4FVTA

Human sirt3 bound to ac-acs peptide and carba-nad
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
274
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis of Carba-NAD and the Structures of Its Ternary Complexes with SIRT3 and SIRT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
total genus 85
structure length 274
sequence length 274
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4fvtA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4fvtA01
4BVHA 4RJIA 1M2GA 1OVMA 1QPBA 1U2GC 5FEMA 2PGOA 2IHVA 1M2NA 1V5GA 2Q5OA 2VJYA 1YC2A 2VK8A 2AG1A 2W93A 3OE1A 5DEIA 2Q28A 3JR3A 4UTZA 4UU8A 5DGTA 5K2OA 3RIGA 1JSCA 3FLMA 4F56A 2VBFA 4RJKA 1UPAA 5EJ4A 2A1TR 1Q14A 4JSRA 4JU9A 4K9MA 1V5FA 4D5GA 4GM4A 4TWIA 3HWWA 4C7BA 4Y6LA 4I5IA 1PYDA 4MPPA 1S7GA 1T9AA 4BVBA 2B4YA 4UTRA 2Q5JA 2Q5QA 1Q17A 1T9CA 4MZXA 4HDAA 1NM5C 3D4BA 5EJ9A 1PNOA 4RMJA 4RMIA 5D7NA 2BRUC 4HD8A 5BWLA 2Q27A 1DJLA 1PTJC 4KXQA 3EYAA 4IF6A 2FWNA 2EZTA 5MFPA 3RIYA 1SZCA 2X7JA 3LQ1A 4KPUA 4QELA 2NYRA 2QQGA 1HZZC 3EA4A 1E3TA 3EY9A 2EZ4A 2NXWA 5K3SA 2PGNA 3GLSA 3PDHA 4KGDA 3FZNA 1UPBA 3ZG6A 1SZDA 2H4HA 1OZFA 4R8MA 1PI3A 4UU7A 2V3WA 4COKA 1Q6ZA 2FRDC 2DJIA 4GPEA 4BVGA 3PKJA 4K9LA 2OD2A 2A1UA 4BVEA 4GP9A 3IAEA 2WVHA 2VK1A 1POXA 3GLTA 1EFPA 1YTLA 5IMSA 1Q1AA 1MA3A 4F4UA 2IHTA 1U28C 5MGNA 4IAOA 1U31A 4Q9DA 1YNOA 2H2FA 4Y6QA 2JLCA 2UZ1A 4FZ3A 1ZPDA 5DGDA 4L3OA 5BWOA 3CLSD 2C31A 3IAFA 2VBIA 4GM0A 1N0HA 4ZZIA 1O97D 1YI1A 4JT9A 4UUAA 3U3DA 4BN5A 3FSJX 2QQFA 1BFDA 1UPCA 2WVGA 2Q29A 3ZGOA 4GG1A 2OD7A 2OORC 3E9YA 1XLTC 4GM1A 4K9KA 2H4FA 2EZ9A 2UZ1B 3HWX1 1T9DA 5EJ6A 4K9OA 4D5EA 3F6BX 2OO5C 4QQ8A 3PKIA 5MF6A 4BV2A 2IHUA 3CF4G 4MQ5A 2VK4A 4J16C 5AHKA 2FSVC 1POWA 4QPZA 3GLRA 4FEEA 1M2JA 2H2DA 1D4OA 1O96B 4O8ZA 3CLUD 2VBGA 3GLUA 1EFVA 1PVDA 3K35A 4JUFA 5EJAA 4UUBA 1T9BA 1Y9DA 1PT9A 1Z8NA 3D7KA 4JD5A 1V5EA 5FYQA 4JUCA 4BUZA 4L2IA 4G1CA 4BV3A 1PO7A 1YI0A 2H59A 5EJ8A 1M2KA 1MCZA 2H2GA 4BN4A 1OZHA 1U2DC 2FR8C 4RJJA 2JLAA 4K9NA 4JUDX 2JIBA 2WVAA 4Y6OA 4UTVA 3JWPA 1S5PA 5BWNA 4FVTA 4BVFA 1YHZA 5MFZA 4MPRA 4V1CA 3U31A 4JU8A 4FEGA 4K9PA 4JT8A 4V1CB 5K6TA 1M2HA 3F6EX 3D81A 4X3OA 1OZGA 1YHYA 2JI7A 4JUAA 4IG9A 4JUBA 5EJMA 2Q5LA 4V1CI 4J1TC 4UTXA 3CLTD 4K9QA 1J8FA 4RMHA 4TWJA 1YBHA 4MPJA 2FN3A 2PANA 4RMGA 4X3PA 3CLRD 2JI8A 5EJ5A 1PNQA 2H4JA 1ICIA 2OD9A 4UTNA 2AG0A 2EZUA 2H2IA 2JI6A 2EZ8A 5K6RA 2JI9A 1YC5A 3ZGVA 2H2HA 2HJHA 4ZP1A 4C78A 5EJ7A
chains in the Genus database with same CATH superfamily
2ZJ5A 1RLJA 4LY9A 4DG9A 1SCQA 3AUSA 3LVFO 2ET6A 4QXQA 2ZK7A 3F7NA 2X1MA 4P9NA 2ZITA 3QEAZ 4P6VF 1YAJA 1FJGB 5F1OA 3PJRA 2Q7OE 4YRRA 4DSUA 1G8SA 1ESEA 1FS6A 5FOTA 2R6HA 1CE8B 1T3ZA 1ZK4A 3ADKA 2H5IA 1PKXA 2B36A 2FW1A 4F1WA 1Y7IA 2ZE8A 2WUGA 1TADA 4NVRA 4XWKA 4G2TA 4LNUB 4MB0A 2SCUA 1H2EA 4FOPA 3VHXA 4DW8A 3GLIA 1F4LA 3VH1A 2ZRIA 1VPWA 1ZH0A 3CZMA 1NSTA 4J9VA 3UMRA 1E8NA 4HZGA 5L53A 4B5LA 1T26A 3JQ8A 5BT8A 3WNDA 1XFAA 1BWSA 3BWBA 5T5QA 1RJGA 1K8XB 2M6SA 1W8DA 4XGRA 4A6PA 3J7TA 3COPA 3L93A 1IUPA 3RC3A 5CYFA 5B3KA 1JXQA 1YU9A 4KGDA 3L8YA 3A4YA 2AD1A 1GSHA 1J23A 2C5BA 1VHJA 1H1DA 1FPQA 2X8LA 5FDFA 1KFJB 1ACJA 3DEAA 4OGLA 3BFPA 1ESDA 3MJHA 1BXRA 2W8BA 3MRXA 2AFIE 2I4RA 3AKDA 1U4OA 1XEAA 3E03A 3GCGA 4W8OA 5J1TB 1QMGA 3ZHXA 3WGNA 4ZHQF 4JBXA 5ECYA 5KOJA 2O8NA 2CJPA 5ER6A 5MFPA 1ZIDA 3HYTA 3ND8A 3TQOA 4YXFA 4AKHA 4P34A 2MJLA 1XN4A 2QXYA 3DVQX 4C0HA 5AUOB 2F3QA 3IRVA 3OSUA 4YRCA 3CEHA 2DT5A 1EH5A 3I2IA 4JEHA 1XKQA 2GN9A 3Q7RA 1CRLA 1E1RA 1VGRA 3A32A 3E9YA 3C98A 3I0NA 4WKCA 1NUSA 1HTBA 3U40A 5G1NA 1L7NA 4EHIA 1CEEA 4O0MA 1QF9A 2ICAA 4NJMA 2VSXA 5KTNA 1LLUA 5J40A 2Q4RA 4Y1RB 4EUHA 3S68A 5AOBA 2VS1A 2AIRA 4I1OA 4BB6A 1YQ9A 5JI2E 4S2UA 3GUZA 3CZQA 3FMGA 4ZALA 3IEUA 1YVUA 2DX7A 1YS9A 3D7MA 3GRYA 4C4OA 1QGZA 2NSHA 1M2JA 1QWOA 1FTQA 4OHWA 2IJGX 3C15C 4UBNA 4W5OA 4HQ0A 4DPLA 3OLQA 5K05A 2P77A 4PR0A 3TOSA 3ZCTA 2WG1A 3L41A 4A3SA 3COSA 4HWGA 1TKCA 4PTYA 4BFXA 5REQB 4MQFB 2BKAA 2E5LB 4MW5A 4BCCA 1JHDA 2DG2A 5H8WA 1F48A 1RRGA 2P67A 4GMKA 1EFKA 3OZ7A 4MGYR 1UXIA 3WC4A 4EVRA 1T3GA 1S5PA 4RK5A 1VIVA 3Q85A 4PLWA 4WCFC 1C9MA 1T2DA 1N2OA 2B8EA 3FGPA 3QVTA 4XUCA 4Y2HA 3T9EA 1UXOA 3U1TA 2BR3A 3P0JA 2ID7A 1MGPA 1QYWA 3QTLA 1TVKA 5HZMA 2WIGA 2M1XA 2XTNA 3V2HA 7ABPA 1FRZA 4NCXA 2I6QA 1YL7A 1A7JA 1XL1A 2OR3A 4Z1MD 5LBUA 1CZLA 1NYTA 1W0KD 2HNBA 1BE8A 1V11B 4ENUA 5KNBD 1HK7A 1HNZB 3AL0C 1T2UA 1BMFD 1JLKA 1XDZA 2D5AA 2IW1A 3HDHA 4PBTA 5IN5A 2PNJA 1YA6A 3GGOA 1Y7PA 1RC0A 5JAPA 3A6GA 5DSTA 1LLDA 4P5DA 3N2KB 4PIVA 1ZP6A 1G21B 1U80A 1UJBA 3MPUA 4G86A 2XB9A 3GF4A 3FWHA 4XI9A 2FSPA 3GDGA 2HT1A 2DBVO 3EC7A 2JD1A 5C8VA 3GWGA 4AKTA 3TW6A 4EZBA 3N6RA 3H5LA 3KDPA 4GLOA 4P5EA 1SEVA 3HDVA 4OI2A 3UT6A 3WGTA 5CH8A 4YJGA 5JNWA 1PGOA 2WOJA 5H7XA 4A8JB 3HWWA 1U99A 3QVLA 4YB8A 3WJ2A 1Q6YA 2W6NA 1Q0UA 4C87A 3HXMA 3KQQA 4FYYA 1UBNA 5TMEA 1NBWB 5JH7F 2O3JA 1E89A 5HJ2A 521PA 2HV8A 4KGVA 4TUYA 1MNAA 3ESZA 1G8HA 3Q5DA 3UC9A 5LD2C 1EFUA 1E5XA 1VL0A 2V4ZA 3F2VA 3I2FA 4FK8A 1PQWA 1AGXA 4RIEA 1RLUA 2X8JB 2CHFA 2GQ0A 4CDMA 2J7PA 3WZ2A 1IXYA 1MB4A 3KKQA 