4FXGB

Complement c4 in complex with masp-2
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
739
structure length
738
Chain Sequence
VNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Complement C4 beta chain
total genus 176
structure length 738
sequence length 739
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.30 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4fxgB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxgB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxgB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxgB04
5HDOA 3F7YA 1A7PH 1I8IB 3RUGA 4XP4L 2GCYB 2PETA 2PR4L 3MXWH 4CMMA 1DBMH 1RZKH 4ZUVB 2V7HA 2NY5L 2NZIA 2QJDA 3BKCH 4FXLA 2IAMB 5GJSL 2IPKA 2H2SD 3RBGA 1HHGA 3GNML 2HKFL 2MNUA 4OFDA 1JHLL 1J1XL 3ARDB 4HUWB 3MV8B 4PLJD 2FH8A 1A0QH 2ZOKB 4HWBA 1JWUA 2WK2A 3PV6A 4OM0H 4KMLB 5ICZB 1UGNA 4RZCB 4YUEL 32C2A 5F44A 4YHNB 3QDHA 1TN6B 3FZUD 1VFUA 2D03L 2YN5A 2GSGB 1KTDA 4WU7B 5CZXD 3QCVH 2VB5A 3CLFH 4U05A 1NI1B 5CWSB 3LKSA 1GHQA 1OY3B 4JG0H 4UU9A 4LIQH 4Y4KA 3T2NH 5IEKB 2RQ8A 2I27N 5E4IA 1INQB 5CLWA 5I15L 4LP5A 3FRUA 1H3BA 3CXDL 4R7NA 2Z31D 1EGJL 1QFWL 3ZHDA 3KLHD 5F6IC 4Z7VA 2PN5A 1QFUL 3OR6A 3QR2A 3FQWB 5EO1A 3CH1A 5IMLB 2YK1H 2OR7A 3HE6D 4M1CD 1QTYT 1A4KB 2FX9L 2X4SA 3FCTB 4OZIE 3VD7A 4I5BA 4XPAL 3QHTC 5GS2D 4ONGH 4EOWH 3PIQB 1WF5A 5E00A 3V0AC 5KZCB 4AEHH 4QHNA 1JRHI 4F9PA 4PJBA 4ONGL 2X2YA 4EOWL 4OGXL 1J12A 3T0EC 5IEHA 1FVEB 3L5XL 1ODAA 3SN6N 1SEQL 4OFIA 1WK0A 1IGMH 3RNKB 5FO8A 1AFVH 3RDTD 4XWOD 4GH7B 4YHYC 1MJ8H 2JCCA 5ADPH 2JCCB 1Y0LB 1ED3A 3RWEB 1ULVA 3U30B 3O2DL 4XBEL 4V1DD 4JJHA 3CXDH 4XH2A 5FYKU 3C60C 5CHNB 4YXLH 1T5WB 3FFCB 2FZ3A 1O79A 3I75B 1SEBA 5IIEB 3U46B 2FHFA 1WUNT 2PW1B 2R1XB 3PZ1B 4N0FB 1U91B 4K3JH 4KK9C 3ZT6A 4OAWB 3VGBA 4C55A 4Y0GA 1A7BA 4GOSA 4GS7C 3LIZL 3I2CH 3V4UH 5EUKA 3DRAB 1FFNA 4PJBE 4M1GL 5FKAA 1BFOB 1QR1A 4RBPK 4P3DB 3TESA 4HV8B 5EORL 4KMTL 1JE6A 3QUXA 3L5IA 3T2PA 3O3DA 2Y5TA 3SEPA 4X98B 4J1UB 4YLQT 5HTSA 3QDME 1DBML 2FRGP 2XV6B 3MLTB 5L6YL 3FZUC 4R7NB 2A83B 2C4XA 1S3KH 2VXSL 3JV4A 4NIKB 1A9EB 2NXYC 1M7DB 5FHBL 4HIHB 4K7FA 3E2HC 5MERB 5ESQA 5TFSH 5B38G 3LS5H 3BDYH 4YPGA 1H5BC 4R97C 4KJPC 2P42B 1AR1C 2YD1A 3P0VL 4HJ0D 4YHML 4FTVB 1H15B 3F7PC 1NJ9B 1GGIH 4GSDL 3O11A 3C72B 3JSSA 2A74B 3RKDD 1X5JA 5KVFL 1FNLA 1Q72L 3SGEI 1G9MC 4N0UE 5HD8D 3MRMB 3NCYP 3QWRA 3RPKA 1QEWB 1D9KB 2XWBB 1A1NA 1MRFL 3TIEB 2OXGA 4FQLH 3EUUA 2HRLA 4NRZB 5FYJD 4JREB 2QSCL 4MA3A 4NHUA 1KCRH 2AEPL 4CDGC 5FCSH 3ZT7A 3F7YB 5C07B 3MXVL 2JIXB 1QFHA 1JGDB 4W6YB 3TVMB 5CJXC 4Z7UF 3B9KD 2DTMH 2EE6A 5EBWB 3T77B 1BJ1J 3V6ZA 4KKLD 1FO0L 1M7XA 3HMWL 3MOAH 2DF3A 2PTUA 2Z4QB 1KG0A 1SMAA 1KNOA 3BVNB 4NQSA 5BOPA 3OKMA 4WW2F 4LEXH 3JWDC 4R4FL 2H3NB 4KKBD 1N6QL 4NPYB 2P4AB 3QCTL 3VRJA 1FNGB 5GSRA 5TJWK 4YAQA 4OCLC 4LLWA 1ZA3B 1INEH 3TBWB 5B3JE 3U1SH 1RZIB 2F53B 1NL0L 2AEQH 3TFKC 4L4VE 1HKFA 3P4NB 3O6LL 4ZRPA 3U6RB 1IEHA 1G7PA 2HYMA 1QQDB 3IGAA 1EXUB 3E6FA 1MFCH 3BPCB 5DJXB 4JO2H 1DUZA 5I15H 5GHWL 3NH7L 4N9GA 4KXZH 5L7XH 1CLYH 3QYCA 2F54B 4JO4H 1XF4A 3RX5A 4R7DA 1C5CL 4LHJB 1WAAE 5DVLA 1EK3A 4U0RC 4HXBH 1N5YL 2WUBH 1OM3L 3BMWA 3RVXD 1KPVA 5LJYH 4KI5F 4N0UA 4BUGA 1C8PA 4JRXD 3KNBB 1CZ8H 5FHAL 4BQ6A 2FX7H 1QZ1A 2WWKO 1R3IL 3X3FL 1M6OA 3VXRA 3MMEA 5KVGH 1U8LA 2ADIA 1DE4A 4KTYA 4XNYH 2XYCA 3TN0B 3B9KA 2EH7H 4OD2A 4LLDB 1OSPH 4KKAC 4XNUL 1OHQA 4E5XA 4GAYB 1F97A 4WO4D 3RHWK 3WNLA 2DN7A 4Z7VE 1ZHNA 3OKEA 2EH8L 1RZKC 3HG1E 3C5ZA 5FF6A 4FQCL 5T1LA 1LEKA 1KPRB 1Z9OA 5EUOE 5D72L 4P48A 3SDXF 5T3XL 5F8RC 2QQNL 4N9OB 3KSLB 2HP4A 1YQ2A 5AAWA 1NGYB 4JHBA 1AHWB 1PZUB 5HJ3B 4L8SB 5L2KE 2Y7QA 3I9GL 1P7QB 2ADGB 2NY6D 1U8KA 4IS6A 4J3SA 4Z95L 1LO2H 4KVCH 5HHQA 4NKQB 2O5XH 4DTGH 1BVLB 5F7HA 1M6OB 4ZFFB 1MH5B 1CF8H 2NW3B 3EGSA 1T83A 3TBTB 4NO5A 4OJFL 3AM8C 1UG9A 4L8CB 1CD0A 1EIBA 4PJCE 1FZJA 3SGEH 4R96B 1HZHH 1YEEH 5IFJB 4X7FC 5I19L 3OPZH 1PSKL 3FB8A 3U9PL 5IR1B 4ETQA 5KSAB 1YYLH 5I1HH 1BPVA 1UEYA 2HLFD 2WBJC 2D4DA 1MOEA 3MJ7A 1O7SA 3QUYB 4GTQB 1C5CH 3KPSE 4L3AA 1EXUA 5DJ6A 1G0DA 1EFXA 1FVDA 3O4OC 4WENB 5D7LD 4GTPB 1FAIL 4MCYB 5IBLC 3QEGH 2V5RA 4ELMB 2BOCA 1RK0A 2VKWA 4KUCD 4X6BB 5GQBA 1I9JL 4PJGE 1G9MH 2J6EH 4XAWL 1IRAY 3H0TA 3SO5A 3P0YL 2CJUH 3CMOL 4BSWB 1U36A 1KJ3L 2Q76A 2W60B 4U1LA 3KR3L 5HVWA 3DUHA 2W9EH 4YDVB 1ZTXL 5FKPB 4R26L 2XOTA 3DUSA 3WL9B 1PD6A 3LV3B 2WQ8A 4NQSB 4BK5A 4Z95H 2G5BA 4P59H 3E3QE 3PP4H 3C5ZC 1N3NA 4UQ2B 1S7VA 1X3DA 3WS6C 4LCUB 5C0AD 5ENWB 4LPUA 3FKUS 4APQA 1YEFH 1I1AB 2F5BL 2APFA 2MQ3A 2QQNH 1OTSC 3ALXA 4Z7NE 4YC2C 4NJAH 4GG6E 2DQCL 2OJZL 3KXFE 1PW3A 3OKLB 4P2QD 4XMLH 4ZMAT 2W0KA 3EOAB 1L0YA 4G8IA 4PJIB 5AEAA 5SX5H 3ZKNC 3MNWA 4PJHF 5SWSB 4C4KO 1T0MA 1U8IA 4U3CA 4MSWA 3WXVL 3IF1A 1YEDA 5DEFA 5C0EA 5J6HB 2I60H 5J11B 4PJ5A 3WFDL 2IPTL 1XGTA 4X6CB 3V95A 2VL5A 1LDPH 3DIFA 1HNGA 5T1LD 4KVCL 4Y19E 4EI5B 3DX6B 1HILA 3PL6B 1GOGA 5AGDA 2VDQH 1ZSDB 4PLKD 4DN4L 5JDSB 5C0FB 1YPZF 2D2OA 3O4LB 5JORA 3AAZA 1U93B 3HZVA 2R4RH 4OLYH 1XCTA 1JPSH 5IK3A 3QUZC 1LP9A 2D0GA 3MLTA 3VCLB 1BIIB 3F12B 3J8F7 4CADB 4FQCH 