4FV2A

Crystal structure of the erk2 complexed with ek5
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
347
structure length
344
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 344
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv2A01
3EL8A 2GPHA 4CFFA 5JKGA 2YJSA 5HO7A 4DG2E 3K5UA 3FDNA 1PKDA 4GFGA 4CZYB 2YDJA 2QR8A 2ZB0A 1WBOA 4O1OA 4RJ4A 4NW5A 5HO8A 3S3IA 3OBGA 5HCZA 5F94A 3O7LB 4FTLA 5CI6A 1B38A 3C0IA 3F3TA 4FSQA 1DS5A 2B9IA 2YM8A 4O83A 4RIWA 4ASDA 4BFMA 5I9WA 2J7TA 5KBRA 4L9IA 4ZTQA 4YHTA 4IC7A 4O21A 1OECA 3IK3A 3TKUA 1SVHA 3R6XA 1OPLA 1RQQA 2V5QA 2RFNA 3P79A 5FUTA 4IJ9A 2W06A 2CSNA 4DFXE 4NK9A 2YJRA 5TT7A 1KE7A 1B6CB 3CQUA 4RIXA 5AR8A 2XK7A 4UX9A 3UZPA 4O84A 3LOKA 4Y5QA 4TL0A 4OW8A 2NP8A 3HV5A 3FKNA 1GIHA 2FO0A 1ZOEA 3IONA 2QO2A 2O8YA 2ERKA 5M57A 2YIQA 3OZ6A 2XKDA 5CEQA 4FIHA 4PMMA 2VO7A 2PE0A 2UV2A 4BN1A 4XG2A 5DLSA 4B9DA 4YZ9A 3UIBA 2YWVA 4JLCA 5HGIA 4KNBA 3BZ3A 4QQJA 4I41A 4ALWA 3FY0A 3E93A 5JGAA 4IB0A 4EKLA 3IECA 3DK3A 4QQCA 4AW2A 3NGAA 4FKPA 4RLLA 2ZDTA 5KMJA 5DFPA 4ORKA 4OAVB 3IW5A 3UBDA 5JRSA 4U45A 3KKVA 5HVKA 4BZNA 4FNWA 1YXXA 1YI4A 4I21A 2BFYA 5AX9A 2UZBA 3F5XA 4YMJA 3VBYA 4O7NA 2XK8A 1MQ4A 4M0ZA 4BCMA 4D2PA 2PY3A 2H6DA 3MA6A 4C3RA 2VUWA 3PP0A 1XBCA 3ANQA 3Q4TA 4YUQA 1NT2A 3JY0A 4F9WA 2XIRA 5C4LA 1TKIA 4H58A 3NWWA 1XH7A 4MBJA 4P5ZA 3DJ7A 4H39A 1W8CA 5KUPA 3D5XA 1H28A 1H1QA 3KCFA 4FV4A 4FUXA 4YC8A 3AC4A 4G5JA 4DCAA 3O2MA 3DJ6A 3R63A 4FL2A 3DPKA 3QALE 3IW4A 5CQUA 3FQHA 2JDTA 2GTMA 3PE1A 5EDQA 4IB3A 3UGCA 3VQHA 3AMYA 3KVXA 3CLYA 4JAIA 2VTHA 4XBRA 3CQWA 3CIKA 3ZONA 2UZEA 3TJCA 2RIOA 4DTBA 5CI7A 4KKHA 3U4UA 5HQ0A 3ZYAA 3RK7A 3ZRKA 3Q6UA 2NO3A 3LCOA 5DR9A 3MH2A 2XIZA 3TUCA 3HV4A 5HNBA 4FV6A 3MYGA 3QAME 4HCVA 4XYFA 5CF6A 2R0UA 3RHKA 1A48A 2BFXA 3DBQA 4RFMA 3EQCA 3E8DA 3Q4CA 1FGKA 1OBDA 3QLGA 3HA6A 5CU3A 3RM7A 2XBJA 4RX7A 4YBKA 5E91A 3EKKA 3WF6A 5LVNA 5EQYA 3W2QA 1KE5A 2OIQA 3BKBA 4B0GA 1ZLTA 3QRJA 2UW6A 4NIFA 3DLSA 4IAIA 3MY5A 3ZDUA 4LGGA 4IQ6A 1ND4A 4FKRA 5ETCA 5CEPA 2YDIA 2A27A 2JD5A 1OPKA 2HW7A 2QG7A 4TZRA 3UNKA 3IOPA 2BZJA 3R00A 4AZVA 3Q3BA 5IDNA 4Q9SA 3UO6A 4ACGA 2O65A 4FKTA 5CT7A 3JVSA 1J3HA 5CU6A 3QTRA 1PXLA 2F2CB 3LFEA 5TF9A 4RG0A 2JBPA 1ZY5A 2XIKA 3QX4A 4LGDA 3RKBA 3WIGA 2WMXA 3LM5A 4KIQA 4ENYA 2ZB1A 4U9AA 1AGWA 4BKJA 1YDRE 3TL8A 3SD0A 5J9LA 3R8LA 3R02A 3O51A 3DZQA 2WTKB 5AR3A 3D5WA 4D2TA 4F09A 5KO1A 3S00A 4BDGA 1UU3A 3QXPA 4LMUA 4DH7A 4Y73A 3PTGA 1KV2A 1U59A 2RFSA 2VTTA 3ACJA 4BKYA 2I0YA 3F9NA 4IH8A 4GJ3A 4RIOA 3THBA 3QGYA 1P4OA 2R64A 1OKVA 3VNTA 4FV1A 2E9VA 4I0TA 3SGCA 2PZRA 3A8XA 3GBZA 3HL7A 4U3YA 3S4QA 1Y6BA 3VUHA 5AAEA 3LIJA 4KD1A 4F08A 2GMXA 2Y7JA 3C5IA 3AC1A 3EFLA 3F7WA 3L1SA 3TCPA 5IISA 1Q3WA 3KXGA 3LLAA 5E8YA 4MNEB 5A4EA 2Y6MA 3JY9A 4QQ5A 1Q8ZA 2WMAA 4RC3A 4RJ8A 2ACXA 2IO6A 2OH0E 4JX7A 5AV2A 4EYMA 4Z3VA 2YM5A 3LFCA 2VO0A 4NM5A 4GUEA 1YI3A 4C58A 5AP4A 3QQLA 4WBBB 3OXZA 2ITNA 5J79A 4D2WA 3EZRA 5AR5A 1KOAA 1WBNA 3AQVA 2GU8A 3QHRA 4I6HA 1R1WA 4QT1A 4V01A 4ZTLA 3KMUA 2VO6A 4U8ZA 4YJVA 3PPZA 5H9BA 2W4KA 1XH5A 3NNUA 1ZMWA 2B52A 4NM7A 3A4OX 4WD5A 3QUDA 3R7EA 5BX0A 2YM7A 3ZO4A 2UW7A 5KMLA 2WGJA 3L9NA 4AQCA 5D41A 3VF8A 1WMKA 3MPAA 3Q2MA 3C1XA 4LUEA 5IQGA 3KA0A 2IG7A 3CSVA 4KRCA 2UZVA 4MQ1A 4I4EA 4QD6A 4CYJA 2DUVA 4CFWA 2AUHA 4BC6A 2BRBA 3CJGA 5KMOA 3BHYA 3PIXA 5DIAA 2UZWE 1L3RE 3TV6A 4GFMA 5HIEA 4WNOA 2HZ0A 5AP6A 3MSSA 3I0OA 4IC8A 2QOFA 2R3MA 3QF9A 2J6MA 5AV0A 5HOAA 5AFVA 3BYMA 5C1QB 3R28A 4I92A 2ITTA 4JDHA 4ZJJA 2OLCA 2OH4A 4Q9ZA 1PMVA 3NUNA 5AUTA 2YCSA 3VS2A 3A61A 5HU9A 3WF5A 1P14A 3ZCLA 4FG9A 3UQCA 3BLQA 3CR0A 3FQSA 3OWKA 3VS4A 3PA5A 1JSTA 3HP5A 4BGHA 3DB8A 4FSYA 4YPSA 4DFUA 2QO7A 4O2ZA 3D15A 4G3FA 4MF0A 5G6VA 2W4OA 2B54A 2R3HA 3ZM4A 2XZSA 2FSLX 4BR3A 3QZGA 3BRBA 3H30A 1U54B 4FTTA 2YCQA 5BUIA 3TNIA 1E1XA 3OHTA 5EH0A 2PMNX 3PVGA 4WG4A 2OI4X 4FT3A 3D94A 2XNPA 3R21A 3KXZA 2WMTA 4RZVA 4FTAA 4ZTNA 2VWZA 3GC0A 5AP2A 2OJGA 5BVEA 3A7FA 4AT4A 4DEAA 5EK7A 2BZHB 4YGAA 5FTOA 2C0IA 2R3GA 3F3WA 3QTWA 5CU2A 3MBLA 3NW6A 4ACCA 4DEBA 3UIUA 2B0QA 3AT3A 3P4KA 3UG1A 1W7HA 3QWKA 4NW6A 3VBWA 4K0YA 4ARKA 5E8SA 2JKOA 4B8MA 5CT0A 2RFEA 4N57A 1UKIA 3ZLSA 4KBCA 4PP7A 4DC2A 3NUAA 4MXXA 4YZCA 2ITYA 5J9YA 2JAVA 2QNJA 3MPMA 4QNAA 5HG8A 3ZLXA 4F64A 2O5KA 1ZWSA 3NYOA 1ZRZA 2C69A 2WQEA 3W32A 2R7BA 2WIHA 3R9RA 3U6HA 2OWBA 1IG1A 4ERKA 4L8MA 4AAAA 5CEMA 3QYWA 5J95A 5LOHA 5AEPA 3EJ1A 3NIZA 1PJKA 4LG4A 1H0VA 4EK3A 2YHVA 2W96B 3MH0A 1SMHA 4TYEA 4QP9A 5IA1A 3DV3A 3C4FA 3Q5IA 2IJMA 3BQCA 4EHZA 4AW0A 4GK4A 3FLQA 3QA0A 2CN5A 1OL2A 5CWZA 5FM3A 3ZRLA 3C7QA 4M68A 3W2PA 3UIMA 4YTHA 3ZFXA 1QCFA 5LMAA 4IB1A 3FAAA 1JPAA 2R3OA 1HCLA 3KMWA 2E9OA 3M1SA 4OTHA 4DBXA 4NL0A 3IW8A 3HAMA 3W10A 5TR6A 2V7OA 3K2LA 3GVUA 5IH6A 5EM8A 4Q2AA 3ITZA 3L9LA 4QMUA 1K2PA 3WIKA 5LVMA 2GS6A 3ZSGA 4OT5A 5D1JA 4FEVA 5HVYA 4PL5A 3E92A 4JBPA 4XNEA 3TI1A 3UP7A 4PWNA 4BF2A 3OS3A 2ZVAA 4BGQA 2W1CA 4ZTSA 5FLFA 4BCPA 1WFCA 3U6JA 3FYKX 3KXHA 5AM6A 2C5OA 4C35A 2C0TA 2C6MA 3CCNA 4FYOA 1ZYJA 4QPMA 5AUWA 2UW8A 4L45A 1CDKA 5HG9A 5K3YA 5C9CA 4UALA 