4FWIB

Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
320
structure length
310
Chain Sequence
SIIIRVEDLRAVYLVREGTIKAADGISLDILENSVTAIVGESASGKSTIIEAMTKTLPPNGRILSGRVLYKGKDLLTMREEELRKIRWKEIALVPQAAQQSLNPTMKVIEHFKDTVEAHGVRWSHSELIEKASEKLRMVRLNPEAVLNSYPLQLSGGMKQRVLIALALLLDPVVLILDEPTSALDVLTQAHIIQLLKELKKMLKITLIFVTHDIAVAAELADKVAVIYGGNLVEYNSTFQIFKNPLHPYTRGLINSIMPIPGDPPSLLNPPSGCRFHPRCEYAMEICKKEKPKWIRLDGEAHVACHLYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the nucleotide-binding domain of a dipeptide ABC transporter reveals a novel iron-sulfur cluster-binding domain
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Transport protein
molecule keywords ABC-type dipeptide/oligopeptide/nickel transport system, ATP
total genus 90
structure length 310
sequence length 320
ec nomenclature
pdb deposition date 2012-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
B PF08352 oligo_HPY Oligopeptide/dipeptide transporter, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fwiB00
1SVIA 2ZIAA 3QI2A 4R98A 1YR6A 4OL0A 4NYIQ 2YOGA 1ZUNB 2WHXA 3FE2A 4M8NE 1KO7A 3C14C 2WPDD 4GOKA 1I4DD 1GL7A 5KTYA 4O0MA 2I1VB 4XVQA 2C9CA 1RW4A 2IW3A 3TSWA 2ODBA 1GP2A 1D2NA 3E70C 4AURA 1NSFA 2ZRCA 3AF0A 3Q5DA 1GTVA 4QJ5A 2NO9A 2PMDA 1GKUB 2RCNA 5IK2D 2QMHA 1P61B 3QXHA 1T5LA 2BVNA 5AUPB 2YC2C 3M4YA 4AI6A 5FBVB 5FOUA 1UFQA 5CM9C 4E07A 3TH5A 1E1RD 4BECA 1CJVC 2DPXA 3SJCA 2B7CA 4W7SA 3SQXA 4NH0A 3PFIA 2ORWA 4X8MA 2O0HA 2XTMA 2FEOA 1FNMA 4I1OA 1YZUA 3EWSA 1Z63A 2FFHA 2VQSA 5SZJA 1W47A 1ZC3A 1IN5A 2WKPA 2CCJA 5BN3A 2F6RA 4RVCA 2IYWA 2DBYA 1G8HA 1YU9A 2BM0A 2PEYA 2GJKA 3EG5A 5AR1A 4TWZA 2IHBA 2RH5A 3T34A 3EPLA 4HSEA 5BYJA 3T35A 2KI5A 5SZKB 2WZQA 3AF3A 3QXSA 2ZYTX 1VHLA 2J7PA 1US8B 5C4GB 3BFKA 3LRPA 3QBVA 1E1QD 2VSFA 3NKVA 2F9MA 3V4FA 3L8ZA 3IEUA 3Q85A 1WMSA 4IDHA 4MKIA 4D0NA 1C1YA 4MUAA 1G8FA 4LI0A 2R44A 2QAGB 4DLWA 4XWAA 3OEEA 4G5RA 4Z8XA 4BFYA 2O8BB 2QI9C 4M21A 3VR1A 1TUIA 2RHDA 4ZDWA 4JMPA 1NVXQ 1TF2A 2BKEA 2AFIE 4GRAA 3U7GA 2G3YA 3GLIB 5H8WA 1AQYA 3FKSD 4A8JA 2QP4A 1E6CA 2IT1A 4FN5A 4BFVA 5EXSA 2D2FA 2C99A 1VYTA 2Z0MA 3KDSE 1AZSC 2QSZA 3UIEA 4ZCMA 2Q9AA 4M9ZA 3KXKA 4FWIB 3VKHA 4KAXA 3CX6A 1VMAA 4TMTA 4AK9A 4DLSA 3KFXA 1FX0B 1W0JD 2JATA 2J46A 2OXRA 4YC7A 3TUIC 5J4KA 2CJWB 1TUEA 3O8BA 3TGPA 1XWIA 4K8OA 4MGKR 2BV3A 2P67A 2ZI6A 3BAFA 1A82A 4OYHA 4UNQA 3SBDA 2ZRIA 1JAHA 3NG1A 4U7DA 2QUZA 4U5XA 2V7QA 4TYNA 2RGDA 3LVRE 4JVSB 1RPZA 2E1RA 2EFCB 4ZDJA 2O8FA 1E2EA 2J3EA 3EIQA 2AX4A 4DRZA 3QE0A 1H8ED 4LUCA 3RWMB 4O3MA 2CL7X 2EFHB 3G5UA 4MKHA 1S8FA 1UBFA 3LO5A 5TB5A 2BMFA 3K70D 2KBEA 2XSZA 3Q8XB 3KJGA 2XXAB 1P2VA 5CM8B 4HZIA 4AKIA 4PSVA 4OQXA 1G5TA 3LLUA 3K9GA 4ZKDA 3RS2A 1TF7A 2FFAA 2KE5A 1NBMD 4BRUA 4L5BA 2GJ8A 1YRBA 5TXGA 4Q1BA 2XOKD 3BRWD 1XD2A 3THXB 2ZSBA 1IXRC 4Q9LA 1TU4A 2RGCA 1G3QA 2J5XA 2VA8A 2DFNA 5E7JA 4D82A 4BASA 2X1VA 1QHXA 4F4CA 4Q00A 4OI4A 3ZGXA 4CIDA 1U99A 5CDFE 4K81B 4YDHB 3P26A 1D5CA 2X19A 3HPQA 1DAEA 1KI3A 4CGZA 4DSNA 3CNNA 1T3LA 1QHGA 2VP2A 5P21A 4BGDA 1E9SA 1XJ0A 2FPMA 4MGYR 1JXMA 1IN8A 4S2EA 4JKYA 1V5WA 3VAAA 5KSYA 2W58A 3DO6A 1UKEA 4EPRA 4HUQA 2QQEA 5FFMA 1ELOA 1FFHA 2JAQA 2BBSA 3PUVA 3K09C 3E1SA 3W6NA 2YKGA 2XTNA 1U9IC 3Q7QA 2ZS8A 1PUJA 4MYTA 4AYTA 3ADBA 2ZE8A 5FOWA 4HAZA 3ZZUA 1R6BX 4JLMA 2EU8A 2CBZA 1G7CA 3CF6R 1P5ZB 2BMDA 3MGCA 3QKSB 1X1SA 5FTJA 3GJ4A 3RS5A 1WXQA 2FDCA 2Z6VA 1J8YF 2E87A 2L0XA 3DHWC 2PZFA 2QMUA 3WRXC 2P6UA 1MT0A 2D4HA 1G21E 2WAYA 1KO4A 1JECA 4QJ3A 2ZI7A 2GDJA 1E2FA 3PEWA 2AWNA 3QKRB 1P72A 2ZSAA 4PHGA 1IONA 3I72A 4KVGA 2DCUA 4PHTA 2O0JA 3E2IA 3BFXA 1LS6A 2GCPA 3TAHA 3LBIA 2ZRBA 4YMWA 3IIKA 4ESHA 2FX3A 2V7QD 4G3XA 1UM8A 4BLSA 3ZVNA 1JEEA 3I8SA 4DVGA 1Z5ZA 4NCHA 1FL9A 3MFYA 4JLAA 2P65A 4OJQA 3NHBA 4LJ9A 4NCKA 4QHSA 3VFDA 1Q1BA 5LB4A 1Z07A 4C30A 1KMHB 1AKEA 1F3OA 1N0UA 2IF2A 2ZS7A 1UEJA 2H92A 4GDFA 2IUUA 4GFDA 1VIAA 2HF8A 221PA 1T3SA 4E03A 1X3SA 4KLNA 2ZI9A 2FSIA 2Y8EA 1M1YE 1IXSB 4NYMR 2GXSA 3LV8A 1RKBA 1JPNA 1R5NA 3OEED 3I3SR 3FMIA 4BRWA 1YR9A 2AWOA 2YINC 3OZXA 3EXAA 2EQBA 3OFND 4A15A 3IUYA 1KO8A 2JDIA 3VX4A 3P27A 4KYIB 5EZ6B 3KQLA 4HLUA 2YWHA 4JVMA 1DS6A 1JAIA 2AK3A 4MKGA 2XZPA 5JLJA 3R7WB 5C2JB 2IYXA 4ESVA 3MUFA 3AP2A 1KK0A 1KSJA 1ZD9A 3LX5A 1VG9B 3NEYA 1GWNA 4DSTA 4ZO4A 5CIWA 3W3AA 1UKYA 1XTQA 3OIYA 3BC1A 3AVUA 4UNNA 1QDEA 4EPWA 2ZRPA 4PHFA 4RY2A 3N5CA 4NTZA 3MG9A 5DI9A 1WF3A 4PTLA 2N1BA 1NI3A 4WZ6A 3KFVA 4PSKA 3CNOA 2ECKA 4IOJA 1W2GA 3O8DA 3DMNA 3SJAA 1DELA 5EXXA 2AK2A 2BEKA 5JSZA 1JR3A 3IILA 4CT5A 4KFUA 1G8PA 1GRRA 4V0ME 1NNEA 3CRMA 2YC4C 1XP8A 2NPIA 4JZKA 2RGNC 4H1VA 3EPJA 3TSOA 2HV8A 4PC7A 1G9XA 2DR3A 5BWMA 4RD0A 2AHOA 3F3YA 3HU1A 3AB3A 1KKLA 3FDIA 3AVTA 2O8BA 2O5VA 1DARA 1KO1A 3L8YA 4P31A 1NKSA 4RD2A 5DE3A 2HXYA 3QF4A 1VG0B 4KFRA 2ZJZA 4TLEA 4DLYA 1CR0A 1R0XA 2LWIA 1E1QA 1UF9A 5BN4A 4US2R 2NMVA 1Z6GA 1SXJD 1W44A 2C98A 3LY5A 121PA 4EJSC 1UAAA 3I4LA 3PJRA 4XD7D 5JHHB 3B1VA 4QGGA 4PC6A 1RJ9A 2PMKA 3A1WA 4WA7A 3HR8A 5KSOA 3R9XA 4HATA 2PJRA 4TTQA 1FTNA 3FKSA 4P3YA 4NYMQ 2F3RA 4BZQA 2DFKB 4DJTA 1JBKA 5CLQA 3W3ZB 5KHOC 4GL2A 2BMJA 3P4XA 2AKYA 1NVWQ 4Q66C 2XEXA 2GBLA 3C15C 1KHTA 2OZEA 