4FVLA

Human collagenase 3 (mmp-13) full form with peptides from pro-domain
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
368
structure length
368
Chain Sequence
b'YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHAFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4fvlA02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4fvlA01
2MLRA 2OVZA 2W14A 5D1SA 2W13A 1B8YA 3AYUA 3LK8A 4PKWA 1HOVA 2X3CA 2WOAA 2TCLA 4L6TA 4HSDA 3EHXA 1ASTA 1IADA 1XFYA 3EDZA 3V6NA 1B3DA 3CKIA 4XM8A 3LGPA 5I4OA 1BQQM 4DPEA 4FVLA 2E3XA 2OW9A 1HXNA 2EROA 3B92A 1OM8A 2L0RA 2OXUA 1I1IP 3SHIA 1UTZA 1A85A 2ERPA 1CGEA 1OS9A 3TT4A 2MQSA 3O2XA 1EB6A 1Y93A 1CK7A 5B5PA 1XFUA 3P24A 1OMJA 2OI0A 3TS4A 4WKIA 4PKRA 1JAQA 3WV1A 1G4KA 1R55A 3KEJA 1DTHA 1R54A 1KUHA 1RMZA 4Q1LA 3F15A 1BM6A 4PKUA 5CUHA 2D1OA 3RTTA 1AF0A 1HV5A 3HY7A 5D1UA 2X3BA 1AYKA 2ERQA 1PWVA 1I73A 4GWMA 4R3VA 2K2GA 4XBHA 1O0TA 1R1HA 1ZVXA 3OHLA 2DW0A 1PWPA 2AYKA 2X3AA 3LQ0A 1UMSA 5I2ZA 1G05A 4QKZA 1HY7A 1RTGA 2J0TA 1BKCA 3ZXHA 4H76A 2OVXA 4FXQA 1PWQA 2K9CA 3N2VA 3ZUKA 3VTGA 1ZS0A 1CXVA 1SATA 4YEHA 3G42A 4XM6A 4PKVA 3KRYA 4H84A 1ZXCA 3EDGA 1GKCA 1K7IA 3I7IA 3DNGA 4H1QA 1YQYA 1IAGA 2OY2A 1XUDA 5D1TA 4H30A 2DDFA 4H2EA 2PJTA 1GO7P 3GBOA 4OEIA 1RM8A 2MZEA 4IJOA 1Z3JA 1KUGA 4GR3A 4JIJA 1UMTA 3G5CA 2D1NA 3AIGA 3V96B 4A7BA 1XFZA 2JT5A 2RJQA 5JMYA 5BOTA 2J83A 5L79A 2N8RA 2O36A 2XS4A 4H3XA 1HFCA 4H49A 3RTSA 2AIGP 1H71P 4EFSA 1K7GA 1SLMA 3USNA 2DW2A 2OXZA 3O64A 2W15A 1JAOA 1R1JA 1MMQA 1QIAA 1CGLA 1R1IA 3HY9A 1GE5A 1G12A 1S4BP 1XFVA 3KHIA 4PKSA 1SRPA 3LE9A 4G9LA 4JQGA 2WO8A 4AIGA 1D5JA 4GWNA 2W12A 1G49A 2CLTA 3KMCA 4GQLA 3E8RA 4I03A 5I12A 3VI1A 3KECA 2DDYA 4I35A 1OM7A 4GR0A 1QICA 1YCMA 1IAEA 1YOUA 4HX3A 4XCTA 4DF9A 1KUIA 1UTTA 1QUAA 1CAQA 1D7XA 3DL1A 1XFWA 456CA 1JKYA 1BKCI 2XS3A 1BKCE 5CXAA 4CTHA 3WV3A 4AXQA 4L63A 1ATLA 5H8XA 2OW0A 2POJA 1DMTA 4PKTA 1AKLA 3EHYA 3EDHA 2WO9A 4GR8A 4H82A 4ILWD 1ND1A 2JXYA 1IAAA 3DWBA 3LJZA 2USNA 2E2DA 1XUCA 3LJTA 2Z2DA 1D8MA 4IUWA 5BPAA 1BUDA 1BZSA 3HBUP 4IN9A 4WKEA 1SMPA 3EDIA 1YP1A 2CKIA 3HB2P 1MNCA 5I43A 5D3CA 4HMAA 4A3WA 3HBVP 1JIZA 1XFXA 3OYOA 2Y6DA 1GKDA 4LL2A 3Q2HA 1BSWA 2DW1A 3LIKA 4JA1A 2JSDA 2JIHA 4PKQA 1D8FA 3B2ZA 3BA0A 3ZVSA 1IACA 1XURA 4J4MA 4FXYP 3C7XA 3DSLA 5BOYA 1ROSA 1CGFA 4JP4A 4L19A 3LUNA 2OXWA 1MMPA 3HDAP 2MZHA 1FBLA 4ON1A 2V4BA 3LJGA 1KAPP 3F18A 3F16A 1ZXVA 3DPFA 1UEAA 3WV2A 3I7GA 4FU4A 2KRJA 3F19A 3UVCA 4AUOA 2FV9A 1EAKA 2JNPA 3F17A 4DV8A 1QHUA 1KUKA 2YB9A 2X7MA 1Y0VA 1USNA 1C3IA 3KWVC 2JT6A 1G9KA 3HYGA 1PWWA 1QIBA 3TVCA 4GF1A 5I3MA 1GXDA 2OW1A 4JPAA 3LIRA 1JANA 3B8ZA 1O0QA 4WK7A 5CZMA 5LABA 1PEXA 3LQBA 1SU3A 2OW2A 2Y6CA 5L7FA 3TSKA 3AYKA 1ITVA 1EUBA 1CIZA 1GE7A 1GO8P 1J7NA 3EWJA 3KMEA 1K7QA 3LEAA 3LILA 4AYKA 4DD8A 1ZTQA 4WF6A 966CA 1BIWA 1WNIA 1Q3AA 3K7LA 2QPJA 3LP9A 1KUFA 1Y8JA 5B5OA 2HU6A 1IABA 2FV5A 3LMCA 1FLSA 