4FXGB

Complement c4 in complex with masp-2
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
739
structure length
738
Chain Sequence
VNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 176
structure length 738
sequence length 739
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.30 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4fxgB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxgB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxgB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxgB04
4WGVB 1OARH 2P8PB 5ALBH 5D5MB 2B4CH 1H15A 1MFCH 4KQ3H 4O2EB 5I74C 4N0YH 3H7BA 3JZ7A 3LKQB 2BNRB 3E6HB 4OCWH 1H36A 4MAYC 4OGXL 4JDTL 3SGDH 5DJ6B 2Q1EA 1VACB 3W0WD 2ADFL 1FZMA 1ZGLP 1HZHH 3O2VL 4NQSA 2EXWC 1RZ8A 5C09E 2DAVA 3VI4E 4I2XB 2GJ6A 2QR0A 1AY1H 3KXFB 5CJOH 4AIZB 4G9DA 4NZRH 1X4YA 2JKXA 1R5IB 4R26L 4KDTA 3FZUD 4WI8A 1V8HA 5E95B 3QQ3A 5L8JB 1AO7B 1WZMA 4UV7L 4ZTOL 3M8OL 3V6OA 5TH2B 3VRIB 4D9RD 1OPGH 4K3JH 1L7IH 4BQ9A 1IGMH 5TDPB 1BOGB 5EU6B 4MAYA 5TFSL 4S1SL 4KMQA 1A7RL 4IHOB 3HE7C 1J0ZA 3ULVL 2D7OA 2Q20A 5E99L 2X89A 2QQLL 3O0RL 3QPXL 4AL8H 2LE9A 2SEBA 3UTOA 1SM3L 1FNHA 2ED8A 4KQ4L 4J3UA 3V6FA 5EC1A 1DSFL 3BW9B 3ZYJA 4JDVB 1QRNE 3BAEL 3D0LA 2H3NB 2F8XC 1XGYH 4YXLH 2GUOA 2W1NA 3MV8A 5K59F 2G0DA 1XGRB 4FQPA 4WJ5B 1T03H 4L1DA 2AJYH 3FQXB 4OFDA 2Y7QB 3GIZH 5GZNC 3TO4D 1OGTA 4LDEB 2XFXB 3DECA 3HMXA 3HE7A 1RK0B 5FGCB 2YKLH 3G6AA 4LBEA 5D1QA 2EDKA 4YHZL 2DF3A 4KVNL 5FM4A 1R3LB 4JO2H 5I1KL 4M6OH 3VXUD 3Q6FA 4PJFF 3KPQB 1UKQA 4L4VB 1ZHLA 1ZHBA 1FFRA 4KK6D 1DDHA 2YD7A 5DJXB 2I9LA 5ALCH 2P8MB 1GHQA 4WUUD 1CYGA 3WFBH 2EC8A 1DVFA 2Y07H 4LLQB 5CCKL 1J0YA 2NLJB 2YA0A 4OCLC 3TZVD 2XN9B 4U1JA 3G9VA 2XIDA 4YLQT 2V7NB 3ZKNC 1CU4H 3EOAB 2MCPL 3VI4F 3WO4B 1HQ4B 3LS4L 4P23C 3RUGB 4HH9B 2XZAL 4JB9L 5LGKA 1XCQA 1HHJB 5GS0L 4N68A 4JM4L 1J0IA 2D31A 3U7YH 3VXTA 3UTTB 4K2UH 3QUZC 5EU4B 5TDOA 1RULL 4M6NL 3LH2H 3NCMA 4I3RL 4CN6A 5HYSA 2FR4B 1I3RA 1H35A 3SDDA 3RZCC 1D5MB 5C2UB 3V5HA 4PGZA 1EBPA 3CCHA 5HY9A 4C56B 4PJDE 1ZTXL 1MCPL 3O3UN 4N5ED 3L3HB 4P23A 3VMOA 2VLJB 1LNUB 4PBVC 1I1YB 3D39E 4N9GA 2DJUA 1I9JL 1J7VR 3PWPB 3H6JA 4JZOB 4G6FD 4YWGL 3I6LD 3HHRB 1BJ8A 1K85A 2ZKHH 5HDQL 1F3RB 4AEEA 1W72H 3RZCA 5EN2A 4K7FA 3OHXA 4D4CA 3CFJB 2NXZC 5C0ND 2A0LC 2C26A 1FG9C 4UNTA 2W9EL 4NWUL 4QRUA 2WIMA 4QHUB 4GKNB 5BVJA 3PQYE 4IMLB 1T4KA 4NQCD 5F6IC 2VH5H 4WHCA 3QEQA 3D5OF 5D6CA 3E34B 1RFDL 4KPHL 4ELMA 5JLZA 1MJ7L 2FEDC 3DXAD 3N1GC 4DEPC 1T0MB 5CEXB 1XF5B 4FZ8H 3BWAA 1JWMB 5DLMH 