4FV2A

Crystal structure of the erk2 complexed with ek5
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
347
structure length
344
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ERK2 complexed with EK5
rcsb
molecule keywords Mitogen-activated protein kinase 1
molecule tags Transferase
source organism Homo sapiens
total genus 108
structure length 344
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv2A01
3Q9YA 4FT7A 3MWUA 3UC4A 5DPVA 3QCSA 1JAMA 1XHAA 4EOLA 4E6QA 1KE6A 4D4VA 4XH6A 2EB3A 3CGOA 4GK4A 3GC9A 4PMPA 1YOMA 4YTHA 2YCFA 4BBMA 2GHMA 1JBPE 3Q96A 3CCNA 5IUIA 4AFJA 4D28A 2CLQA 2YAKA 4FV1A 3LW0A 3WARA 4MQ2A 5F94A 2CNQA 5E8ZA 3U51A 2W17A 1YOLA 5K0KA 4FEWA 4JX3A 1KV2A 4HNIA 5LMAA 4ZZOA 2W0JA 4HYIA 3RPYA 4RX7A 4MK0A 3P4KA 3VS4A 4AZTA 4PF4A 4CRSA 4F0FA 2PVLA 2Y6OA 4TPTA 3R6XA 4F0GA 4BR3A 4CD0A 2VWVA 5KMIA 2XEZA 2R0UA 2OIQA 3ZC6A 5GJGA 5JGAA 1X8BA 4IE9A 3O7LB 1W83A 2G1TA 4CFWA 3ZFXA 2PMOX 2QURA 2CMWA 5CSPA 5ETIA 1H00A 5DT0A 3ZO1A 5HQ0A 5HG8A 4FIHA 3E3PA 3M1SA 3IDPA 4IHPA 2XK9A 4GCJA 4XRJA 4RLLA 5HE2A 5CEIA 3VS6A 2HZ4A 2XK8A 5M4IA 3F3VA 4PL5A 4TT7A 4GJ2A 2XMYA 3POZA 3TUBA 2C3LA 4P90A 5HIEA 3LFNA 3BU3A 4Q5EA 4L67A 3BV2A 2NRYA 4LOQA 3SKCA 1Y91A 3FLZA 5CU0A 2ZDTA 1OBGA 4QYGA 4G1WA 2Z60A 3NWWA 3UQCA 1H26A 3QRJA 2KULA 4CFXA 3VN9A 4E6AA 3VVHA 3BGQA 4M14A 3R28A 4O0XA 1OB3A 4FSZA 2WFYA 4U0IA 2W1ZA 4XG3A 3RPOA 4GKIA 4MXXA 3FAAA 3UP7A 2RL5A 4BWPA 3R1SA 3W8QA 3PSBA 4PNKA 5H8BA 4NM0A 2F9GA 2OZAA 3TZ9A 5HBEA 2BAJA 2WMUA 4FYNA 5K9IA 4HVIA 3FMLA 3DTCA 4QMVA 4K8AA 4AWIA 1LPUA 4ZSAA 2IZSA 2UW0A 3A8WA 3FMKA 3MYGA 3QD2B 4YJSA 2JGZA 3SRVA 3TV6A 3DB8A 1UU9A 3PDTA 5EDRA 3ZM9A 3FHIA 3MS9A 4ANQA 3OC1A 4E7WA 3LAUA 4FKGA 4IWDA 5AP3A 4WG5A 2BFYA 4D55A 2ACXA 2PVHA 4YJQA 4CNHA 2J5FA 3Q9WA 4ZLOA 3PJ8A 1PF8A 4LYNA 3GOPA 4IM0A 4XG6A 3PVWA 3ENMA 4E5WA 5C1QB 1KUTA 2FSOX 3P86A 4S33A 4CVAA 3G6HA 2H6DA 2ZV2A 3DQWA 5IZFA 1O6KA 1OPKA 4HOKA 4FNXA 5EK7A 4A9RA 3M2WA 4R7HA 1Q5KA 2W9FB 3HV5A 5IUHA 5L8LA 5M09A 3EQDA 3JS2A 5HO8A 2GU8A 1QPJA 1S9JA 3HVCA 3DKOA 4WKQA 3AT2A 3FC1X 3FKOA 4ZTSA 4BDDA 4PTCA 2J0LA 3F7WA 4R5SA 5JZJA 5F4NA 2CCIA 5AM7A 2R2PA 3FZSA 1ZMUA 3OCTA 4YUQA 5KZIA 2ZV7A 5IA5A 2OJJA 4MKCA 3PVGA 3LXLA 4X2JA 3R7VA 2PVJA 4AOIA 3HKOA 4IWOA 3TZMA 5DOSA 4RIWA 4DFBA 3BV3A 1OIRA 4R7IA 4UEUA 5LVMA 3LZBA 3R00A 4JLCA 5AP0A 4N70A 3LQ5A 4F9CA 3HDNA 2I0EA 3ERKA 4JRNA 4YPDA 2YERA 4IX4A 5FD2A 2R3GA 5M06A 1J91A 3TKHA 3KRLA 1FMOE 2I1MA 2XYUA 3TCPA 4ZY6A 4ZEGA 2ITOA 4V01A 2X1NA 3RHXA 4EOQA 5HHWA 2RGPA 4R1VA 3VF9A 4QYHA 3ZSHA 1BKXA 2ITUA 3U4WA 1J7LA 4MD8E 3RAKA 3MSSA 4AT3A 3UGCA 2ERKA 5DEWA 2QOOA 3UQFA 4MXAA 3V5PA 1PXKA 5AA9A 5K5NA 4BIDA 2J7TA 2J9MA 4JOAA 4WG4A 3F82A 5LCKA 5I9WA 3ODZX 3KVXA 3UO4A 3W2SA 4A4XA 4CYIA 4DG3E 4E5AX 5L3AA 4E4LA 5JRQA 1SM2A 4FICA 3AG9A 4IX6A 4X21A 4YMJA 4A7CA 4WNPA 4XP3A 5E91A 2X4ZA 3WF8A 1JQHA 3LOKA 3RAHA 2G2HA 4FGRA 5AJQA 4O84A 4NCTC 4BFMA 4RVMA 4EOPA 4UYNA 5CXHA 4DF3A 1M14A 3C4FA 3IG7A 2G01A 4XCUA 3W2OA 4FTOA 3AMAA 4G34A 3P7AA 5HCXA 4D4SA 1FOTA 4EWQA 2ZV9A 3TXOA 2P0CA 4X3FA 3RM7A 2PY3A 4QMUA 5TKDA 4JAJA 4V05A 3R7OA 5A4EA 3CXWA 5J7HA 4KRCA 4IAZA 3BLHA 3OW3A 3ZO3A 3CD8A 4ZTHA 3FMNA 3P9JA 2E9UA 3WF9A 1Y6AA 4XLVA 4A07A 2QHMA 3TJDA 3R71A 3I60A 3QALE 2W7XA 2ZM4A 3C0HA 2VO3A 5EHYA 1ZMWA 2WO6A 3CEKA 3QC9A 4C8BA 4PDYA 4RWIA 5KE0A 2QU5A 2R3JA 5LCJA 4O7WA 3QHRA 3BZ3A 2J6MA 3HV6A 4YNOA 2Y7JA 2C3JA 4J1RA 5CZIA 1ZOEA 3IOKA 4I0SA 4ZTNA 4D58A 5CAPA 1DI9A 4KSPA 4EHZA 1JKTA 3MH1A 2PE0A 4FV9A 1CSNA 3DU8A 1OGUA 2PZRA 3JUHA 3MGYA 2FGIA 3GC0A 3G33A 5K0XA 3ALNA 5C26A 4EQCA 4AP7A 3SQQA 2E9NA 4QMWA 3GCSA 4B8MA 2ZB1A 5EI6A 3N4TA 4JRVA 1OKVA 2OGVA 2OO8X 2PUNA 4ZMEA 2WQEA 3V8WA 2CKQA 1M7QA 4FC0A 2ZB0A 4JX7A 4RPVA 2O63A 3UYSA 3VUMA 5KX8A 3MPMA 5EOLA 2XNOA 3PPJA 3OCSA 4GVAA 4TY1A 3HAVA 4O83A 3UZRA 3UNKA 5FWKK 4QTBA 3GEQA 5G1XA 4FKPA 4FIFA 2YJSA 3D94A 2X8IA 3SW4A 3UC3A 1ZXEA 3R22A 2C3IB 3F69A 2JDSA 4G2FA 2XBJA 3OOGA 4D9TA 2R0IA 2IWIA 2W1CA 4WSQA 4X6RA 4C34A 4CCBA 4EH4A 2A1AB 4EOOA 4R7BA 4BBFA 4AW2A 3VRYA 2R3OA 5CSXA 3VBXA 4D2WA 5BNJA 1A48A 2QO7A 3RJCA 5TO8A 4QTCA 4C36A 2UVYA 2OF4A 4IZYA 4KABA 4KKEA 5HLPA 3R8LA 3VQUA 4EYMA 4I5PA 1QCFA 3NRMA 3QYWA 3R0TA 2BRNA 3RP9A 4ASZA 3V8TA 5M08A 1LR4A 3LXNA 3DXPA 4BICA 1BYGA 1OPJA 4A4LA 1Q3DA 4I0TA 5HIBA 2XNEA 3W18A 3HP2A 2A0CX 2CKOA 4J7BA 4YO6A 5KBQA 2IN6A 1VEBA 2G2IA 4GFGA 3NW7A 1KE8A 4L45A 3UPXA 4B4LA 3U55A 5GINE 2ITXA 5E8YA 4FX3A 1V0BA 2QR8A 4YJTA 3E8DA 3R04A 3C51A 2OJ9A 1GAGA 3Q5ZA 4CSVA 5IDPA 4I92A 5KMNA 4OUCA 3QUDA 3BHTA 4XV1A 2ONLC 3RPVA 3KXGA 5DNRA 5EW8A 3CJFA 4UWBA 3I1AA 4F08A 4WO5A 4WRGA 1XH6A 3PPKA 4JBQA 4BCOA 3NYVA 4C3RA 3O8UA 4WNKA 4NZWB 4UMRA 2EVAA 5I3RA 4QMXA 1Q8YA 4XG7A 2PUIA 4FKSA 3V5JA 3BU5A 4EZ3A 5LWMA 5DR6A 4WRSA 2VTMA 4WG3A 1IAJA 4ACGA 3ZBXA 3IW7A 3QF9A 4RIYB 2UW5A 3FKNA 4M3QA 3F2NA 3W2CA 3QTXA 4NL0A 3BYUA 4Y46A 2O3PA 1E1XA 3G90X 1UU7A 3HNGA 5CAVA 4AU8A 4F7SA 1U59A 3PE2A 2CKPA 1U5QA 1E9HA 1J1CA 3LVPA 3MPTA 4FTJA 4NEUA 4IB1A 3EQRA 3MY5A 4QO9A 4Z3VA 4GK3A 2QVSE 5AP4A 3C4XA 5D1JA 5A4TA 3KQ7A 5I9ZA 3ZSIA 