1DBSA 5DI3A 1G3RA 2QG6A 4GOXA 4DUGA 2W00A 1AS0A 2QE7D 1E9RA 4HI0E 4JL8A 1KO5A 1SVOA 1BIFA 2V1XA 4DEYA 1T4GA 2ZVQX 2A5FA 3WYGA 3ZIAD 1VYUA 1JPJA 1Q22A 1Z22A 4KYUA 1HT1E 5D3MB 4F7WA 3ZDQA 1A7JA 1BOFA 3DOFA 1X6VA 5IT5A 3HYTA 3KKNA 2GILA 1N0VC 4TYWA 2ZTSA 3V00A 4B33A 1E32A 2F9LA 5C4MA 1H65A 1RFLA 2CVHA 4LHYA 5DISB 1Z83A 1I2MA 3UMFA 3U3OA 1G41A 1KI9A 1SZPA 2WIAA 4TLBA 5EE5B 2JCSA 1EFTA 4QHTA 3GJ0A 2R6GA 1BS1A 5EP1A 1F60A 4LPKA 4QFMA 3HJNA 3PEUA 1R0YA 3UATA 3KL4A 5A0FA 2IA5A 2BEJA 3IIJA 4IFEA 3RS4A 2PLRA 4LBWA 4TLAA 3SDZA 1Z08A 1IXZA 2OFXA 2OFWA 2C78A 2CCGA 1CR2A 4IOMA 4EPXA 1F6BA 4PPQA 5HZHA 1CU1A 2AN9A 4HAXA 1W4AA 5DI3B 1M6NA 1F2TB 5EP2A 1UPTA 1VCMA 2KB0A 1SHZA 2ATVA 2X2FA 4C2TA 2QMEA 1N5KA 4O25A 2OBMA 3BFVA 4PZYA 3PXGA 2ZQ5A 5FPTA 5D3QA 1T91A 4Q4HB 3FHCB 2MSDB 4OHYA 4BE7B 1XX6A 3I32A 3UANA 2GAAA 4TT3D 1NKTA 5J4LA 4QBHA 3WYAA 2CE7A 3QSYA 1GRQA 2R9VA 3AKYA 5HR5A 3AF4A 1OFUX 4TL7A 1N6IA 2I4IA 2QA5A 2WAXA 3CZPA 1CJUC 2QORA 3LQQA 2D7DA 2FGKA 1E9EA 4LRWA 3W5JA 4EJSA 5FL7D 1D9XA 2OXCA 3QPVA 4DLUA 1U8AA 5DYGA 1E79D 4KBGA 3TRFA 4TLCA 3LFUA 2Q9BA 3PR1A 3GEEA 1T0HB 1YR7A 5FTLA 4UXIA 1E9AA 4G5GA 1Q44A 1RZ3A 3FTQA 1SVWA 1ZINA 1CF4A 4W5HA 4J0QA 3AVVA 4QC2A 3HPRA 1BYIA 1Z29A 2BC9A 3OEHA 1OH6A 1AQUA 3K09A 4RD3A 2YOHA 3OIUA 4CW7A 2O8CB 2FV8A 2QPTA 2WICA 2BCJQ 2UZIR 3GLHE 4LJAA 5FOVA 1YZQA 1NF3A 3A4NA 4Q21A 1Z0FA 621PA 1E0AA 1JR3D 1KK1A 2ZJ2A 2V6JA 4LC1A 1JR3E 4CEIA 1OIXA 1HA3A 3TMKA 5FTNA 5JJKA 1WDTA 4LJ4A 4ZDKA 5IDVA 4C2UA 2QTVB 3IQXA 3QKSA 2ANCA 2JJ1A 1OXTA 4Z54A 4AIIA 2PJZA 3EW9A 1XXHE 4OHZA 1T0JB 3W6PA 3NDPA 3CR7A 3D3QA 3L2OB 5FR2A 4LJ7A 1SKYE 2B21A 4C0AC 4M1OA 5JCPA 5J4HA 1M74A 2CNWA 3Q7PA 4LK2A 3QPWA 2GXUA 4YONB 1HH4A 3IDQA 1BO6A 4NBSA 3GJ8A 4EJSB 2G83A 4LHVA 4F93B 2V55B 4A9AA 2ZJYA 2HLDD 3VKWA 4R9UC 5TY0A 5FBWB 4EFMA 3OF5A 4M53A 1P3JA 5JRJA 2P5TB 2ZETA 1NN0A 4G5QA 4HAUA 4V03A 3RAPR 2JLZA 5H68A 2LKDA 1NG1A 5CJ2A 5EUMA 4TMKA 5AUQA 4DXAA 1EXMA 1G19A 3A1TA 3OHMA 3EASA 3TJZA 1IM2A 1OKKD 4DLXA 1G4AE 3ETLA 5ELXA 1YZTA 1CJKC 3LAWA 3TK1A 4BEBA 4Q4JB 2ZYUX 2YHSA 1KI4A 1KZGB 5TVKA 4M1SA 5GJWC 3UKDA 4JYCA 4MITA 3K0FA 4C4PA 2PLFA 4G1UC 2DHRA 4MQBA 3GJ5A 2OAQ1 1G7TA 2WSMA 2H57A 1XMVA 4MRNA 4QG7A 2FF7A 1IJEA 2YWEA 3S1AA 3RSOA 4RZ2A 3UWKA 1QVAA 1XEXA 2IHYA 2JJ8A 2W2TA 3TUZC 1J70A 5CIQA 1N25A 4B2LA 5JEEA 2F1JA 2OUKA 4B74A 2IS4A 4BLPA 4EUNA 3CH4B 4HDOB 1N6PA 3GFOA 1E2GA 4HLQB 2XNSA 2IYZA 1R8QA 2FGJA 1E98A 4A2PA 3WXMA 2VL7A 1DAGA 3U4QB 3BWDD 1DG1G 4JS0A 1RYFA 2ZE6A 3B7GA 1GAJA 3PUZA 2W2VA 3ICQB 4PAOA 5TARA 2CMKA 2ZSDA 2QMOA 4RD6A 2ZREA 5JJLA 2FZLA 1E0KA 1COWA 3D7MA 3QF7A 4JVLA 2D74A 1W0KD 3R9IA 2VHJA 2QNRA 2VSXA 4KHZA 1N5LA 1LF0A 4Q4JA 1W0JA 5GADl 5JWOA 3ADKA 1Z6XA 4ACBA 4N1AA 5JCZA 4PO9A 4YLGA 3B9PA 2O52A 4FMCF 1KDRA 1W1WA 4DT1B 1X1RA 3SZRA 3G0HA 4UNPA 1SKQA 3IPYA 1A2KC 4Q5IA 1Q21A 1ZBDA 3S1AB 1U81A 3EIEA 2WVJA 5JECA 1GILA 2IF0A 4RKEA 4TSFA 1XTJA 4B6FA 1MO6A 1U9IA 5FPYA 4OI0A 3AVWA 3BH0A 1Z2AA 3LDAA 1NVUQ 1RRPA 3B82A 4R7ZA 1S4QA 1W49A 4XH9B 3U60B 2JEOA 4Q7KA 1MRNA 1RVDA 3DDCA 4Y0AA 5E7IA 4Q1DA 3U3JA 3QBTA 4KFSA 2QGZA 2FA9A 3QF4B 4BFWA 4ZI2A 1CRPA 4LC0A 1E9CA 3DPUA 3X1WA 3THWA 3NC0C 2JDID 1OKKA 5AJWA 5EE1A 1MABA 1N6RA 2B8WA 2WKRA 3BGWA 1DAFA 4DCTA 3K1JA 2ANBA 4GT1A 3QKRA 3HYRA 3ASZA 3FMOB 1E2QA 1N6KA 2ZJ5A 1Q1QA 4A6XA 5SZHB 1CBUA 3CPHA 3GLIA 3GP8A 1NY6A 3EZ6A 2ZJBA 2IEZA 2ZROA 1W36C 3AQ4A 2AD1A 3K53A 3PIRA 4QGAA 1ONBA 1P6XA 4L16A 4KODA 2WJGA 2QY9A 2WJHA 1L4UA 2R62A 1AM4D 2CDNA 3U61B 2R2AA 1E2IA 3H84A 2ZR0A 1TTTA 3TR5A 4TL8A 4A0HA 3CM0A 2BWJA 2AFHE 2N42A 3NBFA 4ITRC 2WPDA 4ABYA 1E3MA 4S35A 1KMHA 3MJRA 1MRSA 4Z1MA 2QENA 4NYJR 1B23P 1GRNA 2RGEA 3ECCA 4PC3A 2LCFA 3AGPA 3CX8A 4TL6A 4D6PA 5EXPA 1K5DA 4LJYA 1F5NA 2XAUA 5D3MA 2ZE7A 2ZRFA 3DZ8A 1A5TA 3AKEA 4U02A 2XNDA 4IW3B 1N6LA 4OHXA 2J45A 1OHHD 3KXLA 1W4BA 3U3MA 2NO7A 4A8JB 4LBZA 3GJ7A 421PA 4QBGB 2V1UA 2CL6X 2NIPA 3PG5A 2IYVA 3VNUA 3OAAD 1D8TA 1XXHA 2QQ0A 5AUNB 1JQJC 1ETUA 1XD9A 4FCWA 3GMTA 1OB2A 3GLFA 3GD7A 3N70A 5B57C 1HQYE 2ERYA 1MKYA 2RHMA 2QT0A 4IFBA 4LWZA 3UMSA 2QAJA 3KQNA 3TVTA 4OJKA 3ZVRA 2IS1A 5C1BA 1BMFA 2ATXA 1R2QA 2HDNB 3RNLA 3M0EA 2JIZD 3EX7C 1G16A 4IHQA 1DAKA 4WIAA 4B71A 3EZ7A 1KI6A 2HYDA 2EWWA 1W36D 3GJ3A 1GITA 5G40A 1TU3A 2W83A 2IS6A 3ASYA 4MRRA 1IBRA 4EIWA 1GM5A 4EPTA 1E94E 2ZYWX 2FG5A 2H17A 1TNDA 3AP1A 5TDHA 4CEIB 4CT4B 4Z1MD 4Q4HA 4GZMA 2WWYA 1ZNWA 2GVZC 2JLRA 2WWIA 1XCGB 1M7BA 1U94A 1XTSA 2IYYA 2XSZD 3CF2A 3K0CC 4IOKA 3X1XA 1TAGA 1IY0A 3AVXA 3BB1A 4W5JA 1IAQA 1XZQA 1KZ7B 2QGNA 1HT2E 1TADA 2IUTA 2OLKA 2OG2A 1ZNZA 1EX7A 2GAOA 2QEQA 3DZDA 1TMKA 1KI7A 5DO9A 3SJZA 4KVAA 1NBMA 3B78A 4I4LA 5HE8A 2OFOA 1EGAA 2Z4SA 2ZUDA 4JLOA 3CR8A 4Q1CA 4EAQA 1AIPA 3EC1A 2FMXA 4D80A 1OXUA 4JKIA 1VCIA 4OK6A 5AJZA 3F8TA 1W36B 2IBMA 4AG5A 1KJZA 2O8EB 3A36A 1Z0IA 1D6JA 1J7KA 1WCV1 4IEEA 2EWVA 1IQPA 2ZAMA 2ZEJA 4D4LA 2WMOB 1SQ5A 1QF9A 1HUQA 1XEWY 1XTIA 4HDQB 1ZVQA 3NTUA 4BWYA 2ZRJA 4B44A 4DHEA 1KY2A 3CONA 1BMFD 5CITA 5FTMA 3VX3A 2C03A 1QHIA 4I81A 3I5XA 1M8PA 1EFUA 4XOIA 1RJ9B 2VPPA 5FUVA 4OK3A 3RS7A 4BFUA 4LX0A 1OV4A 4KITB 3B85A 2CLCX 5BW8A 2JJ2D 4QL3A 2BHRA 2ZPTX 4V0KA 3THOA 