2I47A 2OY4A 3L0TA 3L0VA 1I76A 2A8HA 1JH1A 3S18A 4WZVA 1FM1A 1HFSA 3MA2A 3LKAA 1BQOA 1A86A 1OO9A 3P1VA 2RJPA 2YIGA 2O3EA 3Q2GA 1MMBA 5I0LA 2W0DA 2SRTA 1KBCA 1L6JA 3U1RA 3KEKA 3LUMA 5D7WA 3K7NA 3HDBA 1QJIA 1JIWP 1HTDA 1BUVM 1QJJA 3DPEA 1OS2A 5D2BA 2MZIA 1C8TA 3NX7A 4XM7A 1MMRA 1GE6A 1GENA 1JK3A 1QJSA 3OHOA 3ELMA 1SLNA 4G0DA 4GUYA 1C7KA 4RT6B 2OZRA 1CQRA 1JJ9A 1OM6A 1PWUA 2MLSA 1ZP5A 4ZR5A 1JAPA 3N2UA 830CA 3F1AA
chains in the Genus database with same CATH superfamily
2MLRA 2OVZA 2W14A 5D1SA 2W13A 1B8YA 3AYUA 3LK8A 4PKWA 1HOVA 2X3CA 2WOAA 2TCLA 4L6TA 4HSDA 3EHXA 1ASTA 1IADA 1XFYA 3EDZA 3V6NA 1B3DA 3CKIA 4XM8A 3LGPA 5I4OA 1BQQM 4DPEA 4FVLA 2E3XA 2OW9A 1HXNA 2EROA 3B92A 1OM8A 2L0RA 2OXUA 1I1IP 3SHIA 1UTZA 1A85A 2ERPA 1CGEA 1OS9A 1OZ9A 3TT4A 2MQSA 3O2XA 1EB6A 1Y93A 1CK7A 5B5PA 1XFUA 3P24A 1OMJA 2OI0A 3TS4A 4WKIA 4PKRA 1JAQA 3WV1A 1G4KA 1R55A 4L7AA 3KEJA 1DTHA 1R54A 1KUHA 1RMZA 4Q1LA 3F15A 1BM6A 4PKUA 5CUHA 2D1OA 3RTTA 1AF0A 1HV5A 3HY7A 5D1UA 2X3BA 1AYKA 2ERQA 1PWVA 1I73A 4GWMA 4R3VA 2K2GA 4XBHA 1O0TA 1R1HA 1XM5A 1ZVXA 3OHLA 2DW0A 1PWPA 2AYKA 2X3AA 3LQ0A 1UMSA 5I2ZA 1G05A 4QKZA 1HY7A 1RTGA 2J0TA 1BKCA 3ZXHA 4H76A 2OVXA 4FXQA 1PWQA 2K9CA 3N2VA 3ZUKA 3VTGA 1ZS0A 1CXVA 1SATA 4YEHA 3G42A 4XM6A 4PKVA 3KRYA 4H84A 1ZXCA 3EDGA 1GKCA 3DTEA 1K7IA 3I7IA 3DNGA 4H1QA 1YQYA 1IAGA 2OY2A 1XUDA 5D1TA 4H30A 2DDFA 4H2EA 2PJTA 1GO7P 3GBOA 4OEIA 1RM8A 2MZEA 4IJOA 1Z3JA 1KUGA 4GR3A 4JIJA 1UMTA 3G5CA 2D1NA 3AIGA 3V96B 4A7BA 1XFZA 2JT5A 2RJQA 5JMYA 5BOTA 2J83A 5L79A 2N8RA 2O36A 2XS4A 1XAXA 4H3XA 1HFCA 4H49A 3RTSA 2AIGP 1H71P 4EFSA 1K7GA 1SLMA 3USNA 2DW2A 2OXZA 3O64A 2W15A 1JAOA 1R1JA 1MMQA 1QIAA 1CGLA 1R1IA 3HY9A 1GE5A 1G12A 1S4BP 1XFVA 3KHIA 3DTKA 4PKSA 1SRPA 3LE9A 4G9LA 4JQGA 2WO8A 4AIGA 1D5JA 4GWNA 2W12A 1G49A 2CLTA 3KMCA 4GQLA 3E8RA 4I03A 5I12A 3VI1A 3KECA 2DDYA 4I35A 1OM7A 4GR0A 1QICA 1YCMA 1IAEA 1YOUA 4HX3A 4XCTA 4DF9A 1KUIA 1UTTA 1QUAA 1CAQA 1D7XA 3DL1A 1XFWA 456CA 1JKYA 1BKCI 2XS3A 1BKCE 5CXAA 4CTHA 3WV3A 4AXQA 4L63A 1ATLA 5H8XA 2OW0A 2POJA 1DMTA 4PKTA 1AKLA 3EHYA 3EDHA 2WO9A 4GR8A 4H82A 4ILWD 1ND1A 2JXYA 1IAAA 3DWBA 3LJZA 2USNA 2E2DA 1XUCA 3LJTA 2Z2DA 1TVIA 1D8MA 4IUWA 5BPAA 1BUDA 1BZSA 3HBUP 4IN9A 4WKEA 1SMPA 3EDIA 1YP1A 2CKIA 3HB2P 1MNCA 5I43A 5D3CA 4HMAA 4A3WA 3HBVP 1JIZA 1XFXA 3OYOA 2Y6DA 1GKDA 4LL2A 3Q2HA 1BSWA 2DW1A 3LIKA 4JA1A 2JSDA 2JIHA 4PKQA 1D8FA 3B2ZA 3BA0A 3ZVSA 1IACA 1XURA 4J4MA 4FXYP 3C7XA 3DSLA 5BOYA 1ROSA 1CGFA 4JP4A 4L19A 3LUNA 2OXWA 1MMPA 3HDAP 2MZHA 1FBLA 4ON1A 2V4BA 3LJGA 1KAPP 3F18A 3F16A 1ZXVA 3DPFA 1UEAA 3WV2A 3I7GA 4FU4A 2KRJA 3F19A 3UVCA 4AUOA 2FV9A 1EAKA 2JNPA 3F17A 4DV8A 1QHUA 1KUKA 2YB9A 2X7MA 1Y0VA 1USNA 1C3IA 3KWVC 2JT6A 1G9KA 3HYGA 1PWWA 1QIBA 3TVCA 4GF1A 5I3MA 1GXDA 2OW1A 4JPAA 3LIRA 1JANA 3B8ZA 1O0QA 4WK7A 5CZMA 5LABA 1PEXA 3LQBA 1SU3A 2OW2A 2Y6CA 5L7FA 3TSKA 3AYKA 1ITVA 1EUBA 