1J7UA 1GIHA 4X3JA 1AQ1A 3G9LX 1NVSA 3EZRA 4OR5A 4IX3A 4KIKB 3TNIA 4EK3A 4EONA 5C8NA 4YP8A 4GSBA 3F3WA 3Q5IA 3S00A 4WBOA 4TNDA 3UYTA 4NT4A 2UZVA 5CEQA 4IC7A 5DGZA 5KO1A 5M4FA 4ZJJA 3F5UA 3C4ZA 2YWVA 2F2CB 2IVSA 4F7LA 2YLEA 3QLGA 1F5QA 2GS2A 2YM3A 3TI1A 4YZMA 3UNZA 3W1FA 3Q4CA 3ZBFA 4O22A 4F9AA 3TT0A 3NW6A 3UBDA 1OBDA 2QLUA 3JXWA 2FH9A 3KA0A 4L53A 2FSMX 5HU3A 1MP8A 4U97A 1KOAA 3BQCA 3LJ0A 3BYVA 1YXUA 4CFNA 1OL2A 2YCRA 3VRZA 5CWZA 4YO4A 4NM3A 3SG8A 4N6ZA 3QTWA 3ZOSA 3O8PA 3TIZA 2I6LA 4DITA 2J0IA 3PPZA 5JT2A 4ALVA 2J2IB 1B6CB 4FKLA 1QL6A 1OZ1A 4OTDA 5CASA 2VTSA 5EQYA 1WVWA 5HBHA 2YDIA 4NCTA 3VAPA 1XBAA 1UNLA 3QYZA 5E8SA 2XBAA 5LMBA 4FKQA 3FEGA 4AW5A 4TWPA 3LFSA 5HG7A 1OVEA 1ZWSA 4FVRA 4AX8A 3FKLA 3FZPA 2VTNA 1NA7A 4NIFA 3D7ZA 2C6OA 4L7FA 5CZHA 2QOCA 3LFAA 4FKRA 4U44A 3RK5A 4HZSA 3DJ5A 3PJCA 3H9OA 4D0XA 3DB6A 2QI8A 5AX9A 2C6TA 2XP2A 5ACBC 4BCFA 4UBAA 5FP5A 2WXVA 3HP5A 3V5WA 3B8QA 1H0WA 2YAAA 2Z7QA 3HYHA 2VTOA 1ERKA 2FB8A 2YEXA 4BCKA 1Q8UA 4Y85A 4BDBA 4EH3A 5A6NA 3DQXA 3H0YA 3BWFA 4APPA 4KIKA 5DH3A 3SX9A 2Q0BA 4JBOA 3AQVA 4QQ5A 4F7NA 3FQHA 4JG8A 4L42A 3DBEA 5CLPA 3EH9A 3V3VA 4D5KA 4D2SA 5ETAA 4RFMA 4O1OA 2X6EA 3DK7A 5EYMA 2RKUA 1WBPA 1FQ1B 1T45A 4UMTA 3G6GA 2IVTA 3KMUA 2JLDA 3RBWA 4PP7A 4LG4A 4X2GA 4DH5A 5ICPA 3FE3A 5J9ZA 4IZ7A 3UMWA 3NYNA 3A7GA 4F09A 1Q24A 3LXKA 4QQJA 4YHFA 2R3IA 3QQUA 4LRJA 5EQPA 5CVGA 2JD5A 2B54A 5FXRA 1P14A 5EHOA 2HELA 3NUAA 4MTAA 4AT5A 3E93A 5HNIX 3N4VA 4I5MA 3IGGA 2VNWA 4TWOA 3BX5A 4F70A 2B9HA 3QRTA 4X6QC 2QOHA 2BAQA 5AUVA 3U4UA 4EH2A 1BL6A 2WMAA 5D41A 4EZ5A 4AUAA 2CGWA 2P3GX 3LFDA 4IMYA 5GIPE 5H9BA 4E73A 2C0OA 2E2BA 5M07A 2UVXA 2V22A 2YM6A 2I0YA 3LLTA 3B2WA 3V6RA 3AD6A 3LXPA 1LP4A 3R9NA 4ANBA 1Q8TA 4LFIA 3LM5A 4CFMA 4BDCA 3GU8A 3EQPA 3CQWA 2OLCA 1ATPE 2CN8A 1W82A 3C7QA 5DWRA 2C6IA 3JY9A 5BYZA 4TXCA 4LGHA 2ZVAA 4ORKA 3QD3A 1PXLA 3Q9XA 2PVFA 4YBKA 4MXOA 4RC3A 4BB4A 2ITZA 4HVSA 3D14A 4QMMA 2REIA 2VU3A 4XRLA 4DLJA 1DI8A 3C4WA 4FE2A 4R78A 4L46A 4KBAA 5BMSA 3F6XA 3O2MA 3ORLA 1YI4A 2BRBA 3CSVA 3KULB 4RJ5A 3DXNA 3F3TA 5HE0A 5AM6A 1SVEA 5AAFA 4K77A 3VJOA 3ZRMA 4C57A 3BLRA 3EYGA 3ROCA 5CU3A 4EH5A 2PMIA 2BIKB 5CAOA 4I21A 3ALOA 3I6WA 2QCSA 2YM8A 2CCHA 3LJ2A 3DBDA 4K6ZA 4PV0A 4W8EA 4X0MA 5CSWA 2JBPA 4GH2A 5CENA 3DS6A 4IZAA 4BGGA 1Z57A 2BTSA 2VTTA 2X4FA 4EHEA 3PWDA 3T3UA 1BL7A 2GNLA 4JR7A 3AD5A 3W8LA 4MEDA 1L3RE 4HGEA 3NZ0A 3ZUVA 3OS3A 5C8KA 4L43A 2Y6MA 2ONLA 2XZSA 4NW5A 4LRMA 4ZJIA 3QTZA 5DN3A 3KXNA 2G9XA 1WAKA 3LPBA 4HNFA 4DFXE 2PUPA 4M69B 2HYYA 3AC1A 3I7BA 2XKEA 2NP8A 3BI6A 2DYLA 4TZRA 2PPQA 4U7ZA 2XH5A 2ITNA 1Y6BA 2HWOA 4RBLA 3VHEA 3QTUA 1MRUA 4EZ7A 1FVRA 4Z9LA 4OTGA 5AEPA 3R9HA 3NVMB 3VUGA 5LJJA 2OWBA 5C03A 4DAWA 4BDHA 2OJFE 5KMOA 3EN7A 3RNYA 4IAFA 5A14A 4TYEA 3TM0A 5JGBA 4FSYA 2C69A 4XS2A 5TE0A 4CMTA 4NWMA 1Z5MA 4H39A 4QMZA 2EWAA 3V5TA 4I5CA 3D83A 4NJDA 3P7CA 2HY81 4HPTE 3R7YA 3WZJA 2OH0E 5HOAA 3T9IA 2C4GA 1GZNA 4KINA 1VR2A 3UDBA 3KULA 4EH6A 4BTMA 3ZDUA 4IX5A 2PK9A 3OBJA 2LGCA 5ETFA 2YM7A 5C01A 3R8UA 5IQHA 1FINA 2VZ6A 5JFWA 2G2FA 3IK3A 4DG0E 3D7TB 5HEZA 3UE4A 3EQBA 3L1SA 4LV5A 3NAXA 1TKIA 4RFZA 4CKJA 4YSJA 5FDPA 5GZ8A 4F64A 4D2VA 4GFMA 3Q60A 4P5QA 5AP5A 1PMUA 2YABA 2QODA 4KB8A 3QQJA 4KIPA 4L8MA 4LUEA 1OKYA 4FT3A 3AC5A 2OJGA 4UV0A 4OBPA 2P2HA 2JIUA 2PMLX 3BQRA 4F9BA 1B39A 2WGJA 5EW9A 2GS7A 2JFLA 2R5TA 3CBLA 3CTJA 3MFSA 4BDAA 4WT6A 3RCJA 5B7VA 3CR0A 3A61A 1SZMA 5JKGA 1PXNA 3EFKA 4IAYA 4EOMA 5IEVA 3V04A 3C9WA 3MH2A 1GZ8A 1XH8A 4L52A 3GFWA 3W16A 3TTJA 5J9YA 4MVFA 4ZZNA 3PXRA 4RLKA 4PPAA 5C4LA 3RPSA 3PJ3A 4OBOA 5DT3A 4EH8A 2WAJA 3I5NA 1YKRA 3G5DA 1I44A 3ZH8A 3NW5A 2GNIA 4H58A 3U9NA 3TDWA 5LARA 5DBXA 4YR8A 2HY0A 4S31A 1VZOA 4FV5A 4N4SA 4O2ZA 3EFLA 3FZTA 4UALA 3MBLA 4QP8A 5EW3A 3RALA 4B6LA 4CV9A 5EYKA 4BHZA 4DGMA 4ZLYA 4C3PA 4IANA 4M0YA 5HLNA 3MIAA 2LAVA 4G16A 3RMFA 4QPSA 3TIYA 4TYHB 1NXKA 2HCKA 4OW8A 5ANDA 4F1MA 4PNIA 4X2NA 3FLNC 2WMTA 3GT8A 2XVDA 3QQGA 2WKMA 4OTPA 2BPMA 5HVJA 2BDFA 4NFMA 4RA4A 2P4IA 3FYJX 3EQGA 4C4GA 4USEA 1TQMA 4M0ZA 3HMNA 2ERZE 3GENA 4RC4A 2BCJA 2WEVA 2VTRA 4XYFA 2B9IA 1CMKE 2BZIB 2WU7A 3HDMA 3PWYA 5AX3A 5L2WA 3I6UA 3L9NA 3WF7A 2VWIA 2CDZA 3C1XA 3DZQA 4IW0A 4QMLA 2R3FA 3OVVA 1JSVA 2XYNA 2XNNA 4BTKA 4E4NA 2BROA 2OW3A 2UUEA 4Y5QA 4FA2A 1KOBA 3KRXA 5HBJA 3QRUA 2VGOA 1Q62A 3GCPA 3ORTA 1RE8A 4O6LA 1WCCA 2JDTA 4AW0A 2C3KA 4I4EA 4BDEA 2F7XE 4TRLA 4DH7A 2OSCA 2RIOA 5CTPA 2F4JA 2V7AA 4CZYB 3FL4A 3VS1A 2HZ0A 4IIRA 4E6DA 5FEQA 1RDQE 2VO7A 3ORIA 3CY2A 5AUXA 3QZHA 3KU2A 2YZAA 1SVHA 2VTAA 5BQ0A 2W4KA 4O0SA 5JFSA 3LCTA 3NUXA 3OWJA 4WA9A 3RKBA 2PE2A 3WE8A 5CANA 4EJ7A 4EH9A 4C33A 5L6PA 1MUOA 3AC8A 5EQEA 3BRBA 5IQIA 4O6EA 2OI4X 3DK3A 1H1WA 3Q6WA 3T9TA 5EFQA 5I9XA 3TN8A 4Z7GA 3O8TA 4L01A 4Y8DA 2R7IA 2VWXA 1GZKA 4KA3A 1XJDA 5EHLA 3UZPA 4DEGA 3VJNA 2JKOA 3OF0A 4MD9E 3FMHA 5ANEA 4UZHA 3TV4A 5IA3A 3OXZA 4UYAA 4O0WA 5DR9A 4I0RA 5J87A 4XJ0A 5T3QA 3FI4A 3R63A 5IKWA 4L44A 4YTIA 4BTJA 4GG5A 4MXZA 4A9UA 4FF8A 1Q8ZA 1P4FA 3QZIA 3R8PA 3COHA 4IVDA 1FVTA 3BELA 4H1MA 5FTOA 5AADA 3VBTA 1MRVA 3E5AA 5FXQA 4KUJA 3W55A 3COKA 