3DEFA 3FGNA 3SNHA 4Q02A 5DSZA 2HYIC 3WP0A 4I99A 4QBFA 5L3SA 2G77B 2YWGA 3CPJB 1Q57A 1ZM3A 4PO8A 3PV0A 2BMEA 5BYKA 1S1CA 2XITA 3LLMA 1UJ2A 4UNRA 4ZDIA 4IEIA 1ZC4A 1Q12A 4X8OA 4O2LA 3TKLA 3BD9A 1QHHB 3BH6A 3HWSA 1F48A 4MRSA 1M7GA 2FPKA 2R6CA 3JZAA 1FTSA 3CH5A 4NKRA 4MGIR 2HJVA 3X2SA 3T06B 4EQ6B 3SI7A 5DN6D 3T15A 1UDWA 2CHGA 4KCGA 4E22A 4P4SA 2OV2A 2Q3HA 4PAMA 3WY9A 4C7OB 1NJGA 2MSEB 1L8QA 2VP5A 4JT2A 1PUIA 2H18A 3VR2A 3H0KA 4JVNA 2VP4A 4JBXA 5CYPA 2J7KA 4DCVA 1MOZA 4DLRA 5B30A 5GVSA 3ZLJA 4LV5B 4BLTA 5CDFA 2WWHA 3MD0A 2IYSA 5F9HA 4UJ5A 1K8RA 4NCIA 2JLWA 2UZ3A 4XIGS 3L0OA 3VTKA 4MRVA 4RD4A 1GKYA 3SHWA 3TLXA 5TV2A 1J99A 4POAA 4WZAE 3M1IA 5KNCA 1EFHA 3QJYA 1JNYA 2OEPA 2ZRLA 4DT1A 3CBQA 2IX3A 4LCBA 4BLQA 3TIFA 1JI0A 1T9HA 4Q7MB 1MO3A 1X86B 5H70A 1US8A 2GEUA 3B1XA 2O8DB 1IN6A 3GLHB 5SZIA 2NZ8A 2RGBA 5C18A 4OQLA 2CVFA 3O8RA 4YMUA 5HCIA 4MYCA 1L2TA 2XGJA 4GP6A 4D2IA 2XOKA 4WOPA 1RC8A 5KDDA 2HCBA 4CEJA 1IY1A 4B75A 5JFGA 3KJIA 1P7CA 5E4FA 3WMFA 2GWHA 1NMYA 3PUXA 1AKYA 1CJMA 4DIEA 5DN6A 1YKSA 3SEAA 1KK3A 2QP3A 4DLZA 2EVWX 1S9HA 2F55A 3AKCA 4D25A 3T5GA 3CWZA 2JLVA 1NG9A 2GZHA 3W6OA 4NMMA 4B43A 2FPLA 5EQTA 4B2IA 3AVQA 1OXXK 2QT1A 1G17A 1PVOA 2VTKA 1NLZA 5KOYA 4TTPA 2PT7A 2GJ9A 4AKHA 4FWTA 4OHVA 4M4SA 4XWKA 4LHWA 2ZXUA 3CIOA 2ASEA 1VYVA 3TAUA 4LBYA 3U7HB 1IHUA 2RGXA 1SGWA 3TBKA 4HZUA 3RRZA 5HCNA 3ND8A 1G18A 4H9GA 1HTWA 3A58B 1FP7A 3DL0A 1ZM9A 4HB2A 3ZIAA 1YR8A 4IVPA 3VKGA 1R5OA 3C5CA 1C4OA 4I1VA 2KWIA 2R6AA 1HE8B 2QRZA 3BIFA 2V4ZA 3IO3A 5FBLB 3LQRA 4AWXA 1ZNYA 5JS8A 1U0JA 3SFVA 1NMZA 3U3RA 4QM7A 3SFZA 3NVAA 1E9BA 2BBWA 4ZCLA 4YMTA 4I1UA 3HU2A 1M2OB 5AJYA 1KJWA 1NL3A 1YZGA 3PITA 4NP6A 2XJ4A 5AJXA 4XTCS 3TVDA 4DKXA 2OBNA 1D2MA 1NN1A 1WP9A 3KUCA 4B47A 2J0UA 2WKQA 4DSOA 1U8YA 4F4IA 2VRWA 1MV5A 1VDZA 4KSBA 3V9PA 2Z4RA 4ZCIA 4A36A 1EFRD 1GDDA 2OILA 4B3CA 4XSHA 2D2EA 4Q4AA 3MWLA 2ONJA 2GZDA 2ORIA 2VHCA 3AGQA 3ZH9B 1SVKA 2ZJ8A 2IEYA 3PEYA 2ZRHA 3LXRA 2ZU0C 1E1RA 2CCKA 2WV9A 3GQBA 2F1IA 2YZ2A 1BYUA 1LVGA 1W0KA 2UVQA 3IIMA 1G7SA 3F5FA 1ZU5A 3NH9A 3K9LA 3BS4A 4GI7A 2FE4A 3Q5EA 3A37A 4GMDA 5HKKD 4RZ3A 3A6PC 3MAAC 2QSYA 4QXAA 5EZ5A 4HLUC 4HZUB 1GG2A 1XU4A 1AS2A 3GFPA 1OH8A 4BFZA 2QM8A 4XSGA 5FUXA 1XJQA 3B60A 2PL3A 4O2RA 5HKKA 1R5BA 3R20A 3KXIA 4Q03A 3K0AA 1P9WA 3Q72A 5KYKA 3L82B 2R6DA 5HPYB 1HE1C 5J4YA 3QXCA 4JIMA 5BQ5A 3VR6A 1DVRA 1U8ZA 2VP0A 3UK6A 3WBJA 1SHKA 2QTFA 1XRJA 1XEXB 2AD5A 3BB4A 2QAGA 2J0UB 1LV7A 4OHWA 3SYLA 4BFXA 4A82A 1H8HD 4QM6A 5E3HA 2R8RA 4FIDA 4V02A 3P32A 3AH8A 2NQ2C 4HUTA 1II8B 3VQTA 1Q1ZA 1ZP6A 3PUYA 1DAIA 1GL6A 3BJIC 4P32A 4RCZA 1AA9A 4FCTA 5KSPA 2GXAA 3QEJA 1TF5A 3RS3A 4YDSA 4AYWA 4JBWA 4OQFA 1JB1A 4ARZA 4ERNA 3HU3A 3NWJA 3F0TA 5CB8A 1FUUA 1ZD8A 2VYFA 3TUJC 3ZYCA 1XJCA 2FJUA 1DOAA 2PEZA 1G5RA 4L8GA 1XCPA 3QXXA 4ACAA 3U2QA 1KKMA 4MGZR 4US1R 1VKJA 1ZYUA 3AF1A 3QKTA 1TEVA 3W9YA 1GNPA 4Q19A 4KFTA 1ZUIA 1ZM7A 4PPFA 4JL5A 2VBCA 2Q21A 2GA8A 5IF9A 4ZPXA 4BUJA 1HYQA 2AR7A 3QNUA 4F92B 3EA5A 4II7A 2K5UA 1QBKC 3WRYC 1LY1A 5KU1A 1E4YA 2VLIA 3IEVA 3MWKA 4TT3A 2ZSEA 2NG1A 2WBLC 3NBZC 4JJKA 1TEXA 1Z0JA 2G88A 4M9QA 1SULA 4M1MA 3QPUA 2QP9X 3FPAA 4IRUB 5CJPA 5LD2C 1SXJE 1WQ1R 4CVNA 4TQUS 3JZMA 5DIFA 4PFSA 4TSFD 5G53C 1G6OA 1FW6A 4DBLC 2ZITA 2RAPA 3ZZ0A 2G6BA 1CXZA 3E5HA 1P2UA 3THXA 2O8EA 4LYAA 1CULC 2OO7A 2F3TA 2QTHA 3KX2A 4R2HA 4TMVA 4EFLA 4KXFB 4ARZB 3T12A 4P4SB 2BJVA 2EYUA 3KJHA 3A4LA 2CHVA 1XPRA 2NOAA 4TZ0A 1GIAA 2IWHA 3FYHA 2A5JA 3D6TB 4GP7A 3RC8A 2XTZA 1UADA 4DIDA 1M7HA 2IXGA 2HXSA 2ZAOA 4RKFA 4F4JA 5FH9A 1P75A 1FX0A 1R4AA 1NBME 4XD7A 5KO2A 2Z5FA 4HLDA 2WJIA 3UWOA 4BEJA 4LJ5A 1O87A 5E7MA 1GKIA 1VIYA 3R8FA 4FXPA 1CR1A 4LOAA 2FEMA 4RFSB 3OIVA 4DUGD 1E2PA 1MR3F 3TSZA 3B6EA 5DGXA 4MUBA 1ZM2A 4A1FA 1TPZA 4URZR 3MJHA 3KTAB 2YYZA 3T1TA 2A30A 2AXNA 4TL9A 5FL7A 1YHNA 4DB4A 3CRW1 2RGNA 3A1UA 4HDCA 3WYFA 3CZQA 5KPDA 2J0QA 3QENA 1E79A 2QZ4A 1JALA 1X8LA 3P4YA 3QEOA 5FI0B 3IHWA 4LHZA 1PLKA 4NDZA 4EQ6A 1KAOA 1EFRA 1G4UR 2NO6A 2A7QA 3AP3A 4IDPA 4NE2A 2C96A 4C0SA 4B48A 4PQFA 1G20E 4XVRA 4HB0A 5DHAA 1TQ2A 2ZRNA 2ZI4A 1FOEB 5AK0A 1Q20A 1J2JA 2C9YA 2QU8A 3TNFA 5JWHA 4DDTA 2A2ZA 1XXHB 4P4UA 4DLVA 2BKUA 1G6HA 1XEWX 2A3RA 2V54A 4PQYA 5CK5A 5ANRB 3SYNA 4V0OA 3IKJA 3ADDA 3QKUA 1S96A 1XBTA 3FHTA 2BOVA 1ZW6A 3H4MA 3KKQA 4LDJA 1WRBA 3U7EB 5JMTA 2BDTA 1LB1B 3IHLA 2DFLA 3FMPB 1R10A 4BZPA 1HEIA 3AVPA 1MO5A 4HAYA 3U3KA 4X8LA 3I73A 2AL7A 1G7RA 2ONKA 4PX9A 3VHXA 2CLDX 1UBEA 6Q21A 2NGRA 1KI2A 3GLHA 3TW8B 4CZ2A 4TYPA 3FB4A 2SHKA 2WSSD 4EKDA 2VIIA 1ZCAA 2JA1A 4XJXA 4D26A 4EFNA 1A4RA 1GNQA 3H2YA 2BM1A 4P33A 2A5GA 4JLPA 3K70C 2OLJA 3B1WA 1W5SA 1E69A 3WMEA 4ASUA 2QPAA 2FU5C 3BE4A 1Z28A 4M1KA 2F7SA 3IPXA 1QHSA 1KK2A 2WJYA 2J9RA 1OF1A 4A6PA 5IHPA 4TMZA 5BXQC 1UKZA 1GUAA 1XMSA 1TX4B 3EWAA 4ILEA 2WWFA 4Q9JA 2IWRA 5LB2A 3QOFA 1W5TA 4FMCB 4A92A 5K8TA 3PQCA 1X8KA 2BBOA 2NPFA 3VU9A 1ODFA 4LV8B 3W34A 1P4SA 2IL1A 3Q3JB 1IN7A 3P1JA 3LA6A 4ZKEA 3AV0B 4YQFA 1E2HA 3DMDA 4NL4H 1Q3HA 3BXZA 4KSCA 4RZUA 1QG4A 4NHOA 4Q18A 2O0KA 4FMBB 3ZQ6A 5JRZA 1YZLA 2YV5A 3KB1A 3VMFA 1YQTA 2JASA 2QL6A 3WHKA 1YZNA 2JLYA 2J41A 3R8CA 1P73A 5B58C 2KBFA 3RHFA 2F1HA 1OH5A 3TQCA 