3RRYA 1KVUA 3HN7A 4B9EA 1GDDA 2BGRA 2OT3B 3I28A 2BHNA 5A9TA 3UK2A 4FNAA 3E9RA 1L4KA 1EBUA 3F96A 1RJ9A 4LWZA 3SOPA 4F9GA 5JJIA 2A9VA 2CJYA 3OZBA 4FI3C 1QFXA 2H92A 1OBHA 2NXWA 3VSEA 5ALXA 3DFIA 5FULA 2AN3A 3FJ1A 3W5CA 1AB6A 2ZI7A 2QHXA 5FV7A 1S2DA 2F64A 3AUKA 3QY9A 4WOPA 3AT1A 1YRBA 1AQYA 1H9AA 5CUQA 1N6PA 1KWGA 1EUDB 4BMPB 1FQOA 5GZ1A 1HE4A 3ETEA 2IUEA 1QAOA 4L0MA 4IIYA 5DIFA 1C1XB 1U31A 1WXHA 3LLSA 3QU4A 4B9AA 1SUCA 2H5EA 3ZVNA 4RNDB 4P2GA 3BFXA 4NU0A 1UC5B 2IP2A 3NEYA 1BNCA 1IU9A 4TLDA 3AY0A 4ND4A 1R16A 3EFBA 1T36A 3FSJX 5EXTA 3VFDA 3GJSA 2O2XA 3U49A 1Y5IA 2V7GA 3KEMA 4KQHA 4UHDA 3VVCA 3EX7C 1XDSA 2WJIA 2P9EA 1YZKA 2EFYA 2PG3A 4QASA 3OESA 2W6OA 1FMLA 2NO9A 2XB4A 5CNKA 2ACEA 1BTOA 1R7RA 1H05A 2J32A 1PQPA 4HEA6 2Q1SA 2V5VA 3F7MA 1Q0PA 3M70A 5P8WA 5TNXA 4YH1A 4AUMA 3LK7A 1VI6A 3LT4A 4INJA 1DCMA 4O59O 4XJSA 2VF4X 3MJFA 3O8OB 1YR9A 4ZGWA 2P9YA 3EJ6A 1CUFA 3OLVA 4IJQA 2AHOA 2Y1LA 1D4FA 1TX4B 4V0SA 3OY2A 1H6CA 4B47A 1OX5A 1CQIB 1AG9A 1JPNA 3O3CA 4FN5A 1RHKA 1PO7A 1AU9A 3A9RA 3AOGA 2O3SA 2EJTA 1Z2OX 5TVKA 3Q9SA 1GQOA 1NDHA 3DP9A 3NLLA 2DH5A 3RYTC 3GUHA 3KYIB 2ZFUA 2C83A 4F2GA 2VI5A 1Y42X 1OGYA 2GCOB 4BUJA 3FSGA 4FFMA 4LWQA 4RSMA 4ARBA 2YFKA 1JEQA 3F5DA 3X3HA 5EC8A 3PQ8A 2GZ3A 3NOXA 3PYXA 1WCIA 4KDCA 1IHXA 1EWKA 2Q3FA 3R0VA 3ZOKA 4DADA 3QWBA 1PGQA 3EXG2 3MC1A 3UJ7A 1ZEJA 2ZPAA 1JHPA 1UBHS 3DQQA 3NHZA 1WZNA 2C07A 2I65A 4ACAA 5AVTA 2ZXEA 2NU7A 3Q3CA 1ZLXA 1QS0A 1YZQA 4IR7A 3G2NA 1QRUA 3T41A 4DIOA 2O7QA 2J0EA 3NONA 1Q15A 3U19A 1TK9A 1NVVQ 1W2GA 3FUWA 2C7QA 2D1FA 1UDWA 4DV5B 1XQYA 3EIFA 3G17A 4I50A 4AULA 2GM5A 1WAMA 5LQCA 1YWGO 4XVHA 2QN7A 4R51A 2K6GA 1N6HA 2YIMA 4W5WA 3U56A 3STUA 1E3DA 4UEJA 1WVGA 4GAEA 1JFFA 1OH6A 2XXAB 1AMNA 4C01A 4U7WA 4IO1A 2H8KA 4IVPA 5HEKA 3ZJ4A 8AT1A 3KQLA 3TRFA 3ZGNA 2FSHA 1RAHA 2FRDA 2Z4RA 3R76A 3UFBA 4EL5A 1WO8A 3RYHB 2VAWA 4LDNA 1W75A 5I9NA 1O9BA 5K3AA 1TMYA 1Z5GA 2NUBA 1A5AB 3RIYA 2WTBA 3LCJA 4ZAZA 1FDVA 5FD8A 4RAQA 3QW4B 1EE9A 2BEKA 2IODA 1ZM4A 4LG1A 3DVAB 1H0HA 4FSXA 1Z4OA 5HTKA 1KO1A 1E1CB 5COQA 1SZDA 3EGIA 1SQ5A 1U63A 3KHUA 5IT9A 2EX0A 2HA7A 4XQ0A 1G18A 1V9SA 4FMBB 4N8DA 3OF5A 1HY3A 5IJAA 2CL7X 3OIFA 1JLLB 3PDUA 2VJOA 4ZREA 4F4UA 1AGRA 3D6MA 3UPDA 2WZCA 3GK3A 2JC3A 4CMHA 3CRVA 4GPAA 3SPXA 2QDXA 4I9UA 2XZDA 1QKKA 2QL6A 2ZUTA 4F0JA 1MHTA 3VMFA 1FRVA 3AHFA 2ATVA 4QFBA 2GK3A 2VPYA 2GSWA 1RR6A 3PNLA 4HXGA 2EBUA 5CLIA 4EI2A 3ZDDA 2ADMA 2I71A 1XCJA 2FPPB 3HN2A 3V2UA 3K20A 1ZAKA 3DF7A 5DE3A 3WIVA 3V1NA 1GA1A 4PO3X 3MFQA 3FLBA 3ZDYB 4CL0A 3FR7A 3R4CA 4IKOA 5E6UB 5LB2A 4NV3A 1OWMA 1GARA 4KI7A 2AKEA 4E7PA 3IDFA 5G3YA 1U1FA 2IW3A 4MLCA 2PKYX 3H2KA 3UJ3X 2EL7A 3IERA 5JV5A 1ECPA 4JSYA 4XWGA 5KUTA 4ASUD 3ODPA 1D4OA 1LZLA 3PR3A 5IANA 4I4TB 5ICMA 1GVHA 4IVQA 1L4HA 2CLFB 1ULTA 1EIZA 2NTJA 1IMJA 2EG5A 3U9SA 3HFSA 3WMWA 1WHSA 1E2HA 1KQ3A 3U26A 2BLLA 3ZGLA 2JAXA 4IOMA 2NW6A 3D6HA 4HTAA 4IZIA 4RK7A 5AM5A 3DB1A 1WW3A 4JJIA 4MV8A 4FSHA 4NULA 4EG5A 1P3DA 1BFUA 1BGWA 3GO4A 2E4YA 3G82C 2ZRLA 3PJFA 1T9GR 2VXYA 4K9PA 1BU5A 4ZI7B 2XF8A 1YD7A 3DBRA 1DKPA 1IOVA 1KYZA 4JUBA 4C4SA 3E7PA 5A0VA 2W4QA 3C3PA 1X70A 1D09A 2NG1A 2PTGA 1H2XA 2C9CA 3HDGA 2R44A 4Q12A 1BHQ1 1NQWA 1VCIA 4B1FA 3DOEA 4IWYA 1U6KA 1BHO1 1UH5A 3BF7A 1N2GA 2DU8A 4MH0R 1W6RA 1Z6TA 4OHBA 2CNLA 1K7SN 3GUVA 4CQMB 3EDRA 3O8DA 2Q4BA 2R8EA 4KSYA 1OI2A 4ZMRA 2CB9A 4DIDA 5ES4B 3T38A 1DNPA 1XZCA 1TUIA 2VYVD 1JYEA 2HZ7A 2G9VA 2QTMA 4O02B 3RRNA 5LQDA 1T3SA 1OX6A 1YACA 3OU2A 4OQQA 2PEYA 1MC8A 3V8VA 1ZMTA 3W3AA 5IFLA 2GK6A 1P62B 3LTEA 2CFIA 4OSOA 5I47A 3AR4A 3KKMA 2VWHA 1EPUA 4JBHA 3EZFA 4UBOA 2AK2A 5ITZA 3K8QA 1NN5A 2PSFA 4TMXA 3TJMA 2XKKA 3B70A 3GJQA 4ZTBA 2AOUA 3N3BC 3GEDA 5E0KB 3U7QA 2ZYVX 1KH1A 1XRLA 1N2CB 4RVDA 1E0SA 7MDHA 3WL6A 3T1YB 1ABEA 3WIUA 1SG9A 4JX9A 2WY2D 1A8HA 2OV2A 1WG8A 2OCKA 4ZGBA 1VSQA 2FFJA 3DDHA 3MINB 2FOXA 4I50B 5H82A 3FMOB 3OPXA 3TTVA 2VXBA 4ZEVA 2O8FA 3LWBA 5LNK6 2B25A 5JAZA 4K0KB 4FFVA 3OOEA 1JQ5A 1IDN1 1IN5A 1E5DA 1P17A 3O31A 4FHDA 4YRKA 1QF6A 2R5FA 2X5OA 3ITEA 4UW9A 4G36A 2G1AA 2XR1A 1RC1A 2Y4OA 3ZXUB 4RTRA 1J5XA 1ES9A 1QP0A 3C6BA 5BQ5A 3LYHA 4ZT5A 2GO1A 1E59A 1Z39A 1L4YA 2J7KA 3JZDA 3U4HA 2A58A 1CUSA 1MVNA 2VHJA 3JSAA 3CONA 4PC2A 4NFLA 2O8EA 1KMQA 2IEZA 4MUNA 2VSQA 2OESA 3W5SA 5C1BA 5JSZB 3KOZA 3WYBA 4R1LA 4QPCA 3TZBA 1UWVA 5ABPA 3AVVA 2BSXA 4BPRA 1SM4A 3KUXA 4OHRA 4AU1A 3LH5A 4PFKA 3RDPA 3KJNA 3U7HB 3L05A 4XYBA 4P83A 3VTAA 4CFSA 4FKMA 1HZJA 4DV7B 3VR6A 1R10A 2E4ZA 3K4HA 3JAKB 1SVWA 1CF2O 1YK1A 1V1RB 4H35A 4KIWA 3L0OA 4M8NE 4O1IA 4A8PA 5JD6A 1NXVA 4CIAA 2B61A 5DF1A 2Y0BA 3P4XA 5ALGA 1NZFA 3I9FA 4JWTA 3KG2A 2N47A 1PVDA 3GAFA 1Q91A 5JZ9A 3DLTA 1ORTA 1Y9DA 4WJLA 1TT5A 4YP7A 3VPSA 3QTBA 1IZ8A 1JJBA 3DMHA 2H59A 1MABB 4P7FA 2Z95A 4ZQCB 1ZCAA 3N0VA 1PSZA 1SU8A 4H1UA 3BB4A 4UHKA 2I2WA 1Q92A 1R6XA 4FJ0A 1X3SA 1CVRA 3C3KA 3TFQA 2H85A 2WJJA 3MUOA 3BWDD 1SHJA 5CDTA 2P2NA 3MJDA 4OK6A 4RWZA 2CFRA 4KXXA 3WGQA 3QE9Y 3KUDA 4QUGA 5IAOA 2EGHA 3MVEA 2OAGA 2RKOA 1LX7A 3ML1A 3U5TA 3I6YA 3C7KA 3GRRA 4YAGA 1T2EA 1Z56C 3SVZA 2ES4A 2OGSA 2QQ5A 2RGWA 4BVJA 1IH8A 5JQGA 2A78A 