5DJ2A 3ULSB 1QLEL 1ZLSH 3SDCB 5I71C 1CIDA 3BH9B 5JR1H 1I9RH 5KANI 5IVXA 5F9WB 2IWGA 4OKDA 1IJ9A 4TVPD 2VISB 4U7MA 2P46B 1BEYH 3GDBA 5IMKA 43CAA 3IU4H 5HI5C 1F02I 1WFNA 5DJDB 5C6TH 3ZT5A 5MP6H 3S5LG 2BFVH 1F97A 3HZYA 3JV6A 3OX8A 4BZ1H 3VFWB 4GLRI 1P1ZB 4J8RA 4O4YL 1OT2A 4CVUA 4N0CC 4ETYA 4D4BA 1EMTL 5TQ0L 5A40E 3GSXA 1KCUL 5I19L 4ORGB 3ARBD 5DMGC 5C71A 5IGXH 1JWSB 1B88A 2QTEA 1U6AH 1QSEA 1U91A 2XPGB 4M8QA 4PRIA 2AXGA 2V17L 3BP4A 2BC4A 4PJDF 4FQLL 4PD4K 1BZ7B 1Q0YL 2X5PA 4XBGB 5DVMA 1ZS8B 4CADA 4ZQKB 4BZ2H 4G80A 4J1UB 1J88A 5IEKB 4D3CH 2DI9A 2Q3AA 4G9FD 4Z7OE 4G6KH 1YNKH 1JRHI 1YEDB 5K9OB 2NW2B 3MRPA 4X5LA 4MDJB 4C4KT 4OF3A 2BDNL 4HXBH 1MOEA 2F58H 1PEWA 4YFLI 1DQDH 3QH3A 1EZVX 2XI9A 3GKWH 4PJ5D 4S2SA 2P24A 1UCBL 1OGAE 2WQ8A 3P4NB 1H0DB 1EZVY 1CXLA 5HHVL 5L7XL 1LE5B 3RJQB 4A2MA 2OK0L 4HLJA 4CGTA 2GTZA 3MOBL 5E2TH 1BBJA 2YD3A 35C8L 4U6XB 4U6YA 1J86A 3S96B 1WZKA 2NX5E 2XQBL 3T2NL 1PZUB 5MI0C 4L9PB 2VXQH 1DANU 1KBGH 4MCYB 1G6RH 3W11D 2HTLC 3EGSA 1MFAH 1NJ9A 1IKFL 1RU9H 4EXPX 5L0QB 1A7BA 2DLIA 1OF2A 2WP3T 4H25B 2GFBB 4IOSD 1UVQA 5IF0A 4XI5C 4ESKA 2YPLB 4LHUB 1N5AB 4XPAL 3TN0C 1E0OB 1K6QL 5CMAA 1M7DA 2H6PB 1N4QB 3CFCH 3MLSL 4R3SB 4EI6B 3VMNA 3UTSB 2WIIB 4FNLH 5HVHC 2Z91B 5E8DH 5IIEB 1DUZA 1BBDH 3OJMB 3RWIB 3UYPA 4YHNB 4NO0B 1XF2B 2WUCL 1T3FA 4WDIA 1J12A 1J05B 4JQXC 1A6UH 3L5JA 1DN2A 4OV5B 3QEUA 3TJHD 4LGRB 3TVMA 3BKJL 1JGDB 1KIQB 3CD4A 3TN0A 3MGOA 2EDLA 3F7YA 4P3CH 2A73B 1IZJA 5MERB 3QCUH 4UINL 1YECH 5EB9A 4Z7OF 2XXCB 1NDMA 3VXNB 4KJPD 3OEDA 1NAMH 1WWCA 1X5KA 4YUEL 1HN1A 4WFHD 5J6HA 4Y19A 2E6PA 2MPAL 5DC0A 1TJIL 3F7VB 4KRNA 2DM3A 2AXJA 4EN3D 2ICWA 1MAJA 3HRPA 3GHEH 4QRSA 3SFXB 1INEH 3H9SB 4JQXA 3EYFB 1DBJL 3LN9A 4YHLL 1BZ9B 3QEGL 2NY5H 4Y4HA 3U9UA 2JCCE 1IAIM 1KGCE 2LTQB 2O5XH 5LGHH 1YN6A 3LQAC 2X40A 3TNMA 1RZIB 5TF0A 1DEEB 2MQCA 3MLRL 1U3ZA 3C8DA 4M7LH 4XNUL 3CMOH 1MCOH 2AJXH 2HVJA 3DX7A 4HT1L 2E27H 5T1MB 3T1WA 1O79A 2ITDB 2XTJB 3FQWB 2MQ3A 5FM8A 2O5ZH 1QNZL 4X4ZA 3RTQC 1C1EL 4U6HA 3HC3H 1OM3H 4FQXC 4X8XA 4ERSL 5CJXC 3N0PB 1WICA 3OKNB 1BJMA 2AK4E 4MQXD 5EUKA 3FOMA 5F7YC 2W92A 1OP3H 4J3OC 2PCPA 3V52L 2VLKE 2BXZA 4LKCB 4BJLA 1NGQH 1YEJH 2APWA 5HYJA 4GW5B 4HCRH 4JFYA 2YA1A 3WCYA 1Q9KA 2E7HA 4WI9A 1OCWL 5HHPA 1GPOH 4X4XA 2CK2A 4U1HB 4OZ4A 3MRNA 2R69H 3MJ9H 3FT4B 2DLHA 2D0FA 2FSEB 3MLYL 1MCEA 1L9NA 2AW2A 1RUAL 5D7JA 2W0LA 1ZLUK 2VXVL 4GMSL 4OSUH 1TVBB 3IDGA 1MRFL 3QQ4A 2IGFH 2X4QB 3P4OB 1LE9B 4OTXL 4UIMB 3BIAX 3LKSA 3PWUB 4JRYA 4M7JH 2CKNA 3FN0L 3H0TB 5DHVA 4PGCA 