4AX8A 4I6FA 3TZ9A 4M8TA 4C2WA 2ITQA 4PQNA 5IEYA 3ORIA 2YDKA 4NFNA 4ZOGA 4RVKA 4DFYA 3EL7A 3PWDA 3LCDA 5HG5A 2QOBA 4CFVA 3DTCA 3UZTA 1Q62A 2PL0A 2RF9A 3NNWA 5HNGA 3UPXA 3HNGA 2FB8A 3EN7A 2HYYA 3WZKA 2HWPA 3ZO3A 4HVSA 4TWCA 4I6QA 4JG8A 4TW9A 3K54A 2W4JA 5EM7A 3QZFA 4ZSJA 5DNRA 5M53A 4AT3A 3VBVA 3UZRA 2J0LA 4RC4A 3ZFYA 4IHPA 2PMLX 2CHLA 5E4HA 3LPBA 4Z16A 1YKRA 5H8BA 5J7HA 4A06A 2ITUA 4QMSA 4ACHA 4BCQA 4YURA 3D83A 2NNWB 1Q24A 1Q4LA 1V0PA 2CCHA 2HY0A 4FEQA 4O0VA 4X2NA 2A4LA 3GOKA 4QTAA 1VR2A 1M7NA 5IH5A 4CG8A 4F65A 4RX5A 2X0GA 3C5UA 4DBNA 5GIPE 4GK3A 3I60A 4QMZA 2QCSA 1W83A 1WBSA 3C4XA 3OTUA 5HVJA 3QTUA 2W1DA 5I3OA 4E20A 1XKKA 3GEQA 2V22A 4D4VA 3FE3A 5LVLA 2PMIA 4EHGA 4FVRA 4F0GA 4ASZA 4KIOA 2HXQA 4E6DA 4G9RA 3MI9A 1BMKA 1ZY4A 3F2RA 3HMMA 3SRVA 3V8SA 5BVFA 4MX9A 2ITXA 3POOA 4GS6A 4JRVA 4E5WA 2PZ5A 4U80A 2BIKB 4FODA 3RCDA 5D9HA 2CGUA 4QYEA 4DE4A 4IEBA 1O9UA 4K9YA 3GCQA 1MRYA 3DFCB 3U8WA 4NH1A 4DEHA 4G17A 3VJNA 2BZIB 4AA4A 2IZRA 2BMCA 2CDZA 4P4CA 4MXAA 4XG4A 3ANRA 2FVDA 2WQMA 1MUOA 3FEGA 3EN4A 2R2PA 1MRVA 1JNKA 4EHVA 1XHAA 5HE2A 3FXXA 4TNBA 3ZU7A 3IOKA 2F49A 3F66A 3OCBA 4J1RA 3ZTXA 5M08A 4LI5A 4UZDA 4DA5A 3W1FA 3QHWA 2XNGA 2B1PA 4ZMFA 3F6XA 2VZ6A 2QVSE 2YM6A 2HY81 4X3FB 5EM6A 5FWKK 1F0QA 4O2PA 1J1CA 4CEGA 5ETAA 5L2SA 3JYAA 3C4CA 5FGKA 4AOIA 3R8ZA 4NYEA 4IM3A 1WZYA 5LMKC 2IVTA 2ITZA 4G16A 1ZYDA 2A19B 3POZA 3LAUA 4FSWA 2C3IB 5CVHA 2UZUE 1OL5A 2X6EA 1PF8A 2P4IA 3AMBA 4YC6A 2VTSA 4FNZA 3ULZA 3BQRA 3MVMA 5AUYA 1YVJA 4FKIA 3TN8A 3ZUVA 4CFNA 1GIIA 2P2IA 4BDKA 4GW8A 4G6NA 2R3QA 4C61A 2DS1A 4BIDA 1OL1A 4EK5A 4RQVA 3ULIA 1FGIA 3HA8A 3D5VA 3JUHA 3PSDA 4BTKA 1H4LA 4O7SA 2R3RA 4RIWB 3TZMA 4O0RA 4CZUA 2Z2WA 4FMQA 1XQZA 4TNDA 2W5AA 3GI3A 4I5PA 4ZTMA 3F7ZA 2VGOA 3NIEA 5AIRA 4FL1A 3GU6A 2HCKA 4W8DA 4GYIA 4JOAA 3R7IA 5A4CA 5HTCA 5GZ8A 3IGOA 3BU6A 2YEXA 4S31A 4G34A 3SC1A 4EORA 4RIXB 4RVMA 5CYIA 2R3NA 3W2SA 2HXLA 5CF8A 4ZY6A 3E7VA 3DXPA 2YABA 4EHEA 4FZ6A 5FEQA 2F2UA 4D28A 2O2UA 5F9EA 5HTBA 2VX0A 5CZHA 3PP1A 3V5WA 3OWPA 1Z57A 3H9OA 5LARA 3FMLA 3GCSA 4P90A 3NNVA 5E7RA 3Q4ZA 4U0IA 2JC6A 1XH9A 2CNUA 2JKQA 3UE4A 3WZUA 4ZLOA 2X4ZA 3KMMA 1VYWA 3DKGA 2UZNA 4IVCA 4RFZA 2HAKA 3FXZA 1YHVA 2EVAA 2XNOA 4FEXA 4AP7A 4WIHA 3A7IA 3UDBA 2PZIA 5IG1A 3R7YA 2J50A 3CGOA 2JAMA 3TWJA 1GOLA 3PXZA 4J8MA 5HEZA 2CLQA 2QOQA 2WXVA 4IBMA 5ACBC 5D7VA 2WEIA 4HVHA 3R1YA 3T3UA 3W2OA 3TM0A 5L2QA 4CXAA 2X8IA 4FGRA 1H07A 4A7CA 3ZRMA 5C4KA 4NJDA 4N6YA 4WOVA 3P7BA 2XRWA 3DCVA 3FL4A 2QG5A 1VYZA 3NX8A 5C27A 2CLXA 3IG7A 4HGSA 4I0RA 3MVJA 3BU5A 4WG5A 4IAKA 2X8DA 4MBLA 3D0EA 3MY0A 4EKKA 3BV3A 1XH8A 3HV3A 1B39A 3ODZX 4TYIA 4E4LA 1CMKE 4QMOA 3PPJA 4AZTA 2QI8A 4JJRA 4O6EA 4EL9A 4H36A 5HLNA 2OJIA 2UW9A 4GU6A 1PKGA 3FC2A 4H3PA 2VTNA 3ZO1A 5CXHA 2JFLA 2WTJA 4E26A 2Y9QA 2YAAA 4FKVA 1H27A 4GG5A 3WF8A 1JQHA 4CGAA 4BDDA 2EXCX 3VHEA 4M14A 2C1AA 4ITHA 4NKAA 1YQJA 2PE1A 1R0EA 5EYKA 3O23A 5FQDC 3ORZA 1I09A 2WFYA 5LXMA 2WMUA 2YFXA 4PDSA 2ITOA 2B9JA 3BGQA 2IW8A 4IAYA 3VO3A 3FYJX 3KN6A 3FLSA 4TYGA 3NAXA 5FG8A 4O0WA 5HIBA 2JDVA 3ZOSA 4XCUA 4X21A 2YCRA 5K4IA 4AE6A 2PVNA 4NIFB 3DJ5A 1PMUA 3QQUA 4LQMA 4LYNA 5CSPA 1ZOHA 2Z7SA 3CTQA 4XP2A 5DMZA 4KS7A 2BAQA 2BIYA 4O38A 4O7ZA 4GK2A 4M12A 3OMVA 4IZ7A 4B4LA 3RWPA 1EH4A 3EB0A 5FBNC 4AGUA 2C3LA 3FMNA 4R6VA 3UODA 2CGXA 2WIPA 5AP0A 2JDOA 4QTDA 4C3FA 2UZOA 3LQ3A 3HGKA 4R1YA 3U9CA 5LVOA 4DFNA 2IWIA 4HVGA 1JKKA 4NM3A 1O6LA 4NZWB 3VWAA 4YHJA 1WBTA 4D9TA 2OFVA 4C59A 3E5AA 3BYVA 3R04A 5BVWA 4A4XA 3D9VA 4UV0A 3ZC6A 4R8QA 2X39A 5E9EA 4ANLA 4PRJA 4KSQA 5A4TA 3ORTA 5FEEA 4FSUA 2WOUA 2XNNA 4TN6A 3M2WA 4GKIA 3ZZWA 2AYPA 1WBPA 2VTPA 4EJ7A 4OLIA 4BZDA 5K0XA 4FYNA 3MFSA 4NKSA 3OW4A 4ZS0A 3VS6A 1GIJA 2XIXA 2BALA 3NW7A 5HTIA 4UXQA 2Q0NA 4XLIA 4NEUA 4EJNA 2X7GA 3DKOA 5J7BA 4O1PA 3EFWA 1PY5A 3IO7A 2E9PA 3KCKA 3R30A 4XV2A 4ZJVA 2ZDUA 3QCYA 2VWIA 3Q6WA 3U9NA 4E4MA 4BI0A 4Y72A 4EQMA 3NYNA 4IWPA 3GENA 5CX9A 2YIYA 4OR5A 5KBQA 1REKA 4YR8A 3R7UA 2GS7A 2R4BA 3OOGA 2OZAA 2HZNA 5EHYA 4ZXTA 3NW5A 3A7JA 4EEVA 1Y6AA 3V3VA 3IKAA 2R3LA 4XG9A 5EI2A 4FKOA 5ANIA 1U5QA 1CKJA 1KUTA 4QYHA 4YLJA 3O7LD 3RPOA 2Y6OA 4A9UA 4IB5A 3VAPA 3OY1A 4O0TA 3D14A 3F2NA 3QCXA 4ID7A 4BDJA 2XK6A 4KWPA 2GQRA 2J5FA 5E1SA 2I6LA 3ZXZA 4BDCA 3MVLA 2W5HA 3HRCA 3EH9A 4JT3A 2GQGA 1CTPE 5JGDA 2PVLA 2Q83A 3U4WA 3E8CA 3H9FA 3B2TA 3KXXA 2YZAA 5FDPA 2VWYA 3PG3A 2UW5A 1Q8TA 4MD9E 5EDRA 4EC9A 4EWHA 2BKZA 4RT7A 2JITA 1PXJA 4Y85A 5HESA 4PMPA 4L68A 5M4CA 3MPTA 4FGBA 4U97A 3NDMA 3BI6A 4E6AA 3SG9A 4W8EA 3LW0A 2J0JA 3PIYA 3GCVA 4S32A 5I5ZA 4CMOA 3NSZA 4II5A 5HE3A 2W1GA 1OPJA 1PRYA 4FV7A 3HRFA 3O0GA 4FV8A 4ANQA 2H96A 3FL5A 3O96A 3F3UA 3RINA 3ROCA 3SOCA 4R7BA 5BMSA 4V04A 5EOBA 3SXSA 3EN5A 4PUZA 4BVUA 3E87A 3V5TA 4BYJA 2CN8A 4C4IA 2WMWA 4CCBA 1GZOA 4AACA 2PVRA 2XKFA 4AE9A 4C2VA 4BBMA 5AV4A 5BNJA 1JBPE 3I79A 3S2PA 3T3VA 4A9TA 1GAGA 4MQ2A 4CKIA 3RPSA 5GNKA 5LJJA 3CEKA 2J0IA 2VO3A 4U3ZA 4HYHA 4EK4A 3NAYA 5IUGA 4HCTA 5F95A 5EYCA 3E3BX 1M2PA 3PA3A 3UO5A 3QA8A 2HWOA 4TWNA 3FV8A 5GINE 2GNGA 3FY2A 3F5UA 3H10A 3KRRA 4G3GA 4I0SA 5EG3A 