1SKMA 2ZWAA 3BB3A 4UM5A 4P3KA 5KPDA 4DLUA 2JLBA 4J8PA 4HGNA 2WIDA 3GXBA 5FUBA 2QAJA 2D7DA 4HEHA 1JEYA 2X14A 5JISA 4LRXA 4BNJA 5HXAA 4BVHA 4FNMA 1VHQA 4IDQA 4CQLB 3D4PA 1JPJA 3GL9A 1JSLA 2VQDA 2Q5OA 3L0IB 1JSXA 4HGYA 4AKEA 3OWHA 3GCZA 1ID1A 4NU5A 5JT1A 1VLJA 3AF4A 4QOHA 4GI3A 2GM4A 3QW2A 3DLBA 4AKSA 1E8DA 4ZGGA 1JSZA 5CFOA 1Z4MA 2BELA 2JATA 2CL5A 1E1QD 2V0CA 2QUKA 1USUA 1F5NA 1VJ1A 2GFHA 5CX1B 4LWPA 1H5QA 2XQKA 4FFBB 3RF6A 3TEMA 5DW3A 4MWZA 3Q12A 2YV5A 3ERCA 3CX3A 1T9CA 1E3LA 3W78A 4MWSA 3K6JA 1UQTA 3RVOA 4BFUA 3PQ3A 5B3AA 4KYVA 1CLUA 1JHVA 4Q7MB 4KXWA 4A03A 1JKIA 2J4DA 1PJBA 4JC4A 5IASA 3N6VA 2Q8PA 1GNPA 3F67A 1CR4A 3TX6A 1AF4A 3OEWA 5HGJA 4YP6A 2V1UA 3NNNA 1XCBA 4PXAA 3WGVA 5BOSB 4JFAA 4M0UA 1CBUA 5HF8A 4YJ2B 1FXWF 1L3IA 1QDUA 2GPTA 3B85A 4YJFA 5CP8A 3TKYA 5K3DA 2NZYA 5F73A 2I67A 1V8BA 2FMFA 3MINA 4W63A 1NLYA 2FZVA 2PD6A 5AVZA 2BCJQ 3TTUA 2C0PA 3AEYA 4EW2A 3ZVMA 5FUXA 1E99A 2MTBA 2WI8A 1C7IA 3NWOA 3HBMA 1O8CA 1RXWA 3A27A 2IA5A 4FMDB 4E2FA 3EXHA 3DOHA 2BKXA 4GG1A 3QLTA 1CR1A 4JWKA 3ZWXA 1WEKA 4IDFA 1P4AA 3N2LA 2DFPA 3R5KA 3TQIA 1EB8A 1N0VC 1X92A 3WV4A 1WDMA 5ALFA 1NJ2A 5EE0A 4BFSA 4ZDIA 3RB8A 1XMOB 1GAXA 5I8PA 1UBLS 1RQXA 2RH5A 3LY8A 1ZHHA 4P4LA 1IEXA 1NVEA 4WFKA 4HL6A 1ABFA 1O57A 2DBRA 2FSVC 3ZD6A 1YU6A 1UKYA 1Y81A 2J6CA 3C1UA 4BJHB 2AFIA 4E08A 3SS7X 2GEKA 4H7IA 5L4SA 3ZBPA 4FNGA 1A5ZA 1ZHFA 2ST1A 3LOQA 4XDGA 1S3SA 3V46A 4F2HA 2FPRA 3LDFA 4F3KA 4GBGA 3ZE6A 2FSSA 2H1FA 1LK7A 2ZRNA 4F2WA 4MS4A 1WA5A 1C2YA 4UNQA 5CURA 3RD5A 1L7OA 1LS1A 2GN0A 1QOQB 3I37X 1GTRA 4RD0A 5DHPA 3D31A 1YUNA 2Q8QA 3HU1A 1DX6A 2OZLA 4GE0A 3P2OA 4HFNA 2IY8A 4OHFA 3N2EA 4REQA 1U3UA 3R09A 4AKIA 1OC4A 3UMJA 3VTZA 3FRHA 5CT5A 5ILGA 4BEBA 3E1GA 4YT2A 2YJGA 2JGJA 2P0EA 5JDCC 3BULA 2FUG1 3DKRA 3KWLA 1N25A 2VLBA 4MV0A 3NBKA 1PNQA 4IDOA 4UZSA 1G0NA 1WV1A 3IBFA 2JDID 4YP0A 2L17A 1KYTA 3D64A 2GSDA 2RGNC 4LJ5A 1EJ2A 2W2KA 3R9KA 4ZIRB 2ZYUX 1SK9A 3A7EA 4NI5A 2VDRB 1ZX1A 1CEYA 1M6VB 3IE2A 5EIEA 2FW9A 5AI9A 3IKMB 3AY6A 2AQKA 4NICA 4TSKA 2Z04A 1GCOA 5T67A 1P7PA 2CXRA 1V39A 2EKBA 3JQ9C 4EEZA 3IKTA 4UMFA 1XJ5A 3RC2A 3ZI0A 5CCXA 4EI7A 1XRPA 4ZZ1A 1IY0A 3DO5A 3ZY2A 5KI6A 4HHEA 1OKKD 2C3PA 5A3VA 1TA4A 1SC9A 5I7OA 2B4AA 3DAOA 1VBKA 1MOPA 4AJLA 4PYOA 4MI9A 1Y3FE 2CMFA 1Y1LA 4K9RA 1A8UA 4IZ6A 4LX0A 3FDFA 4NH4A 2PRYA 5AR1A 2A5GA 2ZGVA 3NEJA 5F78A 4YXWA 2EFDB 1HQYE 2B7CA 4BO4A 5H16A 5EIXA 1P19A 1MO4A 4GKBA 2WOOA 3LUPA 4JDPA 3PFGA 1KE2A 4AJPA 2RJ3A 3A36A 4MYDA 4RYLA 3QUSA 4JMPA 2NYRA 2X58A 1VCHA 3GLHA 4ZYUA 3KZOA 1EFPB 2AOWA 2YXEA 4OSEA 4RLSA 4F12A 4DDUA 1E1KA 4B32A 5L7YA 2AQ8A 4OX9B 1MPTA 3E18A 6ABPA 4I08A 1RVV1 2BFFA 2Y66A 3JQPA 2D54A 2BY4A 2UZ0A 1NF8A 2GZMA 4LMAA 4QL3A 5AKXA 3V7FA 4DQLA 5TLSA 3NTLA 2W90A 3ANNA 3EOAI 5B37A 3MT8A 3LUCA 5G4KA 4HN9A 1TZCA 2WG0A 2WM9B 2ZULA 1QK5A 2VP9A 3ENQA 4E3WA 1QDEA 2O4CA 1QCDA 3AR8A 1VZ3A 1TGVA 3MHPA 1A9PA 3QHPA 2FMXA 4N5NA 5C32A 1U7XA 1N5LA 4A2PA 1GZVA 5JVDA 5M5BA 4OOEA 1MJ5A 4X91A 1R27A 1EX7A 3GJ5A 4R83A 5CFPA 1B74A 1YRWA 3H1PA 3OJXA 2WZBA 1FUYB 4MYCA 1ZRMA 3IXMA 1A7KA 4KE9A 2JIRA 6CHYA 4J2TA 2GEJA 2BFEB 3R77A 1VDZA 1CFZA 4LK2A 2Q6KA 3D7SA 1I30A 5U9CA 2ZSHA 4M8LA 5DYWA 1PFYA 1MTOA 3MEQA 4FOOA 3AUXA 2VNSA 4NZMA 3TQCA 1DOZA 4QBKA 1Z0JA 2DZDA 4BMDA 1UK9A 5JDIA 5K8VA 2B92A 3SSAA 3R5TA 3VO9A 1KAEA 3WSVA 1YL6A 3EVZA 5GONB 4BFYA 4UAGA 4EFMA 4ZHQA 1P2GA 5M29A 4GWGA 3NYWA 4AZWA 4TT3A 3DOUA 1K6IA 3IODA 3SFVA 1F14A 5K20A 3QENA 5K45A 2EKLA 5ICGA 3ACDA 5C5DA 4H17A 1HQKA 4MK4A 1FLNA 2C4HA 1P6UA 1N5OX 2ENWA 4H7DA 3BT7A 2VZLA 1EM8A 1XTUA 5KQPA 1NF9A 1ZH8A 4QU9A 4ZZ3A 5JLJA 4V1CI 1VECA 1UMDA 1L5YA 2EF1A 2TYSB 4J2OA 1M3SA 2JLUA 2DY0A 2Q21A 1Y3CE 1H8HD 1VJDA 1S9DA 2WSIA 4EG6A 2IBTA 4F1KA 2IHKA 3COYA 3R3HA 3IQXA 4IIUA 2OFWA 3HRKA 1TE2A 1U3DA 2OVFA 2ZBRA 2NUPA 2A59A 3DV0A 2HI0A 5BYJA 5TQVA 1T9GS 3E82A 3EJWA 3L43A 3UXMA 4N3GA 1E2EA 1ZIPA 1Q7RA 4K40A 4DPMA 1G20A 2JPDA 1T0BA 4Y2XA 1I6WA 5TPWA 3E53A 3ABZA 2WYVA 3PFCA 4FIZA 1CQJB 1DBIA 3ASVA 4IICA 5A7HA 2FUKA 4ZO9A 2OBXA 3OJWA 1XZNA 1GPLA 2DRIA 1R0RE 2O52A 2W2PA 1ADYA 2NQTA 3WIOA 1FMFA 2PLFA 2Q7XA 3K05A 3F98A 1CEQA 4L07A 3GLGA 1IB6A 4BNZA 2JCVA 2WKSA 5CLGA 1AKYA 5BSTA 3UKDA 1K6JA 5A04A 4IMIB 2GN4A 5BORA 5CBKA 2PH3A 4XD7A 1PFKA 1GOTA 4NFHA 4Y2SA 2EF0A 5LDGA 3GJ0A 4BFWA 1SVMA 1NUAA 1T2CA 1JXAA 2QVGA 5G3ZA 5BRJA 1W36C 1YI8A 1V45E 1VGVA 2HIHA 3CR8A 4REOA 3Q8XB 1WVIA 4G8BA 2GN6A 3R9IA 4CEIB 1KKLA 3LMKA 1KMNA 3F8SA 2I66A 3G2JA 2V96A 1VE3A 1A9QA 3A9TA 4V38A 3VC2A 1NX6A 3T3DA 1ABBA 2BFBA 4ZAGA 1P0IA 4JL6A 1U0HC 1GPBA 1XKTA 4HI0E 5C46F 3EEFA 4TL8A 3IAEA 3JYNA 3ORSA 3MG9A 3A6PC 1T8TA 1JEJA 1XK6A 3F9RA 4D80A 3IT2A 2DAPA 3GW8A 3VDXA 3WYEA 3I09A 1EU1A 5AXCA 5H68A 3VNBA 3EF3A 4EDHA 4EG1A 1F38A 1M1UA 2CUZA 5TARA 2VBIA 3VHXB 2VHEA 1XPJA 4G89A 1S2LA 3T52A 1UXKA 4RHUA 1SBQA 3EVCA 1CIJA 3IJ5A 4LE0A 2P6MA 3ADOA 2B4KA 1O03A 3IHKA 1GG2A 1NP6A 1PL7A 3U3OA 5HJEA 1S3FA 4UUMA 1F0PA 1GDHA 3BCRA 3U62A 3MOSA 3NHFA 1AHHA 4IGKA 4PNPA 1ZVVA 1SOVA 2WSLA 3TIVA 2F3UA 2PKCA 4JI1B 4XOIA 3BGWA 3JQFC 5K0ZA 2OO5C 2J0QA 5JSFA 2HSJA 5MF6A 3V2GA 2G09A 