA 4CBVA 2HK7A 1E2DA 1Q6YA 4JIMA 2DR3A 5HR5A 5CIYA 1ZOSA 2FSIA 2JGAA 1IB6A 2YWHA 3OFKA 1XVAA 2CHEA 5EERA 2E55A 2GEFA 5FBWB 5C34B 1CF2O 3DF9A 3ROGA 3C6YA 1MW9X 3HWWA 3ROQA 4J0EA 4EO4A 4YT2A 2QBYA 5KU1A 2OGWA 4LHSA 2HF8A 3MS2A 3EZXA 2WNSA 1RWMA 3WSVA 3ZDZB 1OT5A 2XWSA 3MERA 5KVQA 2K4MA 4JLKA 2P3LA 3LI2A 3JTMA 2BJOA 3TD6A 3SEAA 1JHZA 1C8KA 1CJCA 4TL6A 2PBZA 1NN0A 3I4LA 4D4MA 2Q3CA 3AEQB 1VLAA 3K9QO 2EAUA 1TT5A 2PUTA 2A33A 4C0WA 4F21A 4DWJA 3G02A 2IZOA 1KA9H 3WWYA 3NYQA 2FSHA 2OO3A 4L9SA 5LMNB 3BILA 3MT0A 5BPFA 1W88B 2I91A 2RB5A 2YN2A 1EJ6A 1JRLA 3FPKA 4XVCA 3FOFC 4G8DA 3NTLA 1IDOA 4GI2A 4DCJA 2I7VA 3M1LA 3QFTA 1JHAA 3L7OA 4WINA 1DXOA 1JBKA 1L4HA 3ZWBA 2AT1A 2C2WA 2PNFA 3AC0A 2IJGX 5DRYA 1R8XA 2O0MA 1HDEA 3D1JA 2JHCA 3OZEA 5IAJA 4Q12A 4UEQA 5ETJA 7AT1A 2ZDQA 1WE2A 4X91A 1ZB9A 1E0JA 1EFDN 2H1VA 1PV1A 3FH0A 3N76A 2VZLA 1KAEA 4LZJA 5ENVA 5B1IA 4C7OA 4BKQA 1FJHA 4ZAZA 1RYYA 1RLJA 4L6AA 4OLBA 1HFWA 3L6EA 3W8RA 5J2UF 1EMDA 1PT7A 2PKQP 1GCOA 2GASA 2N75A 4JUAA 3GVIA 4LGMA 5CLQA 1ZUD1 2QYOA 3GIDA 1ABFA 3RADC 2V7QD 1J5PA 4M1SA 1WB6A 3CBGA 1R66A 3GFQA 3JQDA 4MDYA 2LWIA 2VSYA 4V0NA 3Q7RA 3AEZA 4DR7B 4LF7C 2JIZA 3UK6A 4FOOA 3TDKA 1KFEB 2X0DA 1Z15A 4JBLA 2C29D 2VYFA 3PYLA 3O4FA 4WNYA 2GESA 3JQ7B 4DCCA 1JWAB 2ODBA 2C9BA 2ZYIA 3BXPA 4KCGA 4KAFA 2WYWA 4QPDA 4HQNA 4TLBA 3TW4A 2FXIA 4YR7A 5J1SB 2HNBA 1EXMA 1RJEA 3TQRA 1AIPA 5DN6A 1ADFA 1QORA 2ZRNA 4OGFA 4XEUA 4ZAYA 3YASA 4BTVA 1U8TA 5AI9A 4F85A 5TMPA 2UU9C 1U8UA 2AXQA 2EOAA 1YR3A 1P4EC 4UFNA 5L3RA 2QTRA 4Z4HA 2QU7A 3WS7A 1ODTC 4W5NA 3TIXB 4M1YA 1A7JA 1DCMA 2OAGA 3U7HB 2QJFA 1W4ZA 1XTRA 4UUNA 3RASA 4A16A 2H2IA 2WF6A 4YMTA 2DZDA 2V4UA 4J0FA 3W5SA 1U1DA 3CNEA 3LVQE 2VYVA 3BFXA 4TWRA 4UBNA 5BSFA 3UMMA 1SKQA 4K3VA 1A9PA 4FQ7A 1GZSA 2OY0A 1U9YA 4UNPA 1ISPA 4LFBC 4F7DA 2GH1A 1BN6A 1UIRA 2A92A 4AUMA 4NE7A 4BO7A 4CW7A 5C7YA 1YDHA 2J5QA 2PRSA 3NW9A 1U2RA 2F00A 1EJ0A 1MO3A 1EGQA 3RG8A 4OK3A 3U44B 3BDIA 2IU3A 3CUKA 1I32A 2BFMA 4B6QA 1H05A 2DH5A 2HDHA 2WM8A 2FN9A 3BFJA 4PZ0A 4OG2A 5DCUA 3AVOA 5KX5F 3UXHA 3VPSA 2R68A 4IYRA 3IQFA 3RM3A 3L49A 3L7NA 1BDJA 3PX2A 4J0HA 3U4GA 2BH9A 2DLDA 4PPQA 1NHWA 3A8TA 3EEIA 2C2OA 3C4VA 1QONA 1JR3A 3OURA 3CURA 3PRKE 3EG9B 1J2JA 4L5YA 5FJJA 3GLGA 3PZRA 1M2NA 2CFIA 4O4JB 4G0MA 2EATA 2F4NA 3TLGB 3LUJA 1RI4A 1NKSA 5FTMA 1IPEA 3MRTA 1C4KA 4R5HA 4YROA 3MD9A 4YQEA 4B82A 1VP9A 1ESEA 3BRWD 4XA8A 5FKJA 1SHJA 3H6GA 3K8YA 3BMNB 2GJ8A 2NO0A 3A31A 3ANYB 