3CQEA 4DCEA 4WUNA 5J1WA 3KB7A 3POOA 4DTKA 4XG2A 4G3GA 2JEDA 4ERKA 1BUHA 4NUSA 3JY0A 3HRBA 5EDQA 3FLQA 3TZ8A 3UOHA 4HGSA 4M66A 3WIGA 4LV8A 2OIBA 2QG7A 2RFDA 2GNHA 1JKSA 4DEBA 3LMHA 4O27B 4Q5HA 1IR3A 3ZU7A 4AA0A 3TUDA 4C37A 4EBVA 2BKKA 1YQJA 1ZY4A 2OKRA 4CEGA 5AV4A 2J0MB 2NRUA 2VX1A 1YHSA 4RJ7A 4RWKA 4NM7A 5HVYA 1SNUA 2IW6A 1TQIA 3S2PA 5FLFA 4GIHA 1UWJA 2VWYA 4NM5A 3WF5A 5HZNA 1HOWA 5HESA 2Y4IB 5M51A 1DAYA 4I6HA 3KL8A 3UIXA 4A9YA 3TACA 1P2AA 4MBIA 3B2TA 3SVVA 1Y8GA 4BCJA 3VW6A 1U54B 3LFFA 4U41A 3CTQA 1FVVA 2RFSA 3CE3A 2B53A 2UW9A 1Y8YA 5AUZA 4YZDA 4D9UA 1V1KA 2P33A 1MQ4A 2WQBA 3U6IA 2WMBA 4M12A 4MAOA 1Q41A 3OW4A 2OXDA 4YJNA 4E26A 2B55A 4Q9SA 2GS6A 4PDOA 2IVVA 3BIZA 3ZTXA 2W05A 4D2TA 3HAMA 3QD0A 2GDOA 3PFQA 1OL6A 4DH3A 2X0GA 3BEAA 2YIQA 2UZEA 1CKPA 2O65A 3R2YA 3SLSA 3ZS5A 1F0QA 2H96A 2BRMA 4E20A 2PL0A 3NAYA 3V6SA 5JGDA 4G3DA 4JG6A 5CS6A 3SOCA 5KMMA 2PZIA 1YXXA 3GC8A 3WZUA 5A9UA 5IQAA 3U87A 5IEXA 3EQIA 5LVNA 4KAOA 4RX8A 5E1SA 4EC9A 3VS3A 4DFNA 2RG6A 1M2PA 3DV3A 4PDSA 4PTGA 1WMKA 5B2LA 1CKIA 3EL7A 3QGYA 5BUJA 1R0EA 1XBCA 3LHJA 3RVGA 4J52A 3FHRA 4QOXA 4BCMA 3ITZA 5I5ZA 4QP3A 3ZRKA 3EZVA 3MH3A 2C0TA 2QHNA 3V5LA 5E8VA 2VTJA 3QXOA 4DFYA 3OTVA 4JG7A 4L7SA 5E4HA 2H8HA 4FEXA 4FG8A 4NTSA 4PRJA 4C4EA 4L00A 5AV0A 3BBWA 4FZDB 1REKA 4XEYA 4FT0A 3ID6C 5BYLA 2F57A 3PVBA 4QP6A 5DE2A 2JKKA 4EOIA 5HX6A 5ACKA 1UV5A 1DM2A 2HXQA 2PWLA 5M55A 4G3CA 5FEDA 2B52A 1IA9A 4G6NA 4U5JA 5A54A 2YFXA 1WBWA 2XS0A 2CGUA 2IW9A 4QQTA 4CKIA 5IMEA 5CU6A 3PE1A 1TQPA 3U9CA 3UVRA 4IFGA 4W4WA 4BWKA 4EBWA 1R39A 3IW6A 3K2LA 3ZLWA 3F88A 4AOTA 3ZMMA 3WZDA 4YZNA 3DLZA 4YU2A 4R3RA 2Z7SA 5CEOA 2B9JA 4ANNA 2WD1A 3G15A 3ATTA 1JWHA 4XMOA 5L2QA 5KNJA 2WQOA 3DZOA 4L3LA 2PU8A 3GU4A 2NO3A 3REPA 3GBZA 5DEYA 4ACDA 3RAWA 5JSMA 4QMPA 5AP7A 3TNHA 4QTAA 4U3ZA 2BDWA 3Q52A 3T8OA 1PYEA 1Q97A 3OUKA 3W2QA 3KMMA 3RGFA 3EFJA 2BFXA 3P23A 5A46A 3PIZA 4Q9ZA 1JKLA 2XUUA 4TYGA 5FM2A 3DOGA 2GSFA 4ZS0A 5HCZA 2RFEA 2VO6A 5GNKA 4N0SA 3QQHA 3EQFA 4CTCA 2C5OA 4JL9A 4Q2AA 2XCKA 3H4JA 1URWA 4R3PA 2C0IA 3NS9A 3FYKX 4FGBA 4MF1A 4P7EA 4IZ5A 4GYIA 4ANLA 4RJ6A 4O0VA 4O2PA 2C5VA 5JQ5A 1I09A 5E8WA 2C68A 1KV1A 4B0GA 2QOKA 4I1ZA 5L6OA 3A7IA 3QTIA 3MB6A 1DS5A 3CLYA 2CSNA 3S3IA 5FXSA 3ZLYA 2XIZA 5AV2A 3NUPA 4FG9A 3GVUA 2WMWA 4NTTA 2VUWA 3ORKA 2ETRA 4ZSEA 4RMZA 4EHVA 3DJ6A 3KY2A 3LFEA 2C6KA 4O7TA 2JIIA 4IACA 4R6VA 3PG3A 4RJ4A 3N4UA 4YJPA 5HLWA 3UVPA 2R3MA 2W1FA 4FTLA 2Z2WA 4GFOA 2PTKA 2X81A 5TR6A 4TN6A 5FEEA 4MCVA 3RNIA 3RWQA 4F7JA 5CEKA 2AC3A 4FK3A 3Q9ZA 2WOUA 1REJA 1OL1A 2OF2A 5CSHA 2Y4PA 3VBWA 4ALUA 1PMNA 3P1AA 4OTFA 2XNMA 2OU7A 4CMUA 2C6DA 1ZOHA 2R3LA 3FV8A 4DGOA 4C4JA 5KHXA 3Q2JA 4X2KA 3ZZEA 2GNGA 3H3CA 5HNBA 5HKMA 4JDIA 4HGTA 5JQ8A 2VV9A 4XUFA 3C5IA 2Y0AA 3EKNA 3PXKA 3GXLA 3G9NA 3GC7A 2B1PA 3DPKA 4QP7A 2WTWA 4JR3A 4K0YA 4EUUA 3HMPA 4YHJA 4Y73A 2OFUA 3R7GA 2VTIA 4DH8A 4ZJVA 4C02A 4IJPA 3G0EA 4AAAA 4DEAA 3FZOA 4YJVA 3VS0A 3UIBA 4BYJA 3JYAA 3ATSA 2A19B 2QKWB 4ZK5A 2X7GA 4I6BA 4RIXB 5T68A 5KMLA 2YIRA 3PY1A 2PZYA 4U42A 5DRBA 4BCHA 2VTPA 1Q4LA 2Z7LA 2OIDA 4IB0A 3WOWA 1K3AA 1Q61A 1KE7A 4DGNA 4RX5A 5BX0A 3OBGA 2SRCA 3MTFA 1R78A 5D10A 4U9AA 2GFSA 3LCSA 3R73A 3VULA 3OT3A 5H8GA 3HUBA 4UXQA 4BWXA 3DFAA 2VO0A 4BIEA 3CIKA 4A4OA 4BGQA 4F9WA 4L3JA 3TG1A 4ZOGA 2BILB 5M56A 1WBTA 2HZIA 5E1EA 4V0GB 1H1SA 5EYCA 4IDTA 4FV0A 1UWHA 4R77A 2A2AA 3KN5A 5A6OA 4BCQA 4BZDA 4RGJA 3PTGA 4IAIA 2WMRA 3IQ7A 2X39A 4I23A 2FYSA 4MH7A 4PX6A 5ANOA 4DC2A 4RJ3A 3NIZA 3QZGA 2GQGA 2X2LA 2XJ0A 3RI1A 3ZYAA 4PL4A 4E6CA 2UZTA 4KWPA 2W9ZB 1FPUA 1UA2A 4DA5A 2ZJWA 3QXPA 1NT2A 3TEIA 3VUHA 3QTSA 4J97A 3JPVA 5IQEA 3KXZA 2WTKB 4O38A 4S32A 1H0VA 2IZTA 4RZWA 3CKWA 3FPMA 4OTQA 5CQWA 4CFVA 3VNTA 3MFTA 4Z55A 4D1SA 4S34A 2R3HA 1YRPA 4LOPA 3C13A 3AGMA 4FEVA 4H36A 3EJ1A 5ANGA 3PLAE 2WTVA 4FKWA 1ZY5A 1YXSA 3BGZA 4JDHA 2IW8A 2WNTA 4FIGA 4LQMA 3WILA 5HG5A 1OITA 4CGAA 3TNPC 3ODYX 1SNXA 3L9PA 5ANKA 3SG9A 3QFVA 4J96A 4IH8A 4JT3A 3DTWA 3FMEA 3PSDA 3V51A 4CQGA 4NJ3A 2VGPA 2H9VA 3I5ZA 1WVYA 4YLKA 3DBFA 5D12A 4QYYA 4DN5A 1PXJA 3GB2A 1H8FA 2JIVA 4RX9A 3TNWA 4O91A 4BDIA 4DFZE 2F49A 2GHGA 3KF4A 2WTJA 3LCKA 3NCGA 4RIYA 3NX8A 2VWUA 5AIKA 5DT4A 3DK6A 5BVEA 3R7EA 5JMSA 3NUSA 5KMKA 4RQKA 1OKZA 5E90A 4ASEA 1YI3A 5CF5A 4DFLA 3MDYA 4RC2A 1XKKA 2UZBA 2XJ1A 3NNUA 4U79A 4YBJA 5HU9A 5EI8A 4MNEB 3A99A 3ZO2A 4XX9A 2X8EA 5ANJA 2F7EE 3BCEA 3E64A 3OXIA 4AE6A 4F4PA 4V0GA 5BVDA 5IF1A 2JC6A 1ZAOA 3NDMA 5IQDA 5E7RA 2H34A 3VIDA 5EH0A 3HX4A 3MVLA 4F99A 4QNAA 4ACHA 4I41A 4AGWA 1CM8A 1J3HA 5BUIA 1H07A 5F1ZA 1NW1A 3U6JA 4OT6A 1R1WA 4PMMA 4OBQA 1OECA 3OWKA 4G5JA 3QGWA 4KKHA 4AT4A 3LKMA 4BDFA 4C7TA 4FKVA 4FVPA 4I24A 2BUJA 4D1XA 4QMNA 4RVTA 2YIYA 1GNGA 2O5KA 3R9OA 3E63A 4AACA 4U6RA 3PRIA 4LL5A 3I0QA 4P5ZA 3IW4A 2W5AA 3EQHA 3PRFA 4FL3A 4PMSA 5LMKC 3MFRA 3PA4A 3P79A 2PVYA 2G15A 1XO2B 4G17A 1OM1A 2VWWA 4NH1A 3GCVA 3FSKA 4FKOA 5BVWA 2NPQA 4QMSA 2WMQA 4ZTQA 3QA0A 2Q83A 2IZUA 3H9FA 3QQFA 3KGAA 5LVPA 1H1QA 3ELJA 4PDPA 3F61A 1S9IA 1FMKA 2JAMA 4E93A 3R8MA 3DDQA 3WI6A 3OXTA 5IUGA 5J5TA 2QKRA 4FSUA 2AYPA 5AUYA 4I6FA 3UIUA 