5AHRA 2X3FA 5HIAA 1KEWA 3E6AA 1YFKA 4C7XA 1N9GB 1POWA 1ESMA 3MS2A 4QYXA 3SNKA 2QP4A 1QHHB 2ACWA 2CNWA 3DMDA 4FEEA 4NDAA 2IZ1A 4QX6A 3P9XA 3VKVA 1YB2A 4EX7A 3FMFA 1ND5A 1WPXA 1LVGA 1DBWA 2IDKA 4NG5A 3OQHA 1RYZA 2OKCA 3I3OA 4XIFA 3VMMA 3GRPA 3JQBA 2P9CA 3GDWA 1PJ3A 1R9NA 2A7QA 3NV7A 2ZRGA 1TAUA 3X1YA 3LFUA 4N7MA 3WI7A 4BQSA 3SFTA 2B0JA 3VDMA 1E9AA 3QLUC 4CEJB 1LDMA 2GZRA 3FD8A 4TSRA 5FTWA 4YRBA 4G56A 3LGSA 4RZQA 1OBOA 3V1KA 2V3CC 2MYNA 2C2WA 3CIFA 1VIDA 4ZEWA 2IDJA 1J6UA 4QATA 4ZT7A 3EXAA 4EPVA 2HA4A 4EGCB 4L7QA 2JHCA 3RJMA 4MPJA 2CEKA 1P5ZB 5GINE 4DUYB 4FGSA 4R1PA 2HF7A 1O0CA 3BDAA 5JCPA 3FVQA 4U7GA 4E22A 2LE0A 1K7FB 2VF8A 4ZCTA 4QBHA 4URVR 1CF4A 2LNDA 1SCUA 2Y4NA 3OHMA 2VHXA 2HMUA 6AT1A 4LF4B 1JNYA 3PXEA 1IJBA 4UDYX 4OAQA 4Q3DA 5A2GA 1FFEA 1ONPA 3KTFA 3OKPA 3I52A 1DIOB 4U2GA 1SG6A 2OHOA 3HDTA 5BN1A 1RHUA 3DOOA 3K9CA 2DWUA 2JFFA 5IM4F 1Q14A 1YKGA 2Z8YA 2VBCA 1WUKS 3H99A 4AYTA 4AUNA 5F23A 4EKDA 3QVGA 4Q1VA 1QIEA 4H77A 4X61A 2J9FA 1D8AA 5JCXA 1UBSB 1CZUA 2QX8A 3HA7A 4OKSA 4TLLB 3ICPA 5JFGA 1ZRNA 3SXUA 4N01A 2JJ2D 5TPWB 3S8MA 3WKCA 3BBLA 5KQGA 3ZEAA 4N1AA 3QXGA 3JTEA 4C3UA 2WSSD 5G0SA 2GHRA 4EB6B 2GD1O 4DXHA 1Q20A 3Q7SA 1UPFA 4RVGA 4QQKA 3FLAA 3KALA 4BL5A 5DNAA 3AF3A 3C6QA 2Z5LA 4GSYA 4LF7B 3OU6A 4KFRA 4KIUA 1LRLA 4MKZA 2VH1A 3PDIA 5K7SA 1T0UA 3HYLA 3KZCA 1W96A 3ZNPA 3B2NA 5FTLA 1N1GA 3K09C 1C30B 3HUEA 2GA8A 1WV0A 2NO4A 4MUAA 2ZSIA 3LRPA 4CLEA 1XEXA 4I1YA 3IE0A 3W3AD 1CS0B 4D8YA 3WFIA 3L7AA 4Z9AA 1VE6A 5D3QA 3WBFA 3DE7X 3IA7A 3E1KA 3LPCA 2QZJA 5C7LO 2O8EB 4H0FA 4ZCMA 5LYJB 2AQHA 2OLJA 2YBDA 3GEEA 2JLCA 3DKPA 3KQMA 4QTTB 3HUFA 4B31A 3FCYA 1Z6YA 3TNJA 1YZNA 3E15A 3FBTA 5B3JA 4F91B 1GTVA 5K01A 1IK6A 1M9NA 1UZUA 3HCFA 2W42A 5KMGA 3OIYA 5DLDA 3MS7A 1COWD 4V0KA 3FOBA 5BRNA 3TVYA 2G1UA 3EMDA 2YRFA 1VLHA 4M37A 4ABYA 3CKKA 1TUGA 3MELA 4JI0B 1VGQA 2FE4A 4XARA 1UBOS 1YIAA 3W4KA 1CS4C 1L8QA 4QDXA 4N5HX 1D7AA 3C3DA 4Z1MA 1SC3A 4E5KA 3SQXA 1DIAA 2AI1A 3DSRA 3UPTA 4C6TB 1C3LA 2HW8A 4IDDA 4JLPA 2QZ4A 4XDZA 5DPMA 1YL5A 2Z3ZA 5CFRA 2JIDA 2DQKA 3QEKA 3M4ZA 1JDNA 3CPEA 3FFXA 1RYNA 3LXUX 5JRDS 1DJQA 4NJEB 3TLYA 4Q4LA 1BOOA 2BMEA 5ITSA 4F3TA 1YHZA 5DT9A 1ZGCA 2VQSA 1HRDA 4G1FA 3SHOA 4EW1A 3OEHD 5HQ3A 1Z2AA 4MAFA 3E7XA 3D81A 1SBYA 1U1IA 3F47A 3ZLJA 3L8GA 4PYQA 3QMWA 4EO9A 4KQMA 4TWJA 4KN6A 4KOAA 1G9TA 1M1XB 3ESCA 5J2UB 4OAPA 3IP5A 4MYTA 4D79A 4BMNA 3ZYCA 5CD9A 4A36A 2XUPA 4PRLA 1K0FA 2B5OA 1FU7A 1JX6A 3O8OA 1RPZA 1LI7A 1ZNZA 5TJHA 3NUZA 3QITA 4FE4A 1THZA 2OEPA 4LW8A 4KKVA 5AHXA 3BF8A 4IEFB 5DHFA 3TPFA 2X5JO 3HU3A 5FEMA 2ISCA 2QORA 2Y99A 3D7LA 2RHLA 4KAAA 4OHMA 2C3YA 4YI5A 4WK4B 3NAMA 4MDYA 4GYJA 5BQPA 4CMEC 1C0LA 2GPNA 1TM3E 3QJ5A 5C1IA 1OXBB 5LXTF 3G5TA 1VLMA 3BK1A 1C9NA 4LHXA 1XQWA 4WJZA 5I3ZA 5KJ1A 4RA6B 3NGLA 1XTBA 1YRHA 4NENA 1Q7TA 1ZIYA 3ZHRA 1CJSA 5BNZA 2H4ZA 1NMSA 3PPIA 5LQSA 5TQ0B 4LCBA 3A06A 4H7HA 2IGTA 3QPVA 4I50F 4P4SA 4YDSA 3RV3A 3IVCA 3J7AC 3O2QB 3MQFA 1J56A 3T4PA 4EI9A 4KV7A 4EMBA 3EYAA 4EHJA 2IXBA 3IIIA 3VR1A 1JBQA 2ZEJA 2ETVA 4WXMA 5F5LA 4IXMA 3SQWA 1OXUA 3A1DA 2QF7A 3TSOA 5CCDA 1JIUA 3ZUPA 1SVOA 3O6VA 4RGYA 4CJXA 2RBEA 4D9GA 2PL5A 3GRKA 1G7TA 4M76B 1VJTA 1Z5ZA 3GMTA 5EIFA 1BXGB 3PD0A 3PIIA 4X95A 4JL8A 3ZG6A 2BMWA 4NDNE 4PG6A 3AY7A 3ZS8A 4BLTA 4F3CA 2VDWA 1GDTA 2OG1A 4FGUA 5IWCA 1WCV1 1APBA 3SLRA 1JLMA 2Z5GA 2ZAOA 3PJEA 3U9LA 2VG8A 4C20A 3I23A 4G0MA 4FHZA 1OXSC 1MA3A 2ERCA 3K0HA 4RTKA 1TKAA 1KJQA 2QV0A 2CSUA 3UA3A 3DXFA 4HVAA 1U98A 3C41J 4KCGA 3I5UA 3NBUA 4OXQA 4EK9A 1O5TA 1RE0A 5JZVA 1FE8A 2R9VA 3HBFA 2BYTA 1BW9B 1YS4A 4RPHA 2JJ1A 3PZRA 3W3ZB 2BUBA 3QF4A 5BVHB 3AVOA 1IRIA 1WCWA 2G04A 2YYSA 3IVRA 4RORA 3SM9A 2ZJYA 2VPQA 1QBKC 3G9QA 2GVNA 1K3UB 3F3YA 3E7FA 4B6RA 2XI4A 2Q6OA 4RLHA 2BFCA 1II9A 4MLZA 4NC9A 1EWYA 2KWIA 5DCYA 3DL4A 4IHAA 2IF2A 1AGNA 2VPTA 4RABA 1COZA 5CH5A 3CZRA 1IY1A 4FCVA 2CVPA 2EOAA 4R84A 1GPH1 2C5SA 4C0KA 4MKGA 1IUOA 1INLA 3AP2A 4DM7A 4QVIA 1QZ3A 1MB2A 1DKLA 1Z16A 2PPVA 5AKIA 1ZJ5A 2QPAA 4R71A 3OMLA 4PM4A 1K0UA 4E5UA 1XNRB 3T3OA 2DXIA 1EDOA 1YZ3A 2CBZA 3AWIA 3HJUA 1UZLA 3JAWA 2NACA 3MMPA 4LOIA 4RACA 3IP7A 1QHEA 4K9NA 5E3JA 1E2PA 4BRZA 5AM2A 1D4ZA 4D3FA 1P2VA 4IHKA 5E4FA 4EJSB 4V1CB 2AOXA 4N8EA 2ZE6A 2JFQA 1UDXA 2QRZA 1OHHA 5E2BA 3ZKWB 4AX8A 4UQOA 3TDMA 4Y2YA 1NR5A 3T1HB 3FETA 3QPBA 1FS5A 1DRVA 1FFGA 3VV2A 2HZBA 1QVAA 4WOJA 4ZCLA 3T1OA 4NR0A 2CCJA 1NI4B 4BNYA 5KTYA 2D0PB 2JCYA 3PEWA 3KB1A 4FFLA 3ON5A 3SQOA 1IEQA 4CM8A 3KETA 2FSVA 1ZY2A 4DR6B 1Q22A 1TU0A 1WOYA 1DUVG 3R24A 5TR9A 3T5GA 1NAHA 4X63A 3TL6A 2GA9A 3E0XA 4DUPA 4BCBA 2V4MA 4A10A 2PUCA 2CXHA 1U2GC 4X6YA 3WHLA 1ECLA 1RM3A 1V5GA 1B16A 1EJ0A 2ZI6A 1B6SA 2PO5A 1LDGA 5CTJA 3T4EA 4URWR 4RHTA 5CB0A 4HAZA 5JH7B 1ZD9A 1QTRA 4GM4A 4ZVOA 3ZIAD 1XMPA 1IRXA 2HRQA 3WHPA 1A2KC 2HJWA 2R4QA 1EP9A 5TQ2A 1I4TD 4H3KB 1I1OA 3AY3A 3RVSA 2YASA 4B6JA 2G9QA 4XASA 4FDLA 4DNFA 1UP6A 3FUCA 4YJKA 4CG1A 4R8KA 2H1HA 1G4AE 1M8KA 3NCHA 2QJRA 3I1YA 3B1WA 4WLEA 4ZV9A 4BIMA 4QWMA 1H9BA 3SX0A 4G0NA 4OY3A 1GG5A 1RW4A 5A05A 4BZXA 2LDXA 1DQRA 4LCEA 1JQ3A 2DPXA 2PJDA 3ZU2A 2BFFB 4B7XA 3GZ4A 1GZ7A 3KR0A 