4QJ4A 1S3SA 5E95A 2YOFA 2DY1A 4A0GA 2WJVA 1GSIA 3VR3A 2HEIA 2Q9CA 1WBBA 2CL0X 4QKQA 3RWOA 2BBTA 2NZJA 4URXR 4KV9A 4C9BA 4BLRA 4ZV4A 1RRCA 2DWOA 1HY3A 1NIJA 4OI2A 2PZGA 1NN5A 4C0HA 1K5GA 1ZM4A 4PR0A 2IK8A 2GETA 3TW4A 4LJ8A 1P62B 1EWQA 2ZVPX 3B2EA 4YMVA 3SR0A 1II8A 4JLDA 4RCYA 3VU9B 5FOSA 5FPSA 3EIHA 4A4DA 2H16A 2GTPA 1VTKA 1OLOA 1VHTA 4Q7LA 1FP6A 5DHFA 2V9PA 4JT4A 5JS7A 4PPGA 2YNMA 4JLJA 2C95A 4P4TA 2VH5R 1SXJB 3SYKA 2P6NA 5EE0A 1II0A 1W46A 2GJSA 3GJXC 3MLEA 4KI0A 3VHLB 2OE2A 2JLXA 1S9DA 3ZVLA 3FVQA 1NSTA 4LZZA 2FFBA 4L4UA 4NZYA 5LBIA 1AZTA 4I1SA 1DTSA 4TTRA 4C0BA 3B8HA 1FPMA 1OFHA 3KQUA 5JWRA 2IYUA 5KSZA 1XCMA 1Y3AA 3FKQA 4IDNA 5KPJA 4C3ZA 1XD8A 5JSZB 4GZLA 2I1QA 4A8JC 4WXRA 2P5SA 2BIFA 1N6HA 4A2WA 3U7FB 4CEHB 2D06A 4WVFA 4X8HA 4IJMA 1U90A 5L8VA 2XJ9A 2W0SA 3CF0A 5GJCA 5M04A 3C4JA 1J8MF 1EFCA 2GCOA 1OH7A 2XB4A 1Z6TA 3FFAA 3ZS8A 4B34A 4LJ6A 1MH1A 4E5UA 3VNVA 3RC3A 3AUYA 5L3VA 2IXEA 3AM1A 4IVQA 2IUSA 2HT1A 1Z06A 5K8LA 4GOJA 2VF7A 1FMJA 3HR7A 3A1SA 4UXJA 3PUWA 1N5JA 1Q1EA 4R2IA 1XPUA 5FOXA 5JI2E 1FMLA 1II9A 1SXJA 3Q9LA 1LW7A 3TR0A 2LKCA 4TN1A 2OM2A 1R0ZA 1F2UB 2EW1A 2ZRKA 5FI1B 3HP1A 5EP4A 4CYMA 3X1YA 2CE2X 3NXSA 3K9NA 4JLBA 1OIVA 3A1VA 1A1VA 4LYHA 4F91B 3RRNA 1QZXA 4CDGA 4L15A 4LY6A 4AG6A 1XMIA 2ZS9A 3U44B 4TLDA 1IY2A 2ZRGA 4G5SA 3KKMA 3GCGA 4XTRA 4US0R 2X77A 2HT6A 2VEDA 3L0PA 5L3RA 4BPBA 2MSCB 1OXVA 4OK5A 4M22A 2DWQA 1G64A 1OXSC 3PVSA 1S0UA 3KTAA 4URWR 4RFVA 2G0TA 2CHQA 1TQ6A 2FSFA 5GJVC 3CKLA 3CPEA 1XNJA 5G41A 2D7CA 2IYQA 2J0SA 4MA4A 1OFTA 1S1MA 3KKPA 4Q1FA 4EPVA 3GLGA 3JVUA 4KBFA 2P3SA 3C8UA 1KYIA 2CK3D 4L9WA 2W6ID 1E9FA 1JXOA 1KSFX 2GJAA 2ZM5A 2A78A 4OI1A 4B3BA 4MDEA 2OCAA 4FMDB 5H1YA 2QAGC 4IOLA 2W2XA 4HB4A 4Q9HA 4AC9A 3LWNA 4D0GA 2ZSFA 5TMPA 1GVNB 3L0IB 3RS0A 1A2BA 4C7OA 2D62A 3WMGA 3SQWA 3NIBA 1KNQA 4GMXA 2O8CA 1OYWA 2VSOA 2J87A 3QG1A 2IYRA 1FNNA 2R6FA 5CYOA 4RFSA 3U44A 4B3XA 1QHYA 3FFBA 1Q0UA 3DM5A 3GLFE 2MMGA 4D0LB 5HTKA 4DWJA 1WE2A 5EP3A 2NTYC 2KJQA 3AF2A 3SU8A 3FWYA 5L3QB 2IS2A 1JJVA 4HAVA 3K0AB 4DCNA 3EARA 2FFQA 3KQKA 4JSTA 3IGFA 5FTKA 3NBYC 1KI1A 2PX3A 3NC1C 4IKEA 5CK4A 4WAUA 1ZAKA 4GNKA 4DCUA 2G9NA 2H7VA 2QM7A 4JSYA 3THWB 1IJFA 3W8RA 4R71A 4LV6A 1K6MA 5DLQC 4QHYA 3EZFA 4V0LA 3TE6A 2ZE5A 3ADCA 2JLUA 1PLJA 3K0SA 3FMFA 1G3IA 2EFEB 1NY5A 2W6IA 2XNDD 3QUSA 4NU0A 4EDHA 2HF9A 3M6AA 1AGPA 5DNYB 1Z6YA 2VHUA 4M1WA 2DYKA 5EXTA 4QGHA 2ZJOA 2GHIA 4C0JA 2D3WA 5F2EA 5A4JA 2GXQA 5B2ZA 1ZMXA 2JJ2A 1CR4A 1ZJ6A 5CLLA 2J0VA 1DAMA 5K8IA 1JJ7A 3QXJA 2CEAA 4ASUD 3AUXA 4QBIA 1B0UA 3X1DA 3ZQJA 3N2EA 3ONWA 2FZ4A 1OE0A 3KB2A 3W90A 1ZRHA 1N3BA 4LPSA 4Q9KA 1E2DA 3CW2A 3UMRA 3IQWA 2BJWA 3NBXX 4UXHA 2F43B 1E2NA 1OFIA 2WIBA 4M1TA 1I2DA 5HE9A 3GLIE 4KU4A 2YVUA 4G01B 4WW0A 4F38A 1KY3A 4KJZA 5CB6A 3R9WA 4C0QC 1QG2A 4HLCA 1UBCA 2EYQA 4LHXA 2GEVA 4OBEA 5EE9A 1L7VC 1E2MA 1T5IA 1EESA 3BH7A 3C16C 5F98A 3ICEA 4BFSA 3PCRB 1E2LA 3GFTA 4PPNA 4CEJB 4ZIRB 3KQHA 2W0MA 3SC3A 2XB2A 1KSGA 4V0MA 5FUWA 2WOJA 2I3BA 5FPHA 1XD2B 2WOOA 1UDXA 2Q6TA 3DM9B 4RZXA 3C5HA 2OCBA 2VO1A 3ZD6A 3GEIA 1ZIOA 4PANA 1AS3A 1EK0A 4N3NA 1OT3A 2TMKA 5J47A 4JLKA 1XDBA 3GLFB 2ZRMA 1Z6AA 4IDOA 4URVR 1DEKA 1ESMA 2FSGA 2IYLD 4TYYA 4LBVA 3I8XA 1GFIA 2Q3MA 2PCLA 4PO1A 521PA 1MO4A 2ZRAA 4HUQB 2OCYC 5G3ZA 3W8NA 1KGDA 4Q4AB 4AYXA 1G1MA 1QVRA 1PJRA 2QPOA 1CEEA 1JR6A 2OT3B 3QG5A 4FW9A 4JLVA 2F43A 3LBHA 2IC5A 2PH1A 3BORA 4NYJQ 3QIAA 3I62A 5JI3E 4A0RA 4P0TA 3B1ZA 1WBDA 1W48A 4B2PA 2ZR9A 3BK7A 3CWQA 2FOLA 4FMDF 1HURA 2VP9A 3T1QA 2GRJA 3EPHA 5FOTA 5FPKA 1FUKA 2J1LA 2GF0A 3NHAA 1DPFA 3QVVA 1RRFA 3MCAA 1F2TA 1H8HA 2REBA 2MMCA 1YJ5A 3K0EA 4ZIRA 2ODNA 1XB2A 3SS8A 1E0SA 5JHGB 2G1JA 1HV8A 1GZSA 3HDTA 1VG1A 5GJBA 4NCNA 3U5ZB 2GCNA 1LFDB 3LX8A 2V8OA 1KDPA 3P20A 5JEDA 1UBGA 2C5LA 4UNSA 3T1OA 1LTQA 3OFNA 3OEHD 5IK2A 4JYBA 4ZI3A 2DFTA 4MYUA 4FI3C 4M2LA 4B32A 1XTKA 2B8TA 3DOEA 3CLVA 4LYFA 1E2JA 1RRGA 721PA 2B7BA 5GVRA 1G5PA 1KMQA 1Z8FA 3B1YA 1EWRA 1I4LD 1W2HA 1Y63A 3BERA 3L0SA 4JJZA 1SXJC 2C2HA 1N0WA 4PZLA 3C41J 1ZIPA 2JJ1D 4Q9IA 4CF7A 5KNBA 1NLYA 3DKPA 3H86A 4BQSA 1Z2CA 2EFDB 3CUEF 1ZNXA 1YVDA 5JJIA 5FBQB 1KNXA 1Z0AA 1UKVY 1CP2A 1YE8A 2F1RA 4BZXA 3QY0A 2EFGA 4IXNA 4B35A 2GF9A 4QRHA 3MMPA 3CNLA 4PC1A 4Q4LA 3LVQE 3EC2A 1R0WA 4QNRA 3H1TA 4OKSA 2A5DA 1JEDA 3THYB 2WWGA 2J7PD 3UG7A 1ZD1A 1QHHA 3KJEA 4QGFA 1TQDA 1BH2A 2GEDA 4DDWA 3FHOA 4RJLA 1VCOA 4MRPA 2GK6A 2V6IA 1YZKA 1DADA 4Q1AA 3SOPA 2AXPA 4DLTA 2X2EA 3K9HA 1DAHA 2NO1A 1OHHA 4AKEA 1OW3B 3B13B 4B76A 2FNAA 4IXMA 1P9NA 2VHQA 5HZKA 1O3YA 3GLGB 4HB3A 2ZI3A 4NCJA 3T5DA 4A2QA 4B6EA 2OCPA 5AUOB 4AY2A 4HEJA 5C46F 1KDOA 4C0LA 821PA 3C7KA 3U6KA 3QVUA 5J5CA 4B3FX 3A4MA 4W5WA 3O47A 3OE7D 2VHTA 4PHHA 3WHLA 2P2LA 2ZI5A 5LDDC 1E9DA 2A5YB 2H5EA 2WWWA 3K8YA 3SE0A 2HCJB 1ZUHA 4XWOA 1GOTA 3CRRA 2REOA 5JBQA 3N2IA 4D4KA 4LGMA 2JLQA 3K0CA 4E09A 2P0EA 2JIZA 3OIWA 4K46A 4GBMA 4Z8YA 1OSNA 3EAQA 3NH6A 2ZUBA 4M0LA 1TQ4A 4AD8A 1S2MA 4YXWD 3AVYA 2GK7A 3PENA 1GL9B 3CRVA 3WNDA 4PAQA 5BN5A 4TYQA 1DO0A 4M9XA 3RVBA 5AJVB 5FUYA 4EPYA 5LD2B 2WWXA 5KNDA 3THYA 2QBYB 1W4RA 4AKGA 1NJFA 3K0FB 4DZZA 3AVOA 3EPKA 1NIPA 3WNBA 1DE0A 5F9FA 1L4YA 4B3DA 3RRYA 2QN6A 2FSHA 1GNRA 