3BFKA 3GEEA 4DCMA 1QSGA 1TVKB 3KJGA 1GXSB 3HEBA 4WESB 2ZR8A 1QIGA 3R5XA 2LIPA 3KPJA 4UDXX 3FHLA 2C7OA 1TH5A 3Q7SA 1TGVA 4B71A 2XJ4A 5FBVB 3T7SA 3EN0A 5A05A 3ACBA 3FFTA 1LS6A 13PKA 2DUWA 3AEYA 4I1UA 3ULKA 3IA7A 5JAZA 1P1JA 4AZVA 2PUCA 1Z6XA 3CYFA 4AZ0A 1V2GA 5BR4A 3ZGZA 1IB8A 2P5UA 2D2EA 3BIXA 4IJUA 4O1HA 4FBMA 3SIXA 3TBFA 1TRHA 5A9SB 4EJFA 1V41E 3JWHA 5ITVA 2QZ4A 3PE4A 3TLXA 3GFSA 4LY3A 4AICA 3K1ZA 3PV0A 2H1OA 4K88A 3FDJA 2QSZA 1RSZA 3WGNA 1XKTA 3OSUA 2BTOA 4ZU3A 1U2ZA 1SBIA 5AVRA 1ML4A 2WKQA 4UM5A 5EE3A 4AS2A 4U2BA 2J3MA 3WRXA 3VGJA 1EFUA 1DCKA 4Z5XA 4NV3A 2PTHA 2X4GA 4BVEA 1JDTA 4HTFB 4U2GA 5EHNA 2ZCJA 1AO0A 4IP0A 4B73A 3EQ7A 3ZGNA 4O29A 3BBPA 2MYPA 5HGJA 2IHNA 5I7WA 1HETA 4EFMA 4PBSA 1PEDA 2CNWA 1K4KA 3PLAE 1O87A 3OIWA 1DWUA 5IP5A 4B6EA 4ZJUA 4HS9A 1YO6A 1DRWA 5PNTA 3IMKA 1SGWA 5JPIA 3I12A 4MR8A 3E9YA 4QDTA 5BR8C 1UP7A 3WHIA 4FE7A 1JQKA 3AUYA 4U5YD 2QI9F 3TL6A 2KS6A 5IT4A 3EWIA 1FFAA 1TTHA 2CZGA 4B48A 4PG5A 1NVMB 4CQMD 4EVQA 3P9YA 1IBRA 1XTBA 4LWPA 3KQPA 3WDLA 3KQQA 3LZDA 3ZWNA 4EX7A 2Q0QA 4Z7JA 1X1TA 4BY9E 2R6ZA 3T4UA 1ZN8A 5DFAA 5M5BA 1Z3IX 3R0VA 4KJZA 1MIOA 1GEGA 1KO5A 1KOFA 3A2LA 4LA4A 4RFSB 4MRRA 3UXYA 4QUAA 3VJKA 5BT9A 2PYZA 1KQOA 5HBGA 2KLHA 1SQ6A 2PUFA 4O4LF 4XUCA 4GKKB 3INTA 2WPDA 1RJ9A 4FTWA 1DVRA 5L3QB 5GAJA 1A8PA 3EZ2A 1I1QB 4QUKA 1WV0A 3OO0A 4DIUA 2EKDA 5FOSA 2IX3A 4LYYA 3O26A 1YGPA 3INRA 2QRUA 4KLNA 1UBJS 4BMVA 3VH1A 1K86A 1NJ6A 4F45A 1ZCFA 4M36A 4BPBA 3IP6A 1XZQA 1G64A 1PR4A 1LLCA 2Y3IA 4IOLA 1BS1A 4Q4CA 3AY7A 4DC9A 3E1KA 1WRBA 4BMYA 2WG2A 1S3IA 3A1VA 4P3NA 4RMHA 1KEEB 2NUAA 5DSTA 2BD0A 3EYAA 1WMEA 4JJ6A 3NKVA 2A4KA 1DRVA 1RTKA 3TCKA 4PGFA 2PSSA 4EB3A 4OY3A 4RF2A 2EHJA 1Q0SA 4YONB 5EIXA 3NGLA 5JSUA 3ETJA 3F97A 3A6PC 1WVMA 4JHLA 1H5UA 5BWCA 1XU4A 4A8JB 5K45A 1O7JA 3MELA 1R6AA 3PUVA 4Q3DA 1H42A 2C1XA 4YUYA 4Y2GA 3GRCA 4LMAA 4QSMA 3NJ4A 4MB6A 2O05A 2QTLA 2E4YA 5EJFA 3RHFA 1PL7A 2QMOA 3D3QA 3JZDA 3KL2A 5DHPA 4EZBA 4B7ZA 4Q5IA 1HFJA 1EUYA 2NSYA 2I3GA 1JF8A 1XO1A 1OGYA 2AL7A 4IYJA 2I2FA 2OHFA 2PGOA 3TSWA 3V46A 4QNRA 4YAEA 1NMSA 2Z2KA 4HNVA 1NNEA 3H42B 2GPNA 1Z9BA 2X76A 2JD0A 3BF7A 4P4TA 3H87A 3NUQA 3L6RA 2NYRA 1BMFD 4C6RA 2P2NA 2YFYA 3RAPR 5BR7A 1TO6A 4P3YA 2C97A 3ONWA 5KAPA 5I8PA 5BN4A 3ZHVA 4EYQA 2R6AA 2CSXA 5JFTA 1H69A 1SA0A 4B35A 1L5VA 1KSJA 2BM0A 1BKDR 2JA1A 4MR9B 3U1BA 2HBRA 2O59A 4AU1A 4O5AA 2CK3D 1NN1A 6REQB 1V3TA 1LVGA 1O95A 3U1VA 3ZDDA 3UPUA 1GO2A 1NFQA 2AFVA 2XXJA 