2XOXA 1E3IA 4RTSA 5C81A 4LYYA 3BSYA 1T4CA 2A1UA 3OBIA 1BH2A 4NBNA 4P58A 3MMSA 5EQFA 3TSWA 3W77A 1SC1A 3ZHBA 1CYDA 3RKSA 1DP4A 1T9HA 2V6IA 2ZI5A 2IHJA 1BIFA 5A6SB 4JI3B 4F9EA 1J21A 1ZPDA 2HHLA 4MGIR 1N2CA 1LNSA 4ITVA 4AJOA 3HFJA 3U61B 4XWYA 3I92A 4IRUB 2R6DA 1AKMA 1XHEA 4XIJA 4E09A 1A1SA 3H9GA 5EYPB 2BI7A 4MWGA 1Q44A 4TTVA 2JAHA 3ZDEA 1X38A 4Z3KA 1MEEA 3ILSA 4MS1B 1QAMA 3ECCA 1DAGA 3HSKA 4B46A 1JA1A 4FGZA 1H4SA 2WD9A 3N7UA 3U44A 4XEHA 2R7MA 4CIXA 1N8TA 5C4MA 1GL6A 1T2VA 3SBEA 5FRDA 3B6EA 4GMDA 1EUZA 1Z6ZA 1JE1A 4HDKA 3JARA 4JBLA 4NBRA 2H52A 1OWLA 3TL3A 1QIGA 1FFCA 1XAIA 2O57A 4KWEA 5IUJC 5IWAB 4ZTZB 3N1UA 2ZJBA 3KEGA 4HZUB 1NNSA 3EH2A 1NVDA 4GEKA 4O2AA 4J1TA 3FIUA 3MT0A 1BE6A 2DCMA 1C0KA 3F78A 1IL0A 2WAMA 2Z8XA 1US8B 5JASA 3HCNA 4RMNA 1R0WA 2IYAA 2WYUA 4TXLA 1ZD4A 1QZUA 1VYVA 2YOHA 4NK5A 3NKFA 1B26A 3WNBA 3KPJA 1A9TA 1PFGA 4P4TA 2B8WA 4IQ8A 2ECPA 5AOVA 3UKOA 1TYDE 4CEIA 5JRZA 1LTQA 1Z3CA 4B3XA 3OECA 1B00A 1DKOA 1WSWA 2O0KA 1F12A 2UZAA 3IVAA 2AC4A 1ZN8A 2BTQB 3AP1A 3QE4A 4P3PA 5IHPA 2DHCA 4L0QA 3EULA 1P8AA 1VE5A 2W6QA 3DG9A 2GRUA 4URFA 4A6DA 1GZ4A 1GWNA 1UINA 2I0FA 4QVKA 1IPFA 1FFSA 1X7ZB 2VFAA 1LQTA 2EFCB 1QHXA 4OA8A 1U9IC 3OURA 4L5JA 3Q40A 2DQZA 4L0CA 3IP9A 4QOSA 1A2QA 1EZ4A 5IBCA 1G1MA 4CCWA 1OMOA 2HUNA 1YK0A 3PFKA 3E9QA 4AJ2A 3QX3A 1I3CA 4NXMB 3OO1A 3QNUA 4QTZA 4WESA 3RODA 2WHRA 5AQ1A 3O82A 2HBQA 4LX8A 1S8AA 4Q9NA 4KREA 1JBEA 3D5TA 2BD0A 1NVWQ 3CRNA 2O8DB 1G5QA 1M6YA 2R60A 2PLNA 1XDWA 4HLDA 4UVHA 3P97A 1KPHA 4LC9A 4XRGA 2YWJA 1ENYA 1YR2A 2P6PA 4D96A 2PSSA 2VUSA 2WYOA 1XYYA 3KV1A 3GMDA 1SGWA 4U3JA 1M2WA 5ECDA 4JLDA 1PL6A 2GFQA 2BRUC 2EIXA 2RHOA 1MB3A 1MHPA 3L6BA 3ZHZA 5FOUA 2FFHA 4IF6A 1P74A 1WQ4A 5TMDA 2YWHA 3RVQA 4EHKA 5CCBA 4U02A 5LLTA 3HLKA 2VF2A 4WZBE 4EDFA 1KPGA 4L3VA 5BSHA 2I91A 1FX0B 3D5QA 2H31A 1Q0SA 4OQ4A 2C61A 3KVNA 3LQ2A 4V2UA 1LA2A 2BFBB 4ER7A 4CIYA 1PDOA 3IB6A 4EFNA 1P91A 1MTZA 4L5BA 4ESOA 4TRMA 2OSBA 3GT0A 1LBTA 4WOCA 2DJIA 2IIVA 2WWVD 1DC3A 4IHJA 5T8KC 5EUQB 1D4AA 3KJHA 2PTHA 2PYZA 1YCHA 1VB3A 3PYLA 4L73A 3WLOA 1GQSA 2AEMA 2C4WA 3HYSA 2RGBA 4EO4A 1RWWA 1R18A 4R6WA 1JR3D 1DBSA 4FYIA 2I1WA 1CZNA 1HLDA 2R8ZA 1JYSA 1HDEA 1W581 2WZDA 4KLZA 3QLEA 4B6EA 4EUKA 3IE1A 1JBKA 3PE3A 4F45A 3NATA 5F77A 1LV8A 4EKYA 4PC1A 1AD2A 1I2BA 4H4CA 2V98A 1NONA 3CEJA 3EARA 4I1PA 2PX8A 3LBHA 4IZOA 3C7AA 2B0CA 1P2SA 1E2KA 3I39X 1YRLA 4X41A 5DULA 5K8CA 4G3XA 1O5IA 3M6AA 2IYFA 2Z2IA 3WL8A 3JYOA 4WBSA 3H0CA 4A0RA 4D3ZA 3TUZC 1XCGB 1R6TA 3NC0C 3I1FA 1N9GA 4XWWA 2QVLA 1WY7A 1DTWA 4I4TF 4K88A 4KWHA 5K0FA 3CF4G 4URZR 4NH0A 1K75A 4ZVRA 2ZUCA 5HF6A 4D9BA 5GZ3A 2QN1A 4YJFB 1UMKA 1Z6PA 5G0UA 2X7XA 1TD1A 2HA0A 4F3NA 4QYTA 2DC1A 2H65A 3GGCA 3LX4A 4OXIA 1E18A 2P4EA 3WK6A 3GCWA 1EG2A 1HMYA 3AETA 4LVOA 1RWBA 1Y9ZA 2D5BA 2PN1A 4Q16A 3UMFA 1E7SA 4JI8B 3JPYA 1IZ9A 2TSYB 3FSGD 3NAQA 2W6ID 1G5IA 3AVPA 3O1HB 3CVYA 4X7PA 2R751 2G1PA 1YB6A 3RROA 2G0NA 5ILQA 3NBMA 4EHHA 3R7FA 2AMLA 4PQYA 1GZSA 1NBME 3B9QA 5KCZA 5LMZA 2QZPA 4QDOA 3MD0A 1KRXA 4UAVA 3RYHA 1FDTA 3ITKA 3IDOA 4WBXC 1ML4A 4R8VA 1XA4A 5BVGB 4UQPA 1VBNA 4HWSA 2PSJA 3A70A 4CQMD 2O48X 3V34A 4BZZA 1MMFB 4I4NA 3LZCA 2R6FA 1Z7EA 5ICCA 2H0AA 2AFIB 5K0BA 3H65A 2R5WA 3LCRA 5C5IA 1C0EA 4Q19A 2XMGA 1FYWA 2FE1A 2YX1A 4YRPA 3T3MB 4J75A 5CBPA 2B94A 2QRUA 4MAAA 5K0GA 1GG8A 1ZNYA 4JB0A 4CCYB 1I14A 4IV8A 3PGJA 4U9IS 5IVHA 1EB9A 2EWMA 2WPDA 1VYUA 1L7BA 2PSHA 1YGYA 2QAGA 2V4UA 4ZO8A 4ALNA 4AW9A 4CM9D 3HVRA 5F9HA 1NHGA 2J6IA 3LUHA 1LPBB 3WRYA 1HOXA 1WLSA 4FXPA 3FOCA 1RQ7A 2FLKA 3LX8A 1NVAA 2PX3A 4KQFA 3ZQ6A 3S1SA 2MMCA 2PZAA 1R4NB 1NX9A 1T2FA 2A9FA 3DMRA 5LSAA 1PFQA 4JVMA 3BK7A 4U8HA 3RTEA 1VHDA 4TS9A 1EQ2A 3B1XA 3BXOA 4LY0A 2CHVA 4Q4DA 3IJRA 3RWBA 4E07A 2DKNA 4G41A 2ZUFA 4A15A 3P8ZA 1C29B 2BEVA 1N5JA 4MW4A 3C70A 2NU8B 2RHTA 2CLSA 2FWAA 1VA5A 3Q2IA 1L5KA 2GHQA 2PUFA 3G1UA 1X77A 3G2LA 4DMCA 1W2WB 2ROQA 2JJ1D 3OCVA 4WUTA 3PNQA 4EY6A 4CRWB 2E7ZA 2C2YA 4JEUA 3JZAA 2NO0A 2C9ZA 4GHWA 5EHGA 5G0VA 1JJIA 5AHWA 1ZS9A 1KFEB 2BFWA 1L1RA 4KMRA 4A0GA 3TLBA 4RPCA 4AMZA 3DZJA 1FP7A 1UC9A 4WX2B 5EIOA 4YV1A 3UMMA 4RDCA 1PK8A 4OXRA 2AA3A 4HRYA 2P2LA 4LBZA 3WSTA 3B1VA 3VR4H 3QIVA 1R50A 4OGKA 4G07A 4UC0A 1L6IA 3NTVA 3JYQA 5ALDA 2IIQA 4K6OA 3OTQA 3VHQA 4ZT2A 4E2XA 5KOIA 4EPWA 1FU8A 1UM8A 4ZWNA 3RM3A 4HWKA 1E3SA 1RACA 2NNLD 3GUYA 4V0LA 5EZYF 1RYEA 5K0NA 1QIMA 2HBZA 3OPYB 5DU2A 4G0VA 2HIMA 4AY6A 1GILA 3GLHB 3ZY4A 1P7YA 4ZJUA 3HB1A 3K9LA 3EF1A 1P0FA 4E21A 1NYLA 3LP6A 4I5DA 5BSUA 1Q50A 3BTOA 3KT3A 1SXIA 2EW2A 4D9KA 2VNIA 1X80A 1ZGAA 2GM3A 2BFDA 2ZG6A 4H1TA 3R9XB 1BROA 2QMUA 1W73A 2H2DA 3IL2A 1DT5A 3CLUD 4LMPA 1L4NA 1M6WA 2X13A 3K53A 5TQ0A 1V8ZA 3TLCA 1GGNA 2DECA 3GJ4A 3I8SA 3QE3A 2R1TA 4HLQB 5B7GA 2KE5A 3DQZA 1JTFA 1SCAA 3IH5A 3ANTA 5DFAA 1MAUA 1TJ5A 4EGJA 4R7TA 1CPYA 3G89A 3V1MA 4TMVA 5I9BA 4EBBA 5FL3A 4CETA 5IDWA 1Z7WA 2BM9A 1UJ6A 3DMTA 3IUMA 3K8YA 4QD3A 3QEBZ 4LDJA 2EWWA 3RTGA 2YQ4A 3LLCA 4B8ZA 3LW7A 2QXTA 1BDIA 3KNZA 4FEGA 5C7OO 3IX7A 3FGZA 3D8TA 1RYYA 5KTRA 4MVJA 1IY2A 1KZ1A 3M5WA 3V7WA 2GB4A 2PBFA 3O4IA 4WK0B 1KNQA 1TJPB 1CUJA 4RC9A 