2VD5A 3QC4A 4CNHA 3FZTA 4MCVA 5HX6A 4MWIA 4AXAA 3OXTA 2YACA 4A4OA 2JEDA 4UB7A 2C3JA 4R78A 3OBJA 2BHHA 4EK8A 2QOIA 3GNIB 2QO9A 2GCDA 3DNDA 4F6SA 4V0GB 2C1BA 4MTAA 4YJRA 5JGBA 3MA3A 4BIEA 4EC8A 1W98A 3QRKA 3PJCA 3EMGA 1NXKA 4UZHA 4RGJA 2VTJA 5FBOA 3HRBA 3EQBA 1AQ1A 1FMKA 3OEZA 4FICA 4FK6A 4RA4A 4BCIA 4CD0A 1GZ8A 3VIDA 2YCFA 4YP8A 2H9VA 3DS6A 4RIYA 3HKOA 4R3PA 4BDHA 4CYIA 4JVGA 3QBNA 3D5UA 4BHZA 4A9YA 3T9TA 3ID6C 4E5AX 5DPVA 2VTIA 4QPSA 2WMSA 4RLKA 5AADA 4BDFA 3R8UA 4HPTE 3W18A 4AA5A 3ZC5A 2W1HA 2ZM4A 3G9LX 4RZWA 5CAPA 3BBWA 3BWJA 4EWQA 1Y8GA 2ITPA 2VWWA 4CCUA 3BYSA 3PJ2A 2QURA 3KN5A 3VS3A 3DBDA 2G2IA 4Y95A 3G51A 3ZH8A 4DH5A 4IW0A 4CLIA 3SG8A 3W33A 3RZBA 2B4SB 4J8NA 3AD4A 3HX4A 4YLKA 3KULA 4QYFA 4LRMA 4DGGA 3ZSHA 2OXDA 4ANMA 3R9DA 4O7YA 3HZTA 2XKCA 3OT8A 3HMIA 3NVMB 4BTJA 2VU3A 4BCNA 4FX3A 3CBLA 4D0WA 4D5HA 3EFJA 3LCKA 3ZUUA 4LV8A 5M07A 5EQEA 3GC7A 3LJ0A 4FTKA 3UPZA 5KX8A 3RK5A 3EQHA 3DNEA 3MJ2A 5IQHA 4KIKB 4AZSA 5AUVA 4CZTA 1FBNA 2UZDA 4C4FA 4IWOA 4Y46A 4ZSEA 2BDFA 3GCPA 4BI1A 2F57A 2QU6A 1V0OA 2GNIA 3RNYA 2OXYA 4X6RA 4QYGA 4AGDA 2WQBA 2YLEA 3V5JA 2CCIA 4UMUA 3KL8A 4MXYA 3ZXTA 1OM1A 2B53A 4I22A 2XKEA 4FSTA 1OUKA 1QPJA 4XG8A 3W8QA 4HGLA 1STCE 2YWPA 4R5SA 5I0BA 5JMSA 1ZZ2A 3QQKA 3KEXA 4O7LA 5C8KA 3CXWA 2CKPA 2XB7A 4LGHA 2REIA 3V6RA 2EXEA 4FR4A 4JI9A 4U44A 5BUEA 1M2QA 3W2RA 5JZJA 4K2RA 2QOHA 4ZS4A 3FMKA 1PHKA 3FMDA 3Q60A 3H4JA 3TNWA 2IVUA 4YPDA 2EB2A 2A2AA 3T8OA 4OTFA 5FXSA 5A6NA 3RVGA 1PMNA 3ELJA 3CKXA 2I1MA 3C0HA 5E1EA 4BIBA 3ORMA 1JAMA 2XUUA 3HUBA 3IPHA 4FTIA 2X2KA 3O8PA 2H34A 3V51A 4ZSLA 3RPYA 1ATPE 3OOMA 4APPA 3CGFA 4MXZA 3GT8A 4FBXA 2HK5A 1ZMVA 4C38A 2XBAA 1BUHA 1DI8A 5CS6A 5DGZA 3QKLA 4D55A 4IX5A 4EH9A 4EUUA 1OL6A 3VULA 4FEWA 3GUBA 3QCSA 5AV3A 2JFMA 3HECA 3UYTA 4BWPA 4J95A 2PK9A 1K3AA 3BYUA 4QNYA 4R7IA 5HE1A 4F0FA 4GMYA 5ICPA 4S34A 2PE2A 5JFWA 2OJJA 4YLLA 1OL7A 2WTIA 2C6IA 1JSUA 2VNWA 4I6BA 5AUZA 4E5BA 3MJ1A 2YA9A 3PXQA 5EM5A 1PYXA 5CENA 3LMHA 3NCZA 3UQFA 3EIDA 1FVVA 2X6DA 3DZOA 1TQIA 3OC1A 4RPVA 3VHKA 2DYLA 1URCA 3LFFA 4HW7A 3TUDA 4S2ZA 4A9RA 4JG7A 2X7FA 5L8JA 5AP3A 3TDWA 4HYSA 4GCJA 3WZDA 5T6KA 3U55A 3PZEA 1A06A 3E8NA 3IGGA 5IQAA 3SDJA 4N4SA 3UNJA 3R71A 5HIDA 5M06A 1OKZA 4KB8A 4B7TA 5J1WA 1YOJA 2X81A 3HV6A 5BYYA 1U46A 3WF9A 4EOQA 4YSMA 2FSTX 4HCUA 3HVCA 4I93A 4XV1A 3D7TB 4MF1A 4CG9A 5A46A 1XBAA 2O3PA 4IZYA 3OCGA 3LFDA 2ZM1A 2R3IA 4FV2A 2I0EA 4FNYA 4PTEA 5AR2A 2P3GX 3VBTA 1H1SA 2UZLA 3FMEA 4EH6A 1Z5MA 2NRYA 4RVTA 3LZBA 4MXOA 4ZIMA 3MH1A 4K18A 5KKRB 4FZAB 3QZIA 4TYHB 3HMPA 4UN0C 2ESMA 2FYSA 1OUYA 3BLRA 3EN9A 4KS8A 4RJ5A 5GZAA 4G1WA 2ETMA 1PXOA 2W5BA 2WTKC 4FT0A 2R9SA 3V5QA 3BE2A 3NUUA 1WVXA 4WSYA 2W99B 3BLHA 3EYHA 3LQ8A 5K5NA 4U5JA 4I5MA 2YM4A 4F9AA 2VN9A 3FC1X 4QP2A 1KE6A 5KCVA 4H05A 4RJ3A 4PTGA 4USDA 4CKJA 2R3FA 5H8EA 3PY3A 4GT5A 1R0PA 2C47A 3TNHA 5ANDA 3S95A 3A8WA 3D2KA 2QC6A 4C57A 4ZAUA 4CRSA 4BCGA 4F63A 2BILB 4PL3A 5ANGA 4FVQA 3L8XA 2J5EA 1S9JA 5HBJA 3VUMA 4DT8A 3LFAA 1S9IA 4FIJA 4H3BA 3TNPC 1BI8A 4WA9A 4JBQA 3SXFA 3I5ZA 4UBAA 4E8AA 3MFUA 2ZAZA 5IQDA 3NUYA 3TTJA 5FRIA 1YHSA 4W4WA 3I7BA 3I81A 5DBXA 5IA3A 1U5RA 4O22A 3F3VA 4FOBA 3BPRA 2ZV2A 4MVFA 5H3QA 3F88A 5FP6A 3P7CA 3TNQB 3MTFA 1K9AA 4LOOA 3K3JA 3B8RA 4BTFA 4WRGA 4X2FA 4BKZA 4ZLZA 4LRJA 1LEZA 3PXKA 5AJQA 3U54A 3FI3A 4DGNA 3ZM9A 3OWLA 3FUPA 4U81A 5CNNA 4S33A 4DINA 4BRXA 3L8SA 2FGIA 2V55A 1H0WA 3AGMA 3E88A 4PV0A 4MH7A 3I7CA 4EZ3A 4IAAA 5F1ZA 5JFVA 3WOWA 3DTWA 3MFRA 1Q3DA 5IPJA 3EQFA 3KF4A 3RP9A 3V5PA 3I0QA 3WE4A 5DEYA 3FHRA 3PY0A 2X8EA 3I6UA 3ERKA 3QUEA 4TT7A 3ETAA 1REJA 3G5DA 3QD3A 3R2BA 5DWRA 3KRXA 4EOOA 4FSRA 4XLVA 3AD5A 3P08A 2XNBA 4PF4A 3BHHA 5HHWA 4AF3A 3OCTA 5JH6A 4FSMA 2IVVA 4M67A 4YO6A 1M52A 3RAWA 4NM0A 2V7AA 4DLIA 4EUTA 2QU5A 5HBHA 5JEBA 2VWBA 1H26A 4G3CA 3SX9A 3TIZA 3OUNB 2SRCA 4UWBA 2BTSA 5JFXA 4LRKA 4GRBA 4NSTA 4D4SA 2PU8A 4MHAA 4M13A 5DRDA 3P78A 4L46A 4XHKB 4K11A 1T46A 4KRDA 4U43A 1OITA 3R1QA 4RFYA 4A4LA 1W84A 3MIYA 3SXRA 1T45A 3QTZA 2C3KA 2XK9A 5DT3A 4PPAA 4CSVA 3UTOA 4KBAA 3OT3A 2WMVA 2C6OA 3MY1A 3PVBA 3UOKA 1H1PA 3TV4A 2A1AB 2QLQA 4YBJA 3P86A 4V05A 4W4YA 5KMIA 2X9EA 4DTKA 3UVQA 2WEVA 3EKNA 1IAJA 5D12A 1PYEA 4RJ7A 3L8PA 5EFQA 5AAGA 4GVJA 5B2MA 4JG6A 4DH3A 4JNWA 3BWFA 2XCKA 4X2GA 1J7IA 5L8LA 5LCJA 4RSSA 5A54A 3NCGA 5GJFA 5BMMA 3SVVA 2RKUA 4QTBA 4K33A 2H8HA 3DQXA 4Q5EA 2BKKA 3BIZA 4JDJA 4OTPA 4CT2A 4FI1A 4ZP5A 4FG8A 2J9MA 4U42A 4DFLA 4J96A 3CD8A 2UVZA 2GNJA 2Y4IB 4FVPA 1XO2B 4UMQA 3D7ZA 1OVEA 4I3ZA 2WQOA 4QMNA 1IAHA 2OK1A 5J5SA 2Q0BA 4EOLA 3NPCA 3G6GA 5KKRC 3FI2A 3BEAA 3H0YA 3NYXA 5FM2A 4UYNA 4LUDA 3RWQA 2XJ1A 3H3CA 5L6PA 1KOBA 4AA0A 4BHNA 1Y8YA 3NYVA 3TKIA 5J1VA 2WTWA 3CD3A 3FSFA 4AOTA 3LM0A 1UU7A 3LFQA 3U6IA 4M97A 1KSWA 2C6LA 3LJ2A 3AD6A 3PJ8A 4O82A 1I44A 1WBVA 2NRUA 3G6HA 3UYSA 2I0VA 3VUDA 4IIRA 4ZY4A 2HIWA 1IASA 4USEA 2Z7RA 5JT2A 2RSVA 4QP6A 4ZZOA 4YJQA 1U54A 4BZOA 4GT3A 5C8MA 5HNIX 4FZ7A 4IFCA 2CKOA 3U87A 1G5SA 2ITWA 4O0XA 3LHJA 3CY2A 5E8WA 5TKDA 3K3IA 2XK3A 4EBVA 4IAFA 1GZNA 3KFAA 4BGGA 1TQMA 5DHJA 1QPCA 5KHXA 