4FX3B

Crystal structure of the cdk2/cyclin a complex with oxindole inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title Crystal Structure of the CDK2/Cyclin A complex with oxindole inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4fx3B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4fx3B02
4RODA 5ICPB 2I40B 1OIYB 3MIAB 4EORB 1OL2B 1JKWA 1JOWA 5IF1B 1JSUB 4KRCB 2W99A 2W9ZA 5HNBB 3M03A 4BCPB 2PHGA 2WXVB 4YOOA 3EIDB 3BHVB 4CFXB 2W96A 4IMYB 2I53A 4EC9B 3MY5B 4YOSA 4EONB 2WHBB 4F7JB 4BCMB 4CFUD 2UUEB 5LQFB 1BU2A 3TNWB 5LMKB 2BKZB 1C9BA 3POMA 1AISB 2PMIB 2UZEB 3G33B 4II5B 5BNJB 2C5OB 2C5VB 1H26B 4BCQD 4BCND 1H1SB 1OGUB 3EOCB 1JSTB 2BPMB 4F7LB 2IW8B 1ZP2A 1H4LD 1W98B 1P5EB 4OR5B 2WMAB 3K7AM 5EFQB 1URCB 4NSTB 3DDPB 1O9KA 2B9RA 4F6WB 3DDQB 1H24B 3EJ1B 3BHUB 1D3UB 1H27B 4CFNB 4EOJB 2PK2A 4OGRB 2CCIB 3BLRB 2C6TB 2WPAB 1GUXB 1VOLA 5FGKB 5ACBA 4UN0A 4YOZA 3MY1B 1G3NC 4BCOB 1GY3B 4BCMD 4EOKB 2WEVB 3BLHB 4BCJB 1OIUB 2C5NB 5I5ZB 3TNHB 1TFBA 3H4CA 4F6UB 5IDPB 4F6SB 1OL1B 3BLQB 4CFMB 3MI9B 4BCHB 1H1RB 4F7SB 1N4MA 1OKWB 5HBEB 2UZBB 1VYWB 4BCIB 1H1PB 4KRDB 3O0GD 1OKVB 4EOIB 2PK9B 1H28B 4BCGB 4EC8B 3BHTB 4I3ZB 4YC3B 1AD6A 2W2HA 2JGZB 3DOGB 4BCQB 4BCNB 4F7NB 4BCKB 2UZDB 4BCFB 2EUFA 4EOQB 5HBJB 2W9FA 3QHWB 2C4GB 1H25B 1FVVB 2UZLB 4FX3B 4EOPB 1VINA 4EOMB 2V22B 2IW9B 1OI9B 4Y72B 4F70B 4ELLA 2QDJA 1UNGD 2C5XB 2WFYB 2WMBB 3TN8B 4CFVB 1KXUA 2X1NB 3QHRB 4CRLB 4ROCA 5HVYB 1PKDB 4ROEA 5IDNB 4EOLB 5CEIB 3LQ5B 4CFWB 1F5QB 2IW6B 1O9KB 4G6LB 5HQ0B 4CFUB 3RGFB 3TNIB 2CCHB 1XO2A 4ELJA 1GH6B 1QMZB 4EOOB 2WIHB 2WIPB 5HBHB 4EOSB 4TTHA 1GUXA 5CYIB 2IVXA 1H1QB 4CXAB 1FINB 1UNHD 2F2CA 3F5XB 5L2WB 1UNLD 2G9XB 1E9HB 2CJMB 2R7GA
chains in the Genus database with same CATH superfamily
2QGSA 2CZ0B 1OIYB 4BXXX 1UGQB 3TW7A 1JSUB 3HBLA 4MFEA 5HNBB 2WXVB 4YOOA 4CFXB 3A8HB 4EC9B 4EONB 2BS4A 2WHBB 4F7JB 2UUEB 3BG5A 1BU2A 3TNWB 3G33B 3VKGA 1AHJB 2G77A 4BCQD 4BCND 1QLBA 3QZ5B 2IW8B 1UGSB 1P5EB 4OR5B 3HB9A 5EFQB 2LW4A 2B9RA 3EJ1B 3BHUB 1H27B 1TD6A 1G3NC 2WJ9A 3BLHB 5I5ZB 2KR6A 1TFBA 3H4CA 4F6UB 5IDPB 3MI9B 3X20B 5HBEB 4ZGJB 3PO3S 2PK9B 4BCGB 4EC8B 1AD6A 4BBRM 3QYGB 1FKMA 