1LEGA 1TJIH 3P11L 3ULVF 1GGCH 4Y5YC 2Y72A 3I50L 1ACYH 3MA9L 5DVOA 1UZ6E 1RAMA 2UWEA 3VWJD 1RZFH 3GI9L 2JLLA 5SWQA 4BZYA 3D85A 2M2DA 5EUKB 2XZAH 4Y8DC 1HOCA 2PXYD 3V6BR 1XIWA 4PRHD 2Q8BH 4D4DA 1PG7W 1OWWA 3WE6A 4APQD 2SEBA 4QRTA 3OX8B 4WW1B 1MAKA 1U91A 1AQDA 1ZLVH 5F7EH 1T80A 1A1OB 3BQUD 2ZCHL 4H20L 4LLUA 1T21B 2VLKB 4JZOA 4BFBD 3AREB 3FFCA 3I75A 4R4FH 1XF1A 3PWUA 3HPJB 4CKVX 4OF3A 3O45A 1J05B 1CI5A 2ORBL 3LRHA 1LD8B 2IJ0C 5I8CA 4ZPTB 2O26U 1CFVH 3CZJA 2R69H 3QNXA 1WTLA 1D5BB 1MCOH 4X7TB 2P5WB 3U0PB 3PZ4B 3DI2B 3O6LH 2QEJA 3QIBC 3QFDB 5FECB 3NN8B 3MRIB 1JZ7A 2JCCF 3LKQA 5GRUL 4FQLL 2BNQE 4KI5C 3EYFB 4JKPH 4ZRQA 5IKCA 2CGRL 4KHXL 4LGSB 1RD6A 3GMRB 3NN8A 2JJVA 3UPCA 3R06B 3IFNH 2WQRA 4KFZC 4Q7DA 1YEIL 2GAZB 3VW3H 4MD5A 4R2GC 1FC1A 2WIIB 1H3GA 1HHHB 3QZWB 3VGAC 5DJ0B 4HJGA 1KTLB 3HNSL 4EN3A 1MVUA 2X6MA 1FAKT 2ERJB 4LNGB 1X6NA 5HHNA 3AS3A 5EOTA 5TGBB 5J9PA 1MCCA 3C60A 1S3KL 2VXSH 4J6RL 4Y4HA 1T6VN 1HYSC 1AQDB 4L8DA 2HVKA 2YR3A 4PP2A 1A2YA 3PV6B 2SEBB 3DYOA 5KANI 2ORBH 5E4EC 2FHBA 2B7DT 5DD5H 3IDYB 4GMSH 4M48H 3CFEA 3SCMB 5B8CA 1M7IA 1UWGH 4ONTA 2ICCA 3SDDB 2AXGA 4LKXA 4G9FA 4KK8D 3PDOB 3QA3B 4AEIL 1SY6H 3LN9A 1FZKB 2NOJA 4HGWB 3AMLA 1J86A 1S9XA 4WY7L 2BVQA 1TZHB 1C08A 3QUML 2QADB 5KSVA 5FOBB 4S10A 3TO2A 2Z92A 3UCRA 4Q0XH 4QRQB 1RZKL 3EU5B 1GXEA 1PG7L 2DB8A 1QSEA 2A9ML 2DDQL 2HFFA 1S5IH 1OP5K 1T04A 4FQ1H 5DHXB 1HKLL 3TH3T 1ZT7B 4JFHD 2PO6D 2R2HB 3V52H 5JOPE 3VJ6B 1E6JH 2FJHA 1FIGL 1RI8A 4PJAE 2DLEA 3ZHKA 4YX2H 4F7TA 2MQ0A 1INDH 4RFEB 1S5HA 3SFYB 5E7BA 4JEGB 1H3UA 4V1SA 3TCXA 2Z0BA 3QQ9D 3T0ED 2WIMA 4DN3H 4Y7MA 4QRRB 4X9IA 5CEXA 1W72B 1QBBA 1VFBA 4U4BA 4IRJD 1T0MB 4PTUA 2GSIB 3G6AA 5EC1A 1CWVA 3DVGA 3VFTB 1JCRB 3KG5A 1I7RB 4FQJH 3H9ZA 5TDOA 4D9LL 3FMGL 3SQCA 1K2DB 1K9TA 5KG9B 4JRXA 2IC2A 1HXMA 5FYKL 4RAVB 4ZXBB 5SV3A 3ECBB 1QRNE 3MRPB 3KYOA 5HYJA 2DQHL 3QDGD 1PVHA 2W91A 2BHZA 5CJXA 4ZUSB 1H0DA 5ISZE 3BRGC 2PO6A 4KKJA 3KLAA 5ENWA 1EGJH 1AKJA 1IZJA 3R8BB 5KS9B 4Z77A 2OTPA 2AXGB 1DUYA 3U4AA 4QT5A 5JPMA 4PUBL 6FABH 1BF8A 1BQHA 2J3SA 1H3TA 3VWKC 3EFFA 3BZ4B 4JG0L 3T2NL 4XPBH 3MRNB 4UT7H 4JZJB 4OKVB 4ODVL 2WUCL 3WL9A 4YE4L 3EOYG 1CFBA 5E8DL 1U8OB 4JFFB 3ARGC 3O9WB 4FQ2H 3MRCB 1F3JA 4U3HA 1BVKA 1XH3A 3C6LB 2BB6A 1CICD 2VDKL 1XCQB 3QDAA 4M7JL 3V6OE 5IG7A 1SA4B 4NZJA 4RGMC 3ROOA 4R26H 1O7VA 4ONHB 5D1QB 4JFYB 3E6HB 3LKOA 3UTSD 1KCKA 2W9EL 1KCLA 4XXDB 2GK2A 4XVSH 3VXMD 1PQZB 4HC1H 3UTSE 5HYFA 4EXPX 1A7PL 3FQXA 3B2VL 1EH9A 3PL6C 3UYOD 3NACL 2DWEA 4WI4A 4KTEL 3GI8H 3GMRA 5GGUA 5IKCB 4HIJA 4WNQB 4D8PA 3EYFA 1AGCA 5EU5B 3O2VL 4OF8A 3LEXA 2NX5A 4ZSOE 2ZKHL 3JTTB 3P77B 1DBBH 4PJDF 4G8EB 4ZFGH 4HS6A 4LHQB 3K3QA 4BSJA 1R5WB 4ZAKA 1QVOA 4PV9B 1WBYA 3NCJH 1TPXB 2ZSVA 3CIQA 4MDJB 4GG6F 3A0OA 4UUJA 1UWEH 1JPGA 2EICA 3S36H 2J88H 2DJUA 2L4OA 4MVBC 1LO3H 5EU6E 4YXKH 3VXRD 4BZ1H 4P46B 1P7KB 2HKFH 4QXUH 3F58H 4UQ3B 3SKOA 4ZPTA 3VW3L 3HZMB 4P99A 4Q9RH 5D7LB 5IVOA 4KAQH 2VMFA 5FYJE 4M6AA 4Z76B 5D2LA 4YBLB 4LNRA 2EDWA 4LSUH 2MQCA 1ZLVK 1UM5H 1N2RB 4XNXH 4XPFL 1MF2H 5B38A 4KZEL 1KJ2H 3KWWA 5FA3B 1KCSH 4MA1C 1HOCB 3BP5B 4DKAA 4GAGH 5DK0B 5EG6C 5I1LA 5IT2H 2RB8A 2EC8A 5JQHC 2XKUA 2EH8H 1MCKA 2IADB 1FZOA 4WDIB 5ETUA 3IDIA 4LLMB 5AUMA 4BA8A 1I4FA 2VWEE 1F4XL 1QSEB 3C60D 1P7QD 1XZ0B 2E7LC 3LEYH 1MQKH 3VD5A 4WEUD 2H9GA 3ULVE 1KXVC 1V3JA 3B3IB 4X5XA 5MP6H 1HQ4A 3RDTC 1DUZB 2QADC 5F9OL 1HILB 3PL6A 4DZ8B 1UJTA 3LZFL 3OAZH 4DZBB 5ESVA 3SOBH 3FOMB 4NUJB 3VXOB 1DEEA 4KVNH 3MV11 1XGTB 4JO4L 1A6UH 3UTTA 4O2EA 3Q1SH 2V8JA 1B0GB 5DWUH 5T5FL 5DHVA 4U6YB 1YEFL 4WHYG 4W4OC 3TBWA 5JUEL 4JO3L 2FWOB 3B6SA 4ZODA 2OP4H 1XAUA 1JCQB 2BP3A 4IOIA 4UINH 5IGXL 3S5LA 3PQYD 4F7MA 5ILTL 4HKJB 1DLHB 2LVEA 5I1IL 5D2LF 4GKOA 3H9SB 4H0IA 1DQQB 4PY7A 5DXWA 3D18B 3STLA 5E2WH 3CVHA 4MNGE 3BJLA 2BNRA 4MJIB 5DLML 2YA2A 2X4RB 3MNZB 2NY6B 3CVHH 5HGDB 1ZS8B 1P4BH 3LKPA 1EAJA 2CUMA 2XRAH 5MENA 3EYUH 3V4VH 1NLDH 4QXTB 5CILL 3QEGL 1RMFL 1A6VH 3MOAL 5I17A 4RWYH 3HC0A 4NFBA 4QEGA 5C07A 3THMH 3LD8B 1N8ZA 2RFXB 3QFDA 3AU1B 4I3RH 3REWA 4O2CA 5DI8B 5LGKA 3WIHL 4JANB 1MNUL 5K9QG 2PCPA 1FIEA 3VD9A 2NY3B 3QDJE 3OJMB 3ZMRA 4CVXB 2F5BH 3PHSA 1T1XA 3S9DB 5CZKA 1MFDL 1WV7T 3GGWB 5I1AA 5IVXE 1HZHL 4G6ML 1XGRB 3O2WH 3UJTH 1KCUH 4OF6A 2R0KH 3MJ6A 4R8WH 4P57B 3GJFB 2DIBA 3QUYA 3QXAA 3S3JA 2R0LL 4NQVB 2VLJE 3OG6B 2J6EA 5TQ2H 3QEQD 2Z31C 1T1ZA 2HKHH 3GRWL 1OT2A 3ARFD 4KK5C 4ZUTB 5KJRL 4NKMB 3D85B 3OAYK 3VDAA 2W65A 4XGZB 5L88H 3CMOH 3MPCA 3U4BH 3P0YH 2OX5A 3RY5A 5IGXH 5ICYB 3WFEH 3FB5A 1UKTA 2VXVL 1FQ9C 1HHIB 5IJKA 4ODUB 5F7LB 4HV8A 1MWAA 2ID5A 4MJ4A 1BFOA 4I3SL 1P7QA 5FKAB 2BSRA 2J8UF 4NDMB 2O93L 3I6LE 1S7WA 1MLCA 1VENA 3MCG1 4NRYA 4PJ9D 1CD1A 3VFGH 4XVUD 4ZOEA 2BFVH 1IKFH 4KVNL 2PKDA 3L95B 1A7QH 1I3GH 2E6PA 3G08B 5KVEH 4M5ZH 2YBRA 3BPOB 3GSNB 3S88L 1LO0L 1LEKB 3MUZ1 4U1NA 1FYTD 4AIZA 4JFED 2DBLL 2CUIA 4TULH 3V4PH 4POZD 4QYOB 2VL5B 3S4SG 5EUOF 4N8CH 5DMGD 2VC2H 3R8QA 1IGFH 4Y89A 4EEEA 5D96B 3OMZA 2N4IA 5DYOA 2BY0A 3IF1B 1F58H 3IU4H 4MQXD 2WP3T 3TN0A 4J4PD 3UAJD 5D7KE 1FNFA 4Q6YA 4PJFE 5DD3L 3TJHC 5C0RL 3MNWB 1H8NA 