3P08A 3MN3A 4K11A 4AA4A 4YHTA 3PYYA 3RINA 2J90A 3PSCA 3NUYA 4FOBA 5A4CA 1GIIA 4ASDA 2PZ5A 3KFAA 2BRGA 1JOWB 2ZMCA 4J8MA 5F20A 4LMNA 2YIXA 5H8EA 4M84A 4MNEA 4YJUA 4XOYA 5EDPA 1PHKA 4GT3A 3T3VA 4V04A 3I79A 1KSWA 2HENA 2QO2A 1H24A 3OTUA 4AZVA 4BI2A 5L6WL 2QQ7A 3V01A 5HTIA 3IGOA 3CD3A 3D5XA 4ITHA 4QP1A 3ROYA 5F9EA 4RQVA 3GUBA 4KIQA 2QONA 4C3FA 3HRCA 2KTYA 1V0PA 2QO9A 4QP9A 4C61A 1JSTA 2JAVA 4AZSA 4JS8A 1PKGA 2W4JA 5JFXA 5M53A 3OFMA 4BRXA 1XH7A 4FZ7A 2CN5A 4LI5A 4BC6A 5HD4A 1BMKA 3QCYA 3RK9A 3LLAA 5FUTA 3TZ7A 2UVZA 3PXQA 2FVDA 3QBNA 2X2MA 5ITAA 1FGKA 1H01A 4F6WA 4FIIA 3MPAA 2WTCA 2FUMA 3DNEA 1JPAA 4FTCA 5FBNC 5H3QA 3UO6A 3ZLXA 4DEHA 4UX9A 1H28A 1XWSA 4ITJA 3TTIA 5I9VA 4XV3A 2DWBA 3E88A 5EM5A 3E92A 5CT0A 4TWCA 3M42A 5E8TA 2CHLA 3KXHA 5CNNA 4IB5A 4EK8A 1OL5A 5TF9A 3FXZA 2QOFA 3TJCA 3KRRA 2XKFA 4G5PA 1QMZA 5AR7A 4UXLA 4QPMA 2J50A 5HE1A 4ACMA 3WZEA 3PY0A 5IH5A 3C5UA 3VBYA 4MX9A 1JKKA 4CLJA 1GJOA 2NNWB 2C30A 2I7QA 4ID7A 2C5XA 4KRDA 3AXWA 4GS6A 2HIWA 3DJ7A 3O23A 2WHBA 2RF9A 3E8CA 4B8LA 5M4UA 2WPAA 3FQSA 3VS7A 5HI2A 2EU9A 3BYOA 5A4QA 5CU4A 3K3IA 4O7YA 1YXTA 3CTHA 3FZ1A 3F3ZA 4GVJA 4GU6A 4QPAA 4ZAUA 4TWNA 4HGLA 3OZ6A 3MV5A 1LEWA 3MY1A 3SC1A 1CTPE 1DAWA 4UWYA 5J7BA 4M97A 4JQEA 1G8AA 4PPBA 2VTLA 2Y9QA 4FTUA 3OWPA 4HPUE 4EK6A 4O0YA 5CAQA 3FZRA 4XBRA 1H08A 1H1PA 3D0EA 3DY7A 4AFEA 5I9YA 4YNEA 4OAUC 3RZFA 4BKJA 4FTKA 4W4XA 3OHTA 4BI0A 2HW6A 2XRWA 4FV4A 4E4MA 2O2UA 3OROA 3R83A 4EYJA 3KREA 3V8SA 2EUFB 1P4OA 5CI7A 4ZY4A 1EH4A 1OUKA 5AR5A 3H9RA 3NCZA 1M2QA 2CPKE 4YGAA 3Q32A 4YSMA 4HCVA 5I4NA 1QPDA 2WMSA 4PUZA 4FVQA 3FY0A 3DNDA 1W84A 5D11A 3NR9A 3E7VA 2OG8A 1ND4A 4YJOA 3WE4A 3GU6A 5CT7A 5EM6A 2YDJA 5JFVA 3EMGA 2HK5A 1MQBA 4UMPA 2YM5A 4QP2A 2ZYBA 5AUWA 3AT3A 1XH5A 4KS7A 2ZMDA 3TUCA 4IWPA 3BE9A 4GV1A 4M69A 3PJ1A 4RVLA 5T6KA 3FLYA 4I93A 3HMIA 4JDJA 1ZZLA 4I4FA 4JNWA 3GNIB 4FV2A 5HIDA 4ENXA 3QX2A 3PXFA 4Z16A 3LM0A 3ZONA 2RG5A 4O21A 2GPHA 2YITA 3N51A 5I3OA 2FSTX 3FMMA 4O86A 3ZM4A 3UO5A 1YDTE 1HCKA 2XCHA 5EM7A 4BY9E 3W2PA 2VN9A 4OTRA 3SDJA 2PULA 2PMNX 2GTNA 4YC8A 5AP2A 2CNUA 3CGFA 3F3UA 3H30A 4F1TA 5FDXA 4EWHA 3AC2A 4RFYA 3P7BA 3ZCLA 4LGDA 3U8WA 4S2ZA 2Y4IC 4I20A 1XR1A 5EG3A 4K18A 4CT1A 1ZZ2A 3KK8A 4CRLA 2UZNA 4F1OA 4EOJA 1CDKA 3ZSGA 2V5QA 3GP0A 2J0KA 3KXMA 2YCQA 4TNBA 3ZFYA 5IA4A 1WBOA 4Y83A 4C38A 3OT8A 3S0OA 4IFCA 4QD6A 4DE4A 1YWVA 4BDJA 4QTDA 5ETCA 3H10A 5DHJA 3Q4UA 3PZEA 3D7TA 3HLLA 3MB7A 3L8VA 3W32A 2JDVA 4ZY5A 2QNJA 3I81A 2OXXA 2XM8A 3EN4A 2X7FA 3N9XA 5KKRC 2IO6A 1ZYCA 2C47A 3QRIA 2UW8A 4EQUA 1YHVA 2YJRA 4PMTA 5DYJA 3I7CA 4FTNA 2BR1A 2PYWA 4JVGA 4QMYA 5DA3A 3FPQA 4C62A 5LMKA 2CGXA 4FUXA 5LVLA 5L8KA 4M8TA 2UW7A 3UNJA 4QTEA 5BVNA 4O81A 3QX4A 3GGFA 2GQSA 3K5VA 4FI1A 4BYIA 4EH7A 3WYYA 3TL8A 2OJIA 3HV4A 3OCBA 2XNBA 3HGKA 3KMWA 3LMGA 5IH4A 2E9PA 5IQBA 1PMVA 1UU3A 3UPZA 3DGKA 3AC3A 4D5HA 4JBVA 4UMQA 4MYGA 4EC8A 4F6SA 5EOBA 1BI8A 4FTMA 5CX9A 2PVKA 2ZDUA 3IKAA 3L8SA 4XHKB 3ZRLA 1NVQA 2OZAB 4D2PA 4D4RA 2CLXA 2WELA 3LCDA 3PXZA 3TKIA 3MVHA 4XV9A 3ACKA 3UIMA 5AP6A 4Z7HA 2C6EA 3EOCA 3SRVB 3HEGA 3IS5A 5L2TA 1YOJA 4AN9A 4OGRA 2IJMA 1WBVA 3MJ2A 5DRDA 3W2RA 4BCIA 1GZOA 1M17A 2WEIA 3CS9A 3ORPA 3EN5A 4JBPA 3BPRA 4PPCA 2F7ZE 4DG2E 3BHHA 5JEBA 4ZSGA 4P4CA 3H0ZA 4WOVA 3UOJA 3HMMA 4RWJA 1YDSE 2JDRA 3FSFA 4TYHA 4BN1A 3QD4A 2UZOA 3R7IA 4BCNA 3ANQA 3QKLA 2F2UA 3A62A 3A4PA 4DFUA 4NKSA 3QQKA 4C4IA 3NEWA 3QL8A 4AXAA 1YWNA 3A2CA 5JZNA 3KCKA 3FLSA 3II5A 3Q2MA 2JDOA 4U3YA 4BDKA 4I5HA 4OLIA 4TTHB 4U45A 4AS0A 4DINA 3AC4A 5KBRA 2R3NA 4M15A 4CTBA 4FZFB 2YLFA 5B0XA 4WSYA 4BZNA 4FYOA 5JK3A 3DAKA 3LMIA 2JBOA 3A7FA 4DBNA 2BMCA 2YN8A 5LWNA 3O7LD 3KN6A 4RIWB 4XLIA 1URCA 1ZOGA 4FMQA 1JVPP 5AUUA 2YWPA 5FM3A 4DT8A 1G5SA 4MF0A 2XK7A 5D7AA 4A9SA 4O7SA 3PZHA 2YM4A 4WIHA 3AOXA 3FJQE 4FTRA 4H3BA 4A06A 3VC4A 3ZO4A 1O6LA 4RWLA 1BLXA 2BIYA 4GT5A 5LOHA 3FI2A 2V0DA 2V55A 2WMXA 4R5YA 1LUFA 4G3EA 3NPCA 4KD1A 2HWPA 3MA6A 3TWJA 3W10A 3QAME 4DH1A 5GHVA 3LCOA 2BRHA 3G2FA 3TKUA 4YURA 1P5EA 5IQGA 4AF3A 3L8XA 3EFWA 2X8DA 5IA0A 5AIRA 3BBTB 3RAIA 4AE9A 4YPSA 4FBXA 3UVQA 4JIAA 4C59A 2ESMA 3FMJA 1G8SA 3PJ2A 4E1ZA 1M2RA 4O1PA 4WD5A 5KMJA 4FKIA 4EOSA 3W33A 3R7UA 5HORA 4FK6A 4OT5A 4K33A 2HW7A 3VW8A 3Q6UA 4YC3A 3NVKI 3UOKA 5I0BA 1F3MC 2ZAZA 4PQNA 4IDVA 1IRKA 4XG9A 4BDGA 3VO3A 4OTIA 4DEDA 4IQ6A 3WF6A 5A3XA 5KKRB 4C4FA 4NSTA 2BKZA 3HECA 4QMOA 4NK9A 4LOOA 1JNKA 4ASXA 4H3PA 3U54A 4XOZA 2A4LA 2O8YA 4FV8A 2C5YA 4HCTA 4X3FB 5E9EA 2OXYA 4ENYA 4DEIA 4ZSLA 3UQGA 5BYYA 4Y95A 1XQZA 3BYMA 2V7OA 3HUCA 3FLWA 3ZXTA 5KUPA 2XM9A 5IISA 1IEPA 1YHWA 4ZS4A 4IXPA 3HV3A 3AGLA 4GEOA 4ZIMA 3SW7A 2C5NA 2ITYA 1H27A 4N57A 3HA8A 2QOIA 4ANOA 1YWRA 2CJMA 3E3BX 3O17A 2AUHA 2PE1A 4ZP5A 4EUTA 4Y5HA 5L8JA 2BHEA 2PVNA 2JKQA 4ERWA 4F9YA 3RCDA 1U5RA 4CV8A 5C4KA 5GZAA 3MJ1A 3Q53A 4AOJA 3BE2A 3GQLA 4EKLA 5HNGA 1IASA 3RTPA 4FOCA 4FV6A 3MESA 1PYXA 4FNZA 2EB2A 4AG8A 3V5QA 3PIYA 4XG8A 3HZTA 1RJBA 4BKYA 2Z7RA 3KC3A 1IA8A 2WZJA 4FTTA 2ITTA 4F63A 3ZUUA 4MNFA 4DBXA 3QLFA 2XK6A 3ETAA 4UMUA 2YZLA 4O7NA 3OG7A 3KRWA 5HICA 3DAEA 5HGIA 4B9DA 5LVOA 5CEMA 3KVWA 