3ZT6A 3LZFH 5EZIH 3WEXB 3T04D 8CGTA 3Q6GL 3DBXB 2VDOH 3RWFB 4O02L 4LFHG 3T1FA 1P4LA 4I5BA 1HKLH 2X1WL 3FB5A 3KAAA 1EHNA 2NR6C 4A6YL 3S6CA 5DA4A 3BP7A 4JREC 5F89A 2Y06H 3S35L 3C72B 1UXWA 3CC5A 2JCCF 3IT8D 2A9NH 3VXMA 2CO6B 4IJ3B 3LOWA 1QFUL 3NH7L 3GSUA 4Q6YA 1KTLA 2P8LA 5SX5H 4CMMA 3WDHA 3I84A 3RVUD 1QEWA 5BXFB 1A6WL 4I13B 5BJTB 2GSGB 5BV7H 2ZUQB 1CQYA 5F7NC 1YPZB 2NY0D 2XKNA 1AGEB 3OJDB 3CNKA 2AQ1A 4WHTA 1IC4H 2WWKO 3IJHB 4PJHB 3O6FC 3ROOA 5FYJH 2GW5A 1HXYB 5BOZG 3AM8A 4CMHB 4FQIL 4TSCH 1TLKA 4PTUA 2EE6A 5JW3L 7CGTA 3AS2A 3EYVB 5HYEA 5CLTA 1HH6B 1EO7A 4JFEB 2D03L 5F72S 1S8DA 1CL7H 3SE8L 1G9NH 3P4MB 2ENSA 3BUTA 1IKNC 4JY6B 4MWFA 2YSSB 3KPPB 3P3YA 3D85A 4NPYB 1V7ML 1KELH 3QFDA 2J8UE 3O41B 1DUYB 5A2KH 3IDIB 4LPWA 4UT6L 2I5YL 3ARPA 4BFBD 4YPGA 5IHUL 2BMKA 4XH2B 2ICES 1ZLVH 3QDJE 4D0CB 1QLRA 4MA1B 1V3JA 3HI1B 4U05A 3BRFA 2EDQA 5AZEL 4P4RA 3JVGC 5ID1A 3GK8L 3UMTA 3QNZA 4JHBA 3T0XA 1BIHA 1CFVL 1H9VA 1Z0MA 3V0VA 2YUXA 1CFSB 1XGTA 1DBMH 4RWYH 1D9KA 1S9WA 2BNRD 1BM3H 4JCLA 3QCVH 4LLWB 1QPPA 2Q6WB 1ACYH 2GI7A 5DRWB 1GXNA 3EO9L 4FXLA 2JE8A 5T5NF 3V4PL 1RZGA 4EVNB 3DUUB 1F45A 3KXFD 1Y6MR 3FOLA 5HGAB 3LKRB 1JNLL 1X5IA 5D2LA 1YEHH 4J4PD 3U30B 4LASH 1AO7D 3LHPL 4ZOEA 4LCUA 5DVLA 3F5WB 4ZUSA 1I3VA 1GVIA 2ZPKH 4ONFH 2HP4A 1MJ8L 5EU6D 3HN3A 2XQYK 5C7XH 5E03A 3CLFH 3RWGA 1OW0C 2PW1B 1VEMA 5F96H 5CJQL 5E00A 1EUTA 3TIEA 1K5NA 5I1DB 1J8KA 2V2WB 2VZTA 3EYQD 2DLTA 4S1DD 2HTKD 4JQIL 3O3BA 4NQDE 3D3VD 2IAMC 4Y2DA 1G7LA 1K8IA 2ED9A 4J6RL 3W2DL 2BXYA 5E94A 3SFYB 4YHML 5DJ8A 2J8UF 1T1WA 3U36B 3PG2A 3K4DA 4ZPTA 3SOBH 3TIDA 2M1KA 1QR1A 3TBVB 1FDLL 2ZUXA 4X9IA 2WBJB 1QUNA 1AD9B 4NRYA 4U4BA 4WU7A 4L4TE 1DCEB 4L3EB 5EU3B 1LP9A 4HWBL 5DD6A 2AEPH 4NKDA 3IKCB 1DLFL 4OZGE 4GKOA 4MNGB 3TJEL 2Z35B 1S9YA 3AXLA 3C5ZB 3TT3L 3STZA 5DK2B 3HE6A 3TM6A 3UAJD 4MQ7B 4KKBD 4NO2A 3GEWB 1YJDH 1ZA3A 4X4YA 3NCYS 2OJEB 3ZDZF 4NO5B 2FX8L 4U6VH 5D7KD 1FBIL 2XN9D 5INCA 5DDHA 1A7NL 4Q0XL 3QUXA 1EEZB 4Z95H 1SEQL 3ZYIA 5JO5B 4XCEA 4MBGB 5E1AA 4JPIA 1GSZA 5C0JA 5KTEL 3NGBC 5AAMA 1I3UA 4AQ1B 3SBWC 1ONQB 3U46B 4X5WB 3LEVH 4OUUB 5FOBA 3WD5L 1U95B 4CBPA 4D9LH 1XZ0A 1P4BH 4ONHA 3O3DB 1MFBH 2OJZH 3P77B 5CEZD 1FNEA 2PN5A 2GCYA 2VLJD 2LFGA 3I50L 3VFGL 1F3JA 5F21B 4QOKB 3BSZL 3IKKA 2XRAH 4LSTH 4OZHA 3SBWA 4TVPL 4JFQA 4LQFL 3MXVH 3MJ7A 1RUMH 4GAYA 2P5WB 2D9QB 5EO1B 4A6YA 1JGEB 2VLMD 1TZHB 3MREA 1KB9K 1MREH 2V5RA 4P46C 3WHXA 3HMXH 2ATKA 3ET9F 1ORQB 3OV6A 3LQZA 4OZGF 5B38A 4LAQL 1AFVL 5BMFH 3MRQA 3CDGB 3WLWC 4YFDB 3VD9A 3VFVA 