1U6JA 2CJPA 3O8RA 1VECA 5EQDA 1VKRA 4KXFB 3CH6A 4XIIA 4ZYWA 5I7VA 4II3A 5FI0B 3THOA 1ISMA 1RHMA 2C3UA 2PZFA 2NZYA 2ZRMA 2HOQA 3FLAA 1G4HA 4JT2A 5DULA 4K86A 5FUQA 2X8WA 1V5EA 3JALB 3NTVA 4K6OA 1WS6A 4LPSA 1QAOA 4AJIA 2WJWA 1YE5A 3MGBA 2PVPA 3HUFA 3L7MA 1XMIA 4X00A 3SLRA 2IHZA 1UQTA 4WN3A 3MQ2A 3OH8A 4X7PA 5KHAA 1ENPA 1MH1A 3FPCA 1K88A 1TKRA 1G20E 4U9UA 3WWZA 5JMWA 3EGOA 2G9RA 3W1EA 2XTJA 1EFKA 3BHJA 3A3PA 2R6CA 4DUGA 4IICA 1CJUC 4LE2A 1E4VA 3OQBA 3PT5A 4K9RA 1G20B 3CRMA 5K3SA 3AZQA 1BFKA 1NASA 5F5XA 1ATZA 1XTTA 3IUNA 1CUBA 3HCEA 1I3MA 1FUEA 4TTPA 2D2VA 3IA2A 2VP3A 3CLUD 3TIGA 3Q2IA 3GU3A 4E1VA 4FYKA 1XKQA 3TI9A 3ORYA 3P0EA 1HURA 1IE3A 5HKBA 4FZ3A 4X94A 4DJTA 2DPLA 1BHO1 2E87A 1LF0A 2R8RA 2VHQA 3HFRA 2IK8A 4H35A 4R1SA 3DKVA 5EA2A 4WBNA 4NYIQ 3AINA 2WZBA 3PGLA 4PYKA 1WUKS 4TKMA 4AKHA 1H8ED 2EL9A 2Z4SA 4S1PA 2ECPA 3AL0C 3I09A 2DG2A 3UJBA 1G8SA 2WU1A 4WZAE 1CE8B 4JBWA 4KAAA 4YAWA 3LZCA 4AMVA 1WWKA 5C9ZA 4XFDA 1GZ7A 1WPRA 3WZ2A 3OQ1A 4BO2A 1J8VA 3LKDA 2EP7A 4WZAB 5KWVA 1YE3A 1N8TA 3R9KA 1JP7A 4HBZA 4BFLA 3P2OA 2CXCA 2Y2VA 2BUAA 3VNVA 3DD1A 3W04A 3H2HA 1RYDA 1SJ9A 3OWXA 1NW9B 3P9XA 3B1KA 1Z6ZA 3X1WA 3DTNA 1U7HA 5JDIC 1BGXT 3I30X 3ENQA 3IAFA 3QUCA 3QX9A 4RX1A 1L5GB 2HB6A 1NXVA 3X1DA 2PGDA 1OIXA 4RF4A 4OHOA 2WU0A 2HU5A 1UM9A 2VUTA 3VO8A 1XRSB 1P9OA 4MV6A 4LEIA 3LX8A 2BBSA 4KYUA 2G72A 1CNEA 3WNDA 4WXRA 4V1CI 5EMMA 1FK8A 5E2AA 4F9GA 2VJAA 4XRGA 2C9ZA 5IDVA 2QX7A 3V1YA 3GZJA 1C80A 2DY1A 1ISJA 4FEAA 4JFAA 5JPDA 1FQOA 3T12A 3UK0A 2A1UA 1V9CA 5B7PA 4KR9A 1VJCA 1UJ5A 3NC1C 4OHKA 1P80A 4B3IA 2CBXA 1V8ZA 2HU7A 5GZ3A 1H0KA 2JK0A 4AYXA 1EAMA 2WHPA 4PHFA 4C06A 4MPJA 2OV4A 3DZJA 4FNOA 1F6DA 2GLXA 1KYZA 1S3FA 1YHNA 3CB2A 1KL7A 4L2ZA 4LSWA 3K94A 1OTHA 1EVEA 4IFTA 3SE7A 3U19A 3TQSA 1KEWA 3ZE2B 2JBHA 2OYSA 1U02A 2IU4A 4V3CA 1E2NA 3RS7A 3SCZA 3SZ3A 5T3YA 1OLUB 1OI3A 3CRRA 4D6YA 1BYUA 1CRLA 2AB0A 3D5EA 5A5VA 1QGZA 1N9GA 2VSNA 1QKJA 3W0LB 3TB6A 2B7CA 2V7XA 1F4VA 2GBGA 4OEHA 1DKLA 5JTTA 4LXXA 2H1HA 2H59A 3WYCA 4RHEA 1SK8A 2HQOA 3LX6A 4A0GA 3SFTA 5HKOA 3IDSA 1RBZA 1AXGA 3GOQA 3HLKA 1OSNA 5IVHA 4PGMA 3GY0A 3IUPA 2VZ0A 2X6TA 4R9VA 5K3BA 3SJCA 1IM8A 1VL0A 1RC1A 3HADA 1HLGA 3NBZC 3OHSX 4M46A 1F0YA 1H1LB 4L9AA 1LZKA 4PQYA 4DMRA 5I8WA 4PLZA 1Z7EA 1GT6A 4X20B 5TJHA 4QPZA 3UMBA 4X64B 2LXNA 4EAQA 4OI4A 4LHYA 5IFIA 1Z6TA 3LHFA 5AK4A 3THXB 1B23P 2AI3A 2WIJA 4IHKA 4TXJA 1L6RA 3CT6A 4RYDA 3OPYB 2G08A 3CIOA 1MC5A 3PC8C 4FQ5A 5DTEA 