4FXEA

Crystal structure of the intact e. coli relbe toxin-antitoxin complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
GSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
molecule keywords Antitoxin RelB
total genus 19
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04221 RelB RelB antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 4fxeA00
2WVFA 1X93A 2H1OE 2HZAA 2WVBA 2KELA 3H87C 3LGHA 2CAXA 2K6LA 4ME7E 1BDVA 1BDTA 2JXIA 1PARA 2BNZA 1NLAA 2BJ7A 3GXQA 2WVDA 3VW4A 1MYKA 4FXEA 2BNWA 1MYLA 2BJ3A 3FT7A 4HV0A 1EA4A 3VEBA 3OD2A 1B01A 2CADA 1U9PA 3FMTA 2CAJA 2JXHA 1IRQA 2BJ8A 2CPGA 2K1OA 2K29A 2GPEA 1QTGA 2BJ1A 2CA9A 1ARRA 1P94A 2K5JA 2K9IA 2JXGA 2BJ9A 2WVEA 2BSQE 2HZVA 3VEAA 1B28A 1MNTA 1Q5VA 2WVCA 2BA3A 2AY0A 4D8JA 1ARQA 3QOQA 1BAZA 2RBFA
chains in the Genus database with same CATH superfamily
4NRTA 2A2BA 1BDVA 2BNZA 1SH0A 2JBVA 1MYKA 4FXEA 3FT7A 3UQSA 3VEBA 3LJPA 1QTGA 2WVEA 2JXGA 2BJ9A 4LRVA 1SIWA 1B28A 1MNTA 2BA3A 4D8JA 3G5OA 1X93A 2KOEA 2KELA 3SFGA 2Q2KA 2JXIA 2UUWA 1PARA 2AN7A 3GXQA 1SH2A 3H5YA 2BNWA 1Q16A 3IR7A 1U9PA 2CAJA 3NO7A 2JXHA 3H5XA 2BJ1A 2CA9A 2K9IA 1P94A 3UPFA 3VEAA 3QOQA 2WVCA 4MJWA 4AAIA 2AY0A 1ARQA 1OHNA 2RBFA 2WVFA 2HZAA 2WVBA 4ME7E 3NNEA 1NLAA 2WVDA 2UUTA 2B43A 4HV0A 1B01A 2ADLA 3FMTA 2CPGA 4O4RA 3UR0A 3QIDA 1ARRA 2K5JA 4QPXA 1Q5VA 1SH3A 1BAZA 3VW4A 2H1OE 3H87C 3LGHA 2CKWA 2KKEA 2CAXA 2K6LA 2BJ7A 4NRUA 3BSOA 3BSNA 1MYLA 2BJ3A 1EA4A 3SFUA 3OD2A 4LQ3A 2CADA 1OG7A 2WK4A 1IRQA 2BJ8A 2K1OA 2K29A 2H3AA 2GPEA 2HZVA 2BSQE 3NAHA 3NAIA 1BDTA 4LQ9A
chains in the Genus database with same CATH topology
2WVFA 1X93A 2H1OE 2HZAA 2WVBA 2KELA 3H87C 3LGHA 2CAXA 2K6LA 4ME7E 1BDVA 1BDTA 2JXIA 1PARA 2BNZA 1NLAA 2BJ7A 3GXQA 2WVDA 3VW4A 1MYKA 4FXEA 2BNWA 1MYLA 2BJ3A 3FT7A 4HV0A 1EA4A 3VEBA 3OD2A 1B01A 2CADA 1U9PA 3FMTA 2CAJA 2JXHA 1IRQA 2BJ8A 2CPGA 2K1OA 2K29A 2GPEA 1QTGA 2BJ1A 2CA9A 1ARRA 1P94A 2K5JA 2K9IA 2JXGA 2BJ9A 2WVEA 2BSQE 2HZVA 3VEAA 1B28A 1MNTA 1Q5VA 2WVCA 2BA3A 2AY0A 4D8JA 1ARQA 3QOQA 1BAZA 2RBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVF A;  1X93 A;  2H1O E;  2HZA A;  2WVB A;  2KEL A;  3H87 C;  3LGH A;  2CAX A;  2K6L A;  4ME7 E;  1BDV A;  1BDT A;  2JXI A;  1PAR A;  2BNZ A;  1NLA A;  2BJ7 A;  3GXQ A;  2WVD A;  3VW4 A;  