1S78D 4JRWA 2AK4B 4S1QL 4HD9A 4PGZA 1S7TA 4XCNB 1H3XA 2CKNA 3QIBA 1BD2A 5H2BA 4PRDB 5MEQB 3RL1B 1T4KA 3IFLH 1U58B 4FQQB 4LLQB 1UH4A 1I1AA 3N0PB 3VXTA 5DD6B 1H8SA 3PZ2B 4Y5YB 3OXRB 2EDKA 5F70A 1NFIB 4YWGL 5IVZB 1I7UA 3B9VA 3VXUD 4AEHL 4WO4C 3Q7AB 3QCTH 3MRDA 4KQ3L 3BP6B 3HRPA 1G7IB 3A6BL 3DXAE 3MR9A 5TF0A 5JIKA 3GJFK 1C5BL 3ZDYF 3BRFA 2EIZB 2J8UB 4KROC 3L3DA 4XWOC 3ZDYE 4BZ1L 4YDVA 5IEKA 3C2SA 4QRUB 4GTTB 2AJVH 4GUPA 5F7KC 1BLNA 4LCYA 1T0PB 3QFJE 1RU9L 2GJ6D 4PBVC 5CKAA 3OJDA 2H6PA 4Y4HC 1FNGA 5DZOA 3QIWB 5GXBB 4L4TB 3LB6D 1UENA 4U6XA 5D6CB 4UT6H 5HBBA 3BPLB 3R1GL 2HTLC 1CLYL 1IFHH 1IL1B 1T7XA 2B2XH 1EFXD 1PYWA 5FDWB 5B8CC 3CFKB 2VR9A 4HEPG 4IMKC 5DC0A 3N1FC 1XGPB 4HUMB 4P2RA 1OOAA 3VFMA 3NA9L 5BZDB 4I3GA 3QUZD 2NY1C 1FE8H 1W6KA 3RVVC 3IDXH 3ZKSD 4EIGB 4ZO6A 4JM2C 3HZYA 1U8HB 4C4KT 1EHNA 2XY2A 1I8IA 1HH6B 4HS8H 4AMKH 4PY8J 1JGVL 4QOKD 3BYTA 5EWIH 1JGLH 3GMOA 4HJJH 4NRZA 4ZS6D 3ZDXE 4OV5B 1KYOJ 35C8L 3NCMA 1IGCH 4LVNC 1A1NB 3MRGB 3TIEA 2V2XA 1TPXC 3GMNB 2V2WB 3MJ8B 5J06A 4ZAKC 5FV1L 4PJCA 5FHBH 3MUJA 4RX4D 4C58B 4Z0XB 1Z9LA 2OTUB 2O61A 1SM3L 1HHKB 3M07A 2EO1A 3GHEH 5CLTA 3JWDL 1MRCL 4QLRA 1NJ9A 2EDTA 6FABL 4YIQB 1AXIB 2Y6SC 4X6DB 4NUGL 2Z8VC 3DUUB 1JZ6A 2NPLX 1S7UA 2AP2A 3LDBC 3P4LA 2JELH 4N0YH 4WUUD 4YNYA 1N64H 1IC4L 4RISL 4XP6L 4AENB 1NCNA 1G6RL 4YFEA 2CMRL 3L3JA 1EV2E 4HKXB 4NN6B 4MXVF 4LVHB 1FNSL 4S1SH 4ZG1A 1V7MH 4RMUA 3D9AH 2HMIC 4XMPH 5F3BA 5CEZE 1ZVHA 4IRZH 5FCUH 3EO9H 3QDJD 5DTFA 3RTQD 3QUXB 2PO6C 4XWGL 4JJ5A 1RPQA 1UH3A 3OBAA 5TDPA 3DVNB 2EO9A 3RJ3A 1T1YA 1T66C 1TENA 4OLVL 3TA3D 4NO0B 5ALBH 3GIVA 1CLCA 4U0RB 4NP4L 3FN3A 1TVBB 5JZ7C 2CSPA 1YA5A 1T1YB 5D5MA 2AJXL 4WGVB 4OLUH 4DVRL 1QLEH 5HYSG 1U8MA 2C7UB 4LLYB 4NQXA 1ORQB 1QQDA 1DQTA 3MBEB 1JK8A 4YDKH 4P9ML 1O6HA 1YY9D 3S6CA 4HWNA 1BBJB 1FG9C 5E1AB 4JFOB 5ACMA 5TQ0L 3BZFB 4L4JA 4QOKA 5EORH 5IUSA 5KS9F 3GSUB 3SKNB 1QUNA 3VG0L 2V5TA 1WZ1H 1TTUA 4H5SA 3PHOA 5IEHB 4TTDD 1RZ8B 4PJBB 3NA9H 4MCZB 4PLJC 3C09B 2W1NA 2A9NH 2CKBB 5E99H 2ADFH 1IQDB 1U8PB 2VIRA 2OTUA 4IHOA 5AYUH 5IESH 3QDMB 3CLFL 3VFOB 3QCVL 4J6RH 5IP4A 3KPSD 4A2LA 4E0RB 1U0QA 1CICC 2AABL 2BY3A 2VLRB 5EO1B 2A6KA 3HNVH 3RTQB 4ZDHA 3BPNB 4HXAH 5SX4I 4LPTA 3BHBA 1NGXA 3Q48A 5C09E 4H1LB 2ICWA 1X5LA 1RJZA 5I16B 3PP3H 1VEMA 3QIBD 4ZH1A 1INQA 3LQZB 3LQAL 4I0PD 4L9DA 2VXTH 3TV3H 2QHRL 5SWZB 5J6GA 4QY8A 5HI5C 1JPFA 2HT3D 4H8WL 1JNNL 1RV6X 5KSBF 1CFTA 1U6AL 1XGPA 3GK8L 1FH5H 3WJJA 3E8UL 1J5OL 3IT8D 1ZGLM 3BD4A 1EEZA 1JNLL 1IE5A 3CSPA 3VH8G 4OLXL 3T0VA 2XACC 3OB8A 2HAZA 3I6KB 4MLIA 5C07E 3KXFA 1MCOL 2V7HB 3MRHA 5DMIL 5SWZA 5E8NA 1BMGA 3RUGB 1M7DA 3T2OA 3UTOA 1IGYA 4NN6C 3L3DB 2ZSWA 1YMME 3K80A 4XTRC 5DHYA 1IM9B 1XR9A 2DQIH 4H1LA 4QHKJ 3MGOB 1U3JA 2VLJD 2AQ2A 4WI9A 5DR5H 4ZDHB 1XGUA 4Y16A 5DJCB 4ZTOH 2VZTA 5GISH 1LDSA 3RDTA 2AXFB 1FZMA 2IPUG 5BV7B 1Y18B 3FT3A 3MCLH 5F93C 3O0RH 3RZCA 4EI5D 2CKBL 3WO4B 3BEVA 1RHHA 3NOIA 4OQ1A 1JF6A 1T2QL 4UV4H 1IQDA 1WC7A 5DK2B 1T4KB 2OZ4H 3CFCH 1A22B 1RUMH 1NANH 2EDOA 1KZOB 4QHLB 1JFQH 3U7YL 4L4TD 4N0FA 3MV8D 4PJGA 2F53E 4W4OA 4HKBA 1VKXA 4CDHA 2BJMH 4M62L 3TN0D 4RQQB 5IIEA 4ZPVA 1QNZL 3VGFA 3GM8A 2DMCA 4CN6A 1WT5C 4CMHC 1CQKA 4NRXA 4IEFB 4WEBH 4UBDD 2NXYD 4YBHA 5F9WC 1OSZA 1MAMH 5CZVH 2HLAB 4RX4A 2W0LA 2YEZB 3IDNB 5GRJH 5LGHL 1NDMA 1DLFH 3WXWH 1DL7L 1NMCC 4F58L 1P4LA 2M1KA 2NY1B 3VXSD 1UM6H 2WM0A 2NY6C 4WTWA 1UJ3B 3SDAA 4LASL 3L95A 1OVZA 2L0DA 5K9QI 4NOBA 3UTZA 1DTUA 3ZE2F 4S11A 4NO0A 3DSSB 3BPLC 3TP4A 1MLCB 3OAYH 1FJ1B 4OTXL 3OZ9L 2G75B 4JJ5B 4XNZC 2XTJB 3T4YA 3L5HA 2Q3ZA 4R3SB 1FT1B 4LHUG 5EULV 3SDCD 5IBTH 2IH3B 5EZIH 5ICYA 4I3RL 2QKIB 2ARJA 5ID1B 2ERJC 4HKXA 5ACZB 1DR9A 4OQTL 4MYWB 4Q9QH 1T6WA 4K9EC 1QO3A 3TT1H 4PY8I 3FQUB 1DBKH 3UJJL 1FL6B 5EUOB 2JB6A 3OV6A 1RQ5A 1IQWL 2OR9H 2XZZA 4FQHA 2NW2B 2H32B 3N1MC 4DKFH 2APBA 2R23B 1KTDB 2E7BA 3QP3A 3BH9A 1QPXA 3GB7B 1ZOXA 2VDOH 4WHCA 4PRAB 5TE6L 3F7QA 3MV8A 4CNIB 4XVTL 2VUOA 4NQUA 2R1WA 5HYSB 2BVOB 3TVMD 3RPIA 3ULUD 4ALAH 4YHZL 1CFSA 3WXWL 3GSVB 2FD6H 5EU4B 1UM4L 5C07D 4QKXB 1N0XL 4K23L 4JVPA 2DQEH 3AU1A 3MSPA 3ZKMD 4AM0A 5CD5D 4ODBD 3C5ZD 2VISB 4HX1B 5ANMB 3PF2A 4XBPB 4FG6D 4XHJD 4CUCA 3KPOB 2X89A 1B4JH 3FHQA 1MWAH 4QXTA 1MHHA 3KPSB 1JWMB 1RUML 4BELD 4LSTH 1JFQL 3MLSH 4LQFL 5LCVL 5T5NF 1J1OL 4OV6F 1WVZA 2V17L 5DRXB 5HHOE 3DX8B 3VFMB 1IVLA 5CGMA 2VNCA 3O0RL 3ZYZA 1PSKH 3KDMB 1XF3A 3Q5OA 1WCQA 2GUOA 3QEHB 1TNNA 1YEEL 5CBAA 2E5EA 1GOFA 2WINA 5D71H 4HSQA 4Z5RA 3KHOA 4QTIH 4TPRH 3TNNB 1JGUL 1OP9A 1TJGH 2HH0L 4XC1H 2RGSA 4M43H 2QR0A 5C0GA 5I2IB 5JHDE 1BOYA 1CD8A 2CLRA 2Y07L 1OLZA 3X11B 4I18B 1FYHB 3AB0C 1DEEB 1MCNA 2QSQA 1I1AC 4HK3J 3BZEB 3I84A 1FFOA 4OCRL 1KJVB 4GG6B 4MU9A 3BO8B 4O4YH 3QXUA 1PY9A 2VLME 2E27H 5GRZA 1CGVA 2CLRB 2AV7B 2H9GB 3RL1A 5J11C 4KK6C 1NAMA 5SWSE 2CK0H 1A6PA 1E28B 4NZTH 3B5TA 4PJEB 1AI1L 5D1QD 3TIDB 4U6VL 3VD3A 3KLDA 4JM4L 1YEJL 1FZOB 4WI3A 3TNNA 2B4CC 4X8XA 3RHWF 15C8H 4D0DA 5MI0B 5JXAL 2GI7A 4Y19B 2P47B 3QEHA 5DRZB 1G9NC 1E27B 4JN1L 5L7XL 3O2VH 1JV5B 4WUKL 1OP5H 2R0WH 2VR4A 4GRLD 1A3LH 4W68A 3VWJC 2ZCKH 3S8WA 