3OWLA 5E8UA 4MQ1A 1U54A 2EXMA 4R1YA 5HE3A 1SVGA 5D7VA 4EI4A 5LQFA 1KE5A 2IG7A 3CKXA 3R9DA 1YI6A 3C0IA 2UW6A 5JH6A 5KZ0A 3SXSA 2O64A 3R1YA 4FODA 2GFCA 3KCFA 3ORNA 3MI9A 4GMYA 4KSQA 2QOQA 3ORMA 3PA5A 5IG1A 3D2IA 2DUVA 2O0UA 3FI3A 4NU1A 5HVKA 5CVFA 2XB7A 3OD6X 3L8PA 3QA8A 4FIEA 3K5UA 4L6QA 1JLUE 2YCSA 2E9OA 4RIOA 2XKDA 3ZEPA 3VHKA 4AZWA 2VNYA 4U8ZA 1PJKA 3ZHPC 5CU2A 3UMXA 4CMOA 5J1VA 4AGCA 4C4HA 4HVHA 1SYKA 2WTKC 4GIIA 4PY1A 4TL0A 3PY3A 4O96A 5IMXA 4ACCA 1FBNA 1ZYLA 3NIEA 4NW6A 3RHKA 1YVJA 4HVGA 3EIDA 4CZTA 4WHZA 3VUTA 2XK4A 3NNWA 2BZJA 2OFVA 4D4YA 4CG8A 4O0TA 5J8IA 5AFVA 1QPEA 5FTQA 1Q3WA 1ZYSA 1RQQA 2W1HA 3MTLA 1OIQA 3HV7A 2BVAA 2WIPA 3D4QA 4ZMFA 3OP5A 2R3RA 4RRVA 4XG4A 4HZRA 4QT1A 3CY3A 1W0XC 4MBJA 3UODA 5HTCA 4GL9A 2Z02A 4RSSA 2WOTA 2WQNA 4PP9A 4FL1A 4X7QA 3RZBA 4DYMA 5IA1A 1UU8A 3PP1A 5L2SA 4IM3A 3QCQA 3DLSA 5DMZA 3S1HA 4J99A 4LRKA 2YACA 3OY3A 3Q4ZA 4CFUA 3EL8A 5FGKA 1VYZA 2AC5A 3PXYA 1NY3A 5B2MA 4QP4A 4O7LA 2IPXA 4HYUA 5H2UA 5EYDA 3GU7A 1UNHA 5AR4A 5E92A 4K1BA 5CAUA 4KBKA 5CALA 5KCVA 3AMYA 3ULIA 3MW1A 4C2WA 1LEZA 3C4EA 4CT2A 3K3JA 4WBBB 4G9RA 4APCA 4BCPA 1OIYA 2W4OA 4QMQA 3FXXA 5BVOA 3HMOA 5L2IA 5HO7A 5IEYA 5BVKA 5CF4A 5J9LA 2PUUA 3E87A 2UZDA 1GIJA 3DT1A 4IWQA 3LFQA 3SD0A 4CXAA 5EI2A 4CYJA 1BI7A 2GTMA 3KRJA 2QOLA 2WIHA 3Q04A 4M7IA 2W5HA 3O71A 3IW8A 5IU2A 2Z8CA 1STCE 3VS2A 1QPCA 5IQCA 1K2PA 2UV2A 2JITA 3WIKA 1XH9A 3GU5A 5FQDC 1WBSA 4DLIA 3JR1A 2XEYA 3GI3A 5AR8A 3VUDA 3QKMA 3QRKA 4B7TA 4FZ6A 1Q8WA 4XNEA 2OICA 2R7BA 2B7AA 4FSNA 5CF8A 3QKKA 2V62A 3ENHA 4QYFA 2XIKA 5AA8A 5G6VA 4WNMA 4O7VA 5GIOE 4MD7E 4DHFA 4EL9A 3CQUA 4HCUA 4CKRA 1XBBA 4MWHA 3D5VA 3FY2A 4I3ZA 4ZTMA 5IH6A 4JQ7A 1HCLA 4IAKA 4W8DA 4BF2A 3SXFA 5LXMA 3I0OA 3DBCA 5CY3A 2YISA 1U4DA 3F66A 3FMDA 4ZZMA 1ZARA 2XRUA 3GOKA 3QWJA 1E1VA 1YDRE 4ANSA 4NFNA 4IEBA 4GYGA 1WVXA 4BGHA 4EOKA 4EORA 4OAVB 4L3PA 5AR2A 3BYSA 2WTIA 1H1RA 1Q99A 1JSUA 3CC6A 4FTAA 3R8ZA 4MXYA 1IAHA 2OK1A 3D5WA 5GJDA 1PXOA 1Z9XA 2R3KA 4I94A 3ORXA 1L8TA 4IM2A 4RZVA 1ZMVA 4BZOA 2X9EA 3FXWA 3C50A 4HYSA 3FWQA 3MVJA 5BUEA 3C0GA 3ET7A 4S30A 3QCXA 3ZUTA 4LMUA 3FQEA 4FT5A 1PY5A 4RJ8A 4B99A 3ANRA 3D9VA 3CJGA 4QMTA 2VX3A 4MWIA 4FEQA 3FL5A 1R3CA 2XIYA 3D2KA 4NIFB 3UTOA 3A7JA 1PXPA 2XA4A 2J4ZA 2UZLA 1OUYA 3RPRA 3EHAA 3F5XA 2J51A 3OOMA 2W1GA 2J0JA 2B4SB 4ANMA 4RG0A 2IVUA 3DAJA 3JVRA 4II5A 4IAAA 3VBVA 2X2KA 3NNVA 4H1JA 5DFPA 2W96B 5TOZA 3F2RA 1AGWA 3SGCA 3QHWA 4FR4A 3DBQA 4FKUA 4U80A 5ANIA 5IA2A 4FEUA 3KXXA 4LGGA 4IJ9A 1OI9A 4YLLA 1O6YA 3SOAA 5L4QA 1A06A 2ZOQA 2C6MA 3KK9A 4O0UA 4HJOA 1Y57A 3VUKA 1APME 4H05A 3QTRA 4UB7A 4XBUA 4GU9A 1YXVA 3ZDIA 5IQFA 3G0FA 4RIXA 5C27A 3O51A 2PHKA 4G3FA 1IG1A 4DT9A 3G51A 5AUTA 2X7OA 2JFMA 4ONAA 2R3QA 5HX8A 5CSVA 3PIXA 4KBCA 2QD9A 5C8MA 2UZUE 3PUPA 3R21A 3IECA 5HCYA 1U46A 4QNYA 1W8CA 4CZUA 4OTHA 4AW1A 3UOLA 4L9IA 4CFFA 1OMWA 2C1BA 2PSQA 3BLQA 1R0PA 3AD4A 4FIJA 2R64A 2ITPA 3ORZA 3IDCA 2YIWA 3NUUA 4J8NA 4L68A 4U81A 2BZHB 4FSWA 3F2AA 3OUNB 3GCQA 3NGAA 4CQEA 4TYIA 3DKGA 4USDA 2ITQA 3PLSA 2C6LA 3THBA 2R4BA 3FC2A 2DS1A 4J95A 5I9UA 1NVRA 4E3CA 3VQHA 2OBJA 4FSTA 4WUAA 1O9UA 2ZM1A 3UJGA 3VS5A 4O7ZA 3F5GA 5FBOA 2XIXA 3EWHA 3HL7A 3ZZWA 3SAYA 2GNFA 2ZM3A 4I6QA 4YLJA 1MRYA 2X6DA 4FKJA 3NSZA 4Y72A 4UN0C 5GZ9A 2CGVA 3ACJA 3DKFA 5HG9A 4IVCA 4HVDA 2VWZA 3JVSA 3L9LA 2ZV8A 1VJYA 4K9YA 2XIRA 4FL2A 3NMUF 3BGPA 4FTQA 2Q0NA 2YDKA 4F6UA 5M4CA 2QR7A 4AGUA 4I22A 4YC6A 2GMXA 3D5UA 2HZNA 3R8VA 4C0TA 4CCUA 4KNBA 4FUYA 2GQRA 4O82A 3K54A 3MVMA 3SXRA 3R02A 3NYXA 3ZLSA 4EQMA 5HTBA 4FKTA 3IPHA 4KS8A 3F5PA 3HA6A 4UZDA 3S4QA 5J5SA 2BHHA 4GG7A 2X9FA 3IW5A 4UWCA 4X2FA 2PVMA 4ZLZA 3DCVA 3S95A 1VYWA 1OIUA 4XV2A 3BHYA 4WNOA 4KKGA 4PL3A 1PRYA 5CI6A 4AGDA 5AAEA 4AN3A 4G31A 3DKCA 3C4CA 3R1NA 3LE6A 2XK3A 4NKAA 4MXCA 3LFBA 5AWMA 2I0VA 4D1ZA 1GY3A 2W5BA 3SHEA 3QU0A 3LIJA 4AZEA 4FNWA 4GUBA 4ZSJA 4M68A 4GK2A 4BIBA 3EB0A 3QC4A 1YW2A 3LJ1A 2UW3A 3PG1A 3R01A 5CF6A 2B0QA 2XF0A 3FDNA 3NYOA 3SV0A 5JN2A 4ITIA 1PW2A 5CQUA 4W4VA 4BI1A 4EHGA 2QG5A 1V0OA 2W1DA 1OKWA 2E9VA 2WB8A 3IONA 3MY0A 4GRBA 4GT4A 4IB3A 4RT7A 5DG5A 2FA2A 3UG1A 3KF7A 5J95A 4DTBA 2W06A 4U40A 5BPYA 5DVRA 5K5XA 3A7HA 3KKVA 4JAIA 3NLBA 4JIKA 2BTRA 2R9SA 3BEGA 3RK7A 4ARKA 4YTFA 2JKMA 2XNGA 3MH0A 1PKDA 2ETMA 3GCUA 3WBLA 4AN2A 2VWBA 4E5BA 2VAGA 3BHUA 5AV3A 3MIYA 5K3YA 3AMBA 4G6OA 1ZYJA 1J1BA 4BHNA 2EXCX 2QC6A 1ZLTA 3OEZA 3P5KA 4GW8A 3P78A 5EKOA 1A9UA 2CKEA 3OY1A 4P2KA 5JRSA 5M44A 5M57A 4W4YA 4RA5A 3COIA 4DGLC 4EEVA 5CNOA 4DTAA 1W98A 3D15A 4O0RA 3Q4TA 1KE9A 4USFA 3WZKA 4BTFA 3LQ3A 4NYEA 5CVHA 4F0IA 5FTGA 4RVKA 4XP0A 1CKJA 3AT4A 1TVOA 1K9AA 4E8AA 1J7IA 2BDJA 3R2BA 4C58A 3A60A 4E4XA 5AAGA 2YA9A 4FG7A 5CEPA 2IZRA 2QLQA 5BVFA 1W7HA 1UKIA 1RW8A 2OZOA 3O96A 3EN9A 4JI9A 2VRXA 2I0HA 4XP2A 4U43A 3R1QA 3EN6A 3ZC5A 5AMNA 1KWPA 1PMEA 1PXMA 3MFUA 3PA3A 5DIAA 1M52A 5KHWA 3UP2A 1OL7A 5B2KA 1ZRZA 4M13A 4BBEA 4EKKA 4FNYA 5C9CA 3VWAA 4FSQA 3BU6A 1BX6A 5AR3A 2ITVA 3COMA 3QUPA 2C1AA 4YJRA 3Q3BA 2A27A 3UZTA 3QWKA 4C2VA 3A8XA 3PP0A 3E7OA 3R30A 2VTQA 4IBMA 4FZAB 5A4LA 4IVAA 2WQMA 1UVRA 4LM5A 3ZXZA 