The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
68
|
structure length |
68
|
Chain Sequence |
GSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Toxin/toxin inhibitor
|
| molecule keywords |
Antitoxin RelB
|
| publication title |
The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity.
pubmed doi rcsb |
| source organism |
Escherichia coli
|
| total genus |
19
|
| structure length |
68
|
| sequence length |
68
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2012-07-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04221 | RelB | RelB antitoxin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Met repressor-like |
#chains in the Genus database with same CATH superfamily 2JXI A; 3QOQ A; 4FXE A; 2BNW A; 2WVF A; 1U9P A; 2K29 A; 2BJ9 A; 2AY0 A; 2HZA A; 2CA9 A; 2BNZ A; 1MYK A; 2WVE A; 2H1O E; 1ARR A; 3LGH A; 2K6L A; 1IRQ A; 1BDT A; 2K5J A; 4ME7 E; 3VW4 A; 2BJ1 A; 3FT7 A; 1QTG A; 1Q5V A; 2K9I A; 1NLA A; 4HV0 A; 3FMT A; 2RBF A; 3VEB A; 2HZV A; 1MNT A; 2KEL A; 2WVB A; 3GXQ A; 1B28 A; 2BJ3 A; 2K1O A; 2WVD A; 3OD2 A; 2CAJ A; 2BJ8 A; 2CAX A; 1EA4 A; 1ARQ A; 2JXG A; 1BAZ A; 1X93 A; 1P94 A; 1BDV A; 2WVC A; 2BJ7 A; 2JXH A; 1MYL A; 2GPE A; 2BA3 A; 3H87 C; 2CAD A; 4D8J A; 3VEA A; 1PAR A; 2BSQ E; 1B01 A; 2CPG A; #chains in the Genus database with same CATH topology 2BNW A; 4O4R A; 1SIW A; 2AY0 A; 2WVE A; 1BDT A; 4LRV A; 2B43 A; 3NO7 A; 1QTG A; 4HV0 A; 3G5O A; 1NLA A; 2HZV A; 1MNT A; 3UR0 A; 3H5Y A; 2WVB A; 2CAJ A; 2BJ8 A; 1BAZ A; 1BDV A; 2H3A A; 3NNE A; 2CKW A; 2JXH A; 2GPE A; 3VEA A; 3QOQ A; 4FXE A; 3QID A; 2K29 A; 3IR7 A; 4NRT A; 1ARR A; 2K5J A; 3BSN A; 1OHN A; 3VEB A; 3SFU A; 1B28 A; 2KKE A; 2ADL A; 1X93 A; 2KOE A; 2BSQ E; 1B01 A; 3VW4 A; 2CPG A; 4NRU A; 1U9P A; 3BSO A; 2AN7 A; 2BJ9 A; 2WK4 A; 1IRQ A; 4ME7 E; 2BJ1 A; 1Q5V A; 2K9I A; 3FMT A; 2RBF A; 2Q2K A; 3GXQ A; 2K1O A; 3NAI A; 4LQ9 A; 1P94 A; 2WVC A; 3H87 C; 2UUW A; 2CAD A; 3LJP A; 4D8J A; 3NAH A; 1SH3 A; 1Q16 A; 2JXI A; 2A2B A; 2WVF A; 4MJW A; 3SFG A; 1SH0 A; 2HZA A; 2CA9 A; 2BNZ A; 1MYK A; 2H1O E; 3H5X A; 3LGH A; 1SH2 A; 2K6L A; 4LQ3 A; 2JBV A; 3FT7 A; 1OG7 A; 2KEL A; 2BJ3 A; 2WVD A; 3OD2 A; 2CAX A; 1EA4 A; 1ARQ A; 2JXG A; 3UQS A; 4QPX A; 2BJ7 A; 1MYL A; 2BA3 A; 2UUT A; 4AAI A; 1PAR A; 3UPF A; #chains in the Genus database with same CATH homology 2JXI A; 3QOQ A; 4FXE A; 2BNW A; 2WVF A; 1U9P A; 2K29 A; 2BJ9 A; 2AY0 A; 2HZA A; 2CA9 A; 2BNZ A; 1MYK A; 2WVE A; 2H1O E; 1ARR A; 3LGH A; 2K6L A; 1IRQ A; 1BDT A; 2K5J A; 4ME7 E; 3VW4 A; 2BJ1 A; 3FT7 A; 1QTG A; 1Q5V A; 2K9I A; 1NLA A; 4HV0 A; 3FMT A; 2RBF A; 3VEB A; 2HZV A; 1MNT A; 2KEL A; 2WVB A; 3GXQ A; 1B28 A; 2BJ3 A; 2K1O A; 2WVD A; 3OD2 A; 2CAJ A; 2BJ8 A; 2CAX A; 1EA4 A; 1ARQ A; 2JXG A; 1BAZ A; 1X93 A; 1P94 A; 1BDV A; 2WVC A; 2BJ7 A; 2JXH A; 1MYL A; 2GPE A; 2BA3 A; 3H87 C; 2CAD A; 4D8J A; 3VEA A; 1PAR A; 2BSQ E; 1B01 A; 2CPG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