4IMKA 2ZJSL 4OZFB 3U0WL 3DTXB 5J1SC 4S1RH 3DO3A 5GGQL 1MCHA 1J0ZA 2FSEB 5FM5O 1H3PH 3K74B 2OQJA 1RIUH 4NNXB 3JWOH 1RURL 5DJYB 4XC3H 3UDWA 4FOMA 5ANMA 4WFFE 1FYTA 4G9FE 2J8OA 5EZOH 4P46A 4POYA 3UTTD 3MFGB 5C2UB 3T0WA 4XVUC 4Z7UE 4M00A 2DTSA 4FP8L 3ZL4H 4UILH 2GW5A 4I9WE 1NH6A 4X6EA 1SYVB 2BNUB 1R5WA 4ZAKB 3X3GH 2R1WB 2W65B 4XGZA 2GKIA 3P77A 4ZUTA 4OZFG 4YEEA 4IRJB 3MO1B 3HKFA 4GTMB 4JGMA 4ELKA 4L3CB 1NKOA 4GRWF 2DQTL 2CR6A 4AT6B 5E5MB 3O4OB 4OZHB 3MV7E 3Q6GL 1D5ZA 5ALBL 5CJQH 4DKDC 1FO0A 4M6MH 5I8OL 1LEIA 1JJUA 3LH2H 3PUCA 2UZYB 4B7LA 1UMPA 3NVQA 3VGHA 3N1QC 1F3DH 4CW1B 3IS1X 3HMXA 2OXHA 2VERN 1HXYB 3BIKB 1CL7L 3HB3D 3BE1L 2BRRL 4OIIL 2YWYA 4ESKA 5BJTB 3IFPB 4JPKL 3PWLA 3G5ZA 1NC4A 4OKDA 5GSVA 4JANA 1A9BB 1MHEB 3FFDA 2ITCA 5C0JA 1BFVL 5E95B 4NQCE 3ZE0F 5F3HB 2VLRD 3ZKQD 1HZFA 1N64L 3O9WA 2XWTB 5TF1H 3DBXA 4OUUB 3UTZB 2VQTA 4YHMH 3GMMB 1F4YH 3X13B 3B9DA 3UYPA 3DTXA 4FXGA 4G8GB 4EUPB 1P4LB 3SGJC 1REIA 4NJ9H 4MAUH 4WWKA 3WFHB 4ONFH 1EUUA 3VXSB 2IBGA 4LARH 1QFPA 5DA0B 2JE8A 3HLAB 5DFTA 1NFDF 4FQ1L 2YKLH 3ECBA 1S5IL 8FABB 4G5ZH 1HXMB 4KJWC 3RWJB 1CBVH 4WV1A 2IFFH 1MJUH 1JGLL 3MRRA 3IFOB 3BH8B 2FX8H 5TE4L 3S5LB 4A6YA 5EOCH 1S7QB 2JF1A 1G7QB 5D2NB 4KKIA 4OZHF 4RRPG 1E28A 1RZJH 1FL3A 1VFBB 3F5WB 5HVHB 1QKZH 2CLVB 2Q87A 3IDMA 5IQ9B 1J9CT 3PNWB 1KUMA 1DVFB 3ZE1F 5JQ6H 1V7NL 3QUXC 3RWDB 3MLYH 1FFOB 3CVIH 5DJDA 4Z7OF 4YDEB 2AXFA 2P48B 4WHTA 1ES0B 1S7XB 5C0CD 3E2HB 4PRNB 3X11A 1HQ4B 4U1SA 3PABA 3HRZA 4ZYKA 5HDLA 1B6UA 4I18C 2FL5A 3H8NA 4YHIA 3C8KA 3ROLB 5CUSL 3QDGB 1NCUA 2NMSA 4NGHL 4P5TC 3SDAC 2AJ3A 1BF2A 2DYPB 3R0MA 2NQCA 1WFNA 4JPIA 1HIMH 5FOBA 3ULSB 4XHQA 4HBQA 1S7SB 4LAQH 4PRPA 1Z9MA 3EYSH 1D7FA 3IDIB 4Z9KB 1RJYA 3ARFB 2O5YH 4OD3H 1NEZG 2D7OA 1F4HA 2IH1A 2BVEA 5DEGB 3FT2A 5IFAL 5CBAB 2YC1B 4I2XE 2GIYA 4K2UH 2AQ3A 4ZUWA 4FFYL 4MB3A 5CZXC 4XCCH 4PRHB 4PP2B 3DX8A 4WO4B 1NKRA 1IGIH 4OFKA 3SGKA 3VWJB 4WWKC 5C8JB 1FVCA 4OCSL 2Y07H 2V7NA 1MHHB 3KPSA 2UV3A 2XQBL 4S1QH 3KHQA 5DO2C 1NCWH 1KEMH 3MV7A 5C0RH 1QBLL 1J8KA 2J7LA 4WV1C 1UFUA 2A6KB 3VFWA 3FONB 2X4NB 4TPRL 3VDBA 4U2ZA 5EU4A 2SQCA 5IBUG 5LGJA 3HE7D 2V9RA 5FUZH 1WWWX 3T65B 5DEZA 4PRAA 4CNIA 3O6KL 3LEXB 1T2XA 1MJJB 4DK3A 3DX7A 2DLGA 5IQ7L 1DN0A 3PHOB 2HJKA 3VFGL 3K1KC 3KPQA 2ZUYA 1YDPA 2P5WA 2YD3A 2ZPKL 3U0PA 4FABL 1S9YA 2ZNXA 3S3SA 3V7AG 3BZFA 1B4JL 5C0ND 1WT5A 5D1ZD 3EW3B 4IJ3C 3OKNB 5MHSD 2XQWA 2Z35B 3C87A 2AXHA 1Q0YL 3WN5B 2I07B 4JR9L 3X12A 4ODSH 1A6TA 3OF6A 5ABDE 3PGFL 1MZCB 5FGBA 2ATPA 1U8MB 2C7UA 3QXWA 3DSVB 1F5WA 3AREA 4XPHL 5FUCC 2F19L 5LBSL 2MKWA 3F7RA 2Q8AL 2G75A 5JW4Q 3QBTB 4PJ9C 4ZS7L 4JFZH 5F9DC 1P9MA 4EDXA 4QRTB 3V5HA 4JB9L 4H88L 4ZUUB 5C0AB 3MLUH 3RU8L 3WLWD 4D2NA 4CJ1A 3ARDC 1R3KA 3C5JB 4XPTL 5IB5A 4KROB 3FN0H 4PJXF 3PWJA 4NO0D 3EJYC 5D8JL 3TCLA 2BSTA 3DX9A 5EU6B 1TQBB 1IEAA 1CU4H 1ZA6B 2IFGA 3MYJA 1FYTE 5D7KD 5F1IA 5I1JL 3LHPL 1KBGH 3M8OH 4TUOB 25C8H 4UMGA 4G7YL 5JW3L 4YGVA 3LD8C 1SJEB 4OBRA 1NPUA 4YR6B 3SE4A 3C08L 2AK4D 3DURA 4IDJL 4AENA 4B53A 3QHFL 3AS0A 5TDOB 3THML 3WUZA 4L29B 3VH8B 1I3RA 4ODTH 1NAKL 5JIIA 1TCRA 2IBZY 3OHXA 4GRMB 5I1JH 4K3DH 1GC1H 1NLDL 5KSUB 3QIUC 4QRRA 4EBQH 2BC4A 3MCKA 4LASH 2A6JB 4W6XB 3D69A 3LN4A 1YEDB 4WTXA 3DSXB 1RJCA 4Z0XA 2YPLA 3S37X 3MROA 1IM3B 3MOBH 4NNPL 5HHME 4JVWA 1X7QB 3QPQC 3M45A 3Q5TA 4LRNL 4OZIF 4PBXA 1XR9B 4JFQA 1KOAA 2UY6A 5HHOA 2YUWA 1OTTD 3WDIA 1AE6H 2QADD 4QRQA 1SA5B 4MLSA 3CDYA 4FFZH 1TZHA 3C2AH 3D85D 4OZGF 3MUHL 4UIMA 5E8NB 3WLWC 3MRHB 1MEXH 3NIGE 3DSTB 4HUKB 1HYSD 4P46C 5JIPA 4JY5L 4LPVA 3L1OL 3WV0A 1R3LB 5JPNA 1OPGL 2HJLB 5KOMC 1OAZH 4MNQD 2Y6SD 1E6OH 1TN7B 1W8OA 2N7BA 3MX0A 5HGBB 4K3EH 5D6CA 3L7FA 2C3WA 1KCVH 1S9VB 3UZQA 4G6AD 2OJEB 2CRYA 5LXGL 2MOVA 1EUTA 1JHKH 4X9GA 5J6GB 5SWSD 3QCUL 3NPSC 5EOTB 3BD5A 1IEBB 2GITB 1I7TB 3H0TB 5IB4A 4QRUA 4JGUA 4PLOB 3ZO0A 1GSZA 5DZNA 1LO2L 3RVWD 4X6BA 1NMBH 4MJIE 4EN3B 2EIZA 3TO4D 3MUGA 4PJBF 2IBZX 2WV3A 2GTZB 2IEPA 2VTFA 3BHBB 3MRDB 5J1TC 1LMKA 1NBQA 5EBMA 3WIFA 4WI7A 1AO7A 3P2TA 4EDWL 3NABH 2I24N 2ZNWA 5E5UB 4F7CB 3VXTB 3RJQB 4LSVH 4QCIA 5EO0A 3HB3C 1KXTB 3G6JB 5E8PA 5E6IA 1MUJB 5L0QC 1FH5L 5FYKD 5IFJA 3HE6B 3WHE1 2HT4C 2Z8SA 4V2BA 1LD9A 1N26A 3HE7B 1FBIH 4R90H 5EOQL 3IU3B 4YQXL 1NDGA 4J2XA 1CDGA 1Y6MR 4XNMB 4IOSD 5F97E 3BKYH 5HHQB 3QNXB 5GGRY 5C0CB 4HPYH 3HI1A 1QLRA 2BCKA 4P5MB 4JFOA 3W2DH 1BX2A 1OM3H 3U48A 4NGHH 2A0LD 4X4XA 2OI9B 2RBLA 1N94B 2RHEA 1Q94B 1J05A 4ZFGL 3VI3E 4KZDL 3VE0A 1NUNB 4FZEL 2UUDH 2YBRB 2OZ4A 3UAJC 3CVIL 2X4QB 3RFZC 4ERSL 4KRPB 5DUML 4LHUB 1YMMD 4J3XA 2YD6A 4QRSB 4UV7L 4LSSL 3RP1A 1Q1JH 4LL9A 2VQ1A 4OD2B 2IAMC 4QHUB 1JYWA 4OT1L 5TDPB 4BJLA 3UBXG 5GIRB 2J2ZA 1RZJL 2QQLH 1T2JA 4G42B 1LE9A 4JZNA 3ZYOA 2XXMB 4AJ0A 2CD0A 4TVPD 1E4XH 3IDYC 4Q2ZA 4MB4A 4PJGF 5GGTH 5GS3A 1ITBB 3I02B 5DJ2B 3W5NA 3NAAH 4AYFA 1WITA 1EEUA 3SKMA 4HIIA 1XF4B 5C0BA 4F8TA 4GLRH 3OWEA 4ZTPL 1MCEA 3BN3B 2NTFB 3DSWB 4XPBL 1K5NA 2F9BT 3VE0B 4X6DA 3DMMA 1IBGL 4MXWH 2C1OA 4PTTB 1HHKA 5CJOL 5J3HD 3M1BB 4H25B 1MRDL 3MQIA 4HJ0C 5C3TA 1EEYB 5C0CA 1U8IB 3GBNH 1DFBL 1E4WH 4K71C 1V05A 4S1DD 5TPWH 