3NEWA 4DGLC 5E8XA 1FVTA 4FKGA 3MB7A 3VS7A 5B0XA 4DF3A 2J0KA 5M51A 5EI8A 4QP7A 4PNKA 4GG7A 4JX3A 4A9SA 4DGMA 4CFMA 5EDPA 3OVVA 2XIYA 4L67A 2OGVA 5HICA 4U79A 4GFOA 4EONA 4HNIA 2YIRA 3D2IA 4FIFA 4D1SA 2J2IB 2JGZA 2ZMCA 3O8TA 4FT7A 4FF8A 4RA5A 4IX4A 5EW9A 2GTNA 3Q4UA 2XYUA 4PMTA 3LFSA 3R8MA 4FKJA 1DAYA 1UKHA 2V0DA 1ZYSA 3COHA 3FPMA 3BHVA 3GXLA 3QRTA 4IJPA 2WTDA 3FXWA 2WZJA 1UNHA 3N9XA 3R7GA 1CSNA 2G2HA 2IZTA 3FSKA 3PSBA 4WT6A 2CGWA 4L53A 5DA3A 1KWPA 3B8QA 2OZAB 4YZDA 2VTMA 3Q9XA 5M4IA 4BL1A 4BWKA 4I5HA 5IA2A 3E63A 1FMOE 3FKLA 5L6OA 5HD7A 3LFNA 4IM2A 2BUJA 5AA9A 4FSZA 5E90A 5JFSA 1OMWA 5BVNA 1SVEA 4KAOA 4J71A 3EQIA 3IW7A 1PXKA 3AMAA 1TVOA 1NVRA 2BR1A 1ZMUA 2UW0A 4I94A 3W2CA 3UVPA 3MIAA 1J91A 4HJOA 5CAQA 4U40A 2CNVA 2C6DA 3UG2A 4IFGA 4UXLA 1MP8A 1H00A 4O81A 2BRGA 4TY1A 5DI1A 4X2KA 4CV8A 3KK9A 3QTSA 2GHGA 3RTPA 1UNLA 3QL8A 4UYAA 5LMKA 1UWHA 1UU9A 4G5PA 3FLYA 4PDOA 3ZUTA 2UUEA 2VTLA 5ETIA 4DFBA 2YM3A 3FI4A 3RMFA 3BELA 1PXPA 3FMJA 4TKSA 4C3PA 3T9IA 4RJ6A 4D4RA 4ZZNA 1YXVA 5EKOA 3ATTA 3KRLA 3VBXA 5CSHA 3IDBA 2EWAA 1UWJA 3F5GA 3DT1A 4IANA 3RHXA 2XJ0A 5C26A 2OW3A 3UIXA 4F70A 3Q32A 4M69A 5CZIA 5KZ0A 3KF7A 2J90A 3SV0A 2G1TA 2P0CA 1J7UA 2GDOA 2ONLC 2RG6A 4FIIA 4E93A 3M11A 4JIAA 3OUKA 4O7WA 3BHTA 2FSOX 5BQ0A 3BEGA 2WD1A 4GEOA 2W1IA 3RBWA 5GJDA 3UO4A 4J99A 5EYMA 4C37A 3SKCA 4KINA 4EZ5A 1DM2A 3HEGA 3K5VA 4FV3A 4EYJA 4I5CA 5JK3A 5K0KA 2OFUA 4KA3A 2LAVA 3PXRA 2R3PA 2Y4PA 3OROA 4YO4A 4FTUA 5BYZA 4GU9A 4NTSA 3VRZA 3PRIA 1IEPA 2Y4IC 4E7WA 5M56A 4GKHA 4XG6A 5BVKA 3ET7A 3ZFMA 1SVGA 4CVAA 5B2LA 4IVBA 4C8BA 5JN2A 2HELA 2X1NA 2B9HA 3R8PA 2XM9A 3CY3A 3AC2A 5FDXA 4YJNA 3UJGA 1LEWA 3G9NA 1Y91A 2YAKA 4RWKA 4S30A 2G15A 1FVRA 2KULA 4MKCA 2OF4A 5FP5A 2PVFA 5LWNA 5DYJA 2IZUA 4G31A 4GT4A 1F5QA 4F9YA 1JOWB 4WG3A 2GNHA 1YXUA 4AOJA 4F1TA 1WVYA 3ZDIA 4LM5A 5HLWA 1GZKA 4FZDB 4GJ2A 4MBIA 4M84A 1NY3A 3EOCA 2ZOQA 3KC3A 4QMPA 5F4NA 4EOIA 3ZLWA 3QD4A 3JR1A 3WYYA 4F0IA 1XJDA 2IZSA 5I9UA 3MFTA 3G0FA 5AAFA 4AN3A 2W17A 3COIA 2WMBA 5EKNA 5IQIA 2W9FB 2EXMA 2XJ2A 3PSCA 4X3FC 5AIKA 5D10A 5I3RA 1SM2A 2XH5A 3FZOA 4AZEA 5BVDA 3CS9A 5A6OA 5DE2A 4EH7A 2F9GA 2WQNA 4M66A 1M17A 4YJOA 4A07A 4BDIA 2QKWB 3DBCA 2KTYA 5B2KA 4R3RA 3TT0A 5L2TA 2BVAA 4YSJA 3ATSA 2OICA 4WHZA 2IW9A 4FK3A 2EU9A 2OIDA 4NCTC 4B99A 2PYWA 2OBJA 4BDEA 5TOZA 5M55A 1R78A 3Q9YA 3BGPA 4O0SA 4WKQA 3LXLA 3VS5A 2I40A 3II5A 4JR7A 2I7QA 2XYNA 4F7JA 2C0OA 4DEEA 3NS9A 1JSVA 5JZNA 4BDBA 4CTBA 4CV9A 3VUKA 4QQTA 3ALOA 3EQGA 1ZOGA 2O63A 4G9CA 4PTCA 3DFAA 1JVPP 4G2FA 3KULB 4M0YA 4OTWA 3RPRA 4C33A 4O86A 5EYDA 5IUIA 4E1ZA 2CMWA 2Z7QA 4K77A 3DKFA 4KUJA 1QPEA 5DT0A 5CAVA 5IQCA 3B2WA 1YXTA 3QFVA 2Z02A 3R1NA 3MWUA 3C51A 4QOXA 1XR1A 1VZOA 1E1VA 2JIVA 5AP1A 3ZBFA 4OUCA 5CAOA 4WUAA 1BX6A 5I9ZA 3F61A 2B7AA 5G1XA 4LFIA 2PULA 2VTAA 4BCJA 1OBGA 2Y8OA 4GSBA 4ACDA 1UV5A 4W4XA 5AMNA 3DK7A 4JS8A 4NFMA 3RZFA 1F3MC 1QL6A 2WELA 3R1SA 2OJ9A 4H1MA 1P2AA 4FKUA 1OGUA 2G9XA 4X3FA 3CP9A 3AGLA 4OTIA 5E92A 2C5XA 3OCSA 4NUSA 4XP3A 2QKRA 2XF0A 4RMZA 3VW6A 4E4XA 1SYKA 2PUPA 2WTVA 4ANSA 4G3EA 4NCTA 4RC2A 4J7BA 2PHKA 3HMOA 4JRNA 5EQPA 4CQGA 3LQ5A 4FNXA 4MXCA 4MD8E 4CFUA 5IUHA 3LXKA 4E6QA 4L00A 3F69A 4Y83A 3WYXA 2PZYA 5ANJA 3PXYA 4MAOA 2QR7A 4FG7A 4XV3A 1HCKA 2C6EA 3C0GA 1NA7A 4RQKA 4O7TA 4QTEA 4RWLA 2FA2A 1P4FA 4O7VA 2C6KA 4OBPA 2PTKA 4RWJA 5ANKA 5TE0A 4FC0A 4E73A 3UOJA 1PXNA 2F7ZE 3QQFA 4L3JA 4XP0A 5BVOA 2W7XA 3DQWA 3NNXA 2XCHA 4R7HA 2WMQA 3DXNA 3HV7A 3DY7A 4CMTA 2BAKA 2BAJA 5K4JA 3KVWA 4ALUA 1CKIA 3NMUF 1PMEA 2PSQA 1OIYA 2X7OA 3EHAA 4WO5A 1RE8A 5IH4A 2VGPA 4EOMA 5EW8A 4D1ZA 1IR3A 2GQSA 5IA5A 4AUAA 5ACKA 3KGAA 4DYMA 2OKRA 2AC5A 1JKTA 3UP2A 2AC3A 3R7OA 2QOKA 1NVQA 4RBLA 3SW4A 1X8BA 4E3CA 3GFEA 4IDVA 3BCEA 3OG7A 5I9XA 2C5YA 2Z8CA 3FLNC 5JQ5A 4AFJA 4YNOA 2BRMA 2PZPA 2C6TA 3DAKA 1Q8UA 3R7VA 3QUPA 4EQUA 3WE8A 4HPUE 4ONAA 1BLXA 5J87A 3ZBXA 2JIUA 3QD2B 5TO8A 2VWXA 4X0MA 4DTAA 5AUUA 2R3JA 3IS5A 3VQUA 5IA4A 4JBOA 4DCEA 3C50A 2G2FA 4UY9A 4XS2A 4AGCA 2X2MA 2J4ZA 1RJBA 4DEIA 3QKKA 3F2AA 4R1VA 4BB4A 3ORLA 1VEBA 3PFQA 4KKEA 4N70A 4OBOA 5CY3A 4F99A 1BL6A 5IEVA 1OB3A 2UW4A 3KQ7A 3ODYX 4EOSA 3GU7A 3QQHA 5HU3A 4Z7GA 4ZSGA 3O50A 4YTCA 2W9ZB 5I9YA 5IU2A 4JQ8A 5FXQA 3SLSA 4IWDA 1WBWA 3LMGA 4QP4A 5LQFA 1HOWA 4Z9LA 5GHVA 4FV0A 2XP2A 4WSQA 2V62A 3F3ZA 4IAZA 2ERZE 2G01A 4PX6A 2OG8A 2ZV8A 5BUJA 2WB8A 4D0XA 3GQLA 4D2SA 3TDVA 5KZIA 4J98A 4XUFA 1GY3A 2R3KA 4W9XA 2X2LA 4C34A 5D7AA 3Q9WA 2UVYA 3TACA 4YHFA 2DQ7X 4EOKA 4XG7A 2QODA 4EQCA 5IQFA 3EQDA 4EH8A 5EHLA 3UNZA 3PIZA 5J9ZA 3ZEWA 3EYGA 3LVPA 3BBTB 5LMBA 3V04A 5LWMA 3TJDA 3LLTA 2BPMA 2IW6A 3PDTA 2IN6A 4L3PA 4QMWA 3SHEA 2VTRA 5M4UA 1Q8WA 2PUUA 4NJ3A 1DAWA 4WUNA 4F7NA 4YJSA 3RAIA 4ANOA 4RWIA 4YJTA 3RALA 4ITIA 4UWYA 5HD4A 3QTQA 4TRLA 3TIYA 1QMZA 1A9UA 2W0JA 2W1ZA 2JDRA 4K8AA 3C4EA 4O7RA 1RW8A 1FQ1B 4HGEA 3FLWA 3PJ1A 4XX9A 2ETRA 4GVAA 3AG9A 3GFWA 3UQGA 4KBKA 4DITA 1JKSA 3HP2A 3VW8A 4EZ7A 5BPYA 3LMIA 2OO8X 2QQ7A 4TXCA 1Q8YA 3BHUA 5GIOE 2WO6A 3L9PA 2XMYA 4AN2A 4IZ5A 5HLPA 1CKPA 2JKMA 5J8IA 1YWVA 1Z9XA 4K6ZA 4ZTHA 5AP7A 