1AA6A 1N7GA 1YR8A 3IIKA 2ZIVB 3NPMA 4KN6A 4BKUA 3KAKA 3PR1A 4BMPB 1H2AS 4P2BA 4NRDA 5JZVA 1MX9A 1WR8A 1GDHA 2ZULA 3J81D 2G0NA 2VK4A 4G0QA 4HEJA 4JC8A 5A0TA 2AMLA 4H3KB 2NO1A 2AJTA 2PWBA 2VP4A 4EFNA 1XZMA 2WWWA 1EJBA 5D5PA 3EIWA 4IG4A 4RA6A 3R7SA 3VTAA 4FC7A 5EXDA 3EDCA 3N0TA 3I6QA 4D3YA 5F2KA 5J58A 4HGQA 1EM6A 3BG5A 3M89A 3VBCA 1YK0A 1QVVA 1NMZA 4HNUA 4FGZA 5JAPA 1CQZA 4TLEA 1FYXA 1L7RA 3T5CA 1T6XA 2J1LA 3PUIA 4FQ8A 3ZJ5A 2B25A 3HG7A 3MS7A 1I2CA 1NV9A 5COQA 3BGWA 3H19A 2HIGA 2MTBA 5GWXA 1XRBA 4REOA 3RFVA 5T4EA 3EZLA 2ZJ0A 1CULC 3EDYA 1ZESA 1Z06A 3OJCA 1UBTS 1XB2A 3MJRA 4GOKA 3LBFA 1KNXA 1NP3A 1HR0C 1YS2X 2Q1YA 3K8QA 5LB2A 1I4TD 1NT2A 3UCXA 1GGJA 1UODA 3IP3A 4I8DA 4MWSA 1QIJA 3VM6A 5EQFA 2C31A 1J21A 3W06A 1PO7A 4EKDA 4PQRA 2VP9A 4CM5A 5C37A 3I1IA 4D6PA 4E5KA 1CZLA 1Q20A 1EVZA 1VLHA 3F90A 3HKEA 2X42A 3QITA 5JATA 2X40A 4GVXA 5BSUA 3TR3A 2VTKA 4GR4A 3MPOA 5FNVF 5A3SA 4HWPA 1E9BA 4QUGA 3DO8A 1E60A 1U2GC 3F2IA 1UJ2A 1ML3A 2BKVA 1C8BA 1WZUA 2QTNA 3CA8A 3DAPA 2CJWA 2FQWA 4FOSA 1L5ZA 1P1CA 1Y3AA 3LQKA 3UT6A 3LQFA 4ZV7A 4LCBA 3EXFB 3LNTA 4BKRA 1E1RA 3RRXA 1YDGA 3T9EA 2GVNA 1SXJE 1CY1A 5LKRA 2O8EA 4ND7A 3T99A 4UBJA 1ECPA 1EHYA 3HA7A 4H7HA 4F84A 5B3JA 1SXJB 2A94A 3BJRA 4BNZA 4HRYA 3A4MA 1FTWA 4H31A 1H9BA 3ON5A 3GMSA 2GM3A 2P30A 4RL4A 4CR6A 1ZMBA 3D5TA 2V9PA 4RPJA 4CDNA 2J0VA 1RZRA 4JX9A 1E3TA 3TM5A 3DBOB 4GDFA 3HR4A 1FFXB 3ONNA 1T91A 1ZXXA 1WW8A 3NH9A 1N1DA 3GBSA 3KT0A 4Q3AA 2EVWX 1FFEA 2W4MA 4RMIA 2OV2A 3S44A 3OU2A 1EBFA 3QU4A 1JSZA 4E12A 1QMGA 1X1CA 2V54A 2GPBA 3A06A 1KSHA 3D4IA 2AA3A 3LBAA 3ZOZA 4B17A 3OC6A 1XQ1A 4IWXA 4I6GA 2QTWB 3JQAB 3KZVA 3VAZA 3UYLA 4KQIA 4F96A 1OROA 1XJQA 1PR0A 5DNYB 3I73A 5EE0A 4HN4B 1RAAA 1MQ9A 3D3NA 2QF7A 5KVCA 5JD5A 3SS9X 4NV1A 1N5RA 3RS5A 2W6PA 1LA2A 3UB4A 4MQUA 5KYNA 2DQ4A 2H1LA 3BD6A 3CCBA 2H29A 2PGJA 3AH8A 4I4LA 4P0PB 3RTBA 3PU6A 1D1PA 3L0SA 4GSYA 3B85A 1MAVA 1II9A 2GRJA 3AUAA 4QLAA 5A4DA 4TUYF 3IQGX 1PVOA 4CZ2A 3OM0A 1E20A 3SX4A 1YRBA 3OUUA 1REQB 1I4DD 3PTLA 3RO7A 2XKKA 2Z51A 1CHNA 5BNTA 3K70C 3ETOA 1G2QA 4EPYA 2VC2B 4ZRDA 3QPBA 2EGGA 4KHPC 3KL4A 3RJ9A 2PU7A 3TSCA 1DIGA 1DOZA 1GQOA 2GBPA 1EBUA 2AYYA 3PGJA 4CG1A 4G1BA 3PIIA 3DJFA 4IQGA 1KMHB 3Q7EA 4BV2A 5HQ3B 4YECA 5EGNA 4NE9A 2CXRA 1G2PA 1SN7A 5KI6A 3OLXA 1R8JA 1DARA 5GZ1A 1JAHA 2NXCA 2V0NA 5HDQA 1GL6A 2DSNA 3F96A 1GRNA 1SUDA 4Y8VA 1OX4B 1OXXK 3PKIA 3JZIA 3WO0A 1UZLA 1MT3A 1D7AA 2OSVA 2HDOA 2WC1A 3L6CA 3DBVO 