3RNQB 3MRGA 3RGVC 5LWYH 2B1AH 1J0KA 5T3XD 5E2UH 1G7HA 1X6LA 1Q0XH 1CL7H 2DM7A 5D7IB 5J56B 3DGGA 1TZGL 4MWFB 2JELL 2Z4QA 3ULVL 4F7CA 1T3FA 2UVFA 4XP1H 2CIIB 2FJGA 5F71A 4RDQG 4HUUB 3N9GH 4RMRA 4LCUA 4V1DA 2A73B 3HR6A 3E32B 4P2RB 1E4JA 3FT4A 2J8UE 5EBLB 1FPTL 5EIVA 3STLB 4ORGA 1IL1A 5BS0E 3H3PH 2KDGA 1RJLB 2LU4A 1D5XB 1G7HB 3SKJH 1KPUA 4JGJA 3SQOH 5DQJA 4MA3B 2ICES 3QG7H 4L4TE 4IOIB 1XGYH 2FO1A 1TQBC 4XTRD 7FABL 3WIHA 1AY1L 1YEKH 1LE5B 1B90A 1QYGL 4WRLA 3K4ZA 3EO0A 1BECA 4TNWK 5CEZD 3EKCA 3TF7C 4QRPA 3S36X 4LSSH 5A3ID 2YUXA 4X7CC 1R3JA 2DMKA 2NY7H 4HBCH 4OLZH 1R3LA 5ESVB 1UWGL 3GSOA 3PP3K 5F6HI 4M48L 4KH2A 4JHAH 1IT9L 3D3VB 3HS0B 2DJ4A 4WI5A 1T20B 2R0WL 5C0BB 5C09A 2Z93A 3B3IA 1XR8B 1LHZA 5IV2B 4HFUH 3HC3H 4XBEH 3I3BA 1BD2B 4KQ4H 4F57H 5BQ7A 2O5ZH 5C7XH 3BYYA 5DVMA 5HPMB 3O6FD 5DUBA 1BVLA 4WJ5B 5CIPB 5GIRA 3QJFA 2IQAA 4RSVA 1A14L 4N5ED 4P2RD 1IAOA 1QPPA 4AEEA 3HNTL 3MCKB 1FFNB 3ZT5A 1DEDA 3RQ3A 4F9PC 4LHUA 1AHWA 2DMBA 3WMSA 3KWWB 5FA3A 1NGYA 1CN4A 3D39E 4QRRD 3QEQB 2IALA 1IAIM 4GXVL 5KTEL 4FTVD 3WEXA 4QOKE 2IQ9L 4XZUB 4Z76A 4XP9L 1RIVL 3U46A 1SVZA 1T03L 4OSUH 1TJHL 4XXCC 1LQSR 4Y19D 4X4XB 5D1XC 4JDZA 3VRLF 4UQ3A 1T7ZA 4X80H 1N95B 4ERSH 1QLRB 3ABZA 3HPLB 4ODUA 1KELL 4LIQL 3VXRB 2HT4D 4XX1G 5HPMA 4OZGA 2ZSVB 2HH0H 1NDGB 4JHAL 3KNBA 3LPWA 1JMXA 4NKMA 4I48B 2WBWB 4N8CL 1R3KB 4P4KC 1QSFD 5IV2A 4AH2A 5D9SB 2WAHA 4D8PB 4LDEB 3S96B 3QHZL 3ARFC 3GNMH 4NKOA 1AO7B 3MLRH 1CTNA 2VRAA 4FQPA 2EYSB 3L3HA 3Q6FB 4JCLA 1ZE3C 2YD9A 1PQZA 3FQWA 5F6HJ 1ZK9A 2OBGA 3MUGB 4JAMB 3FO1B 3OG4B 5D1QA 3O6ML 4CN1A 4CMHB 4PPTA 3ROOB 2F58L 4OI7A 1J87A 1H5BA 4PGEA 2R4SH 2VDML 3RX7A 1ZGLP 5C3LD 3P9MB 2V8KA 32C2B 1DN0B 5BVPL 5JOFB 3RWIA 1B2WL 1P9MC 2X09A 3MZTA 4NPYA 5JO5B 4U1JB 1I9RH 4YHPB 1CFQA 1KG0B 1BQLL 2H2PD 2H41A 3DWTA 5F8QC 5JPMB 4QT5B 1NUDA 3HR5B 2IPKB 5CD5C 2DICA 4LCWE 5HGDA 5DF0A 3RA7H 1DDHA 2ATKA 4RIRB 2BRQA 5HYIA 3UXFA 5HYJB 3SJVD 5MEPB 3SQBA 4ZAKD 2DLHA 4OCXH 1DQQA 3TH4T 2VDLL 4FRWA 4WUUA 3ES6A 2BVPB 1CGYA 3GSRA 3P9WB 2C1PA 4BQBA 1R0AL 1OAZL 3DVGB 1YZZA 3CC5B 3DETC 1TVHA 1QEWA 4JFDD 1ZLUK 4Y5XA 4M7KH 4G7YH 3C2AL 1LK3L 2JJSA 2P24B 1A6VL 4RFNB 5EC2B 3CFJB 4LCIL 2C1OB 3W39A 3PGDB 2IH1B 3BDXA 4J23A 3ARDD 2CLZA 4F2MA 4FTVA 4KC3B 3ARFA 4F7TB 1TQCC 3L7EB 4OLWH 3OHXB 3BUYB 5ESQB 2R2HA 2E7LA 3BWUC 4TSBL 2FGZA 1HWHB 5M95B 4HIIB 1WWAX 4OLWL 5L2KD 5GRJL 2Q86A 1NMAH 2AJ3B 3BWAA 4JDTH 5E08L 1RUPH 2H1PH 5D1QC 2VLLB 5GGRA 1P4IH 2V6HA 1SJEA 4GW1A 3FB6B 1I9JH 1S9WA 4IRSC 4K3DL 3QA3A 3VD4A 2Y06H 3KPNB 1C12A 3PWJB 3O3EB 5IB5B 4BQ9A 3WFBL 4N8PA 1KACB 5C0DA 3BD3A 1F4WH 3F5WA 3IJYB 1D6VH 1N2RA 1P4IL 4JN2A 1CXHA 4GO6B 4RGOH 2ZOLB 4GT7A 4JFXB 5FK9B 4DQOH 2OM5A 2PW1A 1ZLSH 3K46A 1SEBB 1P7HL 1A6ZA 3IFOA 4PYHA 5D7LA 4YK4C 1GZQA 3RWJA 1ED3B 3RWEA 2EXYC 1TXKA 1XMWA 4R9HA 2RR3A 4HJGB 4MNQA 4EVNA 2Z35A 1I9RL 2BCKB 4FXKA 4JQIH 43C9B 1I8MB 5KAQF 3MLPA 3GKWL 5DRNA 3TT3H 1F4AA 5K33A 1LD9B 3HE7A 5KZCD 2MHAA 4Y8AA 1OGAB 1MJJA 3VFRB 3LS4L 1FFPA 3DETD 5E8PB 2MHAB 2F58H 1BZ9B 5E8EA 3K0WA 5EO0B 1AXTH 5AD0B 1DBAH 2DWEB 2NY2C 5DRNB 1Z3GH 2Z9TA 5C6TL 5KSBA 3FQXB 1U92B 1OSPL 1YECL 2YRPA 5GSVB 4HHAA 1NGPH 4QGTA 2BERA 3KVQA 4M7LT 1FCCA 5ADOL 3V0VB 3MLRL 4XXDA 4XAKE 2XKNB 5E9DB 3BGFB 2P8MB 3QUYC 4CW1A 3R4DA 1AXSB 2DQFB 2ZUXA 1JWSB 4QHKI 2CRMA 5HHVH 4PP1C 2ZOLA 2AEIT 3MRCA 4FQXC 1IGTA 1S9VA 1AD9B 3BSZL 4G6JL 5HDBE 3NH7H 4PG2A 2X9YA 4D3CH 2IMMA 4HUWA 4JZJA 1JZ5A 1JTPA 1KEML 2XN9B 3KYKL 1QHPA 4FFZL 4MBGB 5BV7H 1LD7B 3K8KA 2MMXA 2XPGB 1A7RL 3D5SA 2OMNA 1N7ML 4AIOA 2UWEB 5IJKC 2VDRL 4GW4A 1OGTB 4PJ9B 3UTTE 2PO6B 3T1FB 4JDTL 5E08H 1UC6A 3FB6A 4CRPA 4CADA 4XPGL 2N7AA 2FATL 3NIDE 4PV8A 1BQUA 4OZ4B 2M26A 4P46D 5CKGA 5HVFB 5CSZA 1BBDL 4GRLA 5B39B 3O3BB 4FNLH 5F1SA 5GS0H 1PFCA 1U93A 1IGJB 3QDGA 2D3VA 5HHOB 4MNHB 2FR4B 1I7RA 4P23A 1MCWW 1OTSD 3E3QC 4PD4J 3V8CA 4PJ8D 2A0LC 1W0YT 4M1DL 5CIPH 5GGTA 3VXPA 3QUMB 4TTDC 4XMKH 3DX6A 5ID0B 2WW8A 3AS2A 3V7AE 1CG9A 1W72A 4KROD 4JFEA 5MI0C 5DRZA 3K8LA 4PJ5B 5FYLE 4X4ME 4M5YL 5I1KH 2OR8A 1CGSL 1MY7A 5DEFB 5IQ9A 4D9RE 4DKEL 1AHWC 2H8PA 4BM7A 1ZLUH 4GMTH 1OB1B 3IDJB 5FFLA 1G7QA 5JHDB 4LPWA 2C3GA 3P9LB 5IHUH 1OCWH 4QXGL 4X5WB 3V5DB 5CEYA 3BH8A 1R3HA 1KBGL 3M8OL 1FNSH 4S1SL 4NC1E 2IGFH 4WV1B 1MRFH 3WYRA 5D2LE 5TDNA 2X7LA 3BI9X 2A6DB 5D1ZB 2XZQL 1ZWIA 4YR6A 3BO8A 1HH9B 4RISH 3GKZA 4HGWA 5IF0B 1VPOH 3EIFA 3O9WD 4TUOA 4FMKA 4JFFD 1S7VB 1GJIA 1ZA6A 2NX5D 5I66A 3G04B 3TCLB 4G80B 4YHPA 1L4IA 1M7IB 4XCFL 2HTKD 4MDIA 3QG7L 3WUWA 3QPXL 3CFEB 3KAAA 4PB9L 3GMLA 1MHPL 3ZE0E 5JO5A 3BJ91 4MJID 2R2LB 1U3YA 5FKPA 4Z7VF 2X05A 1A2YB 4NQEE 3VGEA 3PWPD 1BM3H 3WNKA 2YHGA 3HC3L 2BMKA 4BSWA 5TGBA 5J9PB 1JYXA 3SJVB 2A9MH 3S97C 1O6QA 3UTPD 1PG7H 4EQ3A 2YSSA 3QUZB 4JAMA 3VFUA 4TRPL 3R0NA 4HFWA 2HT2D 1P2CA 1EFXB 4MNQE 3V4UL 4MQSB 3T08A 5HI4C 5IROA 3CX5J 3U36B 3LIZH 2V8IA 1K3ZA 4RGNC 4P3CL 3C8HA 1EERB 3NFSH 5D9SA 4X0KB 3U0WH 2OL3B 3MO1A 1K4DA 4Z7UB 4R0LA 2B2XL 1K4CB 3CCHA 4JY4A 3MRIA 4HX1A 5DQ9A 5E0QA 1BEYL 3T4AB 3QEUA 1UYWL 3S37L 2CUHA 1PEWA 3TBTA 5T3ZE 1RFDL 1J8HA 5L9DH 1KIPB 5CJQL 2UWEF 