4M1YA 4NYIR 3RABA 3GLGE 2CNWD 4TQ9A 2FWRA 1OYYA 2FH5B 1W7AA 2QE7A 2RGGA 1T6NA 1E96A 3B9QA 1E99A 2PBRA 1XPOA 4MDFA 1CKEA 1AK2A 4N0DA 3RSLA 3MRSA 2ERXA 2OBLA 3I61A 4TQAA 1W4CA 3VR4A 1U0HC 2Q3FA 4Z51A 2R65A 1NVVR 1ESNA 1BKDR 2RGAA 4WXPA 1KDTA 1FZQA 3WNCA 3OE7A 4D81A 1SVSA 5A5GA 2C9OA 1KI8A 5IRCD 1KIMA 3VR5A 1ZU4A 3TQFA 1VECA 1EX6A 2JGNA 4QNMA 2RKOA 1NVVQ 1PLLA 2PX0A 2YWFA 3AKDA 1U98A 3ZD7A 5KUTA 3GJ6A 4U00A 1T3HA 4Q7JB 1I4TD 5FBRB 1N5IA 4RD1A 1LS1A 4OQNA 4YXWA 1KI6B 3OESA 1KAGA 2C77A 2ZUCA 3AEZA 4MKFA 5L3QA 1LF5A 1E2KA 1OIWA 3G82C 3DVLA 3UG6A 3BB3A 1RIFA 5EUQB 2Q0HA 1XFAA 1E4VA 1T8UA 3LW7A 3SJBA 4B73A 4MYHA 1Z3IX 4GSYA 2W6JA 1CJTC 1NLFA 1DO2A 4Q48A 2ZANA 2CLSA 3UXMA 4DDVA 1D2EA 4CEHA 3ND9A 3RANA 4RSGA 2HUPA 3RYTC 4FCVA 2DB3A 1WA5A 3UPUA 5K8UA 1G291 2WMNB 4IDQA 3IO5A 1CIPA 1XF9A 3ZVMA 3SN6A 4BFTA 2GNOA 3KKOA 4G5OA 1Q3TA 1FQJA 3RDPA 4M9SA 3D8BA 1OJLA 1MABB 1EG7A 1NRJB 3LBNA 3I5YA 4HYYA 4Q47A 4NPHA 2AKAB 1OB5A 3LNCA 1H8EA 2YJTD 1LNZA 3ZJYA 2G1KA 2WM9B 3ZS9A 4W9MC 1COWD 2CJWA 3V4RA 2RMKA 3EZ2A 5EE3A 5EJEA 3T61A 3L43A 1HQCA 2XX3A 1F2UA 3BBPA 5G3YA 3T1VA 3REGA 2DWPA 4DB2A 1Z0DA 1XTRA 5KDOA 1U0LA 2O8FB 1YRAA 2GKSA 3QQ5A 3BOSA 2N46A 3NDBB 1N6OA 4Y0VA 1R7RA 5DH9A 1P60A 1SVMA 3W5IA 4DC9A 2B6HA 2O8DA 5L3SB 3CO5A 3GPLA 1VPLA 3REFA 4UJ3A 1V43A 1KOFA 2C04A 2XXAA 2GBLC 4C0KA 4Q1EA 1G3UA 4ON9A 5FL3A 2GZAA 2GVDC 1RYHA 4YMSA 1KJYA 3D31A 1CLUA 3GEHA 2OHFA 3RLFA 2IXFA 4PSAA 3LW8A 4UQOA 1G3MA 4B3GA 2Z83A 4IVRA 1OPXA 1P2SA 4PZZA 1UEIA 2RB4A 4FINA 1D9ZA 2H8KA 3B5JA 4PQRA 5JZVA 4PXAA 3CB4A 2Z43A 2HLDA 2C8VA 2ZJAA 1VG8A 2G0NA 2E9SA 1AGRA 3X1ZA 1Z47A 2NO0A 2OESA 1E0JA 4GPTA 4PC2A 4CRWB 1CRQA 1JQLB 1PZNA 1XZPA 2OSBA 1IN4A 5J4VA 1G8GA 4N0EA 1NN3A 3EA0A 1QRAA 2IYTA 4JLNA 2B92A 3LD9A 4FD2A 2HJGA 2FN4A 2OAP1 4WBSA 2J59A 2W6JD 5LPNA 1ANKA 2ZR7A 3KUDA 2ODEA 2QRNA 3K70B 2JLSA 1N6NA 2ZRDA 4TMWA 4TZ6A 1IOZA 2PCJA 1PV4A 1KTVA 2XZOA 5UKDA 1FQKA 2WTUA 3PEVA 3IBYA 4L9SA 1P2TA 2P6RA 4TMXA 4WZBE 4V0NA 3CX7A 4DCSA 1XEFA 2QROA 1N2CE 5F3WB 4HAWA 4MH0R 1J90A 2WJJA 3LH5A 2ODWA 2REXB 4D4MA 2PT5A 1T8TA 1X8JA 1SVLA 2VF8A 2X8AA 3J81k 1P9RA 3MWJA 4URYR 4KO8A 5FR1A 4JL6A 4QOSA 1M34E 4KLZA 1S3GA 3WBKA 1CS4C 2GESA 5AWFC 3MSXA 4UKDA 4XVUA 2KSQA 3RRMA 2UKDA 2XZLA 3SBEA 3U4QA 4H1UA 3R7WA 8OHMA 1WB9A 1NMXA 4URUR 3I1FA 1G8YA 4JBYA 1VCNA 1ZCBA 4A0FA 4LSGA 1KSHA 1SKYB 5B64A 2V3CC 3DKVA 2H1LA 2ZU6A 3WP1B 2A9KA 2BCGY 2CXXA 5J40A 1C9KA 3MWYW 1DG3A 1NP6A 3FOZA 3NEJA 5KDLA 1QHNA 3I92A 3KZ1E 3JVVA 1TL7C 1U2RA 2WSSA 3EZ9A 4Q01A 4DEXA 4G0NA 1AJEA 3O8CA 1RE0A 4DDUA 2VP6A 1AN0A 3U6BA 3SHFA 2PZEA 3LXXA 2ZYVX 3IBGA 4LYJA 1XMJA 4NONA 4OQMA 5DYIA 4DSUA 3OAAA 2QBYA 3CRQA 4D4JA 2ORVA 2CK3A 4BLOA 3A8TA 1Z0KA 3ZZTA 1R8SA 1CTQA 2GCOB
chains in the Genus database with same CATH superfamily
3FPBA 2XVAA 3JWHA 4NJEB 4DLAA 1BE8A 1TD1A 7MDHA 2CZGA 4NYIQ 2HSEA 3S8EA 1ZOLA 4ISCA 4DIUA 3QI7A 3IALA 4K6CA 4PLGA 2JFZA 3BYZA 1A9RA 1LSJA 3T5MA 3AUUA 4MVCA 3PPYA 1LPPA 4O0MA 4XVQA 4B17A 3TSWA 4QLBA 2IW3A 4CTJA 4DJJA 1CNMA 2WKSA 2QTGA 4AURA 3L1KA 5LUAA 1EE9A 1KC3A 1XCBA 2RI6A 3AO0B 3DZIA 3GBPA 1U4SA 4RVDA 4WXYB 3TR6A 4EHJA 2PMDA 2ZBUA 4NOMA 4OBXA 4UHJA 5F35A 3TLKA 4HQRA 2GYUA 3TE7A 3JALA 4UM8B 3WL5A 3A9TA 4DIFA 2CB9A 2RFLA 2IEIA 5FOUA 1Z2PX 4G25A 3LXUX 2J3HA 1E1RD 3LZDA 5FJJA 2XRZA 1CJVC 1E5VA 4DRYA 4W7SA 3E9MA 1SUWA 4WH0A 2G25A 3ANSA 2RGWA 2REQA 2ORWA 4NH0A 4R41A 4X8MA 3ZTWA 1D5WA 3ZBUA 3JQAA 2VNKA 3IKVA 4I1OA 1YZUA 4GR9A 2BM8A 4RVSA 3K92A 2OBBA 3D4LA 1ADYA 3L8EA 4B5LA 1W47A 3VH1A 2YWXA 1NXQA 5ALHA 2WKPA 5IUKC 1KXZA 4BBZA 2NP7A 2PUBA 2DBYA 2PANA 3EMKA 4KXQA 2BM0A 1JFFA 2GJKA 3EG5A 1H4SA 3T7TA 2MIIA 5AR1A 4NFHA 2A0UA 2IHBA 1NMSA 2Q49A 2RH5A 4HSEA 2VNSA 3T35A 1M2WA 3JZFA 4C22A 2X0IA 2WZQA 5K9ZA 5CEFA 4PNZA 3Q10A 3ED5A 4IEFB 3R7FA 3V48A 3U3ZA 4XVCA 2DR2A 2G63A 3BFKA 4LMRA 3GT7A 2XYRA 2VAWA 2F9MA 3IQFA 4PVCA 2C4HA 3L8ZA 4MKIA 4QELA 3V4FA 4L73A 4X45A 4ZU1X 3ZHBA 4KIGA 3I2FA 4CI0B 2A9FA 4D0NA 4MUAA 1G8FA 3WGLA 4CMIB 2FJ0A 3OH8A 3PJEA 3URKA 4DLWA 1PAUA 3BA6A 3T3HA 4BFYA 3ZCSA 3VR1A 2I54A 2FPSA 5BSTA 3CC8A 5CAEB 2X8JA 3OMLA 1U1DA 2BKEA 2ZB4A 1PW7A 3PTLA 4GRAA 5LDGA 1DT3A 1AQYA 2ZWAA 1VSQA 5BV0A 2QP4A 5LZ5A 1F5SA 3IVXA 2IT1A 4YGYA 5FAKA 3UIEA 3EQ7A 4ARIA 4EP1A 1M54A 3PZRA 4M9ZA 4WKGA 3P19A 4MVJE 2OY0A 3CX6A 1YZHA 1MBZA 5AVOA 5T4EA 1OZ0A 2DUWA 1E1NA 3ONFA 5KNCH 1W4ZA 2WF9A 4ZK2A 3RGWS 2J0EA 3PDIA 4YCSA 2CJWB 3EVTA 3RSZA 1TUEA 2GYYA 2O2XA 3JY6A 3ROZA 4U7DA 1QE5A 2DCMA 3UJNA 1R0KA 1V6AA 1K66A 3QX7A 3EIXA 1RABA 3G5MA 1KBQA 4LJRA 5D00A 2WHQA 3EIQA 4GXNA 1W75A 2AX4A 3IB6A 2QUAA 4WNAA 1TQHA 1H8ED 3LTNC 1KWGA 2PZKA 2IZ5A 4MKHA 1EVEA 2VPXA 4KDCA 2BFAA 3OMWA 1ZJWA 3Q8XB 1R4MA 2R11A 1JEYB 1UQRA 2PGNA 4PLFA 5CM8B 1FY2A 1U7HA 3N3AC 3KZCA 3SYMA 4HZIA 1GQRA 5EZQA 3GRUA 4KYVA 4XRGA 4OQXA 3E5NA 1M0WA 1C14A 3K9GA 6LDHA 2XQVA 5JZOA 5I4KA 1B6RA 1MIHA 1U0EA 4H08A 3U1TA 3SHTA 4D7AA 2JEZA 3TG8A 3ZIDA 1XNGA 4CBVA 5TXGA 2FSVC 2K6GA 2XOKD 4Q1BA 4B7ZA 4EITA 3RWBA 5KAMA 3VOAA 3Q0EA 4PZUA 3BMNB 3DT8A 1O77A 1ZPDA 3CN9A 4RSRA 2X1VA 1JIXA 4F4CA 4OI4A 3ZGXA 4CIDA 5G4KB 2NXEA 4EVSA 3P26A 1VL1A 3HPQA 3T52A 5LYJF 4CGZA 