1OXSC 1JPJA 1HSZA 3G0CA 4GP9A 3VNBA 3DZFA 4JDUA 3K0AB 2W70A 4BJ5A 2PX3A 1QDEA 3DT8A 3OM1A 5H4GA 2WQ6A 4F4HA 2HM7A 2BH1X 3VPBA 1NQTA 4QEKA 1OH5A 2R7AA 2OGZA 2C2GA 2FHPA 2CUZA 3VGPA 4HEQA 4CM8A 4Z2YA 5CB0A 5CCXA 2XOXA 3RS8A 4YACA 1FX1A 4Z9FA 3B36A 1E3EA 3BN3A 2GN2A 1Z5PA 3AHCA 3CW2A 1RM3A 3QFFA 3FVVA 3ZNOA 1XMVA 4I9UA 1Z6AA 1F2TB 2ZTSA 2OD9A 4M9XA 1R0SA 1TVCA 4BGDA 3WBFA 4XI9A 4EHKA 1QFJA 3THYB 3GJ0A 4OM7A 4JGGA 3GWZA 3N70A 5FBRB 1QKIA 1GGEA 3KCQA 4JYPA 1BX1A 5IC6A 1JSXA 5BNFA 2D5CA 3IOBA 4C6TB 2QTVA 4FONA 3P9QA 2V97A 1ND5A 3WXMA 2P27A 3RHTA 4KGDA 4OXNA 1QK5A 2ZUVA 3HXLA 3WIDA 5IKMA 1N5KA 4OCZA 3RAGA 3G9XA 4RNDB 2OGUA 4YDSA 3BMQB 1ZK1A 2DM6A 2HL6A 3UMVA 2BMFA 2G9QA 3HACA 4QFCA 4CNQA 3GMIA 2AN5A 3LVFO 3O9VA 3HR7A 3UWMA 3VH4A 4LKOA 1RMTA 2BTQA 4BFZA 4EP1A 2BFCB 4ZI2A 4CTMA 3EVBA 5FOUA 5F7OA 1UWVA 3BB1A 1HG1A 4C7VA 2XA1A 3CNBA 1SBTA 2BI8A 4JSRA 1U0OC 3QBVA 5LQRA 2J08A 4JOCA 1UJ4A 3FMFA 2HK9A 1GKIA 1KZYC 1NIJA 2VPYA 3JX9A 1XYGA 4N0QA 4WY8A 5ALWA 4DLLA 2NUTB 4CLRA 4W9NC 1RWNA 4DV5C 1OTYA 1YOBA 4UAUA 2ZR0A 4PY2A 2IW1A 5BYJA 4TQGA 1CY8A 1WUTA 2R6GA 2PUDA 4WTOA 4WT7A 3NOXA 2AYXA 2ICAA 1P1IA 4JNKA 4Q93A 3TI7A 1T5IA 3FFWA 1F0NA 4WFIA 3EQ2A 3INYA 3EX7C 1NP6A 3JYPA 4RK7A 3VNUA 4PN7A 1GTRA 2DTDA 2PO7A 1HI9A 3OMXA 2OWEA 1QYIA 2GSDA 1VL5A 2YV2A 2G06A 5FFFA 5TQVA 1ST2A 1MZPA 3KUDA 3K0CA 1YCFA 3I8XA 4WZBE 1Y6JA 1R8YA 1V45E 3OUTA 3WKCA 4TV8F 3ICQB 2VJLA 1R1DA 2ZUDA 2QE7D 2JIPA 2RHWA 4WZBB 1J22A 1N77A 4WVFA 1T3HA 3CEMA 4NL4H 5I9NA 2EW1A 1O5TA 3KJNA 5LZ7A 3U40A 4Y9SA 4WACA 4AXXA 1U80A 1R5JA 4ZMSA 1KK1A 4Q4DA 5KDDA 3WK4A 3FYUB 4L6IA 1RRMA 2YX1A 3UMSA 4P38A 2JEYA 3ZV4A 1H2FA 2NYUA 1RLMA 4MRVA 4YRQA 5HFJA 5AKLA 4UPEA 1R37A 5A62A 2R5NA 5A2GA 4BNFA 5DXJA 1K8QA 3O1IC 3QZUA 3USCS 2WUVA 1QOQB 3ZE7A 1ONNA 4Q7KA 1T9HA 4MRSA 4XFJA 5JAQA 2P4QA 4LUCA 2XE6A 3NTRA 1I4LD 2DQYA 1NQUA 5J4KA 1XWWA 2PT5A 2ZTHA 2X5NA 2H4WA 4AKIA 1JB1A 1AXRA 5D87A 1X7XA 2FPXA 2G0AA 2RGNA 2REQA 4FDMA 4RKWA 4QDJA 5AR1A 3VDMA 2FFAA 5CLHA 3VHRA 3LG2A 3QF4B 1F06A 3C3PA 2PO5A 3B5EA 3H04A 3R6LA 2W42A 1QHFA 3VPXA 1G0NA 1FVHA 1EDBA 3SR4A 3KB1A 3ESRA 3VTFA 5IS2A 1IXRC 4S24A 4IFIA 4N47A 5EKUA 3H8VA 3VSCA 4B43A 5KQPA 2GEKA 1EFHA 4J2OA 1UBHS 1HTTA 1VA4A 2VHZA 1Q74A 4KE8A 4Q00A 4AKSA 3PL1A 3DBHA 1V16A 4PLHA 1QBKC 5ADZA 1X80A 4WXEA 2CDNA 4L0CA 2ODWA 3CE6A 4DQLA 3FPEA 1HNZB 1G8PA 3S8MA 2FEOA 1ZDMA 3H9GA 3MJVA 4FLFA 2XA9A 2JI4A 2A67A 1OBHA 2HK8A 2P6MA 3G2MA 3PXEA 