1CIZA 1GE7A 1GO8P 1J7NA 3EWJA 3KMEA 1K7QA 3LEAA 3LILA 4AYKA 4DD8A 1ZTQA 4WF6A 966CA 1BIWA 1WNIA 1Q3AA 3K7LA 2QPJA 3DTIA 3LP9A 1KUFA 1Y8JA 5B5OA 2HU6A 1IABA 2FV5A 3LMCA 1FLSA 2I47A 2OY4A 3L0TA 3L0VA 1I76A 2A8HA 1JH1A 3S18A 4WZVA 1FM1A 1HFSA 3MA2A 3LKAA 1BQOA 1A86A 1OO9A 3P1VA 2RJPA 2YIGA 2O3EA 3Q2GA 1MMBA 5I0LA 2W0DA 2SRTA 1KBCA 1L6JA 3U1RA 3KEKA 3LUMA 5D7WA 3K7NA 3HDBA 1QJIA 1JIWP 1HTDA 1BUVM 1QJJA 3DPEA 1OS2A 5D2BA 2MZIA 1C8TA 3NX7A 4XM7A 1MMRA 1GE6A 1GENA 1JK3A 1QJSA 3OHOA 3ELMA 1SLNA 4G0DA 4GUYA 1C7KA 4RT6B 2OZRA 1CQRA 1JJ9A 1OM6A 1PWUA 2MLSA 1ZP5A 4ZR5A 1JAPA 3N2UA 830CA 3F1AA 2YUFA
chains in the Genus database with same CATH topology
2MLRA 2OVZA 2W14A 5D1SA 2W13A 1B8YA 3AYUA 3LK8A 4PKWA 1HOVA 2X3CA 2WOAA 2TCLA 4L6TA 4HSDA 3EHXA 1ASTA 1IADA 1XFYA 3EDZA 3V6NA 1B3DA 3CKIA 4XM8A 3LGPA 5I4OA 1BQQM 4DPEA 4FVLA 2E3XA 2OW9A 1HXNA 2EROA 3B92A 1OM8A 2L0RA 2OXUA 1I1IP 3SHIA 1UTZA 1A85A 2ERPA 1CGEA 1OS9A 3TT4A 2MQSA 3O2XA 1EB6A 1Y93A 1CK7A 5B5PA 1XFUA 3P24A 1OMJA 2OI0A 3TS4A 4WKIA 4PKRA 1JAQA 3WV1A 1G4KA 1R55A 4L7AA 3KEJA 1DTHA 1R54A 1KUHA 1RMZA 4Q1LA 3F15A 1BM6A 4PKUA 5CUHA 2D1OA 3RTTA 1AF0A 1HV5A 3HY7A 5D1UA 2X3BA 1AYKA 2ERQA 1PWVA 1I73A 4GWMA 4R3VA 2K2GA 4XBHA 1O0TA 1R1HA 1ZVXA 3OHLA 2DW0A 1PWPA 2AYKA 2X3AA 3LQ0A 1UMSA 5I2ZA 1G05A 4QKZA 1HY7A 1RTGA 2J0TA 1BKCA 3ZXHA 4H76A 2OVXA 4FXQA 1PWQA 2K9CA 3N2VA 3ZUKA 3VTGA 1ZS0A 1CXVA 1SATA 4YEHA 3G42A 4XM6A 4PKVA 3KRYA 4H84A 1ZXCA 3EDGA 1GKCA 3DTEA 1K7IA 3I7IA 3DNGA 4H1QA 1YQYA 1IAGA 2OY2A 1XUDA 5D1TA 4H30A 2DDFA 4H2EA 2PJTA 1GO7P 3GBOA 4OEIA 1RM8A 2MZEA 4IJOA 1Z3JA 1KUGA 4GR3A 4JIJA 1UMTA 3G5CA 2D1NA 3AIGA 3V96B 4A7BA 1XFZA 2JT5A 2RJQA 5JMYA 5BOTA 2J83A 5L79A 2N8RA 2O36A 2XS4A 4H3XA 1HFCA 4H49A 3RTSA 2AIGP 1H71P 4EFSA 1K7GA 1SLMA 3USNA 2DW2A 2OXZA 3O64A 2W15A 1JAOA 1R1JA 1MMQA 1QIAA 1CGLA 1R1IA 3HY9A 1GE5A 1G12A 1S4BP 1XFVA 3KHIA 3DTKA 4PKSA 1SRPA 3LE9A 4G9LA 4JQGA 2WO8A 4AIGA 1D5JA 4GWNA 2W12A 1G49A 2CLTA 3KMCA 4GQLA 3E8RA 4I03A 5I12A 3VI1A 3KECA 2DDYA 4I35A 1OM7A 4GR0A 1QICA 1YCMA 1IAEA 1YOUA 4HX3A 4XCTA 4DF9A 1KUIA 1UTTA 1QUAA 1CAQA 1D7XA 3DL1A 1XFWA 456CA 1JKYA 1BKCI 2XS3A 1BKCE 5CXAA 4CTHA 3WV3A 4AXQA 4L63A 1ATLA 5H8XA 2OW0A 2POJA 1DMTA 4PKTA 1AKLA 3EHYA 3EDHA 2WO9A 4GR8A 4H82A 4ILWD 1ND1A 2JXYA 1IAAA 3DWBA 3LJZA 2USNA 2E2DA 1XUCA 3LJTA 2Z2DA 1D8MA 4IUWA 5BPAA 1BUDA 1BZSA 3HBUP 4IN9A 4WKEA 1SMPA 3EDIA 1YP1A 2CKIA 3HB2P 1MNCA 5I43A 5D3CA 4HMAA 4A3WA 3HBVP 1JIZA 1XFXA 3OYOA 2Y6DA 1GKDA 4LL2A 3Q2HA 1BSWA 2DW1A 3LIKA 4JA1A 2JSDA 2JIHA 4PKQA 1D8FA 3B2ZA 3BA0A 3ZVSA 1IACA 1XURA 4J4MA 4FXYP 3C7XA 3DSLA 5BOYA 1ROSA 1CGFA 4JP4A 4L19A 3LUNA 2OXWA 1MMPA 3HDAP 2MZHA 1FBLA 4ON1A 2V4BA 3LJGA 1KAPP 3F18A 3F16A 1ZXVA 3DPFA 1UEAA 3WV2A 3I7GA 4FU4A 2KRJA 3F19A 3UVCA 4AUOA 2FV9A 1EAKA 2JNPA 3F17A 4DV8A 1QHUA 1KUKA 2YB9A 2X7MA 1Y0VA 1USNA 1C3IA 3KWVC 2JT6A 1G9KA 3HYGA 1PWWA 