5AP5A 5LCKA 1XBBA 3VRYA 2QHMA 3N4UA 2B55A 3PLSA 4QP8A 4IXPA 3IQ7A 1P5EA 1ZXEA 3ZO2A 3A2CA 2QOCA 3C4ZA 4JDKA 4XH6A 5CASA 2Y0AA 3TEIA 2JKKA 1W82A 4X7QA 1UNGA 3CC6A 3P0MA 3PWYA 4QRCA 4W4VA 2UW3A 3HDNA 4H3QA 5FTQA 2VV9A 1R39A 3V5LA 4AS0A 3G2FA 5A4QA 4OAUC 2GHLA 4D1XA 4BCFA 3WILA 4UMPA 4B6LA 4OTQA 5I4NA 5CSWA 1KE8A 4CRLA 1H1RA 5FEDA 4QMTA 4JXFA 4QO9A 1SZMA 4BCHA 1IA9A 3VF9A 4L7SA 3AC8A 3P9JA 5DH3A 3QX2A 5CEIA 2X4FA 2J51A 4U6RA 1YDSE 4D9UA 4YZBA 3DK6A 3H0ZA 4PDPA 5L6WL 5K5XA 4UWCA 4ZK5A 3BGZA 3CJFA 3HYHA 1KV1A 2DWBA 2O64A 5CQWA 4GIIA 4GV1A 2YZLA 2GHMA 1YOMA 1LP4A 4TYJA 5HORA 3RJCA 2YIWA 2ETKA 3P7AA 5L2IA 4C02A 1OKYA 3REPA 4IVDA 3WARA 1YOLA 2BDWA 3PJ3A 4F9BA 5CF5A 4L44A 2OU7A 2P33A 1LR4A 4JAJA 2C30A 4AG8A 1H24A 2UVXA 2OXXA 3ORPA 4FTCA 5CVFA 3COKA 2A0CX 2B9FA 3OTVA 5EI6A 3VS1A 4PNIA 4JQ7A 4BY9E 3FZSA 2XRUA 3ROYA 4JQEA 4FL3A 2F4JA 4GH2A 3SOAA 1PW2A 3SQQA 5DG5A 1H08A 1UU8A 3R83A 3QQGA 5AA8A 3RK9A 3O17A 4U41A 4IE9A 5A9UA 4ANNA 3SRVB 1YXSA 2W1EA 4BYIA 5AR4A 1FOTA 2JBOA 3DA6A 3TXOA 4ASEA 3TTIA 3OWJA 4FKSA 2IVSA 2O0UA 4O0UA 4AZWA 4XRLA 4PDYA 2FH9A 3HMNA 3KRJA 4BBEA 4LMNA 2EB3A 4BWXA 4AWIA 4XJ0A 4AW1A 3RNIA 3G0EA 4NT4A 2FUMA 4DHFA 2PVJA 3QRIA 3FKOA 1TQPA 3G90X 5EOLA 5CEOA 3DBEA 3IW6A 2GSFA 2QONA 3PZHA 1BL7A 2JLDA 2GFCA 2XVDA 3V8TA 2WU7A 3P5KA 5GJGA 1YI6A 3QLFA 3VN9A 4GYGA 3CE3A 3PRFA 5HKMA 1M2RA 3LXNA 2XS0A 2OIBA 4ZTRA 4ANBA 1URWA 3ZEPA 2YITA 3MTLA 5DRBA 4Z55A 2WPAA 3SAYA 4YTFA 1G8SA 4DH1A 3DGKA 3QCQA 1WAKA 5IA0A 4WNKA 4JIKA 3C4WA 4C0TA 1WVWA 5E8VA 5A14A 5L3AA 3HUCA 3MV5A 1MQBA 2RGPA 4FTMA 4GUBA 3RAHA 5CALA 5CANA 5IZFA 4ZLYA 3KREA 2QOLA 2Z7LA 3I6WA 2WHBA 3ACKA 1H01A 3TUBA 3WI6A 3R01A 3HLLA 3MH3A 3QTIA 4HYUA 2ITVA 3BYOA 5DR2A 4QP1A 2P2HA 4V0GA 5T68A 2BRHA 1Q5KA 3ORXA 4TPTA 3GGFA 2I0HA 4C4EA 5JQ8A 5ITAA 4OT6A 2ZYBA 3EZVA 3V8WA 4L52A 2XA4A 4KIPA 5C8NA 3SW7A 4XBUA 3COMA 3GC9A 3KXMA 3BE9A 3Q9ZA 5HBEA 3CQEA 4BCOA 3LE6A 4K1BA 3KK8A 3OF0A 3JPVA 3JVRA 2VRXA 3KRWA 4WBOA 3M42A 2VNYA 3QYZA 3TKHA 3PG1A 3DDQA 4MYGA 3GOPA 3FBVA 4DH8A 4MD7E 1YDTE 5IQEA 5ETFA 4DT9A 4AZFA 4FA2A 4G6OA 1RDQE 4XOZA 4F4PA 3LKMA 4C7TA 2WAJA 1PXMA 3GCUA 3ORNA 4MK0A 5DEWA 5E8TA 4EOPA 2GS2A 4I20A 3CTJA 3ZLYA 4OTDA 5CSXA 4AN9A 4NU1A 3R73A 4IX3A 4I1ZA 4U7ZA 3JXWA 3FMMA 2R5TA 5D11A 5J5TA 1M7QA 5CVGA 1GNGA 3RCJA 2PVHA 3KU2A 3VUIA 3FPQA 5DN3A 1OIQA 4OTRA 3QXOA 4UEUA 4QMLA 5IKWA 3UOLA 2BROA 2HW6A 4LL5A 2VWVA 4ACMA 4B8LA 3WBLA 4CQEA 4HGTA 3G15A 3IDCA 3I1AA 5HG7A 3WF7A 3DBFA 3E62A 4HOKA 4IZAA 4ENXA 4FIGA 3MN3A 3CPBA 4C4HA 3A7GA 4IVAA 4XV9A 2YIXA 3AT4A 4KIKA 5AX3A 4FSNA 4M69B 3QZHA 3V6SA 2QLUA 4O27B 3NUXA 3R9HA 5KNJA 4MNEA 3NUSA 4FTJA 1LPUA 3DKCA 4AW5A 1JLUE 5JRQA 4FKLA 2HOGA 2R7IA 1MRUA 2X9FA 3LXPA 3VVHA 1O6KA 4J52A 4L42A 4TTHB 4QP3A 4RX8A 4ZJIA 2GFSA 2CKQA 2C5NA 4HYIA 4M7IA 4QMYA 5EW3A 2PWLA 4F1OA 4QPAA 3R9NA 4UMRA 3VBQA 1IA8A 2PPQA 5E8UA 1NW1A 3DXQA 5ANOA 4CFXA 4MEDA 4P5QA 3Q52A 4BTMA 3S1HA 1WCCA 4YTIA 4IX6A 3GQIA 3MB6A 3RGFA 1U4DA 2E9UA 4J97A 4JDIA 4IADA 4YNEA 1NVSA 3S0OA 5M09A 2WMRA 4H1JA 5AR7A 1JKLA 2C5VA 4HVDA 1BKXA 4FT5A 2ZM3A 3A60A 1UVRA 1G3NA 2RG5A 1OIRA 3VC4A 4Z7HA 3CPCA 3Q04A 3FZRA 4MNFA 4AGWA 4J53A 4R5YA 4EH2A 5IQBA 2OSCA 2WU6A 4FUYA 4ERWA 2XNMA 1V1KA 1DI9A 1G8AA 4WRSA 3RI1A 3TG1A 2GNLA 3PVWA 3GU8A 4R3CA 3E3PA 3ALNA 4HZSA 5M44A 1JWHA 4XEYA 3OW3A 2VTOA 4CT1A 3OFMA 2CGVA 1W0XC 3JS2A 3LCTA 4PMSA 2BHEA 4DEGA 2HENA 2F7XE 2RFDA 3QC9A 2J0MB 5CTPA 5HI2A 3ZS5A 2W1FA 3DAEA 4X3JA 4XOYA 2OZOA 4ITJA 3SA0A 1PXIA 3H9RA 4W9WA 1APME 3ZHPC 5CLPA 5CXZA 4Y8DA 4PPBA 1R3CA 3F82A 4L43A 3MW1A 5KHWA 1ZARA 4WNMA 4XG3A 3L8VA 3RAKA 1AD5A 3W16A 1IRKA 4FZFB 4BBFA 3FMHA 4X2JA 4F6WA 4ZMEA 3E7OA 3DU8A 5L2WA 4FTNA 1BI7A 2CPKE 5B7VA 4FT9A 1ZAOA 1FINA 3OY3A 2PVKA 2Z60A 3E8EA 3D7TA 3FJQE 3PXFA 4DN5A 4EBWA 5HCXA 2IPXA 4I23A 1YW2A 4IACA 2PUNA 2QD9A 4PY1A 3I4BA 2CKEA 3MVHA 4G6LA 4O0YA 5DT4A 4CKRA 3Q2JA 5CNOA 4F6UA 3V01A 1YRPA 2QHNA 3R22A 5AUXA 5HCYA 4DAWA 4EH3A 3P1AA 3EN6A 3FI8A 3MS9A 4P7EA 2WKMA 3O8UA 2VTQA 3Q96A 4KABA 4TYHA 5CAUA 2PMOX 2CJMA 5L8KA 2HZIA 2RL5A 3CTHA 4PPCA 5HO6A 4HZRA 4YC3A 4RVLA 3A4PA 3Q53A 2VWUA 5DOSA 1Q41A 4WNPA 4D5KA 4FV9A 4CLJA 3C13A 4QTCA 5E8ZA 1SNXA 4ASXA 4D2VA 3LCSA 4BICA 3AC3A 2UZTA 3Q5ZA 3VJOA 4FKWA 3A99A 1V0BA 3DLZA 2YISA 2F7EE 3CKWA 3EQPA 3MGYA 1ERKA 2CNQA 2C68A 2VX3A 3QQJA 4FTQA 3UC4A 3W55A 4YZNA 2BDJA 3I5NA 3TZ8A 5FTGA 5BYLA 4HNFA 4USFA 5HX8A 3R8VA 2NPQA 4P2KA 5CSVA 2WOTA 4AFEA 1O6YA 4BI2A 3FQEA 3FZPA 3AXWA 3W8LA 4JR3A 3VUGA 3D4QA 5LVPA 3MDYA 3G33A 4CTCA 5T3QA 2PVMA 3DDPA 3UVRA 2WNTA 2ZJWA 4FKQA 3UMWA 5IDPA 3L9MA 3N4TA 3PE2A 4UMTA 3FWQA 4N6ZA 3AOXA 4FIEA 2R0IA 3OEFX 3RM6A 2ZV9A 3E64A 1L8TA 3BX5A 5JSMA 3GB2A 4D2RA 3MESA 4E6CA 3WZEA 3EFKA 5DVRA 3NLBA 3NZ0A 1XWSA 5F20A 4DG3E 4DLJA 3AC5A 2W05A 5HZNA 4YU2A 3GP0A 4IWQA 2EUFB 4YZMA 3GC8A 2BCJA 5H8GA 4TWOA 3PVUA 4GIHA 3UC3A 3DOGA 5DR6A 2YN8A 3QD0A 2OF2A 4IM0A 4EH5A 4KKGA 4HVIA 3DAJA 5IF1A 2GNFA 3ZMMA 4FOCA 5KMNA 3HAVA 3KXNA 5L4QA 3ENMA 5I9VA 4ALVA 5CEKA 2ZV7A 4FE2A 3R9OA 1YWRA 4IMYA 4D4YA 4EK6A 4OTGA 2P55A 1OIUA 