4KDEA 4N41A 2AE1A 4FHDA 1C3VA 1VKJA 1W5AA 1JKJB 3KOXA 3QW4B 4R2LA 3RUFA 4PWYA 5ESWA 4KQMA 3W8EA 5IT9D 4MUJA 1LX6A 4M9CA 4U7TB 4D41A 2ZS8A 4DTIA 3TFOA 5REQB 3NCTA 2JD2A 3VHXA 2BEVB 4OX9B 3X1JA 1UBGA 3VO1A 3RIEA 5KWSA 1FFHA 3OLCX 3LU1A 4RKYA 4C87A 1MJ5A 3LP5A 4HMQA 1GPDG 3VYVA 3KZNA 4ADSG 1A5BB 4CWAA 2FN7A 3R3WA 4XGRA 3FJ1A 2OENG 2VHEA 2ILVA 1F6BA 2ZP1A 2ZYTX 3LT1A 1JAYA 5AI6A 4F91B 2F9FA 3CIFA 2Q3DA 1HQYE 5AXDA 4B9AA 2FNAA 1NVTA 4C0LA 2LNDA 3G1UA 1AV7A 2PCJA 1XPRA 4MKIA 3MJTA 1SKMA 1OLSA 3IBFA 4NZOA 5K0GA 1XZNA 1JEOA 2IBMA 2OLKA 3AWIA 4GPZA 4IILA 1SOVA 4R0NA 3B1ZA 5EJGA 5JRDS 3QE3A 1QGED 5CH3A 2BHNA 1FVOA 2VJBA 5EMKA 2IYAA 3L6BA 2JGFA 4L3WA 1YQDA 3ZBUA 5JAOA 3AVUA 4WNAB 4U0JA 4KXXA 4Q9IA 4MWCA 5A19A 3CISA 1ZJ4A 2C9OA 3ERCA 5AI4A 2TS1A 1Y6FA 4LDQA 4ARVA 1UPAA 3DH0A 2JIMA 2NSLA 3IUYA 2NV2B 2IYTA 2UDPA 3ETGA 4HX5A 3QYFA 1JA1A 1T24A 3B3AA 4OP3A 4GKJC 1RZUA 1A7AA 2YFQA 1Z4PX 1YS4A 2OHXA 5ILQA 5AMXA 5A3RA 3ITNA 3HN6A 4FMDF 1UKKA 1WPQA 1ZRMA 2LUOA 1SCIA 4IJ6A 2ODNA 3I0NA 4GZLA 4JBHA 1SU8A 1ZIOA 1PGPA 1S4MA 1QUFA 4RD4A 2NO7A 4M55A 2OPLA 3GV0A 1P3Y1 4B47A 3VU0A 2HR1A 4UM8B 4GOXA 2QAJA 3TOCA 2YRXA 1AA9A 2OSBA 1D0SA 5IDQA 1BKSB 1VIYA 4OMFG 4MRPA 3QPUA 2BEKA 1NHGA 1UWLA 4J90A 1HDXA 3H3JA 3TZBA 4NP6A 2PA0A 4Q4JB 4Z9BA 4UCQA 4ZLPA 1VRCA 1YRYE 2G25A 1W4LA 4ZEOA 1NA5A 2V74B 3Q6IA 2ENUA 4NYIR 4YCJA 4MQLA 2DFDA 2PR2A 1XT6A 3MRXA 3IBSA 3PICA 4L57A 3T3HA 4DIFA 1JEYB 3MQ4A 5I7FA 2Q1WA 2GFIA 1IPFA 3RYIB 1M8GA 1C9NA 4RH0A 4L76A 5E7MA 3WYBA 2OAP1 4ENPA 1P0CA 3JYOA 2XCLA 1UBKS 4R1NA 4IIEA 3SD7A 2XTAA 4WV3A 5AKYA 4CEIA 2QIPA 3CUWA 1P1HA 3CXRA 4HB0A 3U9TA 3D0OA 1HEUA 2P2DA 2ZCUA 2WFLB 2OZEA 2UUBC 4PLTA 3RROA 4ZVLA 2IOYA 3KJIA 3GUUA 4ZO8A 3IQIX 4E15A 2D1YA 2I71A 2CVOA 4KR2A 3TQTA 2QAGC 3NRBA 5ADUS 4K9KA 1H94A 3WRXC 5F23A 1J6UA 1IZ8A 4J03A 3EXG1 5T6BA 4DLNA 2ZZNA 3REQB 4DA0A 3IVXA 3FSGA 3LC0A 2PRJA 2OD2A 1HUQA 2I65A 3ZI4A 3KAQA 3ETNA 3FSRA 4I1RA 4BNLA 4V02A 1ONOA 4I5GA 4XASA 3UZ0A 4MGEA 1DX9A 3EBOA 4MVXA 4H1UA 2ZXEA 5A7GA 4N7RA 5C1DA 2XUQA 5MDHA 2O54A 1X1DA 1A2OA 3IEKA 2IZ0A 2HC9A 1TJNA 3FUTA 3KHSA 3KU4A 3NBMA 3PNMA 2RB4A 2PXHA 4KWIA 2XYRA 3HKDA 5ALVA 4K9LA 1P9RA 5CIWA 4IEIA 2O5VA 1R74A 1VHJA 3EAFA 2B82A 1U7TA 1XNJA 3HN7A 1FXUA 1NJFA 1USPB 2IS2A 4RPLA 2IYNA 5E1OA 2AV6A 2XE7A 4X9XA 1ABBA 3EJ6A 5J5AA 5FHRA 5C80A 5EGSA 1I0ZA 3IFSA 3PQ4A 4N5IX 4EFKA 1CR4A 2NZJA 4CMAA 4QC2A 1O4VA 4M7PA 1EK0A 4NBSA 3B9RA 2JIDA 3DFKA 5CTJA 