2ZPBB 3X25B 4EOQB 2C4GB 1IREB 3X26B 2V22B 1OI9B 2ZZDB 4Y72B 4ELLA 1UNGD 2C5XB 3A8MB 3WVEB 3HHTB 5HVYB 4ROEA 5IDNB 5CEIB 4Z6YA 4CFWB 2IW6B 1O9KB 4G6LB 3TNIB 1XO2A 1GH6B 2WIPB 4FM4B 4TTHA 1GUXA 1H1QB 3F5XB 2QF7A 4MIMA 2BS3A 1E9HB 2ZPHB 3A8LB 2I40B 3MIAB 4EORB 3BG9A 2KMGA 1JKWA 5IF1B 3A8OB 3HO8A 2W99A 2W9ZA 2QDYB 3M03A 2IN3A 2PHGA 3EIDB 2W96A 4IMYB 3MY5B 3WVDB 2CYZB 2ZPEB 4CFUD 5LQFB 3POMA 1AISB 2UZEB 2C5VB 4JX5A 1H1SB 1OGUB 4F7LB 1H4LD 2CZ6B 4OB1B 1D3UB 3DJBA 4EOJB 4HL4A 1ENWA 4OGRB 2CCIB 2C6TB 4OB0B 5FGKB 3MY1B 4EOKB 1OIUB 1OL1B 1UGPB 4CFMB 1OKWB 4ZGDB 4KRDB 4NC6A 2ZPGB 4I3ZB 2QFZA 4YC3B 4AKGA 2JGZB 4BCQB 4BCNB 4F7NB 2DMEA 4BCFB 4BY7X 4OB3B 2DD4B 2PJQA 3A8GB 4FX3B 3NDQA 4EOPB 4EOMB 4HNTA 2IW9B 2QDJA 2DXCB 3QHRB 4BY1X 4AKHA 2CCHB 1QMZB 4EOOB 5HBHB 2F2CA 3X28B 5L2WB 1UNLD 3QWLA 2CJMB 3KHIA 2D0QB 4LOCA 3DL1A 4KRCB 4BCPB 2DXBB 3BHVB 2I53A 3QXEB 4BCMB 2BKZB 2C5OB 2BPMB 4MFDA 4AI6A 1ZP2A 1W98B 2WMAB 1URCB 4F6WB 1V29B 2ZPFB 4JX4A 2PK2A 3DTOA 3BLRB 2WPAB 1GUXB 5ACBA 4UN0A 5IHYA 4BBSM 4YOZA 4BCJB 2C5NB 2BS2A 4QSHA 4F6SB 3BLQB 4BCHB 1H1RB 1N4MA 3QYHB 2UZBB 4BCIB 1H1PB 1OKVB 2ZPIB 4EOIB 1H28B 4AKIA 3DOGB 4JX6A 2QQ8A 2ZCFB 3VYGB 3QYEA 2W9FA 3QHWB 1H25B 2UZLB 1VINA 4HNUA 2WFYB 2WMBB 3TN8B 4CFVB 1KXUA 2X1NB 4ROCA 4EOLB 3RGFB 4ELJA 2CZ1B 2DPPB 4EOSB 2IVXA 3QZ9B 1UNHD 2R7GA 4RODA 5ICPB 4HLQA 5DQVA 3HZJA 1OL2B 1JOWA 4HNVA 4YOSA 1UGRB 2AHJB 5LMKB 1C9BA 2PMIB 5BNJB 4II5B 3GTMS 1H26B 5EJCA 3EOCB 3TW6A 1JSTB 3VYHB 3K7AM 4NSTB 2CZ7B 3DDPB 3B57A 1O9KA 3DDQB 1H24B 4CFNB 4ZGEB 1VOLA 4BCOB 4M6VA 1GY3B 4BCMD 2WEVB 3VKHA 3TNHB 5DQWA 4F7SB 1VYWB 3O0GD 3BHTB 3BG3A 2W2HA 1E7PA 4BCKB 2UZDB 2EUFA 5HBJB 1FVVB 3X24B 4F70B 4OB2B 4CRLB 1PKDB 3LQ5B 1F5QB 3QYBA 5HQ0B 4CFUB 2WIHB 5CYIB 4CXAB 1FINB 2G9XB 2DD5B
chains in the Genus database with same CATH topology
4RODA 5ICPB 2I40B 1OIYB 3MIAB 4EORB 1OL2B 1JKWA 1JOWA 5IF1B 1JSUB 4KRCB 2W99A 2W9ZA 5HNBB 3M03A 4BCPB 2PHGA 2WXVB 4YOOA 3EIDB 3BHVB 4CFXB 2W96A 4IMYB 2I53A 4EC9B 3MY5B 4YOSA 4EONB 2WHBB 4F7JB 4BCMB 4CFUD 2UUEB 5LQFB 1BU2A 3TNWB 5LMKB 2BKZB 1C9BA 3POMA 1AISB 2PMIB 2UZEB 3G33B 4II5B 5BNJB 2C5OB 2C5VB 1H26B 4BCQD 4BCND 1H1SB 