2BZKB 4AZFA 4W9XA 5EKNA 4OTWA 4JQ8A 3QUEA 4DGGA 4FV7A 4FT9A 5GJFA 4FSMA 3RWPA 2BALA 4DCAA 5TT7A 3QQLA 3R9RA 4LUDA 4J53A 2W1EA 2P55A 1UKHA 5HD7A 2RFNA 5DR2A 2WMVA 4H3QA 1OPLA 4JJRA 1GOLA 5IPJA 2VX0A 3F9NA 3DXQA 3BKBA 3GQIA 4G6LA 4PTEA 4J71A 1PXIA 3ZFMA 4EK4A 3DA6A 4EJNA 3E8EA 3O50A 4HW7A 5IDNA 2XNPA 5EM8A 2FSLX 5CYIA 1WZYA 3BWJA 5FG8A 3NUNA 3FBVA 3OEFX 3QZFA 4MHAA 2QU6A 3VUIA 3M11A 4BCGA 3TNQB 1WFCA 2XJ2A 3IO7A 3TV7A 4DEEA 3ZEWA 3DFCB 2QOBA 4N6YA 3I4BA 3O0GA 4QRCA 4LL0A 2WU6A 3WYXA 5DI1A 2OH4A 4ZTLA 4D0WA 3OCGA 4FTIA 4HYHA 4BVUA 3EYHA 1H4LA 1WBNA 4M67A 1M7NA 5HO6A 4CG9A 4GKHA 2J5EA 3L9MA 3OMVA 4GUEA 3U6HA 2DQ7X 1T46A 2UZWE 2VTHA 3P0MA 4YZ9A 5FP6A 4TW9A 3RM6A 2BAKA 2YHVA 2P2IA 3PVUA 3DDPA 2GNJA 1H25A 4ZTRA 2CNVA 5K4JA 2HAKA 2HXLA 3GFEA 4G9CA 4CLIA 3A4OX 2ETKA 1SMHA 3IDBA 4QQCA 2WTDA 1G3NA 3VBQA 2UW4A 4YZBA 4F65A 4O7RA 3EKKA 4IVBA 3B8RA 5BMMA 4AA5A 5CXZA 2R3PA 1AD5A 2Y8OA 4EK5A 2ITWA 3IOPA 4R3CA 3ULZA 1B38A 4FSRA 1FGIA 3F7ZA 2VD5A 3LQ8A 2B9FA 4PWNA 1UNGA 3KEXA 4K2RA 2GHLA 5F95A 3UG2A 2PVRA 1ZYDA 3FUPA 4A9TA 4BKZA 3LFCA 2HOGA 2RSVA 4JXFA 2W99B 4YZCA 3CPBA 2GCDA 2I40A 5D9HA 3E62A 4TKSA 2W1IA 4C35A 4ALWA 3CPCA 5DLSA 5AP1A 3FI8A 4ZXTA 2XKCA 3NNXA 4W9WA 4MBLA 4TYJA 2EXEA 4FV3A 4KIOA 4AQCA 3BHVA 4D2RA 1XH4A 3MA3A 5AV1A 5FRIA 5J79A 3CP9A 3QTQA 3VF8A 4X3FC 5K4IA 4QYEA 3SA0A 4YTCA 4R8QA 4J98A 3HRFA 2PZPA 3EQCA 4GJ3A 4UY9A 2FO0A 4BL1A 3TDVA 5E8XA 4IC8A 3E8NA 4IADA 4JDKA
chains in the Genus database with same CATH superfamily
3Q9YA 4FT7A 3MWUA 3UC4A 5DPVA 3QCSA 1JAMA 1XHAA 4EOLA 4E6QA 1KE6A 4D4VA 4XH6A 2EB3A 3CGOA 4GK4A 3GC9A 4PMPA 1YOMA 4YTHA 2YCFA 4BBMA 2GHMA 1JBPE 3Q96A 3CCNA 5IUIA 4AFJA 4D28A 2CLQA 2YAKA 4FV1A 3LW0A 3WARA 4MQ2A 5F94A 2CNQA 5E8ZA 3U51A 2W17A 1YOLA 5K0KA 4FEWA 4JX3A 1KV2A 4HNIA 5LMAA 4ZZOA 2W0JA 4HYIA 3RPYA 4RX7A 4MK0A 3P4KA 3VS4A 4AZTA 4PF4A 4CRSA 4F0FA 2PVLA 2Y6OA 4TPTA 3R6XA 4F0GA 4BR3A 4CD0A 2VWVA 5KMIA 2XEZA 2R0UA 2OIQA 3ZC6A 5GJGA 5JGAA 1X8BA 4IE9A 3P5JC 3O7LB 1W83A 2G1TA 4CFWA 3ZFXA 2PMOX 2QURA 2CMWA 5CSPA 5ETIA 1H00A 5DT0A 3ZO1A 5HQ0A 5HG8A 4FIHA 3E3PA 3M1SA 3IDPA 4IHPA 2XK9A 4GCJA 4XRJA 4RLLA 5HE2A 5CEIA 3VS6A 2HZ4A 2XK8A 5M4IA 3F3VA 4PL5A 4TT7A 4GJ2A 2XMYA 3POZA 3TUBA 2C3LA 4P90A 5HIEA 3LFNA 3BU3A 4Q5EA 4L67A 3BV2A 2NRYA 4LOQA 4O4DA 3SKCA 1Y91A 3FLZA 5CU0A 2ZDTA 1OBGA 4QYGA 4G1WA 2Z60A 3NWWA 3UQCA 1H26A 3QRJA 2KULA 4CFXA 3VN9A 4E6AA 3VVHA 3BGQA 4M14A 3R28A 4O0XA 1OB3A 4FSZA 2WFYA 4U0IA 2W1ZA 4XG3A 3RPOA 2XARA 4GKIA 4MXXA 3FAAA 3UP7A 2RL5A 4BWPA 3R1SA 3W8QA 2ZFYA 3PSBA 4PNKA 5H8BA 4NM0A 2F9GA 2OZAA 3TZ9A 5HBEA 2BAJA 2WMUA 4FYNA 5K9IA 4HVIA 3FMLA 3DTCA 4QMVA 4K8AA 4AWIA 1LPUA 4ZSAA 2IZSA 2UW0A 3A8WA 3FMKA 3MYGA 3QD2B 4YJSA 2JGZA 3SRVA 3TV6A 3DB8A 1UU9A 3PDTA 5EDRA 3ZM9A 3FHIA 3MS9A 4ANQA 3OC1A 4E7WA 3LAUA 4FKGA 4IWDA 5AP3A 4WG5A 4BJJB 2BFYA 4D55A 2ACXA 2PVHA 4YJQA 4CNHA 2J5FA 3Q9WA 4ZLOA 3PJ8A 1PF8A 4LYNA 3GOPA 4IM0A 4XG6A 3PVWA 3ENMA 4E5WA 5C1QB 1KUTA 2FSOX 3P86A 4S33A 4CVAA 3G6HA 2H6DA 2ZV2A 3DQWA 5IZFA 1O6KA 1OPKA 4HOKA 4FNXA 5EK7A 4A9RA 3M2WA 4R7HA 1Q5KA 2W9FB 3HV5A 5IUHA 5L8LA 5M09A 3EQDA 3JS2A 5HO8A 2GU8A 1QPJA 1S9JA 3HVCA 3DKOA 4WKQA 3AT2A 3FC1X 3FKOA 4ZTSA 4BDDA 4PTCA 2J0LA 3F7WA 4R5SA 5JZJA 3PFYA 5F4NA 2CCIA 5AM7A 2R2PA 3FZSA 1ZMUA 3OCTA 4YUQA 5KZIA 2ZV7A 5IA5A 2OJJA 4MKCA 3PVGA 3LXLA 4X2JA 3R7VA 2PVJA 4AOIA 3HKOA 4IWOA 3TZMA 5DOSA 4RIWA 4DFBA 3BV3A 1OIRA 4R7IA 4UEUA 5LVMA 3LZBA 3R00A 4JLCA 5AP0A 4N70A 3LQ5A 4F9CA 3HDNA 2I0EA 3ERKA 4JRNA 4YPDA 2YERA 4IX4A 5FD2A 2R3GA 5M06A 1J91A 3TKHA 3KRLA 1FMOE 2I1MA 2XYUA 3TCPA 4ZY6A 4ZEGA 2ITOA 4V01A 2X1NA 3RHXA 4EOQA 5HHWA 2RGPA 4R1VA 3VF9A 4QYHA 3ZSHA 1BKXA 2ITUA 3U4WA 2XAMA 1J7LA 4MD8E 3RAKA 3MSSA 4AT3A 3UGCA 2ERKA 5DEWA 2QOOA 3UQFA 4MXAA 3V5PA 1PXKA 5AA9A 5K5NA 4BIDA 2J7TA 2J9MA 4JOAA 4WG4A 3F82A 5LCKA 2IF8A 5I9WA 3ODZX 3KVXA 3UO4A 3W2SA 4A4XA 4CYIA 4DG3E 4E5AX 5L3AA 4E4LA 5JRQA 1SM2A 4FICA 3AG9A 4IX6A 4X21A 4YMJA 4A7CA 4WNPA 4XP3A 5E91A 2X4ZA 3WF8A 1JQHA 3LOKA 3RAHA 2G2HA 4FGRA 5AJQA 4O84A 4NCTC 4BFMA 4RVMA 4EOPA 4UYNA 5CXHA 4DF3A 1M14A 3C4FA 3IG7A 2G01A 4XCUA 3W2OA 4FTOA 3AMAA 4G34A 3P7AA 5HCXA 4D4SA 1FOTA 4EWQA 2ZV9A 3TXOA 2P0CA 4X3FA 3RM7A 2PY3A 4QMUA 5TKDA 4JAJA 4V05A 3R7OA 5A4EA 3CXWA 2XAOA 5J7HA 4KRCA 4IAZA 3BLHA 3OW3A 3ZO3A 3CD8A 4ZTHA 3FMNA 3P9JA 2E9UA 3WF9A 1Y6AA 4XLVA 4A07A 2QHMA 3TJDA 3R71A 3I60A 3QALE 2W7XA 2ZM4A 3C0HA 2VO3A 5EHYA 1ZMWA 2WO6A 3CEKA 3QC9A 4C8BA 4PDYA 4RWIA 5KE0A 2QU5A 2R3JA 5LCJA 4O7WA 3QHRA 3BZ3A 2J6MA 3HV6A 4YNOA 2Y7JA 2C3JA 4J1RA 5CZIA 1ZOEA 3IOKA 4I0SA 4ZTNA 4D58A 5CAPA 1DI9A 4KSPA 4EHZA 1JKTA 3MH1A 2PE0A 4FV9A 1CSNA 3DU8A 1OGUA 2PZRA 3JUHA 3MGYA 2FGIA 3GC0A 3G33A 5K0XA 3ALNA 5C26A 4EQCA 4AP7A 3SQQA 2E9NA 4QMWA 3GCSA 4B8MA 2ZB1A 5EI6A 3N4TA 4JRVA 1OKVA 3W0RA 2OGVA 2OO8X 2PUNA 4ZMEA 2WQEA 3V8WA 2CKQA 1M7QA 4FC0A 2ZB0A 4JX7A 4RPVA 2O63A 3UYSA 3VUMA 5KX8A 3MPMA 5EOLA 2XNOA 3PPJA 3OCSA 4GVAA 4TY1A 3HAVA 4O83A 3UZRA 3UNKA 5FWKK 1TZDA 4QTBA 3GEQA 5G1XA 4FKPA 4FIFA 2YJSA 3D94A 2X8IA 3SW4A 3UC3A 1ZXEA 3R22A 2C3IB 3F69A 2JDSA 