1J8HB 3HPLA 3GMQB 2J5LC 3INUH 1JF5A 3CMGA 1Z5LA 2YPVL 3RVXC 1X5XA 1N4SB 3MV7B 1ROWA 2YXFA 4JFHE 1KN2L 4JDZB 5I1DB 5DMKB 4JFDE 2OQJB 5C71A 4N1EA 4DEPB 2ESVE 3PWUB 1QSFB 5B4MD 2ZUTA 3UROR 2HTLD 3MYZA 3HZKA 1A1OA 2R56H 4Q6IC 5KW9H 5T1LB 3WEXB 5A16B 5C9JB 1NCDL 2O5YL 2VH5H 1Q9WB 3PWNA 4PJ7E 1T0NA 4D0CA 1TNZB 3CDCA 3FQUA 3N50A 2YC1A 1OCWL 4QXGH 3SO3B 3QIWD 2XG5A 1F00I 4MGXA 1U9KA 4BSVA 1DE4B 5BMFL 2XI9A 2P5EB 2XWJB 2P49B 5D7IF 2VSDA 1FDLL 5CJOH 2FBOJ 4YFLI 1BEYH 3B83A 5IHLB 2R69L 3BSZH 1D5IH 2AERT 4LP4A 1FJ1A 5LQBH 2VZVA 4JPIB 1NAMB 1MFAH 5E2VL 3PV7A 4JN1H 1YNLH 5J57B 3ZKMC 5F1OB 5JXAH 1XR8A 4M7LL 2EDRA 4LCCC 4P4KA 4BKLB 1T20A 4P5TB 3VXSE 5IHZB 3D3VA 1VFMA 4M1CC 2ZUQB 2XG4A 4YH6A 1XT5A 4X5LA 1YEJH 3RY6A 5JW4R 3ULUC 1R3JB 3MBXH 3DIFB 3QPQD 4XT1C 3OAUH 4Z0BL 4YQXH 3O6FB 4ZOBA 1MREH 1NBVL 4M6NH 3RWCA 2X1OA 3Q7FB 5CBEB 4LSTL 4PJFF 2X7LB 5SX5K 1MWAL 1QOKA 2BNQD 5D2NC 3ZDXF 2NY3C 3VG9B 5LAXB 4POZC 4PJXA 4Z7WB 2Y25A 4OCRH 4WCYL 4A6YB 2NLJB 4R4BB 4ONFL 5GS1C 4BUHA 1N0XH 3MLZL 3VRLE 2R29H 1D5XA 1FPTH 4KU1A 2K3TA 3RWHA 1KT2A 4G7VL 4I1NB 2BSED 3FOLA 4KRPC 1U8QA 1WWCA 4JFEB 3N1GC 1JZ4A 3O3AB 4EUPA 1ZHKB 4LU5L 1N3NB 3P30H 3QDGE 2AEWA 5CD3A 1K6QL 3X13A 3GBLA 1RVFL 1SHMA 4L5FL 2QV2A 5D7IA 1RHFA 1JWMA 2Q7YA 4NQTA 2FR4A 4KHTH 4OZIB 3UJTL 1NGPL 4OB5L 4FFWD 3B2UC 3WD5L 4N5UA 5CMAA 2XWTA 1XF2B 2COQA 4LGPB 2AV1B 2NTSP 4GRWH 3BKJL 1J1PH 4Q9QL 4EI6A 1MIEH 4HLJA 1MCFA 2W92A 4AIXA 4PS4L 3RNQA 1CT8A 4AG4L 2ITCB 1HNFA 3I6KA 3BP7B 1JVKA 3NGBB 1MSPA 2P8LB 5BJTA 4D9QE 2EYTA 4LLVB 4WI8A 3VFVA 2I9LA 4V2CB 4MCYA 2XN9A 2ED9A 4PTTA 4XB8A 4EUPG 3O11B 5DT1H 2W0FB 5JA9A 3TYGL 4H0GA 1H15A 4RMTA 5JZ7D 3RJDA 1G9NH 2X41A 4XI5C 3FAWA 5IMMB 3W82A 4K23H 4P59L 1NMBL 1RUPL 2WY8A 1UCBL 5ITBL 3G6JF 3CVHL 2C4FU 3FFCE 4L3CA 1SJVA 2BK8A 2JB6B 1AXSA 4BZ2L 3FHAA 3NFNA 3OL2A 1N4XH 3EO1B 3DV4A 1QO3B 4NZRL 4OGYH 3BN9D 5CEZL 1ZXQA 1FZJB 2ARJB 4X6EB 4HK0B 4TSAL 5B22A 2Y5TB 4HHAB 4P2QB 4UTAL 4PRBA 3BT2L 1U92A 3JV5A 1AGFA 4PJEF 5L8KB 5H35B 4QHUA 1QNZH 4IRSB 1EA9C 2VQ1B 3QQ4A 1BZ7A 1FFPB 3GMPA 4OD1L 3CX2A 1MCWM 3I3DA 4NT6A 1XIWC 1NGZA 4X9BA 1RZ8A 4NCC1 3PWPE 1F90L 4OCXL 3BP4A 1G0XA 1U3HB 5DS8A 3SDXE 43C9A 5IFHL 4OB5H 1NDMB 3WD5H 3ZTNL 3D0VA 3IDNA 4OGYL 4HIEA 4OJFH 1FPPB 3QULA 3AMKA 1UXSA 1GGTA 5I1EL 4NRXB 1MCJA 2VSCA 5I73B 2OMBA 4JQXA 5TH2B 5C0AE 1DBAL 2AK1H 4B5EA 1FVEA 4PJEA 4JFXA 4HKBB 3RVTC 2BNRD 1KGCD 4Z8FH 5I0ZA 1KPVB 4LVNB 1FGVL 1LK3H 4ZFZB 4R7DB 2RAMA 2AI0H 2G2RB 4NCC2 2IANA 3TT3L 1FGVH 4HWBH 1MF2L 2LU7A 3SDAD 3FCTA 5DJXA 2V2TB 1UQSB 3SDYL 3FT3B 3TPUA 5I18L 5DTFB 2MPAH 5KOVC 5IB1A 4Q97A 2MFNA 3CH1B 1WCBB 5I9QB 2NYYD 1FL5B 3BXNB 4YHLH 2GTZA 4IIQB 5C2BH 1EHXA 2IBBA 2VLLA 2ZUQC 4OQTA 5GGRB 3TV3L 1IM9A 4G3YH 3FRUB 3RA7L 2Z31B 1I9EA 1CIDA 4Y4KB 3S35L 1DQJB 1IC5L 4UAOC 5DD1H 2CO6B 5C0GB 2EDDA 3A67H 2B8OT 3P30L 1A47A 5F96H 1CZ8L 5FHAH 5GS2H 3BN9C 1S7UB 2B5IB 3L9RB 5F88B 1CIUA 4QO1A 3WKML 4GBXB 4RBPH 4FQXA 5HGBA 1EO5A 2XIDA 4XVJH 1MCPL 3HUJE 4MAYB 1HCFX 5DRWA 3H42H 3OKMB 2FJFA 3F65A 4JZJC 1AR1D 1BIHA 1FV1A 3SDCA 4MS8D 5D7JA 2OYPA 2ADFL 5DGQA 3SDYH 4U7MA 4AL8H 5EBWA 3CC5A 3T77A 3TJEL 4PGDB 5E56A 2F8OA 1LO4L 1CXKA 3O2DA 1CXLA 4HKZB 2PUQT 4FABH 1XEDA 1TJHH 5FB8B 3IJHA 1T1WB 4XVSL 1JNLH 3WN5C 4N1HB 3ES6B 3NIFF 1S78C 4XBPA 4JFQB 4X4YB 4NNPH 1ONQA 4DUVA 1H35A 3DO7B 1U8HA 5DD0L 4MQ7B 5IFAH 3HXDB 1I1FB 1Z0NA 1S63B 1ZHLA 2HVJB 5I75B 4NM4L 1N4RB 1A3RL 4LOUD 1IM3A 1K8IA 1D9KC 1NCTA 1W72H 4KDTA 5FDWA 4M7LH 5LVEA 2F54D 5E8DH 4KV5E 4DUWA 1CGXA 4PYGA 1EMTL 2CKBA 2ENYA 1XF5A 1HHJA 4KK9D 1F8TH 4Y2DC 3MODH 3ARTA 2H6PB 3BH9B 1KC5H 4H5SB 5FXCH 1GRWA 4GKZB 5BS0A 3MRFA 4HIHA 4K7FB 5F72S 2EE9A 1I3RB 1YY9C 1YC7A 2BDNH 1GAFL 2EDHA 4P4RA 4I0PA 1OAYH 2DS4A 4P3WA 3JVGC 3IETA 3PQYB 3OKKA 2Z8WC 3QSKB 5DHVH 4YGVB 2IH3A 4YHOH 2ZG3A 1TN8B 3O3DB 4Y4FB 1YPZB 4YFLF 2A6IA 4Y16D 4F7PB 3MYJB 2FBJL 1TIUA 4NKOB 5D5MB 5FYLH 2AJUL 1AY1H 1YEKL 3FL7A 4GBXD 4LSPH 4AH2B 1XFPA 1VDGA 5DURB 5I1GL 5JR1H 4Z7QF 2Q6WB 4I48A 3LPFA 4JM2D 3V5HB 1SQ2N 4OAWA 4G5ZL 5C0CE 3DVNA 3K4DA 2R4SL 3PGFH 1MPAH 4LCCA 1EEQA 1KFAH 4JR9H 4F7PA 4Y1AB 5FO7A 3UPAA 4P9HL 5DJZB 1G7LB 3TYGH 4L3EB 1N5AB 2D0HA 3AY4C 1JZ3A 1X5ZA 4JKKA 1S64B 1A6TB 3IAQA 5HD8C 1IM9D 1IGCL 3UZVB 4XCFH 2Y5EA 2F74A 1KTRL 4Q0XL 4ZFOA 4U1HB 3RNKA 4QYOA 43CAA 5I76A 3OAUL 4Z0BH 3TWCH 2NY7L 4OLZL 4YNYB 1OAQL 4ELME 3REVA 4U1NB 3GJEA 4UBDC 1CTOA 3GSNA 5IROC 1VCAA 4M1GH 2IALB 1U95B 4HZLB 2BOBA 2JJTA 4QTHB 1QYGH 3T0EB 4KHTL 5A43C 1GHFL 1MLBB 5IW6B 4HIXH 1E4WL 3A6OA 3DSFL 1K6QH 3QUKA 2A1WL 4PLKC 1AGFB 4N0YL 3H3BC 2HVJA 4TUJB 2G5RA 3GMNA 4PG9B 5DJCA 1XGUB 1KFAL 3CXHK 5BMFH 4Q9CA 4MAUL 1NCAH 1MFNA 5EN2A 2W59A 5GZOD 3WNMA 5F6IB 3LQAC 4OM1L 3HC4H 1WZLA 3DARA 1A6AB 2YZ8A 1T1WA 3EZ8A 2DQGH 5I9QC 1FVCB 2VH5L 1URLA 1QSZA 5FAAA 4WO4A 5EU7C 5J3HC 5ICZA 1KN4L 2ZOKA 3QDJA 3QUXD 4RGND 1CLOH 4E41B 5EWIL 1KN2H 5E2TL 1L0XA 5C0IB 4JG1H 3FFCD 1OAYL 1KULA 2PCPB 1CT8B 4X6CE 1WTGT 2DOCA 4LCYB 3V6FB 4RA0C 2NY5C 3RIFK 3LH2L 4J12A 5CMAB 1YYML 2NY2D 2X9WA 2B20A 4G6JH 1SMOA 2HT3C 5HI3D 4WUKH 2Y4SA 2Q7YB 4V1DE 