1IBMB 4ZVKA 4LJYA 1WETA 1O0SA 4MDHA 4PG8A 1XVLA 3U37A 1W5TA 2QTVA 2QRVA 2Q0SA 2WILA 1YCGA 1EX1A 3B7WA 2WE8A 4PG5A 4XTCS 3IQIX 5BN5B 3IPAA 4Q24A 1VSUA 3HBAA 3OM8A 3QGMA 2JI9A 2QUJA 1QYRA 3AHIA 4E32A 1PYOA 3GPDG 1KJIA 1Z22A 4MRMB 5K0LA 4YR9A 4LPSA 1OTHA 2H51A 3THWA 4IQ0A 4R16A 5EZQA 2CMHA 3DE5X 3CUVA 2AG1A 1HLPA 4ZT3A 3SM3A 1NA5A 3USCS 3W1WA 2QM8A 3KSZO 3CHYA 3T35A 2JGMA 1QH8B 1MT3A 1UK7A 3AEKA 3W04A 1C1DB 4DSAA 4WFJA 1FTNA 4Z54A 1EXDA 1RRFA 4TWIA 3D6FA 1XD2B 3R4VA 1GQFA 3BERA 4E4RA 4P4SB 4C76A 3ORFA 1Q1QA 3VV3A 1FRQA 4V0NA 3K9QO 3AHCA 3G7UA 4J1NA 4DIBA 4JLUA 5BO5A 4HGQA 5DNDA 2I6XA 4CCYA 1OUMA 1R4ZA 3TE7A 3ZJ5A 3JU3A 1W0JA 2F62A 4HQOA 1RDFA 4A0SA 1FP2A 1QGDA 1F1BA 5GADl 2EZ4A 2P75A 1U1DA 2B6HA 2BHTA 4BAUA 1ILEA 4UU7A 4J0DA 2X2OA 3F6RA 3M49A 3SF0A 4LSGA 2CZGA 2H4XA 1IVYA 1POXA 4YLYA 4HAXA 1XQXA 3RBVA 2RIPA 4TSFA 5DO9A 2MINA 4ARZB 4UUNA 3UMVA 1RKQA 2MHCA 2P9JA 2ZVQX 4MQ6A 3OLYA 3FRIA 3UH1A 5JYDA 5U1PA 3FFWA 3GJ6A 5DLQC 4RD2A 5L3ZA 3LUFA 1DG3A 4JLJA 1B1CA 4D92A 3KJIA 2UVPB 1DAHA 3WX0A 4YUXA 1RC8A 4NBSA 4KQCA 1J0BA 4C6RA 2DGDA 4QM7A 1AA9A 5CM9C 3ESBA 3UN1A 4D9MA 5A5VA 1JALA 2ZT6A 3H2SA 4FYXA 1NXQA 5DK6A 1EWVA 2ID9A 3KUKA 4I55B 4ZANA 4BO7A 2FDCA 1L5MA 3JATB 3H6GA 5G4LA 1QNFA 1C2TA 4QPPA 1SBNE 4FR0A 3QV1A 1TM1E 3FYDA 4PGMA 2X3YA 1XEFA 3N8HA 2RG7A 2IUUA 5BOVA 3ZX4A 1BGVA 1WLYA 3IOCA 3FGOA 4UEOA 1PEDA 3P5SA 3GLUA 3CA8A 4HLCA 1QLHA 1YQXA 3BL5A 4BKQA 1T9ZA 2Z0MA 3EWSA 4IDAA 2DBZA 5DBGA 2X9VA 2LV8A 4AJ1A 2V54A 3FMIA 1UFQA 3VYRB 2OA0A 4RZIA 2QTZA 3ANMA 3DFZA 3AIOA 1Y5RA 1BS2A 1H2FA 2WICA 5ADHA 2H1OA 1U7TA 1DOAA 1YUBA 1ZZGA 2XEXA 3HBNA 1R8XA 3L4BC 2B4RO 4G0YA 2SHKA 4Q9LA 1AKQA 4CT4B 3ZJTA 2EL9A 2NOAA 2QSUA 4JEMA 1GUDA 4KXFB 3C24A 3RBXA 3SYTA 4ENVA 2CLKB 4JUAA 5EUMA 2GBPA 4M38A 3W5JA 3HUDA 4UTXA 4RS4A 4P5PA 2LCFA 4QXMA 1J07A 4KQIA 3WLJA 1T2NA 1KARA 3RU7A 5I7VA 2FFQA 1NMZA 2DWCA 5EMKA 1NG9A 2EZUA 3ZWKA 1EFHA 1F8GA 1UKEA 2N3ZA 3DFMA 2KW5A 1Q1BA 2PUWA 1M7HA 4BN0A 1QE5A 5KSZA 3E9EA 5E6RB 1ZU5A 2VDNB 3WKAA 3THYB 1IPEA 3GLQA 2JGAA 2WT4A 3AG6A 4LOJA 4MWTA 2WTEA 3ESXA 5JJBA 3N8KA 1EINA 1SVIA 3DBLA 1KMHB 1KBZA 1SOAA 2E1RA 3EXHC 4JUIA 4LEIA 3KZMA 4RFSB 4A5SA 4ARSA 5AFSA 1TVEA 2ZBEA 4H6VA 4Z9YA 3DE6X 2QRVB 2VLIA 3MYRA 2VHCA 3GZNA 2O5CA 3BMXA 3MTJA 1X7XA 3D3QA 1WDLA 1ZUNA 2MSWA 3G9UA 1TVMA 3GFVA 3K1AA 4AY4A 2IU6A 3EDOA 1U90A 4MJLA 2H0RA 3FROA 1PJLA 1QM5A 1S2IA 4ZKDA 3O0DA 1AKEA 4RMJA 3ZD7A 1RM5A 1U4NA 3ZV5A 2PM8A 2VA9A 1C3EA 3H7IA 4L57A 1PHPA 3SS8A 4DRZA 2RH4A 3KZXA 4JQOA 4LGVA 2OP1A 5F1KA 3KOMA 2H1IA 4TKVB 3GNSA 2YNMC 1NQTA 5GJCA 5DTIA 1KDZA 2YYAA 1B42A 2YS6A 5EEGA 4IDBA 2ZUSA 2HU5A 3VJLA 1CRZA 4ROSA 5G53C 1WEHA 4C3OB 3Q8KA 1KQOA 1T4CB 2A1UB 9ABPA 2H9YA 1W36D 3PK0A 4YCNA 2K2WA 2GCNA 4CMIA 1WE2A 3JWEA 3P1JA 2X2EA 4DGSA 1I2ZA 2X86A 3IPLA 4Q15A 1VL1A 4UVIA 4DB4A 2FHSA 2QRQA 3H2ZA 5ISMA 3EXG1 3PL1A 3W5DA 1JA0A 3U4IA 2ZIEA 1TYAE 3LQYA 3PGVA 1KDYA 1DAFA 4US2R 1U0LA 1L5FA 1JKMA 2I2FA 1VHTA 4CKZA 1O97D 1RLTA 1OV4A 2O7RA 3IPYA 4K2HA 5DASA 1K88A 3ADBA 3IEVA 1L5VA 4P35A 3CLSC 1N7HA 1R3DA 1RI3A 5AWFC 1MO5A 1X1QA 3RNOA 5F3RA 3B60A 2C2BA 4CG2A 5CDYA 1OAAA 4ZTUB 4CL8A 5LQRA 3UJNA 3C85A 4U0KA 5CMLA 3VOTA 4QUHA 4B44A 4FYWA 3TLXA 1XRSB 4ARZA 2ZRBA 3D1VA 4KOEC 4E13A 3DTTA 1R9MA 4LV6A 3OQJA 5SICE 3WYFA 1H6DA 2G07A 3T95A 3VKWA 3TTWA 1Y0BA 5HSGA 4QNMA 4UOQA 4DN6A 2AC7A 1V4NA 3MWKA 4YMWA 3VR2A 3W3AH 1ZD3A 3KHTA 2LRHA 3PJDA 4RY0A 2MSLA 1QOPB 1ZG3A 5GIPE 3AVUA 4R6XA 1AKNA 3K0SA 5IUNC 3PV0A 2DKOA 2ILVA 4C29A 7GPBA 4GL4A 2CDRA 4Y6OA 2HCRA 2VIIA 1EM6A 2GEVA 3H11B 2EXXA 4PAOA 5KYXB 3S81A 4GDFA 2VJCA 3MTAA 3OFND 2BGKA 2GRJA 5GTDA 4KR3A 3QEOA 4I6EA 2X0DA 2Z6VA 3K8ZA 2MYTA 3G8CA 3MA0A 1IVNA 4H7FA 1W88B 1Y3BE 5IKMA 3L7JA 4JVOA 5HILA 2I1LA 1JFTA 1YRAA 2O6HA 2NWQA 2Q1TA 3AERB 1EIWA 1IN7A 5BQOA 4H7EA 3LYAA 1OFGA 3MRSA 1FTGA 2Y8EA 4MUXA 4RPJA 1Z88A 2HSGA 4HEA1 4P80A 1NUPA 3EBLA 4EG4A 4F96A 6YASA 5JUWA 1ELOA 3Q7IA 1CR2A 2PGDA 3DFKA 2XT9A 3UHAA 1GSAA 3N05A 3PL5A 2AFHA 4WESB 5AJVB 1P3Y1 1VHLA 2IXAA 3E4DA 4OXKA 4RIFA 4Y9UA 1C8KA 2NV6A 5DXAA 4INOA 2YJ6A 4UQLA 5HDQA 1OVMA 1QPBA 3AONB 2J6BA 4MQLA 4E6EA 4CLDA 4IIEA 1GVNB 3HYRA 5ALSA 1WU7A 2Q62A 3AU8A 3NIWA 3B5IA 2A1TR 3IUPA 3RU9A 4MXDA 3BE8A 1SEPA 5DT2A 2H3EA 4Q6BA 1GPMA 4YRSA 4HX9A 5HK8A 3JYLA 4MR8A 4U3JB 1IHDA 1XBTA 3TJRA 2QUBA 1A76A 1E6WA 1EP1B 1EEXB 4BQRA 5DYNA 4RGVA 4C9BA 4DIKA 2ZRHA 1DKRA 2HO4A 2ZIFA 1UBMS 2NPIA 3EAGA 3GXOA 3KWFA 4FKBA 1ISHA 4FNOA 4N54A 5L51A 1TQ2A 3OWXA 3DBLB 3WO0A 1U0FA 1Y98A 3FN4A 4WKNA 4U1RA 3ETJA 3PA8A 3I04M 4Q9IA 3TEFA 3EVEA 2AV6A 3DLIA 4WK2B 2QE7A 1Z74A 3AKZA 3M5DA 5BN4A 5BW8A 3HYNA 2IF0A 1YR7A 1QLJA 2QX6A 1NXSA 2FN9A 3EB9A 2B34A 2GFIA 1QYXA 3AI2A 1KVQA 1ZYUA 4RH0A 3FYCA 3F74A 2XT0A 4MIOA 3W6ZA 1OJ7A 5AK3A 5GONA 4ZHQB 1Z15A 1Q7BA 3IQHX 3MGCA 3QX8A 2JFZA 2UVDA 3PFHA 4AWBA 4X8HA 1YTLA 4O2BF 3S55A 3LCCA 5IMSA 4P1ZA 1FFAA 1ZM2A 1BX3A 2IHTA 1Z4QA 4GWLA 4UPVA 1H2HA 2HHCA 4F7DA 4HVLA 1Z8HA 1JPUA 2C1EA 5AKEA 4B3RB 2B78A 5T6MA 2I4NA 4EH1A 1A9XA 1JHUA 1OZ0A 1HR0B 3UV6A 5IDVA 3LT5A 5HOEA 2Y77A 2IIBA 4TM7A 3JQBC 4KITB 