1QIBA 3TVCA 4GF1A 5I3MA 1GXDA 2OW1A 4JPAA 3LIRA 1JANA 3B8ZA 1O0QA 4WK7A 5CZMA 5LABA 1PEXA 3LQBA 1SU3A 2OW2A 2Y6CA 5L7FA 3TSKA 3AYKA 1ITVA 1EUBA 1CIZA 1GE7A 1GO8P 1J7NA 3EWJA 3KMEA 1K7QA 3LEAA 3LILA 4AYKA 4DD8A 1ZTQA 4WF6A 966CA 1BIWA 1WNIA 1Q3AA 3K7LA 2QPJA 3DTIA 3LP9A 1KUFA 1Y8JA 5B5OA 2HU6A 1IABA 2FV5A 3LMCA 1FLSA 2I47A 2OY4A 3L0TA 3L0VA 1I76A 2A8HA 1JH1A 3S18A 4WZVA 1FM1A 1HFSA 3MA2A 3LKAA 1BQOA 1A86A 1OO9A 3P1VA 2RJPA 2YIGA 2O3EA 3Q2GA 1MMBA 5I0LA 2W0DA 2SRTA 1KBCA 1L6JA 3U1RA 3KEKA 3LUMA 5D7WA 3K7NA 3HDBA 1QJIA 1JIWP 1HTDA 1BUVM 1QJJA 3DPEA 1OS2A 5D2BA 2MZIA 1C8TA 3NX7A 4XM7A 1MMRA 1GE6A 1GENA 1JK3A 1QJSA 3OHOA 3ELMA 1SLNA 4G0DA 4GUYA 1C7KA 4RT6B 2OZRA 1CQRA 1JJ9A 1OM6A 1PWUA 2MLSA 1ZP5A 4ZR5A 1JAPA 3N2UA 830CA 3F1AA 2YUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLR A;  2OVZ A;  2W14 A;  5D1S A;  2W13 A;  1B8Y A;  3AYU A;  3LK8 A;  4PKW A;  1HOV A;  2X3C A;  2WOA A;  2TCL A;  4L6T A;  4HSD A;  3EHX A;  1AST A;  1IAD A;  1XFY A;  3EDZ A;  3V6N A;  1B3D A;  3CKI A;  4XM8 A;  3LGP A;  5I4O A;  1BQQ M;  4DPE A;  4FVL A;  2E3X A;  2OW9 A;  1HXN A;  2ERO A;  3B92 A;  1OM8 A;  2L0R A;  2OXU A;  1I1I P;  3SHI A;  1UTZ A;  1A85 A;  2ERP A;  1CGE A;  1OS9 A;  3TT4 A;  2MQS A;  3O2X A;  1EB6 A;  1Y93 A;  1CK7 A;  5B5P A;  1XFU A;  3P24 A;  1OMJ A;  2OI0 A;  3TS4 A;  4WKI A;  4PKR A;  1JAQ A;  3WV1 A;  1G4K A;  1R55 A;  3KEJ A;  1DTH A;  1R54 A;  1KUH A;  1RMZ A;  4Q1L A;  3F15 A;  1BM6 A;  4PKU A;  5CUH A;  2D1O A;  3RTT A;  1AF0 A;  1HV5 A;  3HY7 A;  5D1U A;  2X3B A;  1AYK A;  2ERQ A;  1PWV A;  1I73 A;  4GWM A;  4R3V A;  2K2G A;  4XBH A;  1O0T A;  1R1H A;  1ZVX A;  3OHL A;  2DW0 A;  1PWP A;  2AYK A;  2X3A A;  3LQ0 A;  1UMS A;  5I2Z A;  1G05 A;  4QKZ A;  1HY7 A;  1RTG A;  2J0T A;  1BKC A;  3ZXH A;  4H76 A;  2OVX A;  4FXQ A;  1PWQ A;  2K9C A;  3N2V A;  3ZUK A;  3VTG A;  1ZS0 A;  1CXV A;  1SAT A;  4YEH A;  3G42 A;  4XM6 A;  4PKV A;  3KRY A;  4H84 A;  1ZXC A;  3EDG A;  1GKC A;  1K7I A;  3I7I A;  3DNG A;  4H1Q A;  1YQY A;  1IAG A;  2OY2 A;  1XUD A;  5D1T A;  4H30 A;  2DDF A;  4H2E A;  2PJT A;  1GO7 P;  3GBO A;  4OEI A;  1RM8 A;  2MZE A;  4IJO A;  1Z3J A;  1KUG A;  4GR3 A;  4JIJ A;  1UMT A;  3G5C A;  2D1N A;  3AIG A;  3V96 B;  4A7B A;  1XFZ A;  2JT5 A;  2RJQ A;  5JMY A;  5BOT A;  2J83 A;  5L79 A;  2N8R A;  2O36 A;  2XS4 A;  4H3X A;  1HFC A;  4H49 A;  3RTS A;  2AIG P;  1H71 P;  4EFS A;  1K7G A;  1SLM A;  3USN A;  2DW2 A;  2OXZ A;  3O64 A;  2W15 A;  1JAO A;  1R1J A;  1MMQ A;  1QIA A;  1CGL A;  1R1I A;  3HY9 A;  1GE5 A;  1G12 A;  1S4B P;  1XFV A;  3KHI A;  4PKS A;  1SRP A;  3LE9 A;  4G9L A;  4JQG A;  2WO8 A;  4AIG A;  1D5J A;  4GWN A;  2W12 A;  1G49 A;  2CLT A;  3KMC A;  4GQL A;  3E8R A;  4I03 A;  5I12 A;  3VI1 A;  3KEC A;  2DDY A;  4I35 A;  1OM7 A;  4GR0 A;  1QIC A;  1YCM A;  1IAE A;  1YOU A;  