4G2FA 2XBJA 3OOGA 4D9TA 2R0IA 2IWIA 2W1CA 4WSQA 4X6RA 4C34A 4CCBA 4EH4A 2A1AB 4EOOA 4R7BA 4BBFA 4AW2A 3VRYA 2R3OA 5CSXA 3VBXA 4D2WA 5BNJA 1A48A 2QO7A 3RJCA 5TO8A 4QTCA 4C36A 2UVYA 2OF4A 4IZYA 4KABA 4KKEA 5HLPA 3R8LA 3VQUA 4EYMA 4I5PA 1QCFA 3NRMA 3QYWA 3R0TA 2BRNA 3RP9A 4ASZA 3V8TA 5M08A 1LR4A 3LXNA 3DXPA 4BICA 1BYGA 1OPJA 4A4LA 1Q3DA 4I0TA 5HIBA 2XNEA 3W18A 3HP2A 2A0CX 2CKOA 4J7BA 4YO6A 5KBQA 2IN6A 1VEBA 2G2IA 4GFGA 3NW7A 1KE8A 4L45A 3UPXA 4B4LA 3U55A 5GINE 2ITXA 5E8YA 4FX3A 1V0BA 2QR8A 4YJTA 4AAYA 3E8DA 3R04A 3C51A 2OJ9A 1GAGA 3Q5ZA 4CSVA 5IDPA 4I92A 5KMNA 4OUCA 3QUDA 3BHTA 4XV1A 2ONLC 3RPVA 3KXGA 5DNRA 5EW8A 3CJFA 4UWBA 3I1AA 4F08A 4WO5A 4WRGA 4QEBA 1XH6A 3PPKA 4JBQA 4BCOA 3NYVA 4DDIA 4C3RA 3O8UA 4WNKA 4NZWB 4UMRA 2EVAA 5I3RA 4QMXA 1Q8YA 4XG7A 2PUIA 4FKSA 3V5JA 3BU5A 4EZ3A 5LWMA 5DR6A 4WRSA 2VTMA 4WG3A 1IAJA 4ACGA 3ZBXA 3IW7A 3QF9A 4RIYB 2UW5A 3FKNA 4M3QA 3F2NA 3W2CA 3QTXA 4NL0A 3BYUA 4Y46A 2O3PA 1E1XA 3G90X 1UU7A 3HNGA 5CAVA 4AU8A 4F7SA 1U59A 3PE2A 2CKPA 1U5QA 1E9HA 1J1CA 3LVPA 3MPTA 4FTJA 4NEUA 4IB1A 3EQRA 3MY5A 4QO9A 4Z3VA 4GK3A 2QVSE 5AP4A 3C4XA 5D1JA 5A4TA 3KQ7A 5I9ZA 3ZSIA 1J7UA 1GIHA 4MUQA 4X3JA 1AQ1A 3G9LX 1NVSA 3EZRA 4OR5A 4IX3A 4KIKB 3TNIA 4EK3A 4EONA 5C8NA 4YP8A 4GSBA 3F3WA 3Q5IA 3S00A 4WBOA 4TNDA 3UYTA 4NT4A 2UZVA 5CEQA 4IC7A 5DGZA 5KO1A 5M4FA 4ZJJA 3F5UA 3C4ZA 2YWVA 2F2CB 2IVSA 2AEGA 4F7LA 2YLEA 3QLGA 1F5QA 2GS2A 2YM3A 3TI1A 4YZMA 3UNZA 3W1FA 3Q4CA 3ZBFA 4O22A 4F9AA 3TT0A 3NW6A 3UBDA 1OBDA 2QLUA 3JXWA 2FH9A 3KA0A 4L53A 2FSMX 5HU3A 3W0NA 1MP8A 4U97A 1KOAA 3BQCA 3LJ0A 3BYVA 1YXUA 4CFNA 1OL2A 2YCRA 3VRZA 5CWZA 4YO4A 4NM3A 3SG8A 4N6ZA 3QTWA 3ZOSA 3O8PA 3TIZA 2I6LA 4DITA 2J0IA 3PPZA 5JT2A 4ALVA 2J2IB 1B6CB 4FKLA 1QL6A 1OZ1A 4OTDA 5CASA 2VTSA 5EQYA 1WVWA 5HBHA 2YDIA 4NCTA 3VAPA 1XBAA 1UNLA 3QYZA 5E8SA 2XBAA 5LMBA 4FKQA 3FEGA 4AW5A 4TWPA 3LFSA 5HG7A 1OVEA 1ZWSA 4FVRA 4AX8A 3FKLA 3FZPA 2VTNA 1NA7A 4NIFA 3D7ZA 2C6OA 4L7FA 5CZHA 2QOCA 3LFAA 4FKRA 4U44A 3RK5A 4HZSA 3DJ5A 3PJCA 3H9OA 4D0XA 3DB6A 2QI8A 5AX9A 2C6TA 2XP2A 5ACBC 4BCFA 4LV7A 4UBAA 5FP5A 2WXVA 3HP5A 3V5WA 3B8QA 1H0WA 2YAAA 2Z7QA 3HYHA 2VTOA 1ERKA 2FB8A 2YEXA 4BCKA 1Q8UA 4Y85A 4BDBA 4EH3A 5A6NA 3DQXA 3H0YA 3BWFA 4APPA 4KIKA 5DH3A 3SX9A 2Q0BA 4JBOA 3AQVA 4QQ5A 4F7NA 3FQHA 4JG8A 4L42A 3DBEA 5CLPA 3EH9A 3V3VA 4D5KA 4D2SA 5ETAA 4RFMA 4O1OA 2X6EA 3DK7A 5EYMA 2RKUA 1WBPA 1FQ1B 1T45A 2A98A 4UMTA 3G6GA 2IVTA 3KMUA 2JLDA 3RBWA 4PP7A 4LG4A 4X2GA 4DH5A 5ICPA 3FE3A 5J9ZA 4IZ7A 3UMWA 3NYNA 3A7GA 4F09A 1Q24A 3LXKA 4QQJA 4YHFA 2R3IA 3QQUA 4LRJA 5EQPA 5CVGA 2JD5A 2B54A 5FXRA 1P14A 5EHOA 2HELA 3NUAA 4MTAA 4AT5A 3E93A 5HNIX 3N4VA 4I5MA 3IGGA 2VNWA 4TWOA 3BX5A 4F70A 2B9HA 3QRTA 4X6QC 2QOHA 2BAQA 5AUVA 3U4UA 4EH2A 1BL6A 2WMAA 1VLRA 5D41A 4EZ5A 4AUAA 2CGWA 2P3GX 3LFDA 4IMYA 5GIPE 5H9BA 4E73A 2C0OA 2E2BA 5M07A 2UVXA 2V22A 2YM6A 2I0YA 3LLTA 3B2WA 3V6RA 3AD6A 3LXPA 1LP4A 3R9NA 4ANBA 1Q8TA 4LFIA 3LM5A 4CFMA 4BDCA 3GU8A 3EQPA 3CQWA 2OLCA 1ATPE 2CN8A 1W82A 3C7QA 5DWRA 2C6IA 3JY9A 5BYZA 4TXCA 4LGHA 2ZVAA 4ORKA 3QD3A 1PXLA 3Q9XA 2PVFA 4YBKA 4MXOA 1XMMA 4RC3A 4BB4A 2ITZA 4HVSA 3D14A 4QMMA 2REIA 2VU3A 4XRLA 4DLJA 1DI8A 3C4WA 4FE2A 4R78A 4L46A 4KBAA 5BMSA 3F6XA 3O2MA 3ORLA 1YI4A 2BRBA 3CSVA 3KULB 4RJ5A 3DXNA 3F3TA 5HE0A 5AM6A 1SVEA 5AAFA 4K77A 3VJOA 3ZRMA 4C57A 3BLRA 3EYGA 3ROCA 5CU3A 4EH5A 2PMIA 4F78A 2BIKB 5CAOA 4I21A 3ALOA 3I6WA 2QCSA 2YM8A 2CCHA 3LJ2A 3DBDA 4K6ZA 4PV0A 4W8EA 4X0MA 5CSWA 2JBPA 4GH2A 5CENA 3DS6A 4IZAA 4BGGA 1Z57A 2BTSA 2VTTA 2X4FA 4EHEA 3PWDA 3T3UA 1BL7A 2GNLA 4JR7A 3AD5A 3W8LA 4MEDA 1L3RE 4HGEA 3NZ0A 3ZUVA 3OS3A 5C8KA 4L43A 2Y6MA 2ONLA 2XZSA 4NW5A 4LRMA 4ZJIA 3QTZA 5DN3A 3KXNA 2G9XA 1WAKA 3LPBA 4HNFA 4DFXE 2PUPA 4M69B 2HYYA 3AC1A 3I7BA 2XKEA 2NP8A 3BI6A 2DYLA 4TZRA 2PPQA 4U7ZA 2XH5A 2ITNA 1Y6BA 1ST4A 2HWOA 4RBLA 3VHEA 3QTUA 1MRUA 4EZ7A 1FVRA 4Z9LA 4OTGA 5AEPA 3R9HA 3NVMB 3VUGA 5LJJA 2OWBA 5C03A 4DAWA 4BDHA 2OJFE 5KMOA 3EN7A 3RNYA 4IAFA 5A14A 4TYEA 3TM0A 5JGBA 4FSYA 2C69A 4XS2A 5TE0A 4CMTA 4NWMA 1Z5MA 4H39A 4QMZA 2EWAA 3V5TA 4I5CA 3D83A 4NJDA 3P7CA 2HY81 4HPTE 3R7YA 3WZJA 2OH0E 5HOAA 3T9IA 2C4GA 1GZNA 4KINA 1VR2A 3UDBA 3KULA 4EH6A 4BTMA 3ZDUA 4IX5A 2PK9A 3OBJA 2LGCA 5ETFA 2YM7A 5C01A 3R8UA 5IQHA 1FINA 2VZ6A 5JFWA 3AKLA 2G2FA 3IK3A 4DG0E 3D7TB 5HEZA 3UE4A 3EQBA 3L1SA 4LV5A 3NAXA 1TKIA 4RFZA 4CKJA 4YSJA 5FDPA 5GZ8A 4F64A 4D2VA 4GFMA 3Q60A 4P5QA 5AP5A 1PMUA 2YABA 2QODA 4KB8A 3QQJA 4KIPA 4L8MA 4LUEA 1OKYA 4FT3A 3AC5A 2OJGA 4UV0A 4OBPA 2P2HA 2JIUA 2PMLX 3BQRA 4F9BA 1B39A 2WGJA 5EW9A 2GS7A 2JFLA 2R5TA 3CBLA 3CTJA 3MFSA 4BDAA 4WT6A 3RCJA 5B7VA 3PUFC 3CR0A 3A61A 1SZMA 5JKGA 1PXNA 3EFKA 4IAYA 4EOMA 5IEVA 3V04A 3C9WA 3MH2A 1GZ8A 1XH8A 4L52A 3GFWA 3W16A 3TTJA 5J9YA 4MVFA 4ZZNA 3PXRA 4RLKA 4PPAA 5C4LA 3RPSA 3PJ3A 4OBOA 5DT3A 4EH8A 2WAJA 3I5NA 1YKRA 3G5DA 1I44A 3ZH8A 3NW5A 2GNIA 4H58A 3U9NA 3TDWA 5LARA 5DBXA 4YR8A 2HY0A 4S31A 1VZOA 4FV5A 4N4SA 4O2ZA 3EFLA 3FZTA 4UALA 3MBLA 4QP8A 5EW3A 3RALA 4B6LA 4CV9A 5EYKA 4BHZA 4DGMA 4ZLYA 4C3PA 4IANA 4M0YA 5HLNA 3MIAA 2LAVA 4G16A 3RMFA 4QPSA 