4RX9A 4AU8A 4CMUA 4DG0E 1BYGA 1VJYA 2BZKB 5KMMA 2VAGA 5AM7A 4Y5HA 4D58A 1YWNA 4FTOA 5ANEA 2BRNA 3AT2A 3PA4A 4F7LA 4G3DA 1SNUA 4YJPA 1H25A 5KE0A 1M14A 4C4GA 4O6LA 3QWJA 3VS0A 1ZZLA 3OXIA 1KE9A 2XNEA 3RPVA 4LL0A 4LV5A 4NTTA 4C36A 5CU0A 3PUPA 3TV7A 4E4NA 4L6QA 3PY1A 1E9HA 5AWMA 4L7FA 4M3QA 3QRUA 3R0TA 3FHIA 4ZZMA 4O91A 3FLZA 1GJOA 5FD2A 2ONLA 4M15A 5CF4A 1XH6A 2XEYA 4JL9A 3N51A 3U51A 4I4FA 1J7LA 3IDPA 1FPUA 5KMKA 3OP5A 4QYYA 2HZ4A 3FZ1A 4JBVA 4F9CA 4RIYB 2FSMX 1QPDA 3C9WA 4FEUA 5FXRA 4RRVA 1Y57A 2JIIA 3ZZEA 2E9NA 2WTCA 4LOPA 5IMEA 1ZYCA 4F7SA 3LFBA 5A3XA 4C62A 2QOOA 4MWHA 3GU5A 4QMQA 3F5PA 4PP9A 3ZSIA 3PPKA 4XRJA 3O71A 5CU4A 3UOHA 5A4LA 3EWHA 1LUFA 4L3LA 3VUTA 4GL9A 3NR9A 2XK4A 3A62A 2BTRA 4OBQA 3PLAE 1Q61A 3LJ1A 4BCKA 2PUIA 1H8FA 4EH4A 3GU4A 3PYYA 4PL4A 2YERA 1ZYLA 2E2BA 4AT5A 4L01A 5IMXA 3NRMA 2PVYA 4ZEGA 4QMMA 2YLFA 1YHWA 1UA2A 5AV1A 4DEDA 4OGRA 1XH4A 3BV2A 5HE0A 4X6QC 4EOJA 3WZJA 2OJFE 5H2UA 1OI9A 3NUPA 3QTXA 4LOQA 2JDSA 3EQRA 4ZY5A 3QKMA 2XM8A 3R2YA 5IEXA 3HDMA 3QGWA 3NVKI 4DGOA 4C4JA 4DFZE 3ENHA 3BU3A 3P23A 4ZSAA 3ORKA 4IDTA 1Q97A 4BDAA 1OKWA 3KY2A 1J1BA 5M4FA 3QU0A 4N0SA 4NWMA 3OD6X 4TWPA 1Q99A 3A7HA 4Q5HA 4KSPA 4FV5A 2LGCA 3KB7A 4YJUA 2XEZA 3TZ7A 4FTRA 2C4GA 1CM8A 2VX1A 5EHOA 4APCA 4I24A 5GZ9A 5K9IA 3DB6A 4QMVA 5C01A 4R77A 1OZ1A 4O96A 1H1WA 5C03A 3UMXA 3N4VA 4EI4A 2ZMDA 4XMOA 4F1MA 4QMXA
chains in the Genus database with same CATH superfamily
3EL8A 2GPHA 4CFFA 5JKGA 2YJSA 5HO7A 4DG2E 3K5UA 3FDNA 1PKDA 4GFGA 4CZYB 1G8KA 2YDJA 2QR8A 2ZB0A 1WBOA 4O1OA 4RJ4A 4NW5A 5HO8A 3S3IA 3OBGA 5HCZA 5F94A 3O7LB 4FTLA 5CI6A 2AEGA 1B38A 3C0IA 3F3TA 4FSQA 1DS5A 2B9IA 2YM8A 4O83A 4RIWA 4ASDA 4BFMA 5I9WA 2J7TA 5KBRA 4L9IA 4ZTQA 4YHTA 4IC7A 4O21A 1OECA 3IK3A 3TKUA 1SVHA 3R6XA 1OPLA 1RQQA 2V5QA 2RFNA 3P79A 5FUTA 4IJ9A 2W06A 2CSNA 4DFXE 4NK9A 2YJRA 5TT7A 1KE7A 1B6CB 3CQUA 4RIXA 5AR8A 2XK7A 4UX9A 3UZPA 4O84A 3LOKA 4Y5QA 4TL0A 4OW8A 3BLAA 2NP8A 3HV5A 3W0RA 3FKNA 1GIHA 2FO0A 4DHJA 1ZOEA 3IONA 2QO2A 2O8YA 2ERKA 5M57A 2YIQA 3OZ6A 2XKDA 5CEQA 4FIHA 4PMMA 2VO7A 2PE0A 2UV2A 4BN1A 4XG2A 5DLSA 4B9DA 4YZ9A 3UIBA 2YWVA 4JLCA 5HGIA 4KNBA 3BZ3A 4QQJA 4I41A 4ALWA 2XALA 3FY0A 3E93A 5JGAA 3TYKA 4IB0A 4EKLA 3IECA 3DK3A 4QQCA 4AW2A 1XMMA 3NGAA 4FKPA 4RLLA 2ZDTA 5KMJA 5DFPA 4ORKA 4OAVB 3IW5A 3UBDA 5JRSA 4U45A 3KKVA 5HVKA 4BZNA 4FNWA 1YXXA 1YI4A 4I21A 2BFYA 5AX9A 2UZBA 3F5XA 4YMJA 3VBYA 4O7NA 2XK8A 1MQ4A 4M0ZA 4BCMA 4D2PA 2PY3A 2H6DA 3MA6A 4C3RA 2VUWA 3PP0A 1XBCA 3ANQA 3Q4TA 4YUQA 1NT2A 3JY0A 4F9WA 2XIRA 5C4LA 1TKIA 4H58A 3NWWA 1XH7A 4MBJA 4P5ZA 3DJ7A 4H39A 1W8CA 5KUPA 3D5XA 1H28A 1H1QA 3KCFA 4FV4A 4FUXA 4YC8A 3AC4A 4G5JA 4DCAA 3O2MA 3DJ6A 3R63A 4FL2A 3DPKA 3QALE 3IW4A 5CQUA 3FQHA 2JDTA 2GTMA 3PE1A 5EDQA 4IB3A 3UGCA 3VQHA 3AMYA 3KVXA 3CLYA 4JAIA 2VTHA 4XBRA 3CQWA 3CIKA 3ZONA 2UZEA 3TJCA 2RIOA 4DTBA 5CI7A 4KKHA 3U4UA 5HQ0A 3ZYAA 3RK7A 3ZRKA 3Q6UA 2NO3A 3LCOA 5DR9A 3MH2A 2XIZA 3TUCA 3HV4A 5HNBA 4FV6A 3MYGA 3QAME 4HCVA 4XYFA 5CF6A 2R0UA 3RHKA 4O4FA 1A48A 2BFXA 3DBQA 4RFMA 3EQCA 3E8DA 3Q4CA 1FGKA 1OBDA 3QLGA 3HA6A 5CU3A 3RM7A 2XBJA 4RX7A 4YBKA 5E91A 3EKKA 3WF6A 5LVNA 5EQYA 3W2QA 1KE5A 2OIQA 3BKBA 4B0GA 1ZLTA 3QRJA 2UW6A 4NIFA 3DLSA 4IAIA 3MY5A 3ZDUA 4LGGA 4IQ6A 1ND4A 4FKRA 5ETCA 5CEPA 2YDIA 2A27A 2JD5A 1OPKA 2HW7A 2QG7A 4TZRA 3UNKA 3IOPA 2BZJA 3R00A 4AZVA 3Q3BA 5IDNA 4Q9SA 3UO6A 4ACGA 2O65A 4FKTA 5CT7A 3JVSA 1J3HA 5CU6A 3QTRA 1PXLA 2F2CB 3LFEA 5TF9A 4RG0A 2JBPA 1ZY5A 2XIKA 3QX4A 4LGDA 3RKBA 3WIGA 2WMXA 3LM5A 4KIQA 4ENYA 2ZB1A 4U9AA 1AGWA 4BKJA 1YDRE 3TL8A 3SD0A 5J9LA 3R8LA 3R02A 3O51A 3DZQA 2WTKB 5AR3A 3D5WA 4D2TA 4F09A 5KO1A 3S00A 4BDGA 1UU3A 3QXPA 4LMUA 4DH7A 4Y73A 3PTGA 1KV2A 1U59A 2RFSA 2VTTA 3ACJA 4BKYA 2I0YA 3F9NA 4IH8A 4GJ3A 4RIOA 3THBA 3QGYA 1P4OA 2R64A 1OKVA 3VNTA 4FV1A 2E9VA 4I0TA 3SGCA 2PZRA 3A8XA 3GBZA 3HL7A 4U3YA 3S4QA 1Y6BA 3VUHA 5AAEA 3LIJA 4KD1A 4F08A 2GMXA 2Y7JA 3C5IA 3AC1A 3EFLA 3F7WA 3L1SA 3TCPA 5IISA 1Q3WA 3KXGA 3LLAA 5E8YA 4MNEB 5A4EA 2Y6MA 3JY9A 4QQ5A 1Q8ZA 2WMAA 4RC3A 4RJ8A 2ACXA 2IO6A 2OH0E 4JX7A 5AV2A 4EYMA 4Z3VA 2YM5A 3LFCA 2VO0A 4NM5A 4GUEA 1YI3A 4C58A 5AP4A 3QQLA 4WBBB 3OXZA 2ITNA 5J79A 4D2WA 4BJJB 3EZRA 5AR5A 1KOAA 1WBNA 3AQVA 2GU8A 3QHRA 4I6HA 1R1WA 4QT1A 4V01A 4ZTLA 3KMUA 2VO6A 4U8ZA 4YJVA 3PPZA 5H9BA 2W4KA 1XH5A 3NNUA 1ZMWA 2B52A 4NM7A 3A4OX 4WD5A 3QUDA 3R7EA 5BX0A 2YM7A 3ZO4A 2UW7A 5KMLA 2WGJA 3L9NA 4AQCA 5D41A 3VF8A 1WMKA 3MPAA 3Q2MA 3C1XA 4LUEA 5IQGA 3KA0A 2IG7A 3CSVA 4KRCA 2UZVA 4MQ1A 4I4EA 4QD6A 4CYJA 2DUVA 4CFWA 4JMQA 1OGYA 2AUHA 4BC6A 2BRBA 3CJGA 5KMOA 3BHYA 3PIXA 5DIAA 2UZWE 1L3RE 3TV6A 4GFMA 5HIEA 4WNOA 2HZ0A 5AP6A 3MSSA 3I0OA 4IC8A 2QOFA 2R3MA 3QF9A 2J6MA 5AV0A 5HOAA 5AFVA 3BYMA 5C1QB 3R28A 4I92A 3BL9A 2ITTA 4JDHA 4ZJJA 2OLCA 2OH4A 4Q9ZA 1PMVA 3NUNA 5AUTA 2YCSA 3VS2A 3A61A 5HU9A 3WF5A 1P14A 3ZCLA 4FG9A 3UQCA 3BLQA 3UDSA 3CR0A 3FQSA 3OWKA 3VS4A 2XAMA 3PA5A 1JSTA 3HP5A 4BGHA 3DB8A 4FSYA 4YPSA 4DFUA 2QO7A 4O2ZA 3D15A 4G3FA 4MF0A 5G6VA 2W4OA 2B54A 2R3HA 3ZM4A 2XZSA 2FSLX 4BR3A 3QZGA 3BRBA 3H30A 