4ODXB 4RA3A 2NYYC 2DQGL 3U6RB 3U0TA 4PLNC 4XB7A 4GG6B 3SDCD 1OOAA 1ZEAL 3RY4A 3IDJB 5GJTL 4D8PB 1IGCL 1AP2A 4TQEH 5IB4B 3UJJH 1QSFB 3C5JA 2I9TA 5KZCB 1FYHB 2PTTB 4U6TA 1SQCA 4FHBD 1ES0B 4HJGA 4P46A 1KXQE 1JGVH 5JIIA 4NYLB 3ZTJH 1JNNL 1UB6A 2YD9A 1QBMH 1C8PA 4PRHE 1JNHA 3UBXG 5F93C 3JWOC 5T3XE 5E8EA 1QFHA 3NFSL 2C1PA 4OGZA 5GSRA 4QHKI 5D1ZA 4V1SA 4GXUM 2HJLB 4FFZL 3HG1D 2BERA 3DX9A 3BPCA 3UZEA 4O58H 1KLFA 3VG0L 3HXEB 2ZOLB 4RGNB 5GSVA 5T1KB 3TPKA 1WVZA 2ADJB 1S9VA 1S5IH 4KKIA 1FLTX 2NY5C 4X99A 1H5BC 3ME0A 4PIRF 3TH2T 1CE1L 2P42B 4UILH 5A1AA 2DICA 1FFQA 4WV1A 3W0WA 4E42A 4CW1A 4YBHA 3WLBB 1NAKL 1GJIA 3KNBA 1JZ3A 2YUZA 4HUUB 3L3KA 1CD8A 1NMBH 2FWOA 5E7BA 4GTRB 1T04A 4HUXA 4ZO6A 5FHBL 4F58L 4YDOB 4XRCA 3VFMA 4XNMA 4ODHL 2WBWB 3K7XA 2XWBB 3SO3B 5AWNH 1H5BA 3EAKA 3EZ8A 4EI5C 3W9EA 4X6CA 2PTUA 3G5ZA 3TO4C 4ZOCA 3ES6B 1S64B 1KPUB 1FSKC 3MUHL 5DQJB 4Y16D 2OSLA 1AHWC 5JDJA 5EUOE 5SX4H 5C0DA 3Q5OA 1YC8A 5T33L 3DGGB 3AUVA 2DMBA 5T1DL 2VSDA 4OFPA 3UP1A 4KK6C 4ZO8A 2H8PA 5HHMB 4MVBD 1U58B 3FB8B 1IC5H 3C08H 1WC7A 4ISVA 4IRSB 2YHGA 3BZFA 1EV2E 5EO0A 1MUJA 1FAIH 1RUQH 3PHQA 4M1CD 2YPLD 4LHUD 1OAKH 1SBSL 2F5BH 1C12A 3TO4A 1BQSA 4I0KA 1IAII 4BM7A 4E41E 3TZVC 1HILB 5I18H 4M93C 4M5YL 1AGDB 1AHWA 3UTSD 3S37H 5DMKB 1XF3A 4LSVL 3VXQA 3VWKB 4HBQA 3PWJB 1G7JB 1GRWA 4K94L 3VXUA 3DSWB 1NFIB 2UZXB 1M05B 2X70A 5D70H 1C16A 3EOTH 4P2RE 4NO0D 4ONGL 3P0GB 3K81A 3VFUA 1T22A 3U2SB 4HW6A 5M94B 1NCUA 1UWGL 4L4JA 4WUUA 4I18C 4OM1L 4NKMA 4PJCE 3DYPA 2UWEA 2HVKA 1NPUA 2QSVA 4V1RA 4N0FB 1B0WA 4M02A 1S7RB 3HNSL 3PL6C 2X4PA 4LLUB 4G6AD 3TZVA 1NGXB 3HI6H 4MU9A 1T5XA 2WINB 5KG9B 3SQCA 3O2DL 1SA4B 5DRZA 1ZAGA 3FQUB 5IWLA 4OJFL 1KOAA 3ZE2E 1EXUB 1AXTH 3GMLB 3S34L 3SGEI 1G7QB 1S7XB 5ADPH 4WI7A 1EO8L 2FX7H 1MHHB 3H9SD 5HGHA 4Y5VC 3KPRB 4OLZL 2NXYB 5JORA 2OTWB 4WHYG 3G6JB 5F7UA 3UO1H 1FIGL 2DWEA 3VGEA 4MD0B 2JK5B 3WNOA 3T2OA 4GRMB 1EA9C 1CLCA 2VN4A 3FAXA 1ZGLA 3IDUA 5IM7B 1JHLL 1K4DA 4PD4J 2A83B 4HJJL 4OGXH 1F3DJ 1F5WA 1ZHKB 4JDTH 2H32A 2V2XB 1JPST 1NMCC 2ADFH 2P5EE 1PG7L 3H8NA 3LS5L 5D9SB 3SPVA 3E6FB 3BJ91 2BJML 3QIWD 4OAWB 4Y5VA 3SDAD 2XKSA 4R7NB 3FKUS 5LXGL 5ETUB 4G6ML 4R26H 3SDXE 2GYSA 3GO1L 3D6GA 1G84A 1JMZA 5E24E 4NO3A 5E2UL 1F6FB 3IDXL 4UV7H 4ZTOH 4GQPH 4EKXA 3IRPX 4NQCA 1CGSL 4U1MB 4PBXA 3DRAB 1BLNA 4NBXB 2Q7YA 1J5OH 4Z7NE 4LLYB 3QR2A 5TFSH 4S1SH 3DXAA 3ULVH 5BZDA 2IPTL 1ZSDA 4X5XA 5E99H 4Z0XA 2QQLH 3O0RH 3E32B 3F7PC 3WKNA 4KQ4H 4PJCF 5GS1B 3LN5A 3BAEH 5DMJB 3O3EA 2MJWA 4PJ7A 3BEVB 5CSBA 4YAQA 5F70A 