1OGUB 3EOCB 1JSTB 2BPMB 4F7LB 2IW8B 1ZP2A 1H4LD 1W98B 1P5EB 4OR5B 2WMAB 3K7AM 5EFQB 1URCB 4NSTB 3DDPB 1O9KA 2B9RA 4F6WB 3DDQB 1H24B 3EJ1B 3BHUB 1D3UB 1H27B 4CFNB 4EOJB 2PK2A 4OGRB 2CCIB 3BLRB 2C6TB 2WPAB 1GUXB 1VOLA 5FGKB 5ACBA 4UN0A 4YOZA 3MY1B 1G3NC 4BCOB 1GY3B 4BCMD 4EOKB 2WEVB 3BLHB 4BCJB 1OIUB 2C5NB 5I5ZB 3TNHB 1TFBA 3H4CA 4F6UB 5IDPB 4F6SB 1OL1B 3BLQB 4CFMB 3MI9B 4BCHB 1H1RB 4F7SB 1N4MA 1OKWB 5HBEB 2UZBB 1VYWB 4BCIB 1H1PB 4KRDB 3O0GD 1OKVB 4EOIB 2PK9B 1H28B 4BCGB 4EC8B 3BHTB 4I3ZB 4YC3B 1AD6A 2W2HA 2JGZB 3DOGB 4BCQB 4BCNB 4F7NB 4BCKB 2UZDB 4BCFB 2EUFA 4EOQB 5HBJB 2W9FA 3QHWB 2C4GB 1H25B 1FVVB 2UZLB 4FX3B 4EOPB 1VINA 4EOMB 2V22B 2IW9B 1OI9B 4Y72B 4F70B 4ELLA 2QDJA 1UNGD 2C5XB 2WFYB 2WMBB 3TN8B 4CFVB 1KXUA 2X1NB 3QHRB 4CRLB 4ROCA 5HVYB 1PKDB 4ROEA 5IDNB 4EOLB 5CEIB 3LQ5B 4CFWB 1F5QB 2IW6B 1O9KB 4G6LB 5HQ0B 4CFUB 3RGFB 3TNIB 2CCHB 1XO2A 4ELJA 1GH6B 1QMZB 4EOOB 2WIHB 2WIPB 5HBHB 4EOSB 4TTHA 1GUXA 5CYIB 2IVXA 1H1QB 4CXAB 1FINB 1UNHD 2F2CA 3F5XB 5L2WB 1UNLD 2G9XB 1E9HB 2CJMB 2R7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ROD A;  5ICP B;  2I40 B;  1OIY B;  3MIA B;  4EOR B;  1OL2 B;  1JKW A;  1JOW A;  5IF1 B;  1JSU B;  4KRC B;  2W99 A;  2W9Z A;  5HNB B;  3M03 A;  4BCP B;  2PHG A;  2WXV B;  4YOO A;  3EID B;  3BHV B;  4CFX B;  2W96 A;  4IMY B;  2I53 A;  4EC9 B;  3MY5 B;  4YOS A;  4EON B;  2WHB B;  4F7J B;  4BCM B;  4CFU D;  2UUE B;  5LQF B;  1BU2 A;  3TNW B;  5LMK B;  2BKZ B;  1C9B A;  3POM A;  1AIS B;  2PMI B;  2UZE B;  3G33 B;  4II5 B;  5BNJ B;  2C5O B;  2C5V B;  1H26 B;  4BCQ D;  4BCN D;  1H1S B;  1OGU B;  3EOC B;  1JST B;  2BPM B;  4F7L B;  2IW8 B;  1ZP2 A;  1H4L D;  1W98 B;  1P5E B;  4OR5 B;  2WMA B;  3K7A M;  5EFQ B;  1URC B;  4NST B;  3DDP B;  1O9K A;  2B9R A;  4F6W B;  3DDQ B;  1H24 B;  3EJ1 B;  3BHU B;  1D3U B;  1H27 B;  4CFN B;  4EOJ B;  2PK2 A;  4OGR B;  2CCI B;  3BLR B;  2C6T B;  2WPA B;  1GUX B;  1VOL A;  5FGK B;  5ACB A;  4UN0 A;  4YOZ A;  3MY1 B;  1G3N C;  4BCO B;  1GY3 B;  4BCM D;  4EOK B;  2WEV B;  3BLH B;  4BCJ B;  1OIU B;  2C5N B;  5I5Z B;  3TNH B;  1TFB A;  3H4C A;  4F6U B;  5IDP B;  4F6S B;  1OL1 B;  3BLQ B;  