1U54B 4FTTA 2YCQA 5BUIA 3TNIA 1E1XA 3OHTA 5EH0A 2PMNX 3PVGA 4WG4A 2OI4X 4FT3A 3AKJA 3D94A 2XNPA 3R21A 4F78A 3KXZA 2WMTA 4RZVA 4FTAA 4ZTNA 2VWZA 3GC0A 5AP2A 2OJGA 5BVEA 3A7FA 4AT4A 4DEAA 5EK7A 2BZHB 4YGAA 5FTOA 2C0IA 2R3GA 3F3WA 3QTWA 5CU2A 3MBLA 3NW6A 4ACCA 4DEBA 3UIUA 2B0QA 3AT3A 3P4KA 3UG1A 1W7HA 3QWKA 4NW6A 3VBWA 4K0YA 4ARKA 5E8SA 2JKOA 4B8MA 5CT0A 2RFEA 4N57A 1UKIA 3ZLSA 4KBCA 4PP7A 4DC2A 3NUAA 4MXXA 4YZCA 2ITYA 5J9YA 2JAVA 2QNJA 3MPMA 4QNAA 5HG8A 3ZLXA 4F64A 2O5KA 1ZWSA 3NYOA 1ZRZA 2C69A 2WQEA 3W32A 2R7BA 2WIHA 3R9RA 3U6HA 2OWBA 1IG1A 4ERKA 1TFFA 4L8MA 4AAAA 5CEMA 3QYWA 5J95A 5LOHA 5AEPA 3EJ1A 3NIZA 1PJKA 4LG4A 1H0VA 4EK3A 2YHVA 2W96B 3MH0A 1SMHA 4TYEA 4QP9A 5IA1A 3DV3A 3C4FA 3Q5IA 2IJMA 3BQCA 4EHZA 4AW0A 4GK4A 3FLQA 3QA0A 2CN5A 1OL2A 5CWZA 5FM3A 3ZRLA 3C7QA 4M68A 3W2PA 3UIMA 4YTHA 3ZFXA 1QCFA 5LMAA 4IB1A 3FAAA 1JPAA 2R3OA 1HCLA 3KMWA 2E9OA 3M1SA 4OTHA 4DBXA 4NL0A 3IW8A 3HAMA 3W10A 5TR6A 2V7OA 3K2LA 3GVUA 5IH6A 5EM8A 4Q2AA 3ITZA 3L9LA 4QMUA 1K2PA 3WIKA 5LVMA 2GS6A 3ZSGA 4OT5A 5D1JA 4FEVA 5HVYA 4PL5A 3E92A 4JBPA 4XNEA 3TI1A 3UP7A 4PWNA 4BF2A 3OS3A 2ZVAA 4BGQA 2W1CA 4ZTSA 5FLFA 4BCPA 1WFCA 3U6JA 3FYKX 3KXHA 5AM6A 2C5OA 4C35A 4DDGA 2C0TA 2C6MA 3CCNA 4FYOA 1ZYJA 4QPMA 5AUWA 2UW8A 4L45A 1CDKA 5HG9A 5K3YA 5C9CA 4UALA 4AX8A 4I6FA 3TZ9A 4M8TA 4C2WA 2ITQA 4PQNA 5IEYA 3ORIA 2YDKA 4NFNA 4ZOGA 4RVKA 4DFYA 3EL7A 3PWDA 3LCDA 5HG5A 2QOBA 4CFVA 3DTCA 3UZTA 1Q62A 2PL0A 2RF9A 3NNWA 5HNGA 3UPXA 3HNGA 2FB8A 3EN7A 2HYYA 3WZKA 2HWPA 3ZO3A 4HVSA 4TWCA 4I6QA 4JG8A 4TW9A 3K54A 2W4JA 5EM7A 3QZFA 4ZSJA 5DNRA 5M53A 4AT3A 3VBVA 3UZRA 2J0LA 4RC4A 3ZFYA 4IHPA 2PMLX 2CHLA 5E4HA 3LPBA 4Z16A 1YKRA 5H8BA 5J7HA 4A06A 2ITUA 4QMSA 4ACHA 4BCQA 4YURA 3D83A 2NNWB 1Q24A 1Q4LA 1V0PA 2CCHA 2HY0A 4FEQA 4O0VA 4X2NA 2A4LA 3GOKA 4QTAA 1VR2A 1M7NA 5IH5A 4CG8A 4F65A 4RX5A 2X0GA 3C5UA 4DBNA 5GIPE 4GK3A 3I60A 4QMZA 2QCSA 1W83A 1WBSA 3C4XA 3OTUA 5HVJA 3QTUA 2W1DA 5I3OA 4E20A 1XKKA 3GEQA 2V22A 4D4VA 3FE3A 5LVLA 2PMIA 4EHGA 4FVRA 4F0GA 4ASZA 4KIOA 2HXQA 4E6DA 3AKKA 4G9RA 3W0SA 3MI9A 1BMKA 1ZY4A 3F2RA 3HMMA 3SRVA 3V8SA 5BVFA 4MX9A 2ITXA 3POOA 4GS6A 4JRVA 4E5WA 2PZ5A 4U80A 2BIKB 4FODA 3RCDA 5D9HA 2CGUA 4O4BB 4QYEA 4DE4A 4IEBA 1O9UA 4K9YA 3GCQA 1MRYA 3DFCB 3U8WA 4NH1A 4DEHA 4G17A 3VJNA 2BZIB 4AA4A 2IZRA 2BMCA 2CDZA 4P4CA 4MXAA 4XG4A 3ANRA 2FVDA 2WQMA 1MUOA 3FEGA 3EN4A 2R2PA 1MRVA 1JNKA 4EHVA 1XHAA 5HE2A 3FXXA 4TNBA 3ZU7A 3IOKA 2F49A 3F66A 3OCBA 4J1RA 3ZTXA 5M08A 4LI5A 4UZDA 4DA5A 3W1FA 3QHWA 2XNGA 2B1PA 4ZMFA 3F6XA 2VZ6A 2QVSE 2YM6A 2HY81 4X3FB 5EM6A 5FWKK 1F0QA 4O2PA 1J1CA 4CEGA 5ETAA 5L2SA 3JYAA 3C4CA 5FGKA 4AOIA 3R8ZA 4NYEA 4IM3A 1WZYA 5LMKC 2IVTA 2ITZA 4G16A 1ZYDA 2A19B 3POZA 3LAUA 4FSWA 2C3IB 5CVHA 2UZUE 1OL5A 2X6EA 3AMBA 1PF8A 2P4IA 2X0PA 2VTSA 4FNZA 4YC6A 3ULZA 3BQRA 3MVMA 5AUYA 1YVJA 4FKIA 3TN8A 3ZUVA 4CFNA 1GIIA 2P2IA 4BDKA 4GW8A 4G6NA 2R3QA 4C61A 2DS1A 4BIDA 1OL1A 4EK5A 4RQVA 3ULIA 1FGIA 3HA8A 3D5VA 3JUHA 3PSDA 4BTKA 1H4LA 4O7SA 2R3RA 4RIWB 3TZMA 4O0RA 4CZUA 4QEBA 2Z2WA 4FMQA 1XQZA 4TNDA 2W5AA 3GI3A 4I5PA 4ZTMA 3F7ZA 2VGOA 3NIEA 5AIRA 4FL1A 3GU6A 2HCKA 4W8DA 2NYAA 4GYIA 4JOAA 3R7IA 5A4CA 5HTCA 5GZ8A 3IGOA 3BU6A 2YEXA 4S31A 4G34A 3SC1A 4EORA 4RIXB 4RVMA 5CYIA 2R3NA 3W2SA 2HXLA 5CF8A 4ZY6A 3E7VA 3DXPA 2YABA 4EHEA 4FZ6A 5FEQA 2F2UA 4D28A 2O2UA 5F9EA 5HTBA 2VX0A 5CZHA 3PP1A 3V5WA 3OWPA 1Z57A 3H9OA 5LARA 1VLRA 3FMLA 3GCSA 4P90A 3NNVA 5E7RA 4AQKA 3Q4ZA 4U0IA 2JC6A 1XH9A 2CNUA 2JKQA 3UE4A 3WZUA 4ZLOA 2X4ZA 3KMMA 1VYWA 3DKGA 2UZNA 4IVCA 4RFZA 2HAKA 3FXZA 1YHVA 2EVAA 2XNOA 4FEXA 4AP7A 4WIHA 3A7IA 3UDBA 2PZIA 5IG1A 3R7YA 2J50A 3CGOA 4QDEA 2JAMA 3TWJA 3W0PA 1GOLA 3PXZA 4J8MA 5HEZA 2CLQA 2QOQA 2WXVA 4IBMA 5ACBC 5D7VA 2WEIA 4HVHA 3R1YA 3T3UA 3W2OA 3TM0A 5L2QA 4CXAA 2X8IA 4FGRA 1H07A 4A7CA 3ZRMA 5C4KA 4NJDA 4N6YA 4WOVA 3P7BA 2XRWA 3DCVA 3FL4A 2QG5A 1VYZA 3NX8A 5C27A 2CLXA 3IG7A 4HGSA 4I0RA 3MVJA 3BU5A 4WG5A 4IAKA 2X8DA 4MBLA 3D0EA 3MY0A 4EKKA 3BV3A 1XH8A 3HV3A 1B39A 3ODZX 4TYIA 4E4LA 1CMKE 4QMOA 3PPJA 4AZTA 2QI8A 4JJRA 4O6EA 4EL9A 4H36A 5HLNA 2OJIA 2UW9A 4GU6A 1PKGA 3FC2A 4H3PA 2VTNA 3ZO1A 5CXHA 2JFLA 2WTJA 4E26A 2Y9QA 2YAAA 4FKVA 1H27A 4GG5A 3WF8A 1JQHA 4CGAA 4BDDA 2EXCX 3VHEA 4M14A 2C1AA 4ITHA 4NKAA 1YQJA 2PE1A 3NFGB 1R0EA 5EYKA 3O23A 5FQDC 3ORZA 1I09A 2WFYA 5LXMA 2WMUA 2YFXA 4PDSA 2ITOA 2B9JA 3BGQA 2IW8A 4IAYA 3VO3A 3FYJX 3KN6A 3FLSA 4TYGA 3NAXA 5FG8A 4O0WA 5HIBA 2JDVA 3ZOSA 4XCUA 4X21A 2YCRA 5K4IA 4AE6A 2PVNA 4NIFB 3DJ5A 1PMUA 3QQUA 4LQMA 4LYNA 5CSPA 1ZOHA 2Z7SA 3CTQA 4XP2A 5DMZA 4KS7A 2BAQA 2BIYA 4O38A 3W0NA 4O7ZA 4GK2A 4M12A 3OMVA 4IZ7A 4B4LA 3RWPA 1EH4A 3EB0A 5FBNC 4AGUA 2C3LA 3FMNA 4R6VA 3UODA 2CGXA 2WIPA 5AP0A 2JDOA 4QTDA 4C3FA 2UZOA 3LQ3A 3HGKA 4R1YA 3U9CA 5LVOA 4DFNA 2IWIA 4HVGA 1JKKA 4NM3A 1O6LA 4NZWB 3VWAA 4YHJA 1WBTA 4D9TA 2OFVA 4C59A 3E5AA 3BYVA 3R04A 5BVWA 4A4XA 3D9VA 4UV0A 3ZC6A 4R8QA 2X39A 5E9EA 4ANLA 4PRJA 4KSQA 5A4TA 3ORTA 5FEEA 4FSUA 2WOUA 2XNNA 4TN6A 3M2WA 4GKIA 3ZZWA 2AYPA 1WBPA 2VTPA 4EJ7A 4OLIA 4BZDA 5K0XA 4FYNA 3MFSA 4NKSA 