4DSNA 3QLUC 5JS2A 2VCHA 1T9ZA 1XJ0A 4JMLA 2WD9A 1IN8A 3QLTA 4S2EA 4RY8A 1PJSA 5KSYA 3RU3A 2XODA 4K6HA 1MTOA 1NXVA 3BM5A 5ADVA 4UBJA 4HUQA 2BFCA 3N2LA 4L07A 3VZQA 2PQ2A 1AC5A 2QQEA 3CGGA 3GFSA 3ND7A 4RF2A 3ROTA 3PUKA 4EYKA 5ALKA 5IN4A 5KOJB 4AS3A 1RLUA 4BMOB 1I3KA 3ZVKA 2BBSA 5HUHA 3CU5A 3LK7A 4ENPA 1C30B 3ECAA 1UMCB 3IA2A 1TO6A 5EYPB 2IKQA 2CJFA 1F1JA 1JP7A 2DBVO 2CFTA 3RT7A 2H29A 2OLEA 4WDQA 4AYTA 4BWGA 1IC6A 2ZE8A 2HFKA 5EKTA 3LT5A 1MJNA 3DV0B 3OQMA 2HLNA 4B46A 1BVHA 2NZVG 5DGCA 4JLMA 2J5QA 4FUQA 1EFVB 3CF6R 4UPEA 2AGVA 1GTG1 4OAQA 4ZOLB 4KP7A 1UMBB 3QKSB 3LX4A 4XDHA 1A7UA 3V3KA 1S8AA 2PVPA 3UENA 2E87A 4D6XA 2P9HA 2P9JA 5E3IA 3U5TA 1Y9ZA 3X1KA 1T24A 2QTNA 3TOSA 2P6UA 2XYGA 3QEAZ 1XRLA 4UU8A 4EKNB 3WLLA 3L4KA 2B9EA 4QJ3A 3UGKA 1EJ0A 2ZI7A 1TA4A 4K87A 4B4OA 1C3OB 5FV7A 3AETA 3EVFA 2ZSAA 4JXXA 3OF2A 5HXAA 5FB3A 4PTYA 5HA5A 1WIWA 2DCUA 3DAFA 4PHTA 3WLMA 4HMOA 4Y6RA 1T9GR 3RNOA 1H0RA 4YMWA 1JDUA 4YMHA 1Q7BA 3BHIA 1YD7A 2Q99A 2QD4A 3JQGA 1NQUA 4KMMA 4BHTA 1YOBA 2DH5A 3ETCA 4FYYA 1T6BY 1JEEA 3KQWA 3B6IA 3I8SA 2IITA 3ZGOA 1U2TA 1UBHS 3HDGA 1KP9A 1U11A 3LOUA 2UUOA 5AKKA 5KKAA 5C3MA 3AESB 5ELLA 5THKA 3WMXA 4KVFA 4R9NA 3UAYA 1UOPA 5IT9A 2P65A 4DZTA 3ANNA 2AUNA 2CHEA 3HADA 5JD3A 5BT8A 1MW9X 4LJ9A 4O2AB 1JA1A 4QHSA 4X9XA 4RNDB 5BWBA 1S8OA 4TKZA 1Z07A 3E2MA 1F3OA 4ETIA 4LF9B 2ZS7A 2O8NA 4MZDA 1NBWB 1TKBA 1TYBE 4J16C 4I1RA 3QOXA 4IG9A 3C85A 3QPBA 3T7JA 4BKPA 4FFVA 5B55A 1GGKA 5JTUA 3RLIA 4L51A 2BKAA 4ICIA 4JXJA 3D7RA 3MWDB 3GARA 3ODGA 4UDXX 1X3SA 5F7XA 1F4VA 1JAZA 1ENYA 2FSIA 2Y8EA 1M1YE 1IXSB 4G9GA 5FP0A 1YIAA 2GXSA 2P2CA 3HSSA 2ZWVA 4WBNF 3OEED 3SSNA 3I3SR 1B6GA 1CSEE 4IF6A 4LE2A 4RENA 3EDMA 5JZBA 3OZXA 3MS7A 1GARA 1D0IA 1SOAA 4Y1RA 2B1IA 4JC0A 5JS6A 4A15A 4URFA 5FEMA 5EZ6B 1FLAA 3UOWA 2E82A 4M7OA 2XQFA 4S12A 2RD2A 3ZCVA 1JL3A 2AK3A 2VXBA 4TTTS 5DEOA 1H0HA 2Y4NA 4MKGA 2ZKLA 3FNGA 3R7WB 3AHCA 3KPWA 4BQEA 3AP2A 3L1IA 5BUQA 4W5QA 1EHYA 1C7IA 1Y3CE 3NEYA 1GWNA 1DIRA 1YDGA 3HB5X 3HCPA 3OIYA 2ZTMA 2PIAA 3ZI4A 4WE3A 1L5RA 5F2NA 3QJ5A 1JAYA 1KFEB 2CDBA 4Q34A 1X9GA 4TS3A 4Y3UA 2AFHB 5ERGB 3Q40A 3WFIA 4ES6A 4F84A 2PH7A 3EGXA 3TFWA 1J00A 1XAIA 3HY6A 3C3KA 3SZLA 4IFIA 2WAAA 1QDLB 1NDQA 3QXGA 3C3YA 3LKVA 4JJ4A 5D5HA 5AMXA 2YRWA 1TIBA 2ECKA 1RJEA 1W2GA 1GUBA 1FF9A 1YB5A 1A4XA 4IX1A 4PGGA 3RRJA 4AMUA 2OVFA 4GZ3A 3C2QA 1UODA 1RQGA 3SJAA 2CYAA 3I28A 3VTFA 4RHUA 3ZNOA 2BEKA 5JSZA 2GFHA 3LT2A 3SK0A 3CLHA 4ERXA 4NJEA 1E3SA 3JS5A 2V9CA 5IAOA 5M7EA 1NNEA 2AG6A 2H1CA 3PXBA 5BR7A 3TNJA 4LF7B 4KUGA 3IAUA 2FW9A 4PY2A 4DMGA 1NUTA 1J20A 4IYRA 4FOLA 5BWMA 3OZUA 4RD0A 2IZ6A 2YW2A 2ZBQA 4MV5A 5DWQA 2BR3A 3E7XA 4FS3A 1J07A 3OJEA 3FDIA 3RUDA 2JI4A 1DARA 4MPJA 3I1YA 2DSTA 1UXKA 3AJDA 1W85B 2OGZA 5SYAA 5DE3A 5DOZA 2D7DA 2HXYA 1NNUA 5MGBA 3U19A 3NALA 4OHPA 1CZNA 3NHSA 4KFRA 4YDQA 2ZJZA 4KPGA 2H1HA 4EW3A 1IPEA 4US2R 4WXEA 1W44A 3LY5A 1JVBA 3GYGA 5JYBA 2JCYA 121PA 1QKJA 4YRGA 1VFNA 2H9AA 2Z3ZA 3GNTA 1PJQA 4YJHA 3AG5A 1F7VA 1MFPA 4Q3CA 4QLAA 2YHIA 5IK2D 4XPIB 4BY9E 3MGBA 2HCTA 3RARA 1HNXB 4L1KA 5KSOA 2G17A 1L8OA 4HATA 1TZ2A 2BJHA 4PX2A 4YX9A 4BQOA 3GFGA 2X1HA 1CY7A 2OV1A 3B3AA 4P3YA 3NPMA 2F3RA 1LCIA 2BSXA 4DJTA 1LSSA 3W3ZB 1VOTA 4GL2A 4C1BA 2BMJA 3JQBA 4EHHA 2VVTA 3COZA 4Q66C 1ZJ4A 2GPJA 2XEXA 3C15C 2YRFA 1Y3DE 1Y5MA 3OZ7A 5DI3A 1COZA 1XVAA 1G3RA 2IOHA 2NNLD 4IIVA 4YCCA 5BN4A 5KWEA 2HA4A 4EWLA 3WLEA 3LDHA 1E9RA 2QE7D 4YREA 1CQPA 1RI4A 4CMIA 5LP6A 4DEYA 1G55A 5IASA 1T4GA 4BNIA 4AX4A 2CLHB 1JPJA 1Q22A 2ODAA 4L76A 4EL5A 3S6JA 5D3MB 2A9RA 3NBAA 1TZKA 4IX9A 4W1QA 4HN2A 3GN2A 4F7WA 1BOFA 2P5YA 2RGUA 1IM5A 2HNKA 4DRXA 1JIKA 2A86A 4DVJA 2JFXA 2J9XB 2WHPB 4WERA 3KKNA 2IZ1A 3CH6A 2ZTSA 4M0DA 3V00A 4TYWA 4B33A 4G0OA 5ARDA 2DUMA 2XKJE 4LXIA 1RFLA 2CVHA 2ILVA 3ND5A 4NHEA 3GUHA 3TTUA 2YWJA 3UMFA 2AZMA 3M6MD 1KI9A 1SZPA 3T5AA 2ODTX 5BSWA 1JXAA 4LJLA 4CKEA 5K5EA 4QHTA 3HZRA 2VAXA 4RJTA 5EP1A 1N0HA 2BDUA 4L7VA 1KYQA 4LRYA 1T3ZA 4QFMA 5J59A 5JV5A 3HJNA 1ZAYA 3CN7A 3LWBA 4P0PB 4OF4A 1L4BA 4MP8A 4X0EA 1OC2A 1QR2A 1R0YA 5ALWA 1RPTA 3UATA 4QG3A 4W5NA 2VZ9A 5JH7F 3QU5A 4TLAA 2I6FA 4WNAB 4XXHA 4CMJA 1KL7A 2VK8A 3N53A 1HQKA 1JWAB 5HZHA 3V1MA 4HAXA 1JEJA 4KQHA 5H59A 2ZT8A 1RKXA 3WQQA 1SHZA 4KIJA 1C3EA 1K6JA 1XSEA 2J9FB 1N5KA 3AEQA 4MWGA 3UAGA 1F0NA 3BFVA 4XB2A 5DKFA 5FPTA 5D3QA 3FHCB 2MSDB 3EYAA 4RGBA 3W5HA 3UANA 3I01M 2C4VA 2GAAA 1HNWB 3OJFA 1C0LA 4QBHA 5CXSA 3WYAA 2CE7A 3K1AB 5DTMA 3HO6A 2R9VA 1D03A 1SU6A 4YJGA 5LP6C 3SGLA 5HR5A 1I2ZA 1OFUX 3AF4A 3JYNA 5D85A 1N6IA 2QA5A 1MNQA 2WAXA 3HP7A 1T0IA 2QD1A 3RSCA 3LQQA 1GV0A 3A3OA 3R4VA 1YC2A 1TUGA 1E9EA 2FGKA 4LRWA 4B9AA 2ZW9A 3KALA 4CFSA 4PSDA 5H4HA 5FL7D 1D9XA 4I3GA 3R5TA 4OXIA 3HCWA 4U9HS 1P1FA 3R8XA 1E8DA 3QPVA 3GRZA 2QN7A 3NJ8A 1T9DA 2A0KA 4GUDA 2FPGA 1W5BA 1IU9A 3TRFA 1PBTA 3ZTTA 2WNHA 4R2MA 3EXEA 4LA4A 2CFOA 4LMAA 4IRMA 2PGAA 4UXIA 5C34B 1VIMA 3Q7EA 2OOKA 3ISTA 4O02B 4TRJA 3FTQA 3WL6A 4KNYA 1RRMA 1AUVA 3GDOA 1ZINA 5I6DA 1R37A 4QC2A 4BVEA 2Q29A 2BC9A 1DQSA 3OIUA 5J58A 2H63A 4DQVA 1DBIA 2UZIR 3G85A 2JCVA 5BO5A 1PW5A 1XF1A 3KUXA 1KK1A 4CEIA 4EHIA 3GLGB 1OIXA 2PS0A 4HP8A 3WDSA 1P33A 4CUJA 2QPLA 2EJWA 5H0IA 1WDTA 