4HX3 A;  4XCT A;  4DF9 A;  1KUI A;  1UTT A;  1QUA A;  1CAQ A;  1D7X A;  3DL1 A;  1XFW A;  456C A;  1JKY A;  1BKC I;  2XS3 A;  1BKC E;  5CXA A;  4CTH A;  3WV3 A;  4AXQ A;  4L63 A;  1ATL A;  5H8X A;  2OW0 A;  2POJ A;  1DMT A;  4PKT A;  1AKL A;  3EHY A;  3EDH A;  2WO9 A;  4GR8 A;  4H82 A;  4ILW D;  1ND1 A;  2JXY A;  1IAA A;  3DWB A;  3LJZ A;  2USN A;  2E2D A;  1XUC A;  3LJT A;  2Z2D A;  1D8M A;  4IUW A;  5BPA A;  1BUD A;  1BZS A;  3HBU P;  4IN9 A;  4WKE A;  1SMP A;  3EDI A;  1YP1 A;  2CKI A;  3HB2 P;  1MNC A;  5I43 A;  5D3C A;  4HMA A;  4A3W A;  3HBV P;  1JIZ A;  1XFX A;  3OYO A;  2Y6D A;  1GKD A;  4LL2 A;  3Q2H A;  1BSW A;  2DW1 A;  3LIK A;  4JA1 A;  2JSD A;  2JIH A;  4PKQ A;  1D8F A;  3B2Z A;  3BA0 A;  3ZVS A;  1IAC A;  1XUR A;  4J4M A;  4FXY P;  3C7X A;  3DSL A;  5BOY A;  1ROS A;  1CGF A;  4JP4 A;  4L19 A;  3LUN A;  2OXW A;  1MMP A;  3HDA P;  2MZH A;  1FBL A;  4ON1 A;  2V4B A;  3LJG A;  1KAP P;  3F18 A;  3F16 A;  1ZXV A;  3DPF A;  1UEA A;  3WV2 A;  3I7G A;  4FU4 A;  2KRJ A;  3F19 A;  3UVC A;  4AUO A;  2FV9 A;  1EAK A;  2JNP A;  3F17 A;  4DV8 A;  1QHU A;  1KUK A;  2YB9 A;  2X7M A;  1Y0V A;  1USN A;  1C3I A;  3KWV C;  2JT6 A;  1G9K A;  3HYG A;  1PWW A;  1QIB A;  3TVC A;  4GF1 A;  5I3M A;  1GXD A;  2OW1 A;  4JPA A;  3LIR A;  1JAN A;  3B8Z A;  1O0Q A;  4WK7 A;  5CZM A;  5LAB A;  1PEX A;  3LQB A;  1SU3 A;  2OW2 A;  2Y6C A;  5L7F A;  3TSK A;  3AYK A;  1ITV A;  1EUB A;  1CIZ A;  1GE7 A;  1GO8 P;  1J7N A;  3EWJ A;  3KME A;  1K7Q A;  3LEA A;  3LIL A;  4AYK A;  4DD8 A;  1ZTQ A;  4WF6 A;  966C A;  1BIW A;  1WNI A;  1Q3A A;  3K7L A;  2QPJ A;  3LP9 A;  1KUF A;  1Y8J A;  5B5O A;  2HU6 A;  1IAB A;  2FV5 A;  3LMC A;  1FLS A;  2I47 A;  2OY4 A;  3L0T A;  3L0V A;  1I76 A;  2A8H A;  1JH1 A;  3S18 A;  4WZV A;  1FM1 A;  1HFS A;  3MA2 A;  3LKA A;  1BQO A;  1A86 A;  1OO9 A;  3P1V A;  2RJP A;  2YIG A;  2O3E A;  3Q2G A;  1MMB A;  5I0L A;  2W0D A;  2SRT A;  1KBC A;  1L6J A;  3U1R A;  3KEK A;  3LUM A;  5D7W A;  3K7N A;  3HDB A;  1QJI A;  1JIW P;  1HTD A;  1BUV M;  1QJJ A;  3DPE A;  1OS2 A;  5D2B A;  2MZI A;  1C8T A;  3NX7 A;  4XM7 A;  1MMR A;  1GE6 A;  1GEN A;  1JK3 A;  1QJS A;  3OHO A;  3ELM A;  1SLN A;  4G0D A;  4GUY A;  1C7K A;  4RT6 B;  2OZR A;  1CQR A;  1JJ9 A;  1OM6 A;  1PWU A;  2MLS A;  1ZP5 A;  4ZR5 A;  1JAP A;  3N2U A;  830C A;  3F1A A; 
#chains in the Genus database with same CATH topology
 2MLR A;  2OVZ A;  2W14 A;  5D1S A;  2W13 A;  1B8Y A;  3AYU A;  3LK8 A;  4PKW A;  1HOV A;  2X3C A;  2WOA A;  2TCL A;  4L6T A;  4HSD A;  3EHX A;  1AST A;  1IAD A;  1XFY A;  3EDZ A;  3V6N A;  1B3D A;  3CKI A;  4XM8 A;  3LGP A;  5I4O A;  1BQQ M;  4DPE A;  4FVL A;  2E3X A;  2OW9 A;  1HXN A;  2ERO A;  3B92 A;  1OM8 A;  2L0R A;  2OXU A;  1I1I P;  3SHI A;  1UTZ A;  1A85 A;  2ERP A;  1CGE A;  1OS9 A;  1OZ9 A;  3TT4 A;  2MQS A;  3O2X