4CFM B;  3MI9 B;  4BCH B;  1H1R B;  4F7S B;  1N4M A;  1OKW B;  5HBE B;  2UZB B;  1VYW B;  4BCI B;  1H1P B;  4KRD B;  3O0G D;  1OKV B;  4EOI B;  2PK9 B;  1H28 B;  4BCG B;  4EC8 B;  3BHT B;  4I3Z B;  4YC3 B;  1AD6 A;  2W2H A;  2JGZ B;  3DOG B;  4BCQ B;  4BCN B;  4F7N B;  4BCK B;  2UZD B;  4BCF B;  2EUF A;  4EOQ B;  5HBJ B;  2W9F A;  3QHW B;  2C4G B;  1H25 B;  1FVV B;  2UZL B;  4FX3 B;  4EOP B;  1VIN A;  4EOM B;  2V22 B;  2IW9 B;  1OI9 B;  4Y72 B;  4F70 B;  4ELL A;  2QDJ A;  1UNG D;  2C5X B;  2WFY B;  2WMB B;  3TN8 B;  4CFV B;  1KXU A;  2X1N B;  3QHR B;  4CRL B;  4ROC A;  5HVY B;  1PKD B;  4ROE A;  5IDN B;  4EOL B;  5CEI B;  3LQ5 B;  4CFW B;  1F5Q B;  2IW6 B;  1O9K B;  4G6L B;  5HQ0 B;  4CFU B;  3RGF B;  3TNI B;  2CCH B;  1XO2 A;  4ELJ A;  1GH6 B;  1QMZ B;  4EOO B;  2WIH B;  2WIP B;  5HBH B;  4EOS B;  4TTH A;  1GUX A;  5CYI B;  2IVX A;  1H1Q B;  4CXA B;  1FIN B;  1UNH D;  2F2C A;  3F5X B;  5L2W B;  1UNL D;  2G9X B;  1E9H B;  2CJM B;  2R7G A; 
#chains in the Genus database with same CATH topology
 2QGS A;  2CZ0 B;  1OIY B;  4BXX X;  1UGQ B;  3TW7 A;  1JSU B;  3HBL A;  4MFE A;  5HNB B;  2WXV B;  4YOO A;  4CFX B;  3A8H B;  4EC9 B;  4EON B;  2BS4 A;  2WHB B;  4F7J B;  2UUE B;  3BG5 A;  1BU2 A;  3TNW B;  3G33 B;  3VKG A;  1AHJ B;  2G77 A;  4BCQ D;  4BCN D;  1QLB A;  3QZ5 B;  2IW8 B;  1UGS B;  1P5E B;  4OR5 B;  3HB9 A;  5EFQ B;  2LW4 A;  2B9R A;  3EJ1 B;  3BHU B;  1H27 B;  1TD6 A;  1G3N C;  2WJ9 A;  3BLH B;  5I5Z B;  2KR6 A;  1TFB A;  3H4C A;  4F6U B;  5IDP B;  3MI9 B;  3X20 B;  5HBE B;  4ZGJ B;  3PO3 S;  2PK9 B;  4BCG B;  4EC8 B;  1AD6 A;  4BBR M;  3QYG B;  1FKM A;  2ZPB B;  3X25 B;  4EOQ B;  2C4G B;  1IRE B;  3X26 B;  2V22 B;  1OI9 B;  2ZZD B;  4Y72 B;  4ELL A;  1UNG D;  2C5X B;  3A8M B;  3WVE B;  3HHT B;  5HVY B;  4ROE A;  5IDN B;  5CEI B;  4Z6Y A;  4CFW B;  2IW6 B;  1O9K B;  4G6L B;  3TNI B;  1XO2 A;  1GH6 B;  2WIP B;  4FM4 B;  4TTH A;  1GUX A;  1H1Q B;  3F5X B;  2QF7 A;  4MIM A;  2BS3 A;  1E9H B;  2ZPH B;  3A8L B;  2I40 B;  3MIA B;  4EOR B;  3BG9 A;  2KMG A;  1JKW A;  5IF1 B;  3A8O B;  3HO8 A;  2W99 A;  2W9Z A;  2QDY B;  3M03 A;  2IN3 A;  