1FFOA 3FONB 4PB0H 2P47B 5BZWA 2VXTL 1CQKA 1SHMA 4X8JA 1TNBB 5KVFL 5IFJA 1D8DB 4S0TD 3BO8A 4XCNB 1LHZA 3ZE2F 4NC2B 5HPOA 3TBTA 1CLYH 3JTSB 2DQJH 4DKAA 1NKRA 5E4EC 5CP7B 1FNLA 1Q72L 3OKDA 3D25A 3ARUA 4KVNH 5I1KH 3GNML 1SYSB 4FQ1H 4ZNCD 3RY6C 2VDLH 2XA8H 2ZCKH 3ARBA 5I1IH 5DWUL 2MHAB 3MV01 3DOSA 1OAZL 4ELKA 3CDCA 4YHIB 3MBEB 4J3XA 5IP4A 3I3EA 4GW1B 3VGAB 2QADB 5K9QI 5E5MA 3OKEB 1N94B 2YRPA 4CVXA 3W11C 4G9FA 2Z92A 1CWVA 1A3LH 2IADA 5BS0B 5E8OB 4L8BA 3ZSSA 3NFPA 2DQCL 4QWWD 3KWWA 2XZAH 4PJ5A 4JB9H 5FKPB 1KFAL 5K33A 4V2CB 4LRNL 4POYA 5DUML 5C08E 5GS0H 3SDXF 4JM4H 4PFEA 4PJEE 3I02B 3PDOA 5ESAB 1RULH 3BN3B 4U33A 1IM9B 1GH7A 3OL2A 1HSAB 4I3RH 4JFED 4KI5C 3CXDL 2FH8A 4Y5YA 3WIHL 1WITA 1D5ZB 2I07B 1XGQB 3U48A 5F1NB 3EHBD 4NQEA 2YXMA 2DQDL 4KGLA 2HKFL 1R5VB 1MCPH 3QO1B 3KYOB 5IVZB 1MI5E 1WLHA 1C7SA 1R5WA 2FECI 2HWZL 1MHCB 3M1BA 1DBKL 1HQRB 5B21A 4UIKL 1A7OH 3SCMB 3VG9B 4YWGH 2A74B 5I8OL 3TJHC 4TUJB 4JR9L 5HDQH 1NCWL 1I7RA 4POZD 5DHVH 2QQKH 1I1RA 2KQMA 4JJHA 2QSTA 5IB5A 5T5NG 1LD7B 1UJTA 3QXDB 4HIXL 3ARFB 4KJPC 4EUPG 1L0XA 4Q9QL 2W9EH 3RL1B 5D93C 4O2FB 2C5DC 4EN3C 4JQVC 1T1ZA 4JVPA 3BH8A 3ROLB 1LD9A 4KPHH 1XH3B 15C8H 3G5VA 1MJ7H 4NC1C 3JBG7 1YMMB 4H1LG 3QIBC 4XC1L 3SE9L 1G1CA 4LNRA 1QLEH 5KSBE 1LO4H 4JANB 4QRPE 1N6QL 1OAUL 4HFWB 3BRGC 1AXSA 4M7ZB 2FEEL 1U8NB 3MV9E 1FQ9C 5BRZE 2FZ3A 4JQVA 4FQQB 1W6JA 5D7IB 5I30H 1MSPA 5DYOA 1ZOXA 4XNQB 3R4DA 1T2QH 2LVEA 3O8XD 4O4YH 4JFXB 3UYRH 3QI9A 4G7YH 1EMTH 4PRAA 5TQ0H 2VQ1A 5I19H 3SE3C 4OGAC 4IRJB 5EOTB 1BQUA 4LSRL 1CXHA 4YNYA 4GT7A 2V17H 4WI3A 1WAAA 1NBZB 3CSPA 4FQLH 1KXVC 3QHFL 4JFDE 4KXZH 1MCHA 1Q0YH 2OP4H 4AEIL 4Z77A 1EAPB 4GQ9L 4XBPA 4H8WL 2WBJD 1I7TB 2C3WA 2EH8L 4KK9D 5E2JA 2NY2C 4JFFE 2VDKL 2O5YL 4P4KD 3STLB 4L3ED 2CMRL 4OD3H 2BDNH 2YC1A 1X4ZA 1GYAA 3VFSB 2R0KL 5IKCA 5ECJE 3RWDB 1UCBH 3W39B 1NLBH 3V8OA 4YR6B 4K3DH 2X4UA 2XWJA 5HHVH 2IQ9L 5C0IA 3C5ZD 3NA4A 2OK0H 1G7HB 3HPJA 35C8H 4PJGA 2XQBH 5EZJA 4EXKA 5CEZL 5DO2D 2PR4L 1U8MB 3RI5K 3D87B 4NM4L 1IKFH 2EE9A 4Z76A 5KSBF 1J8HE 3PWVB 5FYKD 4L8CA 1EVUA 2AEWA 3V0AC 3WMSA 5IQ9B 4ORZC 3MXWL 5TF1L 3H42L 1C08A 1KTKE 8FABA 4HXAH 4PJDB 4Q7DA 1Z9MA 3BKYL 1K6QH 2NY0C 4GBXB 2BOCB 3X3GL 3FQTA 3MLSH 3L6FA 3UBXB 2WK2A 5EC2B 3D39B 1R24A 1VADA 2PTVA 2HN7B 5I1GL 3L7EB 3T8XB 2WUCH 4GTSB 3MO1A 5BCAA 3DVGA 2EIEA 1RJLA 4QOKD 3BKJH 1B0GA 4UB0H 3I3DA 3MRKB 3PQYB 1JZ4A 5J1TC 4UINH 4Z0BL 1E4XL 1IILE 5EZOH 3HC0A 1WZLA 4YUEH 1Q94A 2MPAH 5E9DE 1AQDA 3DO3A 5DI8B 1A1OA 3FB6B 4D0DA 2CLVA 4PJIA 4U1NB 1DBJH 