4F3YA 4GVLA 5IU6A 3GD7A 4XJSA 1ZNZA 2QROA 4WWHA 2ZKIA 3E23A 3NHSA 3HVJA 3ZCUA 1NI4A 1YRHA 3D59A 3H9JA 1PR2A 3L1IA 2AHRA 3VKVA 4I8IA 3SZUA 3R8XA 1TCCA 2JK1A 3KSDO 1JR6A 4XWTA 4M88A 2ISQA 2MINB 4DPMA 5LP6F 5KYYA 2V6FA 1GAXA 3RVBA 4R2IA 3P9SA 4JLBA 1LPNA 2VF4X 3OP4A 1TKAA 2Q3FA 4YXWA 1J23A 2AFIA 4DT1A 3E2MA 2FWPA 3GUYA 3EZ6A 3OEHD 1D4OA 1VE9A 3FR7A 3W2GA 4Y1FA 2WTXA 2BMAA 3JSAA 2ZIAA 5AICA 4QT4A 4IDHA 4KSYA 5KOJA 5LYJB 2IUEA 2EXXA 3PSHA 2C07A 1SIWA 3T94A 1FBTA 3ZVLA 1BEEA 1A8SA 1XTIA 4X8MA 1AB5A 1SCUB 5FA6A 2ZDGA 3G2JA 4LOLA 1E5TA 2HTEA 4DIBA 2QTMA 2V6BA 3TSAA 5CT9A 1AM4D 3QHPA 1T2AA 1ETHA 1TA4A 5E38A 4CM4A 1QMPA 1BSVA 1SURA 2UYGA 4KODA 4PZCA 1WY5A 4G4SP 3WMEA 3R5HA 2QEQA 2CZQA 2GZ1A 3MS4A 4JQOA 2NU8B 4G0WA 4YBRA 3AR4A 4OO3A 1PZHA 5FPQA 4PRZA 4BIMA 4LF9C 1PTJA 4OB8A 4DV3B 2RGGA 3OEED 3P19A 5IW8A 3V4SA 2GN9A 2BI7A 1JIVA 2D4AA 4Q1CA 3IAM6 5G4KB 5BSEA 5JCPA 3D6TB 3L1UA 2SBTA 1YS9A 3L7CA 1MNAA 5TEWA 3OKFA 4RIEA 2G1AA 3O0TA 4MYDA 2GLUA 1C4OA 3VV2A 4DAOA 4KYIB 1VC2A 1JJBA 1ESDA 2P9TA 2YHSA 3EFHA 4KXLA 4Y9TA 4L51A 1BWQA 1KC3A 5AQEA 5AD1A 5A9TA 3HB7A 4DGSA 2ZYAA 1XZIA 2H0RA 3FNIA 4JUDX 4QOSA 3DMNA 5K8UA 1MEJA 4GPD1 4ZT6A 3KE8A 4QJIA 1O95C 1N34C 1TUIA 2WAYA 5L8VA 1UKCA 4OA8A 4P54A 4PVDA 4YC7A 1NZDA 1NMEA 4HUQA 2JCSA 2HD4A 3TLZA 3ZHSA 4BVFA 5K4GA 5TGDA 4MGKR 4DV7C 1EBBA 1PZGA 3I5AA 2EQAA 3Q0IA 4QEZA 2G1KA 4OBWA 2YJ5A 4W9RA 4YQZA 1MO6A 3SYMA 1B6SA 4G4JA 1EK5A 3C87A 5UKDA 3ZZNA 5ITZA 1LF5A 3BTUA 2QUKA 1V4VA 3DT6A 3HABA 1E1YA 4K46A 4MEAA 3GAFA 5JLAA 5EIFA 4D97A 4XTCS 3A6FA 3H4MA 4RVSA 4U2DA 4ARCA 1S8NA 3NBFA 3QX8A 4YLEA 2PZLA 3AHJA 2NO9A 3U7RA 1O77A 1B0UA 1NF2A 2QHXA 2X4LA 3D3WA 4MJ7A 1F14A 4Z1MD 3QY9A 1OZHA 4QXPA 2VXBA 2B8JA 1RYEA 4DS3A 4QG3A 2DVMA 3M33A 3E0QA 5IJ0B 3C3CA 1O0CA 3AM1A 5GADl 3GQBB 2FB9A 2IV3A 1L1EA 4DR1B 3K9LA 3GOHA 2JGNA 4ZI7B 4TUYA 2QMHA 3RSCA 3GMTA 4CM6A 1F7UA 1U3CA 4G2NA 4L6CA 4QULA 2XGJA 2GYYA 1ENYA 2GAAA 2ZTUA 1T2EA 3VYSB 1N78A 1WMAA 1ZY2A 4N0PA 1Q1BA 2FAXA 1Z4MA 5BV1A 4QEDA 3UMJA 9GPBA 2OHIA 4TL7A 1SHKA 5TXGA 2R6JA 1OFVA 4QNMA 4QYSA 1JGTA 4DC1A 4ER0A 4YP6A 1M8FA 3M5CA 2P2JA 2Y67A 5AQ1A 1E8DA 3M6XA 1BE1A 1PL8A 2PBLA 1M2VA 3TRJA 3EVEA 1UC5B 3U7JA 1UBEA 5ALDA 2HYDA 2RHTA 4AROA 5D3QA 3ZXIA 2YQ4A 1IN4A 3JQGA 4BYGA 4FZRA 2OK8A 1JAZA 1XWIA 5LWQA 1D5CA 2L17A 2QD3A 1X7DA 4Q7EA 1G17A 4CF4A 4KNVA 2WQZA 1CG6A 3B53X 3IOYA 2V7EA 4AN4A 4GR5A 3WMXA 2OKGA 3TPCA 4BO6A 5C8XA 5KWEA 1WZ2A 4XZ3A 