A;  1EB6 A;  1Y93 A;  1CK7 A;  5B5P A;  1XFU A;  3P24 A;  1OMJ A;  2OI0 A;  3TS4 A;  4WKI A;  4PKR A;  1JAQ A;  3WV1 A;  1G4K A;  1R55 A;  4L7A A;  3KEJ A;  1DTH A;  1R54 A;  1KUH A;  1RMZ A;  4Q1L A;  3F15 A;  1BM6 A;  4PKU A;  5CUH A;  2D1O A;  3RTT A;  1AF0 A;  1HV5 A;  3HY7 A;  5D1U A;  2X3B A;  1AYK A;  2ERQ A;  1PWV A;  1I73 A;  4GWM A;  4R3V A;  2K2G A;  4XBH A;  1O0T A;  1R1H A;  1XM5 A;  1ZVX A;  3OHL A;  2DW0 A;  1PWP A;  2AYK A;  2X3A A;  3LQ0 A;  1UMS A;  5I2Z A;  1G05 A;  4QKZ A;  1HY7 A;  1RTG A;  2J0T A;  1BKC A;  3ZXH A;  4H76 A;  2OVX A;  4FXQ A;  1PWQ A;  2K9C A;  3N2V A;  3ZUK A;  3VTG A;  1ZS0 A;  1CXV A;  1SAT A;  4YEH A;  3G42 A;  4XM6 A;  4PKV A;  3KRY A;  4H84 A;  1ZXC A;  3EDG A;  1GKC A;  3DTE A;  1K7I A;  3I7I A;  3DNG A;  4H1Q A;  1YQY A;  1IAG A;  2OY2 A;  1XUD A;  5D1T A;  4H30 A;  2DDF A;  4H2E A;  2PJT A;  1GO7 P;  3GBO A;  4OEI A;  1RM8 A;  2MZE A;  4IJO A;  1Z3J A;  1KUG A;  4GR3 A;  4JIJ A;  1UMT A;  3G5C A;  2D1N A;  3AIG A;  3V96 B;  4A7B A;  1XFZ A;  2JT5 A;  2RJQ A;  5JMY A;  5BOT A;  2J83 A;  5L79 A;  2N8R A;  2O36 A;  2XS4 A;  1XAX A;  4H3X A;  1HFC A;  4H49 A;  3RTS A;  2AIG P;  1H71 P;  4EFS A;  1K7G A;  1SLM A;  3USN A;  2DW2 A;  2OXZ A;  3O64 A;  2W15 A;  1JAO A;  1R1J A;  1MMQ A;  1QIA A;  1CGL A;  1R1I A;  3HY9 A;  1GE5 A;  1G12 A;  1S4B P;  1XFV A;  3KHI A;  3DTK A;  4PKS A;  1SRP A;  3LE9 A;  4G9L A;  4JQG A;  2WO8 A;  4AIG A;  1D5J A;  4GWN A;  2W12 A;  1G49 A;  2CLT A;  3KMC A;  4GQL A;  3E8R A;  4I03 A;  5I12 A;  3VI1 A;  3KEC A;  2DDY A;  4I35 A;  1OM7 A;  4GR0 A;  1QIC A;  1YCM A;  1IAE A;  1YOU A;  4HX3 A;  4XCT A;  4DF9 A;  1KUI A;  1UTT A;  1QUA A;  1CAQ A;  1D7X A;  3DL1 A;  1XFW A;  456C A;  1JKY A;  1BKC I;  2XS3 A;  1BKC E;  5CXA A;  4CTH A;  3WV3 A;  4AXQ A;  4L63 A;  1ATL A;  5H8X A;  2OW0 A;  2POJ A;  1DMT A;  4PKT A;  1AKL A;  3EHY A;  3EDH A;  2WO9 A;  4GR8 A;  4H82 A;  4ILW D;  1ND1 A;  2JXY A;  1IAA A;  3DWB A;  3LJZ A;  2USN A;  2E2D A;  1XUC A;  3LJT A;  2Z2D A;  1TVI A;  1D8M A;  4IUW A;  5BPA A;  1BUD A;  1BZS A;  3HBU P;  4IN9 A;  4WKE A;  1SMP A;  3EDI A;  1YP1 A;  2CKI A;  3HB2 P;  1MNC A;  5I43 A;  5D3C A;  4HMA A;  4A3W A;  3HBV P;  1JIZ A;  1XFX A;  3OYO A;  2Y6D A;  1GKD A;  4LL2 A;  3Q2H A;  1BSW A;  2DW1 A;  3LIK A;  4JA1 A;  2JSD A;  2JIH A;  4PKQ A;  1D8F A;  3B2Z A;  3BA0 A;  3ZVS A;  1IAC A;  1XUR A;  4J4M A;  4FXY P;  3C7X A;  3DSL A;  5BOY A;  1ROS A;  1CGF A;  4JP4 A;  4L19 A;  3LUN A;  2OXW A;  1MMP A;  3HDA P;  2MZH A;  1FBL A;  4ON1 A;  2V4B A;  3LJG A;  1KAP P;  3F18 A;  3F16 A;  1ZXV A;  3DPF A;  1UEA A;  3WV2 A;  3I7G A;  4FU4 A;  2KRJ A;  3F19 A;  3UVC A;  4AUO A;  2FV9 A;  1EAK A;  2JNP A;  3F17 A;  4DV8 A;  1QHU A;  1KUK A;  2YB9 A;  2X7M A;  1Y0V A;  1USN A;  1C3I A;  3KWV C;  2JT6 A;  1G9K A;  3HYG