2G2RA 4ZG1A 1MFEL 3NFNA 4YHLH 3PABB 3EDJA 1YQVL 4V1DB 2VDPL 3T65A 2AXHA 2HLFD 4XC3L 4NSKA 3BPLB 1I7UB 3T0WA 1CDYA 2G5BB 3QO0B 1YY9C 4YDVA 1QSFD 3MLRH 5CJ8A 2Y5TA 3MROB 2P7TB 4XNUH 5KZCD 5HGGS 4HT1H 4HUVB 2OM5A 2R9HC 4NFBA 1U8PA 5DJAB 2EXYD 3JTTB 4O5LL 2OMNA 1MY7A 4UUJA 1C1EH 4GRWH 1DP0A 3QPQD 3QNYA 1I3GL 3OKKA 4BQBA 4TTDC 1Z3GL 3BPNC 4ERSH 3O45A 5J06A 4QY8B 3ULUD 3QULA 3DV4B 3GM8A 1FO0B 1RJYB 2PUQT 1QOKA 4GAGL 4GAJL 3BZDA 3V52H 2FIKA 2PO6C 3GM0A 5FYJE 3WUWA 1PX4A 1UZ6E 4PJXE 1T5WA 4WUKH 5E8NA 4QTHA 2IANB 4RGND 1FNGB 4J4PC 2P8PA 2RBLA 3RVXD 3WIHA 1CGVA 1OCWH 1QA9B 2BNRA 5F1IA 1HCVA 1JPFA 2EO1A 3HAEG 1MWAL 5DJ6A 3MLYH 1VACA 3P73B 4HS3B 4AMKH 2VXVH 4GMSH 5AG9A 4LU5L 1EVTC 1MRFH 1MNUL 5E6IB 2UYLB 1P4IL 3EYQC 4AIXA 2VWEE 1TENA 3DMMC 2HTKC 3F58H 4OTXH 4S1DC 4I2XA 1UENA 3KXFA 4AIZA 3FTGB 3FN0H 4KDVA 1EJ6A 1R5IA 2XKUA 3JWNC 2NX5B 4HWEL 5IJVB 1NEZA 1KTRL 3Q6GH 1AO7A 6FABL 4FMFA 2BVEA 4O02H 4OF0A 3VRIA 5L9DL 4UT9L 5EU6A 4A6YH 2F5AH 5FGSA 4IHOA 3FMGH 2Z0BA 3S35H 3FO1B 1KT2A 3BW9A 3BUYA 2BVYA 4YDJB 3G5XB 4P5KB 1NH6A 4XHQA 1T89A 3SGDI 2H3NA 3D3VA 4OZFG 4DZ8B 1MIML 1QFUH 2Q3ZA 3GMNA 4PPTA 4WFGD 1BIIA 1I8LC 3KJ4B 3WXVH 1TNYB 4I77H 1GXEA 3MZGB 4E5XA 4HK3N 4O9HL 3ARSA 1A6WH 4WJ5A 4KJQD 4KKBC 4I48B 3X12B 2E9BA 3FQXA 4JAMB 3KHQA 4JPVL 5DC4B 3WN5B 3MJ8B 4RX4D 5JZ7C 1RK0A 5C6PB 1FORL 3OB8A 5TJWK 5FDWB 1LO2L 3TYFB 1R3LA 4LGPB 3UDWC 1GC1C 1Z5LB 4FQIH 3KR3L 1QPXA 3KPQA 3CFKB 1KB9J 2QLVB 1UZ6F 4PJXF 5JW3H 1NC4B 5E6YA 2H1PL 2P8MA 1PD6A 2LU4A 4JM2B 3E3QE 1KCVL 2P1YA 4YO0B 3ALPA 4ZSOB 2HG5B 1VEOA 2HRPH 4UT7L 5JMRA 2NLJA 4DKFL 2XN9A 2FYYA 4EZMA 4M1DL 3RKPA 2V7NA 5IBUG 3INUL 4PBWD 2A77L 4EDXB 1HQ4A 1KIRB 4GKSA 3RUGA 4HH9A 4UT6H 2I5YH 5TE6H 4R4BB 2B7DT 5IHUH 1HHJA 3B9KB 5I6XC 1N2RA 3N1FC 3T0EB 4JGUA 1EK3A 5GGQL 1AIFB 2LQRA 2G60L 4NRXB 1FPTL 4NNYA 5AZEH 2NXYD 1D5MA 2IG2L 2D2OA 3GK8H 1CFVH 2FCBA 3L3HA 1HWHB 4AEHL 4B50A 5L2KE 2VLKB 4JZOA 3EO9H 5F9JB 4ZS6D 3OPZL 4PP2B 3V4PH 2VMFA 2J12B 4M4PA 4UNUA 3VW3L 2R4RL 2P49B 1T6VN 3TESA 5F9WC 3GJFB 4RISL 4B5EA 5IR1B 3AREB 3CFJA 2Y36L 3OGOE 1NCCL 3LKOA 2YRZA 3LHPH 4QHUA 4S1QL 1TJHL 2X9WA 2RCSL 1N4XL 4IMLA 2GJ6E 2DKUA 5FB8A 3HXDB 1F2QA 4MZ2A 1WCBB 5AYQA 1MJ8H 4H88L 1LEIA 1IM3B 3ETBF 3OJ2C 3SEPA 1T0MA 2R1YB 5CEXA 1WEJH 1XF5A 5CJQH 1JWMA 1HHHA 5DJ0B 3SDCA 3V6OE 3DPBA 4RAVB 1S3KL 4J23A 3BH9A 4JQIH 2EDEA 3KPOB 1YN7B 2WUBL 5C0BA 3H3PL 1XAUA 2R56L 1OP5H 3QZWG 1E6OL 3G08B 2VISA 5IB1A 5DEGB 4JPKL 3TYGL 1TJGL 1FDLH 1X5ZA 5DJDA 3PIQA 1CF8L 2DLGA 4XBEH 2BSSA 