5J89A 3ZYIA 3L5JA 3PABB 3MRKA 3LEVL 2D03H 3RTQA 1P6AB 2BNRE 5IHBA 3QO0B 3MREB 4HGMA 4PGCB 4YUEH 3BPNC 4HCRL 5DJDB 1I7UB 3TPUB 5JW4M 3QIUD 3CAFA 2NY4D 1JRHH 4O58L 1QLFA 2VITB 1RK1A 5T3ZD 5EDXA 2EDEA 4WFHE 1L6XA 1EZVY 5E2TH 2FEEL 1U58A 3H9SA 3MNVB 3IDMB 5I71C 5GGSB 1MI5E 1HQRA 5MEQA 2QQLL 1VGKA 3PDDA 4R4BA 2IF7A 3VMPA 2P5WD 4OT1H 3W9EB 1ZHBA 3IVKB 4MA8L 2VZUA 5I30H 3GSUA 3SKNA 4PJXB 4Z7WA 4YWGH 1D6EA 3MRRB 4ZOAA 1CDIA 3L5WB 5IW1B 4U6YA 5I1CL 3H3PL 5DUMH 2WY7A 4HLZG 2UZIH 2VLKE 5K59E 3MRQB 4YC2B 2W38A 1F4YL 4U33A 5E8OB 3EUVB 3CUPA 4HQQH 1DVFD 5L9DL 4POUB 3S37H 3ARZA 1PLGL 3KPRB 4HMEA 4MHHI 4P5TA 1W8NA 3W2DL 2P5WE 4NT6B 1TNYB 3IU4L 1F58L 1TCMA 1AD0B 4S0SD 1FRGL 2IPTH 3VWKA 2VL4A 3AUVA 3D9AL 4R8WL 2J4WH 1BJ8A 2BSRB 1I4FB 4NDMA 2NNAB 4KJQC 4ZOCA 3EJJX 4YHLL 2BNQB 4HUXA 4KI5E 2CQVA 4HUVA 4X7DC 1LILA 5M94B 4PJHA 1OAUL 4LVHC 3CPLB 4OCYH 5EU3B 3C6SA 1FLRH 1EPFA 5EB9A 4XMLL 1O1TB 3D39B 4J4PA 4G8GD 3PHQA 1HXYA 3BIKA 3MLSL 3EO1A 4LPXA 4M5YH 5I1KL 3MLXL 4OM1H 4YDLC 1S7RB 2X4QA 1EVTC 1FO0B 3TJEH 5F1NB 2G9HA 3KLSA 4JHZA 1QFWM 3UO1L 3DUUA 4OZHA 3BIAX 4DVBA 4OF5A 1KF9B 3DSUB 1UADC 3FTGA 3NTCL 4UB0L 3ARGB 2V5MA 4EZMA 2VXUL 4MB5A 1A4JA 5A1AA 1DBJH 3RWFA 2X4TB 1BBDH 3C09C 2O61B 3NZHH 2GJJA 1FORL 3DRQA 1W0VB 4OBSA 4YHKH 1JGVH 4XC3L 1A8JH 5J8OA 5D7JC 3ME0A 5TQ2L 4EKXA 1DQLL 1GC1C 4EUPH 4LCIH 1TDQA 2AV1A 4HS6B 1O1RB 4MJ5A 3AGVA 1KCUL 1J1OH 1FSKB 4DCQA 5I17B 2WWMC 4H8WC 3IDGB 5EU5A 3GSXB 4CAGA 1KGCE 4KGJA 4WNQA 2JB5L 1LP9E 3Q1SL 5MENB 3UTSA 3OAZK 3VRIA 3HZYB 4HH8A 5CP3A 4QF1B 2HA1A 3U7WH 5D4QA 2X4RA 1KC5L 2DL9A 4QNPE 2QQQA 3MODL 1E27A 2H1PL 5CJ5A 1PYWB 3LHPH 3E6HA 5MP6L 1RMFH 1VFOA 1AI1H 3BKYL 1B3JA 5FO9A 4C57C 2CK0L 3WJLC 3BZDA 1XCQA 3CFBA 1NC2A 4M93C 2X4OB 3C6LA 3L3OA 2O5XL 3WJJC 2HWZL 4U2YA 4X7SL 5DHVB 4F80A 4J4PC 4TUKL 1BFTA 2P5ED 5CBEA 4MDIB 3MR9B 4DKFL 4LCWB 4I0PC 4XPHH 3O6FA 1YJDC 4FA8A 3SE8H 5JW5B 1A3QA 3TYFA 3JVGA 4ZQKB 3FO0H 1JCSB 5ISZD 5HYJE 2BDNL 1QRNB 1TETH 3GKWH 4X99A 3OXRA 4G9DB 5FGSA 5IF0A 5FA4B 2ZWLT 1K8DB 5DSCB 1E4KA 4LLQA 5B4MC 3EDJA 4NKIL 1CE6A 3BKJH 1CXEA 4LBEA 1KXQE 4JRXB 2MWCA 4NCDA 4IIQC 1MCPH 1AGBB 2EH7L 1I85A 4Y16C 2F5AL 5CEYB 3V5DA 1VB9A 5CS7A 2EC9T 3WO3B 1KB5B 5AG8A 1NC2B 1TITA 2CKBH 3RIAK 3WNOA 2XWJA 2F15A 1TZIB 5ERWB 1N4XL 2VYRE 4NZRH 2EEAA 4LQ1A 4DUXA 4G3YL 5IJVB 4HZAA 1MQKL 3E1F1 5AZ2H 3VGGA 4G43B 5B38B 1ZGLA 3MLWL 5CZVL 2WWKT 2UUDK 5K93A 3ARBC 4UZGA 3VJ6A 3LKRB 3MFFB 4P2OC 3UTSB 1F45A 2NXYB 3ARRA 1Q0YH 4X80L 1NFDE 2I5YH 2YD7A 4S2SB 4P23B 4UOJA 1TETL 1X5KA 4MNHA 3B2VH 3Q73B 4L9PB 2D7QA 1J0HA 1CGTA 2XXCB 4JDVA 5AG9A 2Z92B 4M3KB 2EIEA 3JV0A 4LRNH 3MLWH 5FYJL 2PYEA 3IJSB 1Z5LB 5AZ2L 2CDGB 3U1SL 4XCCL 1ERNA 4U6TA 3K2UH 2IANE 1T2QH 4X7SH 3FB5B 1VA9A 1WIOA 1J1PL 1WBYB 3DRQB 2DIAA 2GK0A 2K1MA 3T4AA 2VDKH 5I75C 1I8LC 4KAQL 5DQ9B 4M8QB 4IM8A 3H2WA 2R0LH 3H7LA 5INDA 4KDTC 3LPGA 1I1AD 2UZXB 1A4JB 3JTTA 2XT1B 2OL3A 1AD9A 5HY9B 2AGJL 1NBYB 4G6MH 3EJYD 2J88L 5CAYB 5C92A 4QXWA 4N0CD 2R23A 4HXAL 3NCEB 2ZG1A 3QJHB 4OQTH 4TTGA 4MZ3A 3W0WE 5BS0D 3HMXL 2ZIRB 1HN1A 1NFKA 1MVUB 4LLAA 1WWBX 1ZANH 2ZUWA 1M05B 4YGAB 3RX8A 2DQHH 1YJDL 2OL3L 1I85C 2XY1A 1UXWB 1QA9B 1RIVH 1CU4L 4KUZL 3FMGH 3SJVA 2CRIA 3MLVH 2H2PC 5CGYC 4LSQL 4O02H 1TNBB 1W6JA 5JHDD 2ICEA 1NSNL 3M17A 4NSKA 1J7VR 5F7WC 5DLMH 1UM6L 1AD0A 5CEZH 4XAKD 1EJ6A 3NIGF 1UJ3A 4ZNEE 5FECA 5E24E 3EYSL 2IFFL 1XGYL 3S5LG 3BKML 2RCSH 3ET9F 5H37G 4WI6A 1JTTA 1EO8L 5ILTH 1BJ1H 5TFSL 4D9RD 5BZWA 2K7PA 1W0WA 4J7RA 4U1GC 3W0WA 3UPRB 5BRZA 3EJZC 5D1ZA 4NJ9L 3RIAF 4UDTB 1BJMA 1WEJH 4M62H 2NY0B 4DW2L 1GZQB 5IESL 4XBGA 1IILE 1A5FL 1R3HB 4Z7NF 1YYMH 3P9LA 1TTFA 2A9NL 3O8XC 4HMCA 3V2AR 2GSIA 3G6AB 4JRYD 5EC1B 2YD4A 4KKCC 4ODHH 1ORSA 3OR7B 1DQLH 3KPLB 1XIWB 2UWEE 3V5KA 4Z6AT 4PJDA 1RK1B 4OF7A 2GJZA 1EX0A 3TBVA 4UIKL 3H9SE 4RFEA 3VWKD 5GZNC 1WAAF 5HI3C 2F0YB 3TO4B 1DBJL 1MVFA 4C83A 1IC4H 4XP6H 2VUYA 2C3VA 4DZ8A 4UAOB 1UCBH 3CK0H 1OQXA 3W81A 5F89B 2E9WA 1JZ8A 4PRPB 1T04B 1DANT 3MGOA 3VGDA 1UB6A 4DN3L 1DN2A 3HZVB 3AAZB 3U9UA 2YPVH 1Z9SA 1F2QA 3OGOE 3ILPB 4U1SB 1FCGA 3PJSA 4HC1A 3BUYA 1IGIL 1JHTA 1ES0A 1S7XA 4C83B 2IADA 4JE4B 1OGTA 3VXMA 3KGRA 3TO4A 4GXVH 2BB5A 4F2MB 3CK0L 4XRCB 1H37A 3X3GL 5C0IA 2UYLB 2V5YA 4PJDB 5J12C 3CFJA 4FFVD 2VDPH 2XZQH 4LRIC 1FG2B 5GGVY 3QDJB 5I6XC 1CFTB 1OGAD 2HVKB 1JPFB 4Y4HB 5D1XD 3SGJA 4YDIL 3EOAA 4O58H 2ARWA 1QFOA 1JWSA 2EXWD 2FLBT 4UV7H 4ODHL 4KQ4L 4NFCA 1Z2KA 2AABH 4WUUB 2R2CA 5GGQH 2BSSB 1AP2A 4HQQL 4GTSB 3WFCL 2ZJSH 5BRZB 4NUGH 3UPRA 4UT9H 3NIFE 5D93B 1JPGB 3R1GH 5H8DA 3VXSA 5KANG 4HAFA 4FXGB 4PJ7F 4ZTPH 1V7NH 4FFWC 5EH1A 5I1CH 2EEBA 5AD0A 4IHOB 4B50A 3SE3A 4NQEB 2B1HH 1U8PA 2VIRB 1ZT1A 5EPMB 4U6VH 3DBXB 4OUUA 2MJWA 2D7PA 4NSKB 3KJ4C 1H39A 3MGTB 4FP8H 4HIJB 3X14B 1MREL 3P9MA 5IWLA 5TQ0H 4HWUA 3GDBA 1D5BA 3ZHLA 2E27L 1UXWA 1NC4B 1JRHL 2B1HL 2BXYA 3DPYB 4IRSD 2M8XA 1RK0B 3VA2C 1GGCL 4KDWA 2DQGL 1ETZB 5HGAB 5CINL 1JK8B 1T5XB 3T3ME 1D9KD 3DRTA 4Y5VB 5DJZA 3LOWA 4ZNCD 3QJHA 3C8DA 4YBQD 3TZVC 5KSAC 3WJLA 2FO4B 4PUBH 3TO4C 3HXFB 4XP1L 1HSBA 5BW7A 3OX8A 4JN2B 1HDMA 5F7FA 