4BV8A 3N58A 5BN3B 2ZLBA 4ZA2A 1UMBA 3QKSA 2GZSA 5J63A 3ZE8A 4Z54A 2Z5VA 3AZOA 4Y9RA 1ZH8A 4ZOCA 1T0JB 3NDPA 1DLJA 1XVIA 3EQ2A 3L2OB 4LDPA 1RYEA 3H16A 1OAOC 1LVHA 1WXEA 1YJBA 2VSNA 2B21A 1OMOA 5EMHA 3T7SA 4D0SA 1KRWA 9ABPA 4QQFA 5J4HA 4MTLA 1M74A 1H6AA 3Q7PA 1DEHA 2DBZA 1JLSA 2GXUA 3NHFA 1WPQA 3Q3EA 4KQXA 5K03A 1P1RA 3GJ8A 4FLFA 1SOUA 3AEKA 3I9KA 3BIJA 4EJSB 4RM2A 3C4QA 3A32A 2C7PA 3BE8A 3R3WA 1HDYA 2CYCA 1ZI8A 2AC2A 4WADA 4I50B 1XZKA 3IOCA 3KUUA 5TY0A 1M1UA 1ZH2A 5BSEA 3JQGB 3DPIA 5JALA 1NJSA 2OL4A 1JA9A 4MRAA 5IN5A 1P3JA 1W6UA 3TLYA 3TZ6A 5JRJA 1CQXA 2P5TB 2ZETA 4HAUA 1RD4A 5CGQB 2JLZA 2LKDA 1NG1A 4N0QA 5CJ2A 3CWCA 2WUEA 3EODA 3VYTB 2HH9A 3OHMA 3TJZA 1G8KA 2IX9A 4EMSA 4Y2UA 4UU1A 4UOEA 3ZHRA 4B6PA 4MQEB 2GZMA 3JD0A 4NESA 3SHVA 2LR0A 1TKAA 2YHSA 3R4CA 5H81A 5TVKA 4KR9A 1YQGA 3S99A 3K0FA 3KB8A 2PLFA 3HYCA 2ZUUA 1ACMA 4GVXA 3GJ5A 2D4AA 4KK3A 1G7TA 3HZOA 4BNDB 4CPDA 5IULC 4Q93A 1XMVA 2O54A 2QRJA 4Q3BA 1QONA 3T99A 4DR5B 2FF7A 3B5IA 1PV1A 2M1XA 3PPIA 1KZ4A 5FO1A 3RHTA 3UWKA 1XTVA 4FFLA 5EPEA 2FPIB 1POXA 4JBLA 2XMCA 3IVRA 3HKCB 2EGUA 1F8XA 4MUJA 2ZIZA 2GEKA 2PRIA 3ZHUA 1Z88A 1ODTC 3RJ9A 1BMTA 4IZHA 1B7GO 4BLPA 4KPFC 4GX2A 4Y1EA 1B3BA 4D4GA 5BV8A 1I10A 1B4DA 2AMYA 4JXZA 4B6RA 4TRNA 3CT6A 1ZLYA 4YRSA 2VK4A 4OHBA 1CRLA 3W5UA 2IYZA 4ZHSA 2P11A 4CT0A 2FGJA 2B3DA 4BNUA 3TS1A 4EJ6A 4A2PA 4EABA 3L1JA 1M1NA 3BTOA 1EI9A 4JS0A 1NQVA 3PDHA 4GQIA 2GCIA 1BCRA 3ICQB 2BR5A 1NU8A 5TARA 1XTPA 2CMKA 1CY2A 1JA0A 2QMOA 3CNEA 3CXRA 2ZREA 3MLAA 4RD6A 4UHFA 4E11A 1BEZA 5A4AA 3WBFA 3BMQA 5JJLA 1J0EA 3BREA 4CTNA 2D5IA 3ZLUA 4B2YA 4D9MA 4YQZA 2FX5A 1LF0A 1P0PA 1GZ4A 3RAGA 4FLMA 5JAOA 1KS9A 5LQAA 1Z6XA 1Z73A 4DCGA 1SIWA 4PO9A 5FLKA 4UAUA 5CYFA 2FZKA 3ZW9A 5C8XA 5JZ9A 3AW9A 5JY6A 1W1WA 2QLMA 5DBIA 1KVQA 4CKBB 1UBOS 3KSBC 4ZANA 1EFLA 1U3DA 1ZI6A 2Z2KA 1OA0A 3DEYX 2I76A 4PX5A 2VQ6A 1AX9A 2F1OA 2TMDA 4GD3Q 4I3FA 2WVJA 2VNJA 1GILA 3A7EA 4KQ2A 3ZHYA 4QQ8A 5CPFA 1AKRA 3VA7A 3DTVB 4TZKA 3NYQA 3AVWA 1FA9A 1KVSA 4BAUA 3JWJA 3UHFA 4FKZA 1NVUQ 1RRPA 4LNUB 4XH9B 4B9EA 1IK4A 1W49A 3U60B 3LCVB 2QRMA 1VHDA 1QAQA 2JEOA 4BO1A 3RVJA 3DXYA 4FYXA 1MRNA 2WJZB 2FP4A 3KT0A 4S1TA 5REQA 3DDCA 1USWA 1Y7TA 2AOTA 3HKDA 3NBUA 3U3JA 1QF7A 4IR7A 4KFSA 1E5DA 4EG4A 4ZI2A 2CDCA 5FX2A 5BVHB 4OMUA 2NXCA 5I4CA 3CRZA 4W5OA 2B8WA 3I5MA 5T67A 1AO3A 5I9BA 3RUHA 2ANBA 4A10A 4EX7A 1APBA 3T3IA 1QU3A 1REQB 4GSLA 4BDTA 5BQXA 1H2RS 1E3EA 1QZ3A 1XQ6A 2QR3A 1XNQB 4BWVA 1Q6ZA 3CF4A 3QWFA 4M0UA 4Y9SA 4A6XA 5IX8A 4BE4A 4DOMA 3ZE6A 1X38A 2Q5JA 3A1NA 2ZJBA 2ZROA 2QX4A 3RKRA 3PQEA 2WJ4A 1CUFA 3IMCA 3K53A 2Q62A 3L8GA 3PIRA 4RIEA 1P6XA 4PBSA 4X54A 3QEBZ 3V1LA 2IUFA 3MINB 2O6HA 1XHLA 4FSDA 3DNMA 1R6AA 1L4UA 2R62A 3HLYA 1PD1A 4Q3NA 3P9QA 5A9TA 2R2AA 3U61B 1Y8RB 1P7WA 3HCOA 1QVWA 1N2XA 1M2GA 3WLSA 3ETNA 5IBPA 2IYNA 1Z5VA 3T94A 4Q1VA 3NBFA 4F9TA 2WPDA 4NENA 1CE8A 2EKDA 3H17A 1XZAA 2QMQA 1KMHA 3DE6X 3MJRA 1MRSA 1XHEA 2V0CA 4Z1MA 4DYHA 1O9GA 3NEPX 4TLLB 4NYJR 2CXUA 4DNFA 3A4VA 5JO9A 1VXRA 4CDMA 3ECCA 4PC3A 3AGPA 4ZFNA 1EHIA 1DSSG 1RXUA 1ZIXA 2NV0A 3EQZA 5D3MA 2AYXA 2ZRFA 3DBRB 5JCOA 2HMAA 1BXGB 2C9ZA 2ZB3A 3IRUA 3UJPA 3AKEA 1Q5PA 4Z3OA 1ZH0A 2Z3WA 2J45A 3IHKA 5EUCA 4AWBA 5AVUA 1OHHD 3KXLA 4PM4A 3HJAA 3U3MA 3DXZA 4LFAB 2IEGA 2I3ZA 4LBZA 3GJ7A 1JDZA 3D7KA 2PUTA 3F74A 4PCAA 3ROEA 2XZDA 2V1UA 1M5RA 1LX7A 2BZSA 2IYVA 3PG5A 5HIAA 2HF7A 5G2OA 5CFRA 4WMLA 3T3NA 1YMUA 1MQ9A 3O82A 4RTLA 2WUFA 1XXHA 2QQ0A 2R2GA 4FBMA 1CUBA 1ETUA 1XD9A 2W71A 2VPIA 1X7ZB 3EGDA 4K9RA 3L93A 4CKEB 4NV3A 4BTEA 4OQYA 3RREA 1D2AA 4ZK6A 2ERYA 1QQAA 1HYEA 3EVBA 2OYRA 1NKVA 2QT0A 1UWLA 2Q4TA 3LC2O 4J0KA 3UMSA 1PNRA 4FXOA 3KSUA 3TDKA 4DEVA 4DLKA 2QLNA 5BNWA 1MW8X 1J4AA 2QVBA 5IYZA 3L02A 4XQ9A 1R2QA 2HDNB 2V5VA 1ZD4A 2MSKA 3RNLA 3PQ4A 2PUFA 1G16A 3OBIA 1FJGB 3EZ7A 3ONEA 3SY8A 1E1DA 4YRFA 4WBNB 5KB3A 4K2HA 3GJ3A 4MW5A 4N0MA 3H99A 4H16A 1J8VA 3ASYA 4MRRA 2OWDA 2YV3A 4EPTA 4REQB 1RE1A 5IBQA 1B73A 1C9EA 3AP1A 3FRHA 4CEIB 2WA2A 3SYTA 1EUQA 4Z1MD 2I2BA 5AD1A 2A9QA 2WWIA 1U94A 3LBYA 3K0CC 4MYRA 3WYFA 3MAJA 3UYKA 4E46A 1K4YA 4MUEA 1PJ8A 1Q0LA 2QRKA 3QKWA 4M46A 1RQRA 1JH9A 3C6YA 1FFXB 1TADA 1N2BA 2OG2A 2YV4A 2V97A 3SJZA 2FWAA 2G7MC 1RSZA 2WDPA 5DXAA 5JVDB 2MYUA 3B78A 3SXUB 3I76A 1QV9A 1JEOA 1EGAA 1NYRA 4JLOA 2I9PA 4EAQA 1JW9B 1QFXA 3P9XA 5B1YA 1G42A 3T0GA 3E18A 1P81A 2W4IA 3EGEA 4JKIA 4HEA6 3D6NB 5AJZA 3TZEA 2OGTA 5U9CA 3BKXA 5B1IA 4YALA 4ZT4A 1KJZA 3PUHA 1YQXA 4ZVSA 1Z0IA 3ZC3A 3H42B 3CS3A 1I3OA 5JPIA 5JCJA 3HJUA 3FF4A 3UUFA 1ADFA 4WOKA 2BUAA 4IEEA 1R4NB 4CMEA 4IPTA 2IHKA 2WMOB 4TKLA 1XTIA 3B38A 3NTUA 3WOVA 4BWYA 4B3IA 1UXIA 1HTBA 1U3TA 3M3DA 3TCXB 4RTSA 1YOVA 5HIIA 3FWZA 3TXYA 5CITA 3TQOA 3DAPA 4UULA 1QHIA 1XRMA 3QPCA 4I81A 2PKQO 1EFUA 1ZZGA 1YR1A 2NUAB 2C4UA 4MULA 3DE7X 4LX0A 1OV4A 4Y1GA 4E08A 1D4ZA 3UMBA 3PWKA 1NU6A 2JJ2D 1DWPA 2IOQA 1GO2A 4K03A 2XWPA 4QL3A 4V0KA 4B81A 4HWOA 3DEFA 3SNHA 5DSZA 3PFBA 5GONF 2BT4A 3O84A 1RP1A 2G77B 2GO1A 4JJAA 4AMYA 1EP1B 4M86A 1XALA 4JY7A 2P1RA 4PRZA 3HO1A 1FVXA 4UNRA 1UJ2A 1N2GA 4IEIA 1A8QA 1H2BA 3LCJA 4RPCA 1PNOA 3TO5A 1TRKA 1VL2A 2JFVA 3TKLA 3CZ5A 3HKCA 3BD9A 4EZBA 2C61A 2XHEA 2EDAA 1VSUA 