2ZG1A 3W81A 3HG1A 3VFWA 1P1ZA 1ADQL 1P2CB 4HWBH 3EUVB 1DLFH 4OLYL 3D9AL 1CD0A 4EUPB 1MJUL 1IQWL 3TJEH 2E8YA 3RU8L 2XPGA 3ILQD 3TT3H 4U3HA 5ERWB 3F6IA 1BZ7A 4N1EA 1A6ZA 4U2YA 3MBED 4JO1L 4RCAA 1JPGB 4XBGA 1ZS8A 4P99A 2QADD 3ZO0A 4TYUA 2X9XA 5CD3A 3A6BH 5IEKA 1SEBA 2FX8H 1FBIH 5LQBL 1YEDA 5K9OA 1A7NH 4Q0XH 5BS0D 1UT9A 2NW2A 2H32H 4MDJA 5L0QC 3WO3B 3DURB 1T1XA 3VFTB 3ZKMD 1BWMA 3RQ3A 3BYTA 1RV6X 1T0NB 1H0DA 4M1CC 3MLVL 1LE5A 1FFPB 5AG8A 3F8UB 1YYLL 2C1OB 3K1KC 2G75A 1IM9D 1Q9OB 2J8UB 3MRBB 4U6XA 3NTCL 1H3AA 1OB1B 2NTFB 1L4IA 5JA8B 4Y16A 1SJHB 4MA7H 3S96A 1E4WL 3QJHB 3WD5H 4MCYA 3ECBA 1EHAA 1BGXL 1MWAA 5IW1B 3QUYB 1HOCA 4DWHA 1CXKA 1AI1L 3I50H 1WFUA 5D2NB 3VFGH 4H25A 2I26N 4NN7B 1IGFL 3QUZB 2GFBA 2XQWA 1L7TL 4HUWB 4LMQI 3SCMD 1G0DA 4MXWL 2YPLA 4XP6L 4LHUA 4DCQA 4OIAA 1N5AA 2EC9T 4KDWA 2Y23A 1CD9B 1CFTB 2H45A 2H6PA 4LQFH 3HFMH 4R3SA 3UTSA 4AENA 3KPMA 2Z91A 2QKIB 1JUFB 3AS0A 3ARFD 1INQB 4TUKH 2BVQB 3Q7FB 3B6SB 4HKZB 3RWIA 5FYLD 4LAQH 1AFVH 4YHNA 4NO0A 3ALXA 2OR9H 4MS8D 1J05A 3H9HB 2CDGB 1GSMA 1YMMD 3GJEB 3DHJA 1JGDA 1KN2L 1KIQA 4HPYL 4X0KA 3UTQB 1ZEAH 2LTQC 5GJTH 3QEQE 3RKDD 1IGCH 1KYOK 4ELME 2XZQL 4DVRL 1K3ZA 3LRSB 5DJYB 4JKMA 2IFGA 4LVNB 3VXNA 2Q76B 1AXIB 5F6IB 4OGYH 4GTMB 2XTJC 1CXEA 3WHE0 3F7VA 1JNNH 2ZOKB 5IVXE 4DEPB 4NN5B 4NQDB 4RNRB 1XGPA 1NGYB 1QLFB 2NTSP 3H9SA 3ZHDA 1NCTA 1ZANL 3NFSH 3MNWB 1BZ9A 5ELIA 3LQMA 4FFZH 3UTZA 4XPBL 2G5RA 3GSRB 1WIUA 2Y6SD 3QNXB 1RZIA 4IRJD 4PGEB 1DEEA 4F8QA 4RFEA 1DQLL 5T1MA 2E9WA 1CE1H 1MCLA 2ITDA 2EICA 3FQWA 3LEYL 4DUVA 3WL9B 4AY0A 3MRCA 2VTFA 4OZGB 4BOKA 1NAKH 1QSEE 2C3GA 1EFQA 2ZUVA 4PRIE 3KHOA 5FYKL 3QIWA 3SDAA 1KLGB 2A9ML 3OKNA 4MJ4A 2ZWLT 4L9LA 3GSQB 1VPOL 2EH7L 5FHBH 4IRZL 1ZV5A 4F58H 4GW5A 1BAFL 5FECB 4ODHH 5AYUL 5IK3A 3BIBX 5HVFB 4ZAKB 4N8VA 4HWZB 1UWEH 4DN4L 1IFHL 2FHBA 4X4MA 4XNZB 3WE6A 9CGTA 4U1HA 3HR5B 5IQ7L 5GGRY 4X6BB 1S63B 1ZT1A 4PUBH 2FSEA 2RFXA 2BY2A 3QUMB 4MX7A 1TVBA 4O51A 5T33H 5EBMB 1LE9A 4KUCD 4N5UA 1UA6L 3PWUA 4IJ3C 2GTWA 1UQSA 4OFYD 4PRPD 3PZ3B 4U2ZA 1QFWM 2F54B 4ELMF 3JWDC 3H0TA 5FV2A 1CVRA 3WEXA 2RJMA 3DBXA 3DWTA 3RWFA 5CBAB 4HV8A 4CJ0A 4GBXD 1B9ZA 4M5YH 3LPWA 3V6BR 1X4XA 4KAQL 4LSVH 5E2VL 2ESVD 4K94H 4QWWC 3RIAF 3I6KB 4GXUN 1MCBA 3MR9A 2XT1B 4HMCA 4NQUA 4ZOBA 3PZ4B 4ENED 4OCSL 1PDKA 5GGUB 3NIDE 4MXVE 1UWGH 5ITBL 1TXKA 3BP6B 4NNPL 4OM1H 5BXFA 5I2IA 3ULVE 4H0GA 5BJTA 2GSGA 4M61B 5DJZB 4GTTB 4NQVB 1PKQE 5KOVC 3HAEB 5C0GB 1LILA 3HNSH 3STBA 5HDLA 2J1KA 1NL4B 1KPRB 3FQNB 1AGEA 4QCIB 5GIRB 5DMYA 4X98A 4I1NB 