3OW4A 4ZS0A 3VS6A 1GIJA 2XIXA 2BALA 3NW7A 5HTIA 4UXQA 2Q0NA 4XLIA 4NEUA 4EJNA 2X7GA 3DKOA 5J7BA 4O1PA 3EFWA 1PY5A 3IO7A 2E9PA 3KCKA 3R30A 4XV2A 4ZJVA 2ZDUA 3QCYA 3TMOA 2VWIA 3Q6WA 3U9NA 4E4MA 4BI0A 4Y72A 4EQMA 3NYNA 4IWPA 3GENA 5CX9A 2YIYA 4OR5A 5KBQA 1REKA 4YR8A 3R7UA 2GS7A 2R4BA 3OOGA 2OZAA 2HZNA 5EHYA 4ZXTA 3NW5A 3A7JA 4EEVA 1Y6AA 3V3VA 3IKAA 2R3LA 4XG9A 5EI2A 4FKOA 5ANIA 1U5QA 1CKJA 1KUTA 4QYHA 4YLJA 3O7LD 3RPOA 2Y6OA 4A9UA 4IB5A 3VAPA 3OY1A 4O0TA 3D14A 3F2NA 3QCXA 4ID7A 4BDJA 2XK6A 4KWPA 2GQRA 2J5FA 5E1SA 2I6LA 3ZXZA 4BDCA 3MVLA 2W5HA 3HRCA 3EH9A 4JT3A 2GQGA 1CTPE 5JGDA 2PVLA 2IEWA 2Q83A 3U4WA 3E8CA 3H9FA 3B2TA 3KXXA 2YZAA 5FDPA 2VWYA 3PG3A 2UW5A 1Q8TA 4MD9E 5EDRA 4EC9A 4EWHA 2BKZA 4RT7A 2JITA 1PXJA 4Y85A 5HESA 4PMPA 4L68A 5M4CA 3MPTA 4FGBA 4U97A 3NDMA 3BI6A 4E6AA 3SG9A 4W8EA 3LW0A 2J0JA 3PIYA 4LDTA 3GCVA 4S32A 5I5ZA 4CMOA 3NSZA 4II5A 5HE3A 2W1GA 1OPJA 1PRYA 4FV7A 3HRFA 3O0GA 4FV8A 4ANQA 2H96A 3FL5A 3O96A 3F3UA 3RINA 3ROCA 3SOCA 4R7BA 5BMSA 4V04A 5EOBA 3SXSA 3EN5A 4PUZA 4BVUA 3E87A 3V5TA 4I6LA 4BYJA 2CN8A 4C4IA 2WMWA 4CCBA 1GZOA 4AACA 2PVRA 2XKFA 4AE9A 4C2VA 4BBMA 5AV4A 5BNJA 1JBPE 3I79A 3S2PA 3T3VA 4A9TA 1GAGA 4MQ2A 4CKIA 3RPSA 5GNKA 5LJJA 3CEKA 2J0IA 2VO3A 4U3ZA 4HYHA 4EK4A 3NAYA 5IUGA 4HCTA 5F95A 5EYCA 3E3BX 1M2PA 3PA3A 3UO5A 3QA8A 2HWOA 4TWNA 3FV8A 5GINE 2GNGA 3FY2A 1W2DA 3F5UA 3H10A 3KRRA 4G3GA 4I0SA 5EG3A 2VD5A 3QC4A 4CNHA 3FZTA 4MCVA 5HX6A 4MWIA 4AXAA 3OXTA 2YACA 4A4OA 2JEDA 4UB7A 2C3JA 4R78A 3OBJA 2BHHA 4EK8A 3ML1A 2QOIA 3GNIB 2QO9A 2GCDA 3DNDA 4F6SA 4V0GB 2C1BA 4MTAA 4YJRA 5JGBA 3MA3A 4BIEA 4EC8A 1W98A 3QRKA 3PJCA 3EMGA 1NXKA 4UZHA 4RGJA 2VTJA 5FBOA 3HRBA 3EQBA 1AQ1A 1FMKA 3OEZA 4FICA 4FK6A 4RA4A 4BCIA 4CD0A 1GZ8A 3VIDA 2YCFA 4YP8A 2H9VA 3DS6A 4RIYA 3HKOA 4R3PA 4BDHA 4CYIA 4JVGA 3QBNA 3D5UA 4BHZA 4A9YA 3T9TA 3ID6C 4E5AX 5DPVA 2VTIA 4QPSA 2WMSA 4RLKA 5AADA 4BDFA 3R8UA 4HPTE 3W18A 4AA5A 3ZC5A 3UDZA 2W1HA 2ZM4A 3G9LX 4RZWA 5CAPA 3BBWA 3BWJA 4EWQA 1Y8GA 2ITPA 2VWWA 4CCUA 3BYSA 3PJ2A 2QURA 3KN5A 3VS3A 3DBDA 2G2IA 4Y95A 3G51A 3ZH8A 4DH5A 4IW0A 4CLIA 4LV7A 3SG8A 3W33A 3RZBA 2B4SB 4J8NA 3AD4A 3HX4A 4YLKA 3KULA 4QYFA 4LRMA 3W0OA 4DGGA 3ZSHA 3UDTA 2OXDA 4ANMA 3R9DA 4O7YA 3HZTA 2XKCA 3OT8A 3HMIA 3NVMB 4BTJA 2VU3A 4BCNA 4FX3A 3CBLA 4D0WA 4D5HA 3EFJA 3LCKA 3ZUUA 4LV8A 5M07A 5EQEA 3GC7A 3LJ0A 4FTKA 3UPZA 5KX8A 3RK5A 3EQHA 3DNEA 3MJ2A 5IQHA 4KIKB 4AZSA 5AUVA 4CZTA 1FBNA 2UZDA 4C4FA 4IWOA 4Y46A 4ZSEA 2BDFA 3GCPA 4BI1A 2F57A 2QU6A 1V0OA 2GNIA 3RNYA 2OXYA 4X6RA 4QYGA 4AGDA 2WQBA 2YLEA 3V5JA 2CCIA 4UMUA 3KL8A 4MXYA 3ZXTA 1XMLA 1OM1A 2B53A 4I22A 2XKEA 4FSTA 1OUKA 1QPJA 4XG8A 3W8QA 4HGLA 1STCE 2YWPA 4R5SA 5I0BA 5JMSA 1ZZ2A 3QQKA 3KEXA 4O7LA 5C8KA 3CXWA 2CKPA 2XB7A 4LGHA 2REIA 3V6RA 2EXEA 4FR4A 4JI9A 4U44A 5BUEA 1M2QA 3W2RA 5JZJA 4K2RA 2QOHA 4ZS4A 3FMKA 1PHKA 3FMDA 3Q60A 3H4JA 3TNWA 2IVUA 4YPDA 2EB2A 2A2AA 3T8OA 4OTFA 5FXSA 4FRFA 5A6NA 3RVGA 1PMNA 3ELJA 3CKXA 2I1MA 3C0HA 5E1EA 4BIBA 3ORMA 1JAMA 2XUUA 3HUBA 3IPHA 4FTIA 2X2KA 3O8PA 2H34A 3V51A 4ZSLA 3RPYA 1ATPE 3OOMA 4APPA 3CGFA 4MXZA 3GT8A 4FBXA 2HK5A 1ZMVA 4C38A 2XBAA 1BUHA 1DI8A 5CS6A 5DGZA 3QKLA 4D55A 4IX5A 4EH9A 4EUUA 1OL6A 3VULA 4FEWA 3GUBA 3QCSA 5AV3A 2JFMA 3HECA 3UYTA 4BWPA 4J95A 2PK9A 1K3AA 3BYUA 4QNYA 4R7IA 5HE1A 4F0FA 4GMYA 5ICPA 4DHIB 4S34A 2PE2A 5JFWA 2OJJA 4YLLA 1OL7A 2WTIA 2C6IA 1JSUA 2VNWA 4I6BA 5AUZA 4E5BA 3MJ1A 2YA9A 3PXQA 5EM5A 1PYXA 5CENA 3LMHA 3NCZA 3UQFA 3EIDA 1FVVA 2X6DA 3DZOA 1TQIA 3OC1A 4RPVA 3VHKA 2DYLA 1URCA 3LFFA 4HW7A 3TUDA 4S2ZA 4A9RA 4JG7A 2X7FA 5L8JA 5AP3A 3TDWA 4HYSA 4GCJA 3WZDA 5T6KA 3U55A 3PZEA 1A06A 2A98A 3E8NA 3IGGA 5IQAA 3SDJA 4N4SA 3UNJA 3R71A 5HIDA 5M06A 1OKZA 4KB8A 4B7TA 5J1WA 1YOJA 2X81A 3HV6A 5BYYA 1U46A 3WF9A 4EOQA 4YSMA 2FSTX 4HCUA 3HVCA 4I93A 4XV1A 3D7TB 4MF1A 4CG9A 5A46A 1XBAA 2O3PA 4IZYA 3OCGA 3LFDA 2ZM1A 2R3IA 4FV2A 2I0EA 4FNYA 4PTEA 5AR2A 2P3GX 3VBTA 1H1SA 4QDVA 2UZLA 3FMEA 4EH6A 1Z5MA 2NRYA 4RVTA 3LZBA 4MXOA 4ZIMA 3MH1A 4K18A 5KKRB 4FZAB 1G8JA 3QZIA 4TYHB 3HMPA 4UN0C 2ESMA 2FYSA 1OUYA 3BLRA 3EN9A 4KS8A 4RJ5A 5GZAA 4G1WA 2ETMA 1PXOA 2W5BA 2WTKC 4FT0A 2R9SA 3V5QA 3BE2A 3NUUA 1WVXA 4WSYA 2W99B 3BLHA 3EYHA 3LQ8A 5K5NA 4U5JA 4I5MA 2YM4A 4F9AA 2VN9A 3FC1X 4QP2A 1KE6A 5KCVA 4H05A 4RJ3A 4PTGA 4USDA 4CKJA 1TZDA 2R3FA 5H8EA 3PY3A 4GT5A 1R0PA 2C47A 3TNHA 4O4DA 5ANDA 3S95A 3A8WA 3D2KA 2QC6A 4C57A 4ZAUA 4CRSA 4BCGA 4F63A 2BILB 4PL3A 5ANGA 4FVQA 3L8XA 2J5EA 1S9JA 5HBJA 3VUMA 4DT8A 3LFAA 1S9IA 4FIJA 4H3BA 3TNPC 1BI8A 4WA9A 4JBQA 3SXFA 3I5ZA 4UBAA 4E8AA 3MFUA 2ZAZA 5IQDA 3NUYA 3TTJA 5FRIA 1YHSA 4W4WA 3I7BA 3I81A 5DBXA 5IA3A 1U5RA 4O22A 3F3VA 4FOBA 3BPRA 2ZV2A 4MVFA 5H3QA 3F88A 5FP6A 3P7CA 3TNQB 3MTFA 1K9AA 4LOOA 3K3JA 3B8RA 4BTFA 4WRGA 4X2FA 4BKZA 4ZLZA 4LRJA 1LEZA 3PXKA 5AJQA 3U54A 3FI3A 4DGNA 3ZM9A 3OWLA 3FUPA 4U81A 5CNNA 4S33A 4DINA 4BRXA 3L8SA 2FGIA 2V55A 1H0WA 2X0QA 3AGMA 3E88A 4PV0A 4MH7A 3I7CA 4EZ3A 4IAAA 5F1ZA 5JFVA 3WOWA 3DTWA 3MFRA 1Q3DA 5IPJA 3EQFA 3KF4A 3RP9A 3V5PA 3I0QA 3WE4A 5DEYA 3FHRA 3PY0A 2X8EA 3I6UA