1U8OA 4JFFA 3FB8B 3C6LC 3VXNA 2YPLD 5C0DB 5F7MC 1CE1L 1JNJA 1MI5A 4JG1L 2VLMD 4OIBA 3KPNA 4E42A 1GHFH 2X40A 5KS9A 4G6KH 4FQJL 1NCDH 5F7EL 1U8KB 3QI9A 2ESVB 3CD4A 3KYOB 4MZ2A 3U82B 3L3JB 3OKKB 1QSFE 3HAEB 3LCYA 4NBZB 3UTQA 1SVCP 2VE6A 2N1KA 4XPGH 3L1OH 5FYJH 2ZUSA 4RAUB 1R5VB 3QRGH 5FDYA 4GKZA 3VFTA 4JQVC 3HG1D 3MJ9A 2C3HA 5D5MF 2VDRH 1AJ7L 4P9HH 5A3IC 4YIQA 1BP3B 1JV5A 2H6FB 3LMJH 4LFHG 3QFJB 5K9KB 4CVUA 1G9EA 3QPXH 4PB9H 4Z78B 5EA0L 5L88L 3QZWG 5C6WH 3CU7A 2YUVA 1TJGL 4LAJH 4D0DB 2IQAB 4RMWA 2ADIB 2FH6A 1WQVT 2NYYC 5HHXH 1IAKB 2EDJA 1DSFL 4G8IB 2HRPH 4U49A 2ZCLL 4D0BA 1CICA 3VMNA 4U31A 4AEIH 1AGBA 2EE3A 1I1YA 4DJMA 2J12B 3QUYD 4KY1L 4NQDE 2I9TA 1WJ3A 4KUZH 4LBEB 3AXLA 1RIHH 1C08B 3HS0A 4HKZA 4OCMC 4S1RL 2Y36H 5JHLH 1JGEA 4GMSL 1DFBH 3GSOB 1BOGA 4JY6B 5C9KA 3PDOA 4G6FB 4FZEH 4LKXB 3EDFA 3IGAB 4L4VA 3D2UB 1FV1B 1X4XA 3U6RA 1MCBA 5E6ID 4KI5D 4MX7A 2R2EB 2X4PA 3NIDF 4K3HA 2FYYB 4QRPB 1YYLL 5I1HL 4Z7WE 2YPLE 5JW3H 2WSKA 1RZIA 2F53A 2RCSL 3I6GA 2EKSB 5I2IA 3OJDB 4P5TD 2L7UA 3W9DA 4U1LB 1MAJA 3VFSA 1W72L 2BEDB 2X1PA 2AJUH 2E9JA 1TLKA 2OSLA 2FBJH 4ELMA 4LSQH 1IZKA 3MRLA 2FYYA 2GUOB 2WLYA 1BQSA 1FL5A 2XKSA 2VKXA 3BXNA 4LSDA 4PRIE 5HXMA 5DO2D 4MD5B 2MCG1 2MKLC 2R8SH 2G0DA 3G6DL 3MZGB 3HI6H 3D87B 4HUUA 2IAND 1T3FB 4WEBL 2VWEC 1D6VL 4UDUA 1JUFB 5F9AC 3QIUA 1N7MH 2FNBA 3ZKXB 2FGWL 3TVMA 5BV7L 1BQHG 5EZIL 2JIXA 1EHAA 2VOTA 5BVJA 2J5LB 5T1MB 4MJ6A 4NNYA 3AFLA 1EMTH 4Y5XC 5JNYA 4O5LH 5JMRA 1I3UA 4ZFFA 3EYUL 1GGBH 3GSVA 1UXSB 4KGLA 3M1BA 3CFIC 4ACPA 5K9KA 1N0LA 1U3HA 5DS8B 2F5AH 1S9KC 1G7JA 1B2WH 4ZO9A 4PGBB 1LK2A 5LCVH 4UB0H 3VMOA 4JKLA 2EXYD 1CD9B 1R5VA 4KUCF 1ZHNB 3O8XA 2VZOA 4XNQB 1G9NL 1A9EA 1S7RA 4XCEB 3LMJL 3FB7A 4E5XB 1UVQB 3TC9A 4F9LA 5JUEH 5DT1L 3LRSA 5ID1A 4IRSA 1IKNA 3QI9B 3UDWC 4EJ1C 4LCWD 5EIQA 4X98A 4OLYL 1HK6A 4PRBB 4PJHB 4WFEE 1I1CA 4TUKH 5EZJB 2C9AA 4PS4H 2R15A 4L9LA 3F12A 2HWZH 4RAHA 5GRXG 2VDOL 2Y23A 1UVQA 3MCLL 3ZDZF 3FB7B 1LDPL 4MJ2A 2GJ6E 3PWPB 4NYLB 3WIIH 1HDMB 5C09B 3T04D 3SDXB 4N9GB 5JLZB 5ADOH 5J7CC 1RVFH 3IYLW 4HW6A 5C2BL 2J1KA 5CHNA 1F4XH 2JCCE 3CUPB 3S3PA 3SE4C 1UT9A 5FGCE 1X81B 3ULUE 1G7PB 2DRUA 3ESVF 3PGCA 1UWXK 4HF5L 5HGAA 2YEZA 1NCWL 1XGRA 1ETZA 4QWWC 5C0EB 5J6HA 1WFTA 3EO0B 1KV3A 2P8LA 4OD1H 3GSWA 1IARB 3FO0L 2JB5H 5IB3B 1ZA3A 2FECL 4NO3A 4GAGL 3MLZH 3HI6L 3HN3A 4MQTB 5CINH 5E99L 3IVKA 4EI6B 3P4MB 2NY2B 5DQJB 3OKLA 3HE6A 3IDUA 4FFYH 3VRJB 4QHNB 4S1DC 1T22B 5A2JH 4U1MA 3B8SA 3RI5F 4OZIA 3S98A 2X44D 4WTZG 1U3HC 4H88H 1G84A 2QSVA 4TSBH 1OF2A 3LQAH 1Y18A 1OF2B 2F19H 5LBSH 2Q8AH 1U42A 4PJ5D 1CBVL 5IFHH 3OR6B 3DGGB 3BQUA 4HCRH 3V79C 1QLEL 1GGBL 5DHYB 4U1MB 3L3IA 3MBEC 3ZTJG 2EZ0D 1NL4B 5I8EB 3D25B 4FTVE 4FFVC 1QFWI 3MLXH 2FB4H 2VZSA 1KELH 5F7DB 3WSQH 2R9HD 3FQTA 5FGRA 3DHJA 4NO3B 1A6UL 2E7HA 3WS3A 1A02N 1EEYA 2FGWH 2HFGL 5I6XB 4RFOH 3BOVA 3LZFH 2VDLH 1J0JA 3DSNA 1KB9K 4RCAA 2UYLA 3D2UA 4TN9A 4F33A 5DJ6B 4TVPE 5I19H 1HEZB 5IVXF 1JGEB 3NZHL 2F53D 5JLZA 2NXZB 2PXYA 3SDXA 3PJSB 4XPTH 3ILPA 5KSAA 5F1KC 3TJHD 1H9VA 2APXA 1Q72H 2I9TB 2HLFC 1BREA 2VXQL 2WBJD 5EBGA 2DM2A 5I16A 5EO9B 3D5RA 5F89A 4UNTA 4KMQA 3BMVA 3EGSB 4WDIA 5ETUB 2NW3A 4P5KA 4JZNB 4YZFE 1NCAL 3MROB 3SE9H 3VFOA 4P3DA 4WCYH 4YDOB 1QR1B 2XTJE 4L8SC 2ADGA 5I1LB 4PJ8A 2G02A 4LSUL 4RMVA 3O41B 2VAJA 2Z91A 2A38A 1MLBA 4M9OA 2A1WH 4XCEA 4QTHA 1NBZA 5KN5B 3T0EA 2Q7NA 1ORSB 3O8XB 1U95A 4HZLA 4IRZL 5T1DH 4HWZB 1X9QA 4KTDH 1A1MA 4PJ7A 1UZ8A 4PGBA 4WY7H 2CMRH 3C5ZB 3HCVA 5HSFA 1P6FA 2ZISB 4AMKL 2EIBA 3LDBB 1SY6L 4XH2B 1RUAH 1DANU 1MI5D 4N68A 1W2KT 4ZFOB 3U0TA 2HRPL 2AKRB 5CUSH 2ESVA 2YPKA 4HG4K 4I4WB 2HG5A 3MBEA 4RA3A 3VGAB 1WICA 3MMEB 1P69B 5F1IB 4NC1C 4MDJA 1KIPA 2V3NA 2WBKA 5EA0H 5JNYB 3QQ9C 3D1MC 4E42B 3QEUB 4ODWB 1FDLH 5GS0D 1Y6NR 1K4DB 1P1ZB 5HPOA 5ANME 4UDUB 1IGML 35C8H 1JIBA 1SBSH 4GRWE 3OSKA 3N9GL 1NBVH 4M6NL 5E2JA 3IXAB 1XGQA 1VADB 5KTEH 5TE4H 1V3MA 1P2CB 4OGXH 3QAZC 2R56L 4HFWB 3ETBF 3AVEA 2FEEI 4Z7VB 1M05A 4M7JH 3PQYA 4XP4H 4JFYA 2RJMA 5B21A 4P4RB 4FG6C 4XHJC 4OLUL 4LLWB 5DJAA 3LKSB 3UBXB 2P44B 2FX9H 3MRBA 4NC0B 4WU7A 3SCMD 3GBNL 2XTJC 4XNZB 1GAFH 5L2KB 2OCFD 5ITFB 4PJ8C 3VI4F 1O0VA 3EDKA 1R5IB 4OLVH 3ARDA 1KENL 3BZ4A 5E4EB 4MX7B 4G80A 4M43L 3G04A 3EO9L 2HJLA 4M6OL 4PJCB 1AKJB 2HJFB 3NZ8A 4OSUL 4HIXL 3MXVH 1O1SB 1BOGB 4JY6A 5HHMD 3RGVA 2V2WA 2BHUA 1WFUA 1NQBA 2QSTA 2X5PA 1ONQB 4X4YA 1PGRB 3RY4A 3RVTD 2K9UA 1S8DA 1LO0H 3ZKND 3LKNB 4O4YL 2GQHA 3TWCL 4S2SA 4TRPH 2OS7A 2F8XC 4Y4KD 1VEOA 5JHDA 4W6WB 3QT2A 1AIFB 4E41E 4CVWA 5K59F 2D31B 4YBQC 3TZVD 1F11B 4G43A 1KLGA 1OQOA 4Y1AD 3VG9C 3EBAA 4JPWL 3LS5L 4OFPA 2FJFB 2I5YL 5IMOB 4AL8L 1OT1A 2BC4B 1TZIA 5ERWA 1MPAL 1S5HB 3MV9A 4L4TA 4GBXA 3WO4C 4F15C 4X4MA 1V5JA 2V5SA 5HHPA 1BWMA 3L9RA 3QNZB 3VXPB 5TE7H 4ALAL 1EAPA 4GUPB 1ZEAL 1T7VA 3WKMH 1DQJA 1TZGH 4HEME 1NANI 3ORJA 4BFIA 2A83A 1CCZA 2J8UA 3IKKA 1UA6H 5KSVB 2EIDA 3QI9D 4PV8B 3DURB 1JPTL 3HRZB 4ZYKB 2BVQB 2CIKA 4M7ZC 1K8DA 1WCBA 4KJYA 4X99B 1IKNC 2YD8A 4NN5C 3H9HB 5T1DL 3OKDA 4QHMB 2DI8A 4G9FB 2KZWA 2V2TA 5ESAB 2BFVL 3ZDZE 2XPGA 5DD6A 1F3DJ 3SDDA 1MI5B