2BAGA 4RFLA 4Z7OB 1RXYA 2VTEA 5ITZA 3HWSA 1WTCA 3OU7A 2NTVA 3QIVA 1JKXA 3HN2A 5IWAB 1EDZA 4D43A 1R1DA 1U7ZA 3L0YA 2F3UA 3HJFA 2C2ZA 2JFPA 4XGRA 3CH5A 2GUGA 3KYDB 5KCZA 4ZAGA 3VC2A 3X2SA 4EQ6B 3L4BA 1Y4ZA 3FGPA 4XM0A 1YQ9A 1UIMA 5DMXA 3T15A 4CN8A 4MHTA 2Q3HA 4PAMA 4RDIA 1NJGA 1T1RA 1V5IA 4HO1X 3T3OA 1Z0ZA 1CJSA 2V7PA 3H0KA 2VP4A 2X6QA 3GFRA 3QELA 2HU2A 3CPSA 3LFTA 5CYPA 4FDTA 4DCVA 3O1JC 1DRKA 3ZLJA 4LV5B 3WB9A 4PFKA 1IB0A 3X1MA 1XTTA 5E9QA 5CDFA 1ZN9A 2HKIA 4FE3A 5F5NA 3ZBPA 5F9HA 5MFZA 4UJ5A 1K8RA 4KQGA 9ATCA 2YXEA 5BWOA 3GG9A 2UZ3A 4DR7B 2BFDA 1GKYA 2ONZA 2DECA 1QIEA 3BRWA 4UCXA 2DPMA 2VNAA 2NW6A 4POAA 3OPNA 2DT8A 4BFCA 2OEPA 2ZRLA 1U7TA 2W37A 1E4OA 2P41A 3GN1A 4QXMA 4LCBA 2E89A 4NV1A 4UNIA 5DM60 4BLQA 2O2ZA 1Z5PA 1X86B 4OGGA 1VHQA 2O8DB 2XW6A 1CFJA 2E48A 2I3AA 3GLHB 3UCXA 4CMKA 1HR0B 1F6WA 2WILA 5KYUB 1AV6A 4EG3A 4Y6OA 3AHIA 3SIRA 2CVFA 4DNQA 5FFFA 1VLLA 1KH3A 4J0IA 4D2IA 4YV7A 1FPQA 2IZOA 3N2GA 1LBSA 4UUMA 5DSTA 2HCBA 1CYEA 3GAAA 3ONNA 2C3PA 4G5XA 3KJIA 5E4FA 4ARUA 1QH8B 4R8LA 3OX2A 4F2DA 1O94C 3SVZA 2OCLA 4DIEA 5DN6A 1EXNA 1K27A 3WGHA 1BCRB 1WPGA 4GYYA 1SC4A 3DCJA 3GLVA 3AKCA 5FO0A 4IMIB 4DMHA 3CG4A 2VATA 4GMGA 1B2RA 5K09A 1K92A 2PZLA 3KELA 5I5EA 3KYCB 4B43A 5KX5B 2P68A 2R4QA 1NUSA 4IZOA 4NMHA 1GN9A 1G17A 4RS4A 3RS9A 3AOGA 1PVOA 1NLZA 1ZQ9A 5EFZA 4TTPA 4AKHA 2O7QA 3DD1A 3H1AA 1V1JA 4M76B 2N47A 1W8DA 3ZI7A 1J21A 5K4GA 3C70A 4EKYA 3GT4A 3QE3A 4R0NA 3OZWA 4CKBA 3UMCA 2AC4A 1GG8A 3RTEA 1Y6FA 4JAVC 2Y1KA 3GEDA 2RGXA 1SGWA 3GJRA 4HZUA 3PL5A 1Y6QA 4PYMA 4WY2A 3TBKA 5LIRA 1G18A 3MELA 2IH5A 1DDOA 5FI5A 3TL6A 2OZPA 1FW8A 2R00C 3ZIAA 1ZM9A 3DTVA 1YR8A 3PXCX 3VKGA 1R5OA 1LU9A 1U2DC 3FOCA 5TEWA 2QVCA 1I8TA 5LOVA 5U1PA 1X1BA 3DWEX 2EJUA 2NQTA 2QX6A 2VBFA 2JIMA 5DDIP 1VSBA 3NTQA 5FBLB 5IAJA 3VVBA 3DVRX 4AWXA 2NUTA 3FTCA 1HZJA 1U0JA 3LRTA 1NMZA 3U62A 4YT8A 3O4JA 4QM7A 1ZRMA 3R5HA 4JV5B 1KY5A 3NVAA 2QD5A 2GPAA 3HI6A 4YMTA 5CB4B 4I1UA 5ER6A 2CEKA 3HU2A 2C8LA 1M2OB 1H3FA 4TKMA 5AJYA 2PTGA 1BDMA 4NNJA 1MDFA 4ENRA 4EKEA 1QGOA 4ZTBA 1NR5A 3TVDA 4RC9A 2Q0SA 3OA2A 1EBFA 1NN1A 4CMHA 4EYEA 4N03A 4LN1A 3Q0IA 1T1EA 2WKQA 1WSDA 3ORRA 1JG7A 1MV5A 2VRWA 4B47A 2YY6A 3LC1O 1IIRA 3AUAA 4ZCIA 4A36A 1K8ZB 4NR0A 2JAOA 2OILA 4YI3A 2Q4RA 3RJ5A 3P2KA 3CE9A 2A1IA 2D0IA 4OXKA 2VHCA 4OU5A 5DCYA 3AGQA 2ONJA 3ZH9B 2GN8A 2IEYA 1EIWA 2ZRHA 4JBGA 1NW9B 3LXRA 3M34A 4ZMSA 1S6YA 3U49A 4UDNA 3JWIA 1CUDA 4TKVB 3E03A 4NAHA 2AYYA 1W0KA 3NH9A 1OX4B 5H4GA 1T10A 3F5FA 1W36B 2FE4A 1L7OA 4EB6A 3MAAC 2PYDA 2D2VA 2DTXA 4QXAA 5EZ5A 3MS4A 3B3QA 3EG9B 3HMQA 2RG7A 3TQSA 3U17A 4LYGA 3NFYA 5K0LA 4YAGA 1R0SA 2FUKA 2QM8A 3PNVA 4XSGA 1M2KA 1XJQA 1U04A 2A7XA 2C5FA 2F3QA 3B60A 3M6VA 2K2WA 1K8YB 5D87A 5EZYA 4QQKA 5CVEA 3CLUD 3FYSA 1IEWA 4ALNA 2OKCA 2FCRA 2LIPA 2ZJFA 3R20A 4F04A 1L5MA 2XUZA 1P9WA 5GPBA 3EXG2 3U3DA 3Q72A 5E9JA 5KYKA 1QTRA 2ZIVB 2PSSA 2I99A 4ZP1A 4HRYA 1N0IA 4JIMA 1X2BA 1QHFA 1U8ZA 3UK6A 4UATA 1O8BA 3D3WB 3N74A 1RYDA 3PIIA 1RHRA 4OY3A 4YP1A 2E6KA 1NZFA 1Z25A 1XEXB 3GR6A 4J16A 3G0CA 4WK6A 3TW6A 1BWSA 2XI4A 3BB4A 5AM4A 4YY3B 3OM0A 3COSA 3H1BA 2HJ9A 3EQ9A 4HH3C 5LQNA 1U2DA 5KEIA 3HA7A 3DP7A 3VPDA 1CG6A 3PNBA 3DZJA 1Y9JA 4BKQA 3GT3A 4QM6A 4MICA 5E3HA 3F7TA 5LWQA 5EWMB 2I6UA 4UUOA 1JLLB 1AKNA 2XYQA 2EG5A 3OE1A 4HUTA 1ZOOA 2B5WA 1QKIA 1Q1ZA 3PUYA 4YRQA 1GL6A 1M9NA 2ORYA 3BJIC 3AR6A 1AA9A 3PPWA 1C5KA 3T9EA 1A2OA 3JSXA 5AKEA 2MSNA 3WNVA 4AYWA 5BQFA 5I7OA 4ARZA 2AYZA 3HBLA 1JS1X 3HBMA 1IHDA 3GPCA 2XDAA 4TUYB 2UUCB 3TUJC 3GLQA 3K0HA 5T4BA 1X19A 4WNCA 1XJCA 3ZYCA 4RDXA 5JANA 1R3UA 2XBLA 4ESOA 5HKAA 4L8GA 5C0OE 5HJEA 2OZVA 3GU3A 1KYYA 3P2IA 3KEOA 3H2SA 3QXXA 3H11B 1QFYA 4ACAA 5EJ7A 4MGZR 4US1R 5JQGB 1ZYUA 1QQ7A 2H2AA 2HMTA 1UBKS 3QPAA 3CJQA 3FYUB 3G8AA 1CF9A 4ZVPA 2OMEA 4JL5A 1BN7A 2Q21A 5IF9A 2F64A 2HRDA 4ZPXA 1IEQA 3H5LA 1HYQA 3WYNA 1X80B 1Z15A 3EVNA 3WRYC 2Q27A 2P6OA 3GGSA 3KVOA 2X3FA 1FTQA 3DLBA 1XTUA 1OI4A 1Q2UA 2NG1A 2ADFA 1JEYA 2WBLC 5CLFA 1N3IA 3OWXA 4JJKA 2Z3VA 3EBLA 2MDTA 4LYYA 5CJPA 4CMAA 5KYWA 3FPAA 5G0TA 3AERA 1I24A 3TLCA 1WQ1R 2IPMA 1V35A 4I9HA 4IGIA 4CVNA 3GOQA 4TQUS 5FF9A 2V0GA 1EK5A 5AI4A 5EFOA 3A6HA 4AMGA 2WIGA 1H0SA 2O2CA 1WEHA 2ZITA 3A9WA 4HBZA 4YV0A 2HRZA 5EI5A 1CXZA 4TWAA 1N2IA 1OROA 5H02A 5IH7A 2YN0A 1OFVA 1CULC 4AJEA 4EW6A 5JXIA 3R3VA 2GLUA 3VC7A 2CWDA 3T12A 1BA3A 1Z4PX 2BJVA 4J0CA 5JSYA 1W4LA 4JCCA 4YVFA 2PSDA 5JCXA 4TZ0A 4QJIA 2W6NA 3D6TB 3S2EA 3DZGA 1L0BA 7GPBA 3MWEB 3M8KA 1NQXA 2WNSA 2ZB7A 1OI3A 3NKLA 5K4AA 3R7AA 2HXSA 1KJ9A 3KCNA 5LN1A 4RH3A 3IPRA 4MW2A 3D8RA 3I2YX 2BFCB 4NBVA 1JAXA 3DL4A 5FH9A 1FX0A 3R24A 1NBME 3KSRA 1BTOA 2XD9A 2Z5FA 3PU6A 2NSYA 4HPXB 4RPGA 4KQMA 4XD7A 5BOVA 4CCYB 2XIJA 2HIHA 1O87A 3MWGA 4HZGA 2NXNA 2FW8A 1S02A 4JSRA 4ZOAA 2YUTA 5CFOA 4DUYB 4FXPA 2GM9A 3GJYA 1Z2OX 4RFSB 4QTTB 1WXWA 5DGXA 1YDFA 4MUBA 4OBBA 1ZM2A 4PRKA 4R68A 3MXTA 3X2EA 3SLKA 2OD7A 5KTMA 3T1TA 4ZT3A 3AC0A 1YHNA 5FL7A 1WKBA 4H0FA 3RKUA 2XKKA 3AL0C 5JSKA 2OCGA 2J0QA 2ZBPA 1WQ4A 3QENA 2H4ZA 4LVNA 4UTRA 4IILA 4F9EA 3RBXA 1X8LA 2C9DA 1T43A 3FYDA 3HNRA 1I4WA 2Y1DA 4W4TA 5FI0B 5JNRA 1WW3A 1PLKA 3WWZA 4EQ6A 3F4LA 2ZUFA 3TLMA 3GVXA 5MGNA 1A8SA