2PHG A;  3EID B;  2W96 A;  4IMY B;  3MY5 B;  3WVD B;  2CYZ B;  2ZPE B;  4CFU D;  5LQF B;  3POM A;  1AIS B;  2UZE B;  2C5V B;  4JX5 A;  1H1S B;  1OGU B;  4F7L B;  1H4L D;  2CZ6 B;  4OB1 B;  1D3U B;  3DJB A;  4EOJ B;  4HL4 A;  1ENW A;  4OGR B;  2CCI B;  2C6T B;  4OB0 B;  5FGK B;  3MY1 B;  4EOK B;  1OIU B;  1OL1 B;  1UGP B;  4CFM B;  1OKW B;  4ZGD B;  4KRD B;  4NC6 A;  2ZPG B;  4I3Z B;  2QFZ A;  4YC3 B;  4AKG A;  2JGZ B;  4BCQ B;  4BCN B;  4F7N B;  2DME A;  4BCF B;  4BY7 X;  4OB3 B;  2DD4 B;  2PJQ A;  3A8G B;  4FX3 B;  3NDQ A;  4EOP B;  4EOM B;  4HNT A;  2IW9 B;  2QDJ A;  2DXC B;  3QHR B;  4BY1 X;  4AKH A;  2CCH B;  1QMZ B;  4EOO B;  5HBH B;  2F2C A;  3X28 B;  5L2W B;  1UNL D;  3QWL A;  2CJM B;  3KHI A;  2D0Q B;  4LOC A;  3DL1 A;  4KRC B;  4BCP B;  2DXB B;  3BHV B;  2I53 A;  3QXE B;  4BCM B;  2BKZ B;  2C5O B;  2BPM B;  4MFD A;  4AI6 A;  1ZP2 A;  1W98 B;  2WMA B;  1URC B;  4F6W B;  1V29 B;  2ZPF B;  4JX4 A;  2PK2 A;  3DTO A;  3BLR B;  2WPA B;  1GUX B;  5ACB A;  4UN0 A;  5IHY A;  4BBS M;  4YOZ A;  4BCJ B;  2C5N B;  2BS2 A;  4QSH A;  4F6S B;  3BLQ B;  4BCH B;  1H1R B;  1N4M A;  3QYH B;  2UZB B;  4BCI B;  1H1P B;  1OKV B;  2ZPI B;  4EOI B;  1H28 B;  4AKI A;  3DOG B;  4JX6 A;  2QQ8 A;  2ZCF B;  3VYG B;  3QYE A;  2W9F A;  3QHW B;  1H25 B;  2UZL B;  1VIN A;  4HNU A;  2WFY B;  2WMB B;  3TN8 B;  4CFV B;  1KXU A;  2X1N B;  4ROC A;  4EOL B;  3RGF B;  4ELJ A;  2CZ1 B;  2DPP B;  4EOS B;  2IVX A;  3QZ9 B;  1UNH D;  2R7G A;  4ROD A;  5ICP B;  4HLQ A;  5DQV A;  3HZJ A;  1OL2 B;  1JOW A;  4HNV A;  4YOS A;  1UGR B;  2AHJ B;  5LMK B;  1C9B A;  2PMI B;  5BNJ B;  4II5 B;  3GTM S;  1H26 B;  5EJC A;  3EOC B;  3TW6 A;  1JST B;  3VYH B;  3K7A M;  4NST B;  2CZ7 B;  3DDP B;  3B57 A;  1O9K A;  3DDQ B;  1H24 B;  4CFN B;  4ZGE B;  1VOL A;  4BCO B;  4M6V A;  1GY3 B;  4BCM D;  2WEV B;  3VKH A;  3TNH B;  5DQW A;  4F7S B;  1VYW B;  3O0G D;  3BHT B;  3BG3 A;  2W2H A;  1E7P A;  4BCK B;  2UZD B;  2EUF A;  5HBJ B;  1FVV B;  3X24 B;  4F70 B;  4OB2 B;  4CRL B;  1PKD B;  3LQ5 B;  1F5Q B;  3QYB A;  5HQ0 B;  4CFU B;  2WIH B;  5CYI B;  4CXA B;  1FIN B;  2G9X B;  2DD5 B; 