4YR7A 1PG0A 2V7QA 3CUKA 4N6GA 5ER9A 5H80A 4B8WA 5CA1F 5HK9A 4HDNB 2FQWA 4M49A 3FX2A 4Q00A 3KUUA 5KDOA 4Q5IA 5H70A 4J6FA 2XVYA 3LVRE 2AR0A 4PNHA 3A58B 4R1MA 3VPFA 3R8FA 3E5NA 4H0CA 5AHKA 3SQLA 1PG2A 2B6NA 2QTGA 3RPEA 2W2LD 1DQZA 2C4KA 1QORA 3OJEA 4XWAA 4MGEA 3SC2A 4Q7QA 1TJNA 2WLSA 3I3SR 3I6ZA 4WACA 3RUDA 4BE4A 3SJBA 1V5EA 3H9BA 3IB3A 3M82A 4PYIA 1E6KA 4PSDA 2OGZA 4MO9A 3UWSA 4B45A 3WAGA 1EWTA 1NBMD 1DEKA 3GEMA 821PA 5JMWA 3PGMA 2DLCX 1FLVA 3WSWA 4LFBB 3U1BA 4E3ZA 4KFTA 4EKEA 1M0EA 4V03A 5IVIA 4F9FA 2ZAMA 3S70A 4MVJI 1WKCA 4ZQGA 1MG0A 1SKYB 1Z62A 1F9AA 3KPVA 5BMVF 5K3FB 4WFQA 4I55F 1VL8A 1X14A 3RUHA 3SE7A 4UNNA 3OE7D 3IVXA 5LYYA 5CFMA 1I0ZA 5LOVF 2HAEA 4NBLA 4ZA2A 1CQXA 4HVCA 5IFKA 4JAVC 3ZBUA 5IYZB 5HMLA 1M2FA 2ZI4A 1AV7A 1J00A 4CQLA 4BGDA 1S3IA 3ELBA 1H3NA 1WVMA 2DR2A 2PZLA 3IMCA 2RARA 2X8WA 5LDHA 3ZCUA 2AE2A 3BMCB 2BGMA 4UE2A 3V7UA 2NUAB 4NXNB 1CP3A 4EHFA 3UTDA 4LJAA 1EUCA 3ONFA 4ZZ0A 1U8AA 3K72B 2YNMD 4OJQA 1BS9A 2K87A 2Q2QA 1QV6A 3QELB 4IDEA 1AMOA 1CB7A 1KZ9A 3W5UA 3EDCA 4OP2A 4KMOA 1D8TA 1V16B 2ANCA 2BW0A 2VKTA 3ZZ1A 2ZSJA 3OZTA 3RUCA 4GX1A 3V6LA 1C1XA 2DM6A 1Z13A 3M83A 3WNZA 1C7ZA 2GZDA 1TZMA 1P7WA 5FAXA 1UT5A 1L1EA 1QXSA 2UYYA 1E7YA 3V00A 1JYFA 4XR9A 3U3KA 4JP5A 3LDAA 3W5VA 4HAYA 2KHZA 1SXHA 2R8BA 2W6PA 2AWOA 5JBQA 1FNMA 5C8YA 3KD2A 1EX6A 4EJ0A 1JTEA 4JR0A 4ECAA 3M0EA 5AUQA 5A7GA 3T7EA 5DHSA 3Q7TA 5JSUA 1XRRA 3B1FA 2J3QA 3GA5A 4DMKA 1NVVR 1SCKA 4OUDB 1SKAA 4LIPD 2H06A 1KS9A 3A6LA 1EVZA 4BTLA 5I45A 3L6RA 9MHTA 2AG5A 2NVBA 4YJ3F 1NR1A 2YRXA 1PYGA 3AHHA 3ESDA 1RQPA 1F4VA 1KH3A 2LTAA 3TTYA 5IULC 3N76A 5AM0A 3CCFA 2YZMA 1UEJA 2V97A 3C87A 1KH2A 2ZW9A 4P08A 3FWKA 2P69A 2AG6A 3HKCB 3DHVA 4OGGA 4Y9RA 1QYCA 1P1RA 4DHWA 4DXAA 4ZK6A 1QRSA 3VPXA 3SNHA 4DM4A 1TI7A 2VUIB 1X80B 5AJYA 5ALHA 1JHMA 1Z17A 2JF0A 3IUYA 4F6LA 4MPTA 4PNEA 1V9LA 4NWIA 2QS9A 1A5BB 1EGAA 1UPUA 2Y1DA 4JJ4A 3R7LA 2QL7A 5EGNA 1Z9BA 3CV3A 5DIZA 3UG6A 4A8TA 1WSBA 2N75A 2J30A 5IM4A 2PPLA 2DBQA 2FEKA 3FUUA 4NCJA 4NU6A 3K73O 4AY2A 3N59A 4LHWA 1Z0AA 4G1CA 4U2CA 1U9ZA 4A0FA 1E2DA 5A3RA 1YJ8A 5GV7A 4FX2A 3K6KA 3RSLA 1PJTA 2BFOA 3H5NA 4B8YA 4KR6A 2NTNA 2P11A 2BJVA 3HXPA 4D8XA 3FMPB 3FPKA 1H0RA 3OO0A 1P0CA 2ZYWX 4YRAA 1XJ0A 2RSLA 1K86A 1NFFA 3OX2A 1KYWA 3D3NA 3RYFB 4B2IA 2XTAA 3ND6A 1NJ1A 1H2RS 1MO2A 1QHYA 2GKOA 1AS0A 3FIJA 4GC9A 5DGHA 3ZLVA 1LPAB 4GO1A 3AVWA 4QUDA 4IRXA 3QKSB 1DRKA 2NUTB 4XR4A 2O8CB 3H97A 1VXOA 3NM5A 1P7VA 3ZVLA 5K6RA 2C82A 1XA3A 5GY7A 1KTVA 1FCJA 2ILTA 3G02A 4R0MA 1KJYA 3K9FC 3KWJA 1M6VA 1VG1A 4OFXA 1G5HA 2J3DA 2NZUG 3HQ4O 4L7VA 2KI5A 1C1HA 2Q3LA 4J0IA 2C8JA 3H8JA 3OZVA 3QG1A 1HFJA 1MO3A 3F2IA 3JALA 4JMLA 4NAHA 3WTCA 2D2VA 2IV7A 4NIMA 5BSVA 4AXBA 1RZRA 3I2HA 1L5HA 3ED1A 3K4PA 2PR2A 4GC5A 1U3GA 3URKA 3WS7A 9ATCA 1UBKS 4O2RA 1N1DA 3WYGA 4EJFA 4KRGA 1ZOLA 3L77A 1PIWA 3H0EA 3G2HA 4UXIA 3AHGA 1YRYE 5IT5A 4DZZA 3I30X 2YW9A 5HIJA 2OG2A 4R0NA 2NV2B 4ZMSA 3VR6D 4DLAA 4UDXX 2DYKA 3M81A 2C4MA 2QTAA 1IN1A 4W9MC 3VO8A 3C6XA 3QYJA 2DETA 4KFSA 1HUQA 2R65A 3FSEA 3ZLBA 2QA5A 5ALNA 2HLDD 1E0DA 5B30A 2E37A 3QTTA 2AWNA 1II8B 4L9WA 4RTMA 2FFBA 1VMAA 1QH9A 5HFNA 2Q7DA 4AJ9A 5BSGA 1FRNA 4YCJA 2FB9A 4O4LA 4POOA 3HMQA 3U4DA 4C5CA 2NIPA 3PIDA 2OWEA 4MWDA 2GBLC 1TQ6A 2NSDA 1VLQA 3Q9NA 2VPWA 5ED0A 2PZGA 3FVWA 4IL5A 1E96A 1K4KA 5FUYA 1DAMA 5BV7A 3WNVA 2W2NA 2AN1A 4HMPA 1TW3A 4E5NA 5AW7A 1IY8A 5HQ3B 3RHZA 3QFCA 4LSZA 1AX9A 3TMAA 2Q6VA 1S2MA 3EFOB 1AIPA 4M3NA 4ZVMA 4G5SA 4JBGA 4YBZA 1GM5A 1HFKA 3ZWQA 2HEGA 3DBVO 5C8YB 3P32A 1NMXA 3N2YA 1T3TA 3PC6A 5KWJA 2FETA 2GM9A 3K6SB 1VG9B 2IYVA 5DYYA 5J2UA 4AZ0B 3O75A 5B1DA 4ERXA 2B7LA 4IIDA 2V0GA 1M0SA 3N07A 3L2OB 4H6PA 1NATA 2ZSUA 1QGED 3KXPA 3DBRB 4C7JA 4DNOA 4ID3A 4GZ6A 5CDFA 4DGQA 1F17A 4HQKA 1Z2PX 1QNLA 3D1JA 3QP9A 1JAYA 1VI2A 3T12A 2PJZA 1VC2A 3DH0A 1EFVA 2QR2A 4O4IF 3TINA 1PR3A 3C3BA 4LRUA 5F33A 4BNDB 2DVMA 4DQVA 4G5FA 1SUIA 3EIXA 4ITRC 4R1NA 2UU9B 2XOEA 2JG3A 4WCFA 3NKLA 1N8SA 4MX8A 1EK0A 3BGSA 2R4UA 4E4TA 4TKVA 5JAUA 4Q02A 1EVQA 1NU8A 1L5GB 2VXOA 3BL6A 1QQBA 4EPTA 1UDCA 4UDNA 5UKDA 2PV7A 3I9KA 2V5AA 1ZGGA 4KL8S 3LW8A 1JJAA 4RF4A 1GRRA 4MJXA 4NHEA 4TXJA 5FL7A 2VP4A 5F7XA 3HO1A 3KR2A 4R54A 2Q3EA 2WEKA 4K8RB 4QUBA 3SEZA 3TXYA 2UYHA 2I8AA 1YGPA 2PANA 3CLVA 1VE9A 5JY1A 1MVOA 2GKSA 2X9GA 1PZFA 3WK4A 2CNBA 4TTRA 1JQBA 1E2NA 1K6MA 1XZPA 4A1FA 4DTIA 5A06A 4ILEA 1NBHA 4F4JA 1BQ3A 2PU5A 2I7DA 2V6BA 4HQRA 4ZXPA 2YXNA 4WBNB 5M3BA 3OE1A 1CX9B 2AT1A 5T41A 3TLEA 1W4LA 4J94A 2J0UB 4AO6A 4PEVA 5CNIA 4XE5A 4CL2A 1DGQA 3AEUB 3TI9A 3QKSA 2O8CA 3A2MA 3K1AB 3D9QX 3OT5A 3H9JA 1EFRA 1I2MA 1N0UA 3AK4A 3WLLA 2JIQA 2O1WA 2QZSA 5CU7A 1BW9A 4EA8A 3G8DA 4R7GA 3DBHA 3INRA 2P68A 4NLLA 1AS3A 5K51A 4Z4FA 1GZUA 4GOLD 4WK6A 1PR9A 3RFXA 1ZXLA 2BDTA 5BVGA 3R3VA 5KEIA 4KU4A 3FOZA 1ZAYA 3EXEB 4EKGA 4MUBA 5KQLA 4KXQA 1RXUA 4M87A 1UBUS 1O89A 2DPHA 2VYFA 4KBYA 4MKXA 5EHQA 4AMUA 4TZKA 2YOFA 4IGFA 1HDGO 2DTEA 4JEIA 2C2HA 5IBRA 1YFZA 3GYBA 2Y05A 1X13A 2BEJA 2YY6A 1X7YB 3BYZA 3EA4A 3T7DA 2J1LA 3M5PA 4HS4A 2C9BA 2JKVA 4KIGA 2YMQA 4ZU3A 3MWDA 3M7IA 1XTKA 4G8JA 1O94D 1NZDA 3R5JA 4M7OA 