1MYK A;  4FXE A;  2BNW A;  1MYL A;  2BJ3 A;  3FT7 A;  4HV0 A;  1EA4 A;  3VEB A;  3OD2 A;  1B01 A;  2CAD A;  1U9P A;  3FMT A;  2CAJ A;  2JXH A;  1IRQ A;  2BJ8 A;  2CPG A;  2K1O A;  2K29 A;  2GPE A;  1QTG A;  2BJ1 A;  2CA9 A;  1ARR A;  1P94 A;  2K5J A;  2K9I A;  2JXG A;  2BJ9 A;  2WVE A;  2BSQ E;  2HZV A;  3VEA A;  1B28 A;  1MNT A;  1Q5V A;  2WVC A;  2BA3 A;  2AY0 A;  4D8J A;  1ARQ A;  3QOQ A;  1BAZ A;  2RBF A; 
#chains in the Genus database with same CATH topology
 4NRT A;  2A2B A;  1BDV A;  2BNZ A;  1SH0 A;  2JBV A;  1MYK A;  4FXE A;  3FT7 A;  3UQS A;  3VEB A;  3LJP A;  1QTG A;  2WVE A;  2JXG A;  2BJ9 A;  4LRV A;  1SIW A;  1B28 A;  1MNT A;  2BA3 A;  4D8J A;  3G5O A;  1X93 A;  2KOE A;  2KEL A;  3SFG A;  2Q2K A;  2JXI A;  2UUW A;  1PAR A;  2AN7 A;  3GXQ A;  1SH2 A;  3H5Y A;  2BNW A;  1Q16 A;  3IR7 A;  1U9P A;  2CAJ A;  3NO7 A;  2JXH A;  3H5X A;  2BJ1 A;  2CA9 A;  2K9I A;  1P94 A;  3UPF A;  3VEA A;  3QOQ A;  2WVC A;  4MJW A;  4AAI A;  2AY0 A;  1ARQ A;  1OHN A;  2RBF A;  2WVF A;  2HZA A;  2WVB A;  4ME7 E;  3NNE A;  1NLA A;  2WVD A;  2UUT A;  2B43 A;  4HV0 A;  1B01 A;  2ADL A;  3FMT A;  2CPG A;  4O4R A;  3UR0 A;  3QID A;  1ARR A;  2K5J A;  4QPX A;  1Q5V A;  1SH3 A;  1BAZ A;  3VW4 A;  2H1O E;  3H87 C;  3LGH A;  2CKW A;  2KKE A;  2CAX A;  2K6L A;  2BJ7 A;  4NRU A;  3BSO A;  3BSN A;  1MYL A;  2BJ3 A;  1EA4 A;  3SFU A;  3OD2 A;  4LQ3 A;  2CAD A;  1OG7 A;  2WK4 A;  1IRQ A;  2BJ8 A;  2K1O A;  2K29 A;  2H3A A;  2GPE A;  2HZV A;  2BSQ E;  3NAH A;  3NAI A;  1BDT A;  4LQ9 A; 
#chains in the Genus database with same CATH homology
 2WVF A;  1X93 A;  2H1O E;  2HZA A;  2WVB A;  2KEL A;  3H87 C;  3LGH A;  2CAX A;  2K6L A;  4ME7 E;  1BDV A;  1BDT A;  2JXI A;  1PAR A;  2BNZ A;  1NLA A;  2BJ7 A;  3GXQ A;  2WVD A;  3VW4 A;  1MYK A;  4FXE A;  2BNW A;  1MYL A;  2BJ3 A;  3FT7 A;  4HV0 A;  1EA4 A;  3VEB A;  3OD2 A;  1B01 A;  2CAD A;  1U9P A;  3FMT A;  2CAJ A;  2JXH A;  1IRQ A;  2BJ8 A;  2CPG A;  2K1O A;  2K29 A;  2GPE A;  1QTG A;  2BJ1 A;  2CA9 A;  1ARR A;  1P94 A;  2K5J A;  2K9I A;  2JXG A;  2BJ9 A;  2WVE A;  2BSQ E;  2HZV A;  3VEA A;  1B28 A;  1MNT A;  1Q5V A;  2WVC A;  2BA3 A;  2AY0 A;  4D8J A;  1ARQ A;  3QOQ A;  1BAZ A;  2RBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...