A;  1PWW A;  1QIB A;  3TVC A;  4GF1 A;  5I3M A;  1GXD A;  2OW1 A;  4JPA A;  3LIR A;  1JAN A;  3B8Z A;  1O0Q A;  4WK7 A;  5CZM A;  5LAB A;  1PEX A;  3LQB A;  1SU3 A;  2OW2 A;  2Y6C A;  5L7F A;  3TSK A;  3AYK A;  1ITV A;  1EUB A;  1CIZ A;  1GE7 A;  1GO8 P;  1J7N A;  3EWJ A;  3KME A;  1K7Q A;  3LEA A;  3LIL A;  4AYK A;  4DD8 A;  1ZTQ A;  4WF6 A;  966C A;  1BIW A;  1WNI A;  1Q3A A;  3K7L A;  2QPJ A;  3DTI A;  3LP9 A;  1KUF A;  1Y8J A;  5B5O A;  2HU6 A;  1IAB A;  2FV5 A;  3LMC A;  1FLS A;  2I47 A;  2OY4 A;  3L0T A;  3L0V A;  1I76 A;  2A8H A;  1JH1 A;  3S18 A;  4WZV A;  1FM1 A;  1HFS A;  3MA2 A;  3LKA A;  1BQO A;  1A86 A;  1OO9 A;  3P1V A;  2RJP A;  2YIG A;  2O3E A;  3Q2G A;  1MMB A;  5I0L A;  2W0D A;  2SRT A;  1KBC A;  1L6J A;  3U1R A;  3KEK A;  3LUM A;  5D7W A;  3K7N A;  3HDB A;  1QJI A;  1JIW P;  1HTD A;  1BUV M;  1QJJ A;  3DPE A;  1OS2 A;  5D2B A;  2MZI A;  1C8T A;  3NX7 A;  4XM7 A;  1MMR A;  1GE6 A;  1GEN A;  1JK3 A;  1QJS A;  3OHO A;  3ELM A;  1SLN A;  4G0D A;  4GUY A;  1C7K A;  4RT6 B;  2OZR A;  1CQR A;  1JJ9 A;  1OM6 A;  1PWU A;  2MLS A;  1ZP5 A;  4ZR5 A;  1JAP A;  3N2U A;  830C A;  3F1A A;  2YUF A; 
#chains in the Genus database with same CATH homology
 2MLR A;  2OVZ A;  2W14 A;  5D1S A;  2W13 A;  1B8Y A;  3AYU A;  3LK8 A;  4PKW A;  1HOV A;  2X3C A;  2WOA A;  2TCL A;  4L6T A;  4HSD A;  3EHX A;  1AST A;  1IAD A;  1XFY A;  3EDZ A;  3V6N A;  1B3D A;  3CKI A;  4XM8 A;  3LGP A;  5I4O A;  1BQQ M;  4DPE A;  4FVL A;  2E3X A;  2OW9 A;  1HXN A;  2ERO A;  3B92 A;  1OM8 A;  2L0R A;  2OXU A;  1I1I P;  3SHI A;  1UTZ A;  1A85 A;  2ERP A;  1CGE A;  1OS9 A;  3TT4 A;  2MQS A;  3O2X A;  1EB6 A;  1Y93 A;  1CK7 A;  5B5P A;  1XFU A;  3P24 A;  1OMJ A;  2OI0 A;  3TS4 A;  4WKI A;  4PKR A;  1JAQ A;  3WV1 A;  1G4K A;  1R55 A;  4L7A A;  3KEJ A;  1DTH A;  1R54 A;  1KUH A;  1RMZ A;  4Q1L A;  3F15 A;  1BM6 A;  4PKU A;  5CUH A;  2D1O A;  3RTT A;  1AF0 A;  1HV5 A;  3HY7 A;  5D1U A;  2X3B A;  1AYK A;  2ERQ A;  1PWV A;  1I73 A;  4GWM A;  4R3V A;  2K2G A;  4XBH A;  1O0T A;  1R1H A;  1ZVX A;  3OHL A;  2DW0 A;  1PWP A;  2AYK A;  2X3A A;  3LQ0 A;  1UMS A;  5I2Z A;  1G05 A;  4QKZ A;  1HY7 A;  1RTG A;  2J0T A;  1BKC A;  3ZXH A;  4H76 A;  2OVX A;  4FXQ A;  1PWQ A;  2K9C A;  3N2V A;  3ZUK A;  3VTG A;  1ZS0 A;  1CXV A;  1SAT A;  4YEH A;  3G42 A;  4XM6 A;  4PKV A;  3KRY A;  4H84 A;  1ZXC A;  3EDG A;  1GKC A;  3DTE A;  1K7I A;  3I7I A;  3DNG A;  4H1Q A;  1YQY A;  1IAG A;  2OY2 A;  1XUD A;  5D1T A;  4H30 A;  2DDF A;  4H2E A;  2PJT A;  1GO7 P;  3GBO A;  4OEI A;  1RM8 A;  2MZE A;  4IJO A;  1Z3J A;  1KUG A;  4GR3 A;  4JIJ A;  1UMT A;  3G5C A;  2D1N A;  3AIG A;  3V96 B;  4A7B A;  1XFZ A;  2JT5 A;  2RJQ A;  5JMY A;  5BOT A;  2J83 A;  5L79 A;  2N8R A;  2O36 A;  2XS4 A;  4H3X A;  1HFC A;  4H49 A;  3RTS A;  2AIG P;  1H71 P;  4EFS A;  1K7G A;  