5U4XA 2XD4A 3TIXB 5E7IA 2J4FA 1KKMA 1XROA 1IN8A 3NJ4A 3KOUA 4D3DA 5BPHA 4QEZA 4EMUA 3WBBA 1JN0A 3TM4A 1N3LA 3O8QB 4FMDF 1E4YA 1YNOA 2AMYA 3L7LA 2RHRA 4AYXA 5JXWA 1PK7A 4MGHA 4K8OA 5HQJA 2UUAB 1ZVJA 3BD8A 1DRJA 5JAMA 3U6BA 3DJFA 3SJCA 1X39A 4OYYA 4IOJA 5E7JA 1GGKA 3C3WA 3CWCA 5KTTA 2VTBB 4BO2A 1MABA 4DPKA 1UPCA 4Y0NA 3EQ2A 5IJZA 1N36B 1LC3A 4JVNA 2C94A 3CFYA 2FZ5A 4JC8A 1XLTC 4QXRA 1EGQA 1DRUA 1NI4A 1M8FA 1P1FA 1RVDA 2FW0A 2FWPA 3DVLA 2X23A 3I01M 3TDNA 4KHPB 4NFSA 1ZIOA 1Y1SA 3DEZA 2D1SA 4QJ4A 2I3ZA 4Z51A 1QFYA 1P0MA 5JMPA 2CLLB 4BV2A 2XCIA 3CCBA 3SLKA 3PHLA 3VZDA 1KFKB 4KO2S 2EYQA 3GLRA 2HDWA 3CF0A 3O9VA 2ZJ7A 1I36A 4CF5A 2QSJA 2CV2A 1FDIA 3KOWA 3ADDA 3H1EA 1R8QA 3A11A 4FFRA 5JQGB 3RT1A 3FKSA 2D62A 2NYVA 4ALMA 4P33A 4J1SA 1E3JA 2PQ0A 3QU7A 3BJRA 4JROA 4ND7A 4NP6A 3U0VA 5JNUA 5LQKA 5NULA 4ZYZA 4G0OA 4OHUA 5AKJA 2AL7A 2I5PO 2L19A 3LTNC 3UJHA 1JDTA 5CAEA 2YH2A 2XADA 4MW2A 4RV5A 4YCDA 2WB2A 1P5FA 1CNEA 2G6BA 3TVDA 3WWCA 2D7JA 1CV2A 1SD5A 5FH9A 5HKKA 2OMEA 1NXWA 2WUFA 2ZB2A 2J5KA 3PF8A 2O0JA 5CEJA 2HSWA 2QR5A 3BRWA 4R1UA 4AIRA 4OHPA 1ILWA 4DF3A 4DLVA 4BNIA 5CHEA 3LD9A 5CCEA 4GVXA 3IUNA 3LLUA 1GGVA 4GR4A 4BO5A 3WGJA 3IIKA 1R4MB 5IXJA 1M8PA 5JYCA 3EIQA 3TJZA 1QGUA 1U2RA 1QP4A 4GH5A 2QBYA 5TDHA 3S1AA 3N75A 2LKCA 4ZVSA 1WCIB 4BB0A 1L3BA 2CK3A 1CP2A 1CXZA 1DEOA 1JZSA 3BPSA 3H75A 4RZUA 4TTSA 5AW5A 3VU3A 4AX4A 3HK2A 2VZEA 1YC2A 2WNHA 3BXGA 3TUIC 5FPYA 3HZRA 1CUZA 3MBOA 4UARA 3Q8LA 2IEDA 4Z7OB 4JJ6A 5FWAA 3UPUA 1RAIA 1M8GA 1LKZA 1SUWA 1WHTB 4A73A 4BFTA 5BQFA 4OL9A 3MTDA 4EZIA 4UNSA 2WPDD 1QHGA 4MICA 3T1TA 3IXQA 3WYDA 4R3UC 2QP9X 1OW3B 2H29A 3ROQA 221PA 2QN6A 4FP9A 4MVYA 4DYVA 2H11A 4OB6A 3H5VA 4YHHB 1LBHA 1PNOA 4Z3OA 3SKVA 3QWAA 3QXSA 1HMPA 3UCFA 1AN9A 4AJJA 4XJVA 1UKVY 1XLTA 1PVVA 2AN4A 1OWOA 2B37A 4MI6A 2W58A 3G8BA 3KQSA 2XGJA 4BP3A 4IKEA 3WK8A 5B7NA 1E5LA 4TKUA 4TWBA 5TV2A 1IHPA 1TOAA 1YQQA 2ORED 3QXJA 1B6RA 2WF9A 5JC8A 1SHUX 1SKBA 2BGLA 3DBHB 2Z1NA 3DDCA 2ZVJA 1ADBA 4BOYA 1V8OA 4E0BA 4XQEA 5EE3A 4B6SA 4KACA 4MS3B 2G08A 4E1VA 1MENA 1XKXA 1AT1A 3AEKB 3GJXC 1L5WA 1M34B 2XCTB 1MA0A 4B4VA 1GN8A 4B3BA 2G4CA 4ZT6A 5SY4A 1W5AA 2E2WA 5CJPA 4AS1A 2G70A 2VHQA 3OPMA 2ZROA 2OGTA 4G09A 4BZPA 1OXKB 2RGGA 4Z8YA 3CF4A 1MLDA 1NIJA 4HBZA 4Y9DA 5JCJA 4F5WA 2C29D 2VOEA 1JEAA 1GFSA 2GK7A 2V55B 1N2ZA 1X8XA 4JZYA 4MRPA 4PCLA 5KMGB 4B6PA 3F7OA 2CXSA 3GNTA 4OXYA 2ZYDA 4S1NA 1CE8A 1S2OA 2YV2A 1KE1A 5KNCD 2XUDA 3KZ1E 2BZ0A 3PQ4A 2FCAA 2G40A 1GGHA 4ARAA 4FDUA 1N6LA 4ENRA 3PE4A 2WF7A 1NNI1 1V1MA 2KSQA 3CZPA 3OZUA 2INGX 2Z3WA 2WWWA 4LMRA 1N57A 1K27A 1NV9A 2H2AA 4K81B 1PDVA 1IWPB 2G9RA 4TS1A 1BDJA 1P29A 2PUJA 4QUJA 3B9BA 4GNRA 1T5IA 1VFNA 2QVBA 2H4YA 1LS6A 2D1TA 4DT1A 2ZTHA 4U5XA 1KAGA 1U0TA 1XEWX 3NWPA 4OU5A 5FTNA 3TG8A 1AGPA 4RIIA 4QOJA 3MB5A 4M4SA 1JAZA 3JVEA 5HUHA 1FQJA 4TYQA 3BE5A 3E9ZA 2A0KA 5HWSA 1OLUA 2CLCX 2K5UA 4LZJA 3VPHA 2FSUA 3BCSA 1AXRA 1J25A 3KQYA 5HF5A 3O4VA 1NKVA 4I46A 1NLUA 4JOQA 2FRVA 1MC5A 3PC8C 4MHSA 4UM8B 1XNHA 1P18A 3M6IA 5ALPA 4Q05A 1T6ZA 4UHHA 1YQWA 2ZUEA 3TD2A 1XVVA 3KBOA 3T1QA 2P9ZA 3W9YA 4BJ3A 3OTOB 1DMSA 1IVSA 1NXTA 3O2JA 3R5HA 1WP4A 1Z12A 2BTOA 3OE4A 4GPIB 5D6NA 3TRDA 5I7SA 4RO0A 3R7WA 3DMNA 2HJGA 2CCKA 3PD7A 1LLQA 4Q1BA 1H3EA 1RJWA 2D5LA 4AECA 1TKBA 1YAHA 2QMHA 2O2DA 4Z0TA 4AJEA 4AZTA 1U2PA 2XLCA 2VK8A 4WZAB 5AP9A 3TLGA 2ONJA 1V47A 1IQRA 2PXHA 5NLLA 3AIKA 1BXKA 3EH1A 2HWYA 3HKCA 4S1VA 4RIHA 3QIAA 4DA9A 4EGSA 4HSEA 4LDAA 5FTJA 3WLRA 3H87A 3KSDO 4TLAA 1GKIA 2P30A 1EFAA 4BU0A 1LLFA 1Y37A 1J97A 2FX2A 3D4OA 4QLBA 1QMPA 3NFRA 2ZSAA 2IXFA 1DXOA 4QGSA 1E2IA 2DPYA 2O3TA 3GA0A 4RHCA 5E3IA 5GIOE 2RBGA 3Q3IA 4QGBA 1HKHA 5D7NA 4QOIA 1D9ZA 3C48A 3NYRA 1SHZA 121PA 2HU2A 4L27A 1EXVA 2P3SA 5LQMA 2MR6A 2QJTA 3D8UA 1T15A 2C4TA 1OZAA 1ZUIA 2Q4EA 2ZRQA 3A4IA 4LAFA 1EVLA 4YRTA 5EXEA 3VH2A 3KYDA 5L4LA 3H2HA 2Y93A 1ZN7A 4LOHA 1U2DA 2D13A 5ARCA 4KXNA 1BXGA 1SBTA 2X5KO 3HA3A 4Z4IA 1XCOA 2WFLA 2Z09A 2G1KA 3FHCB 3UB2A 3OHPA 4NCBA 3ESYA 3LQQA 5KOHA 5C1OA 1T25A 1NR7A 1ZRHA 3P0EA 4GD3Q 4DV0B 3LNCA 2J9RA 3QU5A 3BKWA 4Y2VA 4JBYA 4C7VA 1Z7BA 4QM6A 3PVSA 1DC7A 2PZKA 4WTOA 3O83A 4BIIA 3NTRA 2ZCUA 3LPLA 3IP3A 1E79D 1R6AA 2RDMA 1FFDA 3NOOA 3OQVA 5THXA 2VSOA 3OOYA 1ULHA 2ZAIA 5FQNA 1PLLA 2A0UA 2R8RA 4N6NA 3TWOA 3U7EB 2C3UA 5C35A 2DUMA 2P2GA 2VRNA 3M3PA 3PNYA 2PQ6A 1DWUA 1JDSA 1K7EB 3C8DA 3QF4B 4K6GA 3V33A 3HSYA 3ZTTA 5AXBA 5BWMA 4BNMA 4ZQBA 4JN6B 4V0ME 5KWEA 1CUWA 1F6WA 4YECA 3T4XA 2V6GA 3NFYA 1E94E 4ZAWA 2NO5A 1XALA 1ZH2A 1C0PA 2PGLA 4AL4A 1ZD8A 3RSFA 3PR2B 1RQNA 3ISTA 5ERXA 1PJSA 4LHVA 1N8KA 3HEAA 3MCWA 4MAMA 2M6LA 1UMCB 2XYPA 1FLAA 3NDRA 3U16A 1C7EA 2XD9A 4F4HA 2HMVA 3EXFB 3DJYA 1U0EA 2IWRA 4CVNA 2HA2A 1KNXA 2GR9A 1YOVA 3JWJA 1XXHA 4HGRA 4BTEA 5ALJA 4OCZA 3SVTA 5DTMA 1GCIA 3DE1X 3K0FB 2ZYSA 1OYYA 1RHMA 1SJ9A 3QMMA 4V1CA 5E4YA 1ZWKA 4JT8A 1KIFA 4F2PA 3AR3A 4XB2A 4QBFA 1YULA 3L8ZA 5EJMA 5C8ZA 1Z36A 4HDCA 1L1FA 5JS1A 4G9BA 5ECWA 3CN9A 1L4GA 2QGZA 3PI6A 4ASUA 4EECA 1NDUA 3GWZA 2XMQA 4Q39A 3OLWA 4QWWA 3ZX5A 1ST3A 4GXRA 1U6JA 2Y0PA 1T36B 3KLMX 3PUHA 4NY1A 3IHLA 4CLRB