3TIYA 4TYHB 1NXKA 2HCKA 4OW8A 5ANDA 4F1MA 4PNIA 4X2NA 3FLNC 2WMTA 3GT8A 2XVDA 3QQGA 2WKMA 4OTPA 2BPMA 5HVJA 2BDFA 4NFMA 4RA4A 2P4IA 3FYJX 3EQGA 4C4GA 4USEA 4AXCA 1TQMA 4M0ZA 3HMNA 2ERZE 3GENA 4RC4A 2BCJA 2WEVA 2VTRA 4XYFA 2B9IA 1CMKE 2BZIB 2WU7A 3HDMA 3PWYA 5AX3A 5L2WA 3I6UA 3L9NA 3WF7A 2VWIA 2CDZA 3C1XA 3DZQA 4IW0A 4QMLA 2R3FA 3OVVA 1JSVA 2XYNA 2XNNA 2X0PA 4BTKA 4E4NA 2BROA 2OW3A 2UUEA 4Y5QA 4FA2A 1KOBA 3KRXA 5HBJA 3QRUA 2VGOA 1Q62A 3GCPA 3ORTA 1RE8A 4O6LA 1WCCA 2JDTA 4AW0A 2C3KA 4I4EA 3ML1A 4BDEA 2F7XE 4TRLA 4DH7A 2OSCA 2RIOA 5CTPA 2F4JA 3NFFB 2V7AA 4CZYB 3FL4A 3VS1A 2HZ0A 4IIRA 4E6DA 2AQXA 5FEQA 1RDQE 2VO7A 3ORIA 3CY2A 5AUXA 3QZHA 3KU2A 2YZAA 1SVHA 2VTAA 5BQ0A 2W4KA 4O0SA 5JFSA 3LCTA 3NUXA 3OWJA 4WA9A 3RKBA 2PE2A 3WE8A 5CANA 4EJ7A 4EH9A 4C33A 5L6PA 1MUOA 3AC8A 5EQEA 3BRBA 5IQIA 4O6EA 2OI4X 4AXDA 3DK3A 1H1WA 3Q6WA 3T9TA 5EFQA 5I9XA 3TN8A 4Z7GA 3O8TA 4L01A 4Y8DA 2R7IA 2VWXA 1GZKA 4KA3A 1XJDA 5EHLA 3UZPA 4DEGA 3VJNA 2JKOA 3OF0A 4MD9E 3FMHA 5ANEA 4UZHA 3TV4A 5IA3A 3OXZA 4UYAA 4O0WA 5DR9A 4I0RA 5J87A 4XJ0A 5T3QA 3FI4A 3R63A 5IKWA 4L44A 4YTIA 4BTJA 4GG5A 4MXZA 4A9UA 4FF8A 1Q8ZA 1P4FA 3QZIA 3R8PA 3COHA 4IVDA 1FVTA 3BELA 4H1MA 5FTOA 5AADA 3VBTA 1MRVA 3E5AA 5FXQA 4KUJA 3W55A 3COKA 3CQEA 4DCEA 4WUNA 5J1WA 3KB7A 3POOA 4DTKA 4XG2A 4G3GA 2JEDA 4ERKA 1BUHA 4NUSA 3JY0A 3HRBA 5EDQA 3FLQA 3TZ8A 3UOHA 4HGSA 4M66A 3WIGA 4LV8A 2OIBA 2QG7A 2RFDA 3W0MA 2GNHA 1JKSA 4DEBA 3LMHA 4O27B 4Q5HA 1IR3A 3ZU7A 4AA0A 3TUDA 4C37A 4EBVA 2BKKA 1YQJA 1ZY4A 2OKRA 4CEGA 5AV4A 2J0MB 2NRUA 2VX1A 1YHSA 4RJ7A 4RWKA 4NM7A 5HVYA 1SNUA 2IW6A 1TQIA 3S2PA 4O4BB 5FLFA 4GIHA 1UWJA 2VWYA 4NM5A 3WF5A 5HZNA 1HOWA 5HESA 2Y4IB 5M51A 1DAYA 4I6HA 3KL8A 3UIXA 4A9YA 3TACA 1P2AA 4MBIA 3B2TA 3SVVA 1Y8GA 4BCJA 3VW6A 1U54B 3LFFA 4U41A 3CTQA 1FVVA 2RFSA 3CE3A 2B53A 2UW9A 1Y8YA 5AUZA 4YZDA 4D9UA 1V1KA 2P33A 1MQ4A 2WQBA 3U6IA 2WMBA 4M12A 4MAOA 1Q41A 3OW4A 2OXDA 4YJNA 4E26A 2B55A 4Q9SA 2GS6A 4PDOA 2IVVA 3BIZA 3ZTXA 2W05A 4D2TA 3HAMA 3QD0A 2GDOA 3PFQA 1OL6A 4DH3A 2X0GA 3BEAA 2YIQA 2UZEA 1CKPA 2O65A 3R2YA 3SLSA 3ZS5A 1F0QA 2H96A 2BRMA 4E20A 2PL0A 3NAYA 3V6SA 5JGDA 4G3DA 4JG6A 5CS6A 3SOCA 5KMMA 2PZIA 1YXXA 3GC8A 3WZUA 5A9UA 5IQAA 3U87A 5IEXA 3EQIA 5LVNA 4KAOA 4RX8A 5E1SA 4EC9A 3VS3A 4DFNA 2RG6A 1M2PA 3DV3A 4BJJA 4PDSA 4PTGA 1WMKA 5B2LA 1CKIA 3EL7A 3QGYA 5BUJA 1R0EA 1XBCA 3LHJA 3RVGA 4J52A 3FHRA 4QOXA 4BCMA 3ITZA 5I5ZA 4QP3A 3ZRKA 3EZVA 3MH3A 2C0TA 2QHNA 3V5LA 5E8VA 2VTJA 3QXOA 4DFYA 3OTVA 4JG7A 4L7SA 5E4HA 2H8HA 4FEXA 4FG8A 4NTSA 4PRJA 4C4EA 4L00A 5AV0A 3BBWA 4FZDB 1REKA 4XEYA 4FT0A 3ID6C 5BYLA 2F57A 3PVBA 4QP6A 5DE2A 2JKKA 4EOIA 5HX6A 5ACKA 1UV5A 1DM2A 2HXQA 2PWLA 5M55A 4G3CA 5FEDA 2B52A 1IA9A 4G6NA 4U5JA 5A54A 2YFXA 1WBWA 2XS0A 2CGUA 2IW9A 4QQTA 4CKIA 5IMEA 5CU6A 3PE1A 1TQPA 3U9CA 3UVRA 4IFGA 4W4WA 4BWKA 4EBWA 1R39A 3IW6A 3K2LA 3ZLWA 3F88A 4AOTA 3ZMMA 3WZDA 4YZNA 3DLZA 4YU2A 4R3RA 2Z7SA 5CEOA 2B9JA 4ANNA 2WD1A 3G15A 3ATTA 1JWHA 4XMOA 5L2QA 5KNJA 2WQOA 3DZOA 4L3LA 2PU8A 3GU4A 2NO3A 3REPA 3GBZA 5DEYA 4ACDA 3RAWA 5JSMA 4QMPA 5AP7A 3TNHA 4QTAA 4U3ZA 3W0PA 2BDWA 2X0OA 3Q52A 3T8OA 1PYEA 1Q97A 3OUKA 3W2QA 3KMMA 3RGFA 3EFJA 2BFXA 3P23A 5A46A 3PIZA 4Q9ZA 1JKLA 2XUUA 4TYGA 5FM2A 3DOGA 2GSFA 4ZS0A 5HCZA 2RFEA 2VO6A 5GNKA 4N0SA 3QQHA 3EQFA 4CTCA 2C5OA 4JL9A 4Q2AA 2XCKA 3H4JA 1URWA 4R3PA 2C0IA 3NS9A 3FYKX 4FGBA 4MF1A 4P7EA 4IZ5A 4GYIA 4ANLA 4RJ6A 4O0VA 4O2PA 2C5VA 5JQ5A 1I09A 5E8WA 2C68A 1KV1A 4B0GA 2QOKA 4I1ZA 5L6OA 3A7IA 3QTIA 3MB6A 1DS5A 3CLYA 2CSNA 3S3IA 5FXSA 3ZLYA 2XIZA 5AV2A 3NUPA 4FG9A 3GVUA 2WMWA 4NTTA 2VUWA 3ORKA 2ETRA 4ZSEA 4RMZA 4EHVA 3DJ6A 3KY2A 3LFEA 2C6KA 4O7TA 2JIIA 4IACA 4R6VA 3PG3A 4RJ4A 3N4UA 4YJPA 5HLWA 3UVPA 2R3MA 2W1FA 4FTLA 2Z2WA 4GFOA 2PTKA 2X81A 5TR6A 4TN6A 5FEEA 4MCVA 3RNIA 3RWQA 4F7JA 5CEKA 2AC3A 4FK3A 3Q9ZA 2WOUA 1REJA 1OL1A 2OF2A 5CSHA 2Y4PA 3VBWA 4ALUA 1PMNA 3P1AA 4OTFA 2XNMA 2OU7A 4CMUA 2C6DA 1ZOHA 2R3LA 3FV8A 4DGOA 4C4JA 5KHXA 3Q2JA 4X2KA 3ZZEA 2GNGA 3H3CA 5HNBA 5HKMA 4JDIA 4HGTA 5JQ8A 2VV9A 4XUFA 3C5IA 2Y0AA 3EKNA 3PXKA 3GXLA 3G9NA 3GC7A 2B1PA 3DPKA 4QP7A 2WTWA 4JR3A 4K0YA 4EUUA 3HMPA 4YHJA 4Y73A 2OFUA 3R7GA 2VTIA 4DH8A 4ZJVA 4C02A 4IJPA 3G0EA 4AAAA 4DEAA 3FZOA 4YJVA 3VS0A 3UIBA 4BYJA 3JYAA 3ATSA 2A19B 2QKWB 4ZK5A 2X7GA 4I6BA 4RIXB 5T68A 5KMLA 2YIRA 3PY1A 2PZYA 4U42A 5DRBA 4BCHA 2VTPA 1Q4LA 2Z7LA 2OIDA 4IB0A 3WOWA 1K3AA 1Q61A 1KE7A 4DGNA 4RX5A 5BX0A 3OBGA 2SRCA 3MTFA 1R78A 5D10A 4U9AA 2GFSA 3LCSA 3R73A 3VULA 3OT3A 5H8GA 3HUBA 4UXQA 4BWXA 3DFAA 2VO0A 4BIEA 3CIKA 4A4OA 4BGQA 4F9WA 4L3JA 3TG1A 4ZOGA 2BILB 5M56A 1WBTA 2HZIA 5E1EA 4V0GB 1H1SA 5EYCA 4IDTA 4FV0A 1UWHA 4R77A 2A2AA 3KN5A 5A6OA 4BCQA 4BZDA 4RGJA 3PTGA 4IAIA 2WMRA 3IQ7A 2X39A 4I23A 2FYSA 4MH7A 4PX6A 5ANOA 4DC2A 4RJ3A 3NIZA 3QZGA 2GQGA 2X2LA 2XJ0A 3RI1A 3ZYAA 4PL4A 4E6CA 2UZTA 4KWPA 2W9ZB 1FPUA 1UA2A 4DA5A 2ZJWA 3QXPA 1NT2A 3TEIA 3VUHA 3QTSA 4J97A 3JPVA 5IQEA 3KXZA 2WTKB 4O38A 4S32A 1H0VA 2IZTA 4RZWA 3CKWA 3FPMA 4OTQA 5CQWA 4CFVA 3VNTA 3MFTA 4Z55A 4D1SA 4S34A 2R3HA 1YRPA 4LOPA 3C13A 3AGMA 4FEVA 4H36A <