1SLM A;  3USN A;  2DW2 A;  2OXZ A;  3O64 A;  2W15 A;  1JAO A;  1R1J A;  1MMQ A;  1QIA A;  1CGL A;  1R1I A;  3HY9 A;  1GE5 A;  1G12 A;  1S4B P;  1XFV A;  3KHI A;  3DTK A;  4PKS A;  1SRP A;  3LE9 A;  4G9L A;  4JQG A;  2WO8 A;  4AIG A;  1D5J A;  4GWN A;  2W12 A;  1G49 A;  2CLT A;  3KMC A;  4GQL A;  3E8R A;  4I03 A;  5I12 A;  3VI1 A;  3KEC A;  2DDY A;  4I35 A;  1OM7 A;  4GR0 A;  1QIC A;  1YCM A;  1IAE A;  1YOU A;  4HX3 A;  4XCT A;  4DF9 A;  1KUI A;  1UTT A;  1QUA A;  1CAQ A;  1D7X A;  3DL1 A;  1XFW A;  456C A;  1JKY A;  1BKC I;  2XS3 A;  1BKC E;  5CXA A;  4CTH A;  3WV3 A;  4AXQ A;  4L63 A;  1ATL A;  5H8X A;  2OW0 A;  2POJ A;  1DMT A;  4PKT A;  1AKL A;  3EHY A;  3EDH A;  2WO9 A;  4GR8 A;  4H82 A;  4ILW D;  1ND1 A;  2JXY A;  1IAA A;  3DWB A;  3LJZ A;  2USN A;  2E2D A;  1XUC A;  3LJT A;  2Z2D A;  1D8M A;  4IUW A;  5BPA A;  1BUD A;  1BZS A;  3HBU P;  4IN9 A;  4WKE A;  1SMP A;  3EDI A;  1YP1 A;  2CKI A;  3HB2 P;  1MNC A;  5I43 A;  5D3C A;  4HMA A;  4A3W A;  3HBV P;  1JIZ A;  1XFX A;  3OYO A;  2Y6D A;  1GKD A;  4LL2 A;  3Q2H A;  1BSW A;  2DW1 A;  3LIK A;  4JA1 A;  2JSD A;  2JIH A;  4PKQ A;  1D8F A;  3B2Z A;  3BA0 A;  3ZVS A;  1IAC A;  1XUR A;  4J4M A;  4FXY P;  3C7X A;  3DSL A;  5BOY A;  1ROS A;  1CGF A;  4JP4 A;  4L19 A;  3LUN A;  2OXW A;  1MMP A;  3HDA P;  2MZH A;  1FBL A;  4ON1 A;  2V4B A;  3LJG A;  1KAP P;  3F18 A;  3F16 A;  1ZXV A;  3DPF A;  1UEA A;  3WV2 A;  3I7G A;  4FU4 A;  2KRJ A;  3F19 A;  3UVC A;  4AUO A;  2FV9 A;  1EAK A;  2JNP A;  3F17 A;  4DV8 A;  1QHU A;  1KUK A;  2YB9 A;  2X7M A;  1Y0V A;  1USN A;  1C3I A;  3KWV C;  2JT6 A;  1G9K A;  3HYG A;  1PWW A;  1QIB A;  3TVC A;  4GF1 A;  5I3M A;  1GXD A;  2OW1 A;  4JPA A;  3LIR A;  1JAN A;  3B8Z A;  1O0Q A;  4WK7 A;  5CZM A;  5LAB A;  1PEX A;  3LQB A;  1SU3 A;  2OW2 A;  2Y6C A;  5L7F A;  3TSK A;  3AYK A;  1ITV A;  1EUB A;  1CIZ A;  1GE7 A;  1GO8 P;  1J7N A;  3EWJ A;  3KME A;  1K7Q A;  3LEA A;  3LIL A;  4AYK A;  4DD8 A;  1ZTQ A;  4WF6 A;  966C A;  1BIW A;  1WNI A;  1Q3A A;  3K7L A;  2QPJ A;  3DTI A;  3LP9 A;  1KUF A;  1Y8J A;  5B5O A;  2HU6 A;  1IAB A;  2FV5 A;  3LMC A;  1FLS A;  2I47 A;  2OY4 A;  3L0T A;  3L0V A;  1I76 A;  2A8H A;  1JH1 A;  3S18 A;  4WZV A;  1FM1 A;  1HFS A;  3MA2 A;  3LKA A;  1BQO A;  1A86 A;  1OO9 A;  3P1V A;  2RJP A;  2YIG A;  2O3E A;  3Q2G A;  1MMB A;  5I0L A;  2W0D A;  2SRT A;  1KBC A;  1L6J A;  3U1R A;  3KEK A;  3LUM A;  5D7W A;  3K7N A;  3HDB A;  1QJI A;  1JIW P;  1HTD A;  1BUV M;  1QJJ A;  3DPE A;  1OS2 A;  5D2B A;  2MZI A;  1C8T A;  3NX7 A;  4XM7 A;  1MMR A;  1GE6 A;  1GEN A;  1JK3 A;  1QJS A;  3OHO A;  3ELM A;  1SLN A;  4G0D A;  4GUY A;  1C7K A;  4RT6 B;  2OZR A;  1CQR A;  1JJ9 A;  1OM6 A;  1PWU A;  2MLS A;  1ZP5 A;  4ZR5 A;  1JAP A;  3N2U A;  830C A;  3F1A A;  2YUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...