2AN3A 4LF6B 1H4TA 1JAXA 3TOSA 1Y33E 3IIJA 2QRPA 4FHEA 1G42A 3QG5A 3DPUA 3U7QB 2Z8XA 4CN9A 5ABPA 2FQYA 5A0VA 4JQYA 2AD1A 3TDEA 1ZQ9A 4WHMA 4BBPA 2C7BA 3KZCA 2PR7A 2ZAMA 1QP0A 4ZT5A 1XNQC 3H7IA 4IOKA 1XDBA 2A57A 4TMFA 4X54A 1AO3A 3EZ7A 3SHQA 4AKEA 4LZOA 4GICA 4XVRA 2W6IA 4A23A 2A3NA 3ND5A 2FWJA 3KHKA 3UT0A 4DGQA 2C5FA 2AF3C 2AOTA 4MWGA 4ZCSA 2P8SA 1R0YA 3RVJA 3IP7A 3PCXA 4CM9A 1B6GA 3IOEA 3IT3A 4WCFB 4DQVA 4BJHB 3CMCO 3PHCA 3QMMA 3IHWA 3HCRA 1XZ8A 3VV3A 1KAHA 1LJ8A 3VU9A 5U1PA 1VJ0A 3QKRB 4QQKA 1G9TA 3A3KA 3S2IA 1PJTA 1V5WA 2TYSB 5BNWA 3EK2A 5CA1F 2DBQA 2J4FA 5KC8A 1Q21A 4LJ5A 3FRJA 1WQ1R 1H2ZA 3K8OE 4LZAA 4AZWA 1AF4A 1JMVA 3I2KA 5SZKB 1J49A 3MTDA 3SJZA 2IYEA 3B6IA 3M34A 3GLIE 1HH2P 3T5GA 4KJXA 1DAMA 2P65A 3BUSA 2I3DA 5ALKA 2YN0A 3NEAA 4QWWA 5E4TA 3TECE 2NXWA 2DJ5A 1G21A 3GLIB 1KRHA 2ZFUA 1QHHA 1Y8QB 2Y76A 2XGSA 1NIPA 1ODSA 4KW7A 5IYZF 3VJLA 1Y4DE 3WBJA 1YVDA 4A7PA 4PEVA 2HXSA 4Y0AA 3UPDA 3LM8A 4H6VA 4F97A 2CVHA 3R40A 2CJYA 3ZHUA 4OXIA 4RFLA 2ZTVA 4X66C 3NVMB 4CFZA 2ZDHA 1KDRA 2ZKLA 3GJ3A 4YLGA 4DR6C 4FGWA 4TTVA 5CYGA 2ERYA 2ZVPX 1VEHA 1OZFA 1I51A 3C24A 4JCCA 4DLYA 3M4NA 1JVSA 3PGMA 3VR5D 4BRUA 4DIOA 1YJ8A 1J5EC 3FIUA 1DADA 4KQXA 1V6AA 3ROXA 4DOMA 4BFCA 2F90A 2WJGA 4M0MA 5FPPA 1IWOA 5E7QA 3AY3A 2AI2A 5DOZA 5JVDF 2YHIB 2QVYX 4EL0A 3I9OA 5IAAA 2Z5FA 3RV4A 4OFBA 1IM2A 4GM4A 3RANA 4KX5A 1Z82A 1SXGA 4OYRA 4TV8A 4UTOA 4WNCA 2GDZA 3C7AA 3NHAA 1VLZA 4IDPA 1YRQA 5FUBA 1OAKA 3QIAA 2WABA 7MDHA 2X0EA 2CLMB 3QVMA 4WW0A 4Z0TA 4C5BA 4FJ1A 4G1EB 3K0EA 2I6XA 2NAPA 1LTQA 3E27A 4DNOA 3BRQA 1C7ZA 1FDVA 1LZLA 4P22A 4EW6A 1JX6A 4Q9AA 3Q8WA 2NGRA 3I05A 1XC7A 4RPHA 1N5DA 2BJVA 2VPIA 2XJ9A 1FPMA 1RPZA 3GA0A 4EJ2A 4ZO9A 3ZD9A 1GU1A 1M1NB 5THQA 1KOGA 2RBKA 4ZOEA 3KLPX 1TPYA 4GXTA 4KMSA 1OF1A 2SKDA 1DWOA 1F9EA 1GAJA 4J0JA 4YAJA 5LIRA 2JKVA 2YASA 3R5SA 4JLVA 3CE9A 3W5DA 4CQNA 1E4YA 1QDUA 1SIBE 3LXMA 4REQA 4U5XA 2XQJA 3OZRA 5EWJB 1UQUA 3WHLA 4V0QA 1UBLS 3ZD7A 4BXOB 1VCNA 3LT5A 1QP4A 2B35A 3WLQA 1JEJA 1C3JA 2PRYA 2XNHA 3MAAC 4B3SB 3U5TA 3UX2A 2M5HA 1AK1A 1X15A 3D1VA 4I5IA 3WHKA 4CF6A 3TXAA 4B0PA 4E33A 5AXCA 1I6MA 3NNDA 5JG7A 1Q7EA 3DUFB 2Q4OA 1ESCA 1LS1A 3AKYA 4UHKA 1RNLA 1A0OA 1Y7HA 1PL0A 3MT9A 5DASA 4OOFA 4XYBA 1RAGA 2I3AA 1THMA 4ZI3A 1MXAA 4ND5A 3P1JA 4YAKA 4ZZ0A 3V4RA 1JNXX 4OBEA 3TLBA 1QDLB 3ZWDA 4K0KB 1DT5A 4JYAB 2WFAA 1F2VA 3CJTA 2YVUA 3KOZA 5CURA 4NYMQ 2HSGA 4Y6SA 3W6UA 3U7IA 5B3JC 3WFJA 3ZD6A 4UNQA 2PD6A 4RM3A