#chains in the Genus database with same CATH homology
 4ROD A;  5ICP B;  2I40 B;  1OIY B;  3MIA B;  4EOR B;  1OL2 B;  1JKW A;  1JOW A;  5IF1 B;  1JSU B;  4KRC B;  2W99 A;  2W9Z A;  5HNB B;  3M03 A;  4BCP B;  2PHG A;  2WXV B;  4YOO A;  3EID B;  3BHV B;  4CFX B;  2W96 A;  4IMY B;  2I53 A;  4EC9 B;  3MY5 B;  4YOS A;  4EON B;  2WHB B;  4F7J B;  4BCM B;  4CFU D;  2UUE B;  5LQF B;  1BU2 A;  3TNW B;  5LMK B;  2BKZ B;  1C9B A;  3POM A;  1AIS B;  2PMI B;  2UZE B;  3G33 B;  4II5 B;  5BNJ B;  2C5O B;  2C5V B;  1H26 B;  4BCQ D;  4BCN D;  1H1S B;  1OGU B;  3EOC B;  1JST B;  2BPM B;  4F7L B;  2IW8 B;  1ZP2 A;  1H4L D;  1W98 B;  1P5E B;  4OR5 B;  2WMA B;  3K7A M;  5EFQ B;  1URC B;  4NST B;  3DDP B;  1O9K A;  2B9R A;  4F6W B;  3DDQ B;  1H24 B;  3EJ1 B;  3BHU B;  1D3U B;  1H27 B;  4CFN B;  4EOJ B;  2PK2 A;  4OGR B;  2CCI B;  3BLR B;  2C6T B;  2WPA B;  1GUX B;  1VOL A;  5FGK B;  5ACB A;  4UN0 A;  4YOZ A;  3MY1 B;  1G3N C;  4BCO B;  1GY3 B;  4BCM D;  4EOK B;  2WEV B;  3BLH B;  4BCJ B;  1OIU B;  2C5N B;  5I5Z B;  3TNH B;  1TFB A;  3H4C A;  4F6U B;  5IDP B;  4F6S B;  1OL1 B;  3BLQ B;  4CFM B;  3MI9 B;  4BCH B;  1H1R B;  4F7S B;  1N4M A;  1OKW B;  5HBE B;  2UZB B;  1VYW B;  4BCI B;  1H1P B;  4KRD B;  3O0G D;  1OKV B;  4EOI B;  2PK9 B;  1H28 B;  4BCG B;  4EC8 B;  3BHT B;  4I3Z B;  4YC3 B;  1AD6 A;  2W2H A;  2JGZ B;  3DOG B;  4BCQ B;  4BCN B;  4F7N B;  4BCK B;  2UZD B;  4BCF B;  2EUF A;  4EOQ B;  5HBJ B;  2W9F A;  3QHW B;  2C4G B;  1H25 B;  1FVV B;  2UZL B;  4FX3 B;  4EOP B;  1VIN A;  4EOM B;  2V22 B;  2IW9 B;  1OI9 B;  4Y72 B;  4F70 B;  4ELL A;  2QDJ A;  1UNG D;  2C5X B;  2WFY B;  2WMB B;  3TN8 B;  4CFV B;  1KXU A;  2X1N B;  3QHR B;  4CRL B;  4ROC A;  5HVY B;  1PKD B;  4ROE A;  5IDN B;  4EOL B;  5CEI B;  3LQ5 B;  4CFW B;  1F5Q B;  2IW6 B;  1O9K B;  4G6L B;  5HQ0 B;  4CFU B;  3RGF B;  3TNI B;  2CCH B;  1XO2 A;  4ELJ A;  1GH6 B;  1QMZ B;  4EOO B;  2WIH B;  2WIP B;  5HBH B;  4EOS B;  4TTH A;  1GUX A;  5CYI B;  2IVX A;  1H1Q B;  4CXA B;  1FIN B;  1UNH D;  2F2C A;  3F5X B;  5L2W B;  1UNL D;  2G9X B;  1E9H B;  2CJM B;  2R7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...