2EDWA 4W4NA 2JB5L 4PJHA 4HAFA 1HXYA 3O2DH 1HYSC 4OJFH 3ULUL 1UFUA 3S34H 4FMKA 3KYKH 3TH4T 3CZJA 1EO8H 5AEAA 2Z93B 4TULL 1HH6A 5C0CB 2A6IB 4P9ML 4JFEA 3B43A 1WCQA 4OLZH 3OKLB 4HF5L 3P4MA 3V4VH 2AS5M 2FGWL 5L88L 4V1DD 2YSSA 3KPPA 3OTTA 4WFED 3LEXB 4Z7VF 4PRHB 3I9GL 4NPYA 4PJ8B 4YX2L 1K3IA 3O41A 1DUYA 1JHLH 4IIQB 1QZ1A 3IDIA 4HJJH 3FCTB 1JRHL 1NUDA 3GSNB 3K4AA 1R3KB 2EKSB 2OCFD 4X7SL 3E33B 1PG7H 2X4OB 2MQ0A 5DXWA 5JIHA 4D0CA 2BJMH 3HI1A 2DQIL 4KHTL 5C9JA 5ITFA 2BY0A 2KDGA 5LXGH 3QDGE 1K4CB 4G6MH 5FM5M 1SVZA 1N64L 5E2UH 2IAND 3BQUC 3IDXH 3U30C 3D1MC 1CFSA 1CGSH 4X6DB 3UCRA 2ICEB 1DN0B 4IMKC 1BF2A 3QUKB 1S7QB 2XNAB 4OIBA 3FO0L 3DVNA 1A7QL 4LLWA 2IPTH 3K74B 5HYJE 3NIDF 2FB4L 5DRWA 5KSVB 5D7SH 4QEGA 3ULVF 3BD4A 5E6ID 1JYXA 3T2QA 4JG0L 1I8KB 2HFEA 2ITCB 5FM5O 4EVNA 1UCTA 3DUUA 3AY4C 3QIUC 3WFDL 4GMTL 5HGAA 3LKRA 2AEQL 2NX5D 2VXTH 4F33B 1FNSL 5KVFH 4JRYE 1EAJA 3AAZB 4HBCL 4KRMB 4NQXB 4KK9C 3EU5B 3TBYB 2E8ZA 3O8XA 2FATL 2PW1A 3GMQB 3QDHA 4RMVA 4M6AA 2JJUA 3GNMH 5I1DA 2V2WA 3BEWB 5DWUH 1R76A 3RDTC 3AY4A 1OTTC 4MHHI 4Y1AD 4E41B 1NL0L 4R0LB 5ID0B 2EDHA 3R0MA 3U36A 1RZJH 5EIVA 3VXME 2R15A 3W82A 1LEGB 4XVUD 2WBJA 5DO2C 5LGJB 1AD9A 3CXHK 4MSWB 4P4KA 4L3EA 5EU3A 4ZRQA 4KROB 4HLZG 3BN9D 2DQCH 2Z31D 4PJCB 2YWYA 2CIKB 1FZJB 1KFAH 2GK2A 3IKCA 3ZE1E 5SV3A 4LRNH 5DUMH 5FUCC 3BWUC 4KGJA 4LCYA 2R23A 1GZPA 5AGDA 4HC1H 5DRXB 1Q9LB 2Z35A 3HA0A 5F3HB 3C5ZA 1NC4D 3NZ8B 2P43B 3W5MA 4KI1A 4RFNB 4JM2D 3WIHH 1MRCL 3OWEA 3HPLB 3O6FB 4NO5A 3L1OL 2DQDH 1P9MA 2HKFH 4JVWA 1J87A 2BSED 1G7PB 1KG0B 1EEZA 2Q86B 2HWZH 2V8KA 3FHAA 5JO5A 1JL8A 4M7LT 1X5LA 3QZWB 1KZOB 1OAXL 3B9KD 5I8OH 4JR9H 5JW4R 3T0ED 1EFXB 5KS9A 1KCLA 3ZDYE 1NCWH 1ONQA 3MRRB 1RZKC 1A1NB 3U46A 4X5WA 2F15A 4OUUA 2AAVA 1AGBA 3FRUB 3MRHB 1A22B 3AFLA 4XWGL 3FO9B 2J3SA 3DSXB 1KLUB 3NCJL 3O3DA 2BY1A 5GGVY 3WKML 4IOIA 3P77A 3IDMB 2X4SB 4JZJC 3OR6B 3VFRB 4NZTL 4KK5C 1FC2D 3KPLB 3SDXB 4XPHL 4YGVB 2N7AA 3GSOB 4XC1H 5LG1A 5A2FA 2HLFC 2ORBL 4AM0B 5I8CB 5FF6B 1WT5C 4ZPVB 4L1HA 3X11B 3QG6A 1OAUH 5ACLA 3VXRB 5EO1A 1JGEA 1M6OA 1TZHA 1RJZB 1A9EB 3R0NA 5HJ3B 1RAMA 2R8SL 2EXYC 1MAKA 3NIFE 3VD7A 3CFBB 2VYRE 3ZE1F 4MLIA 3TC9A 2J88L 1X3DA 1ZMYA 1DEDA 3BDXA 3ULUC 5D2LE 3DI2B 5IBLD 4ODXA 2VIRB 4YFEA 5JXAL 4GG6A 3IFLH 3MLZL 2F9BT 4BFEA 3IDJA 3GBNL 4RGNC 5IB4A 1QSFA 4X9FA 4LSRH 3IFOB 1B6DA 1PKOA 3REWB 5B4MD 1U8QB 1W72B 3QHFH 2W91A 2H26B 4AEIH 5DS8A 1A4KB 5MENA 1EUUA 3KSLB 4H8WH 4LVEA 2YD2A 3RPKA 3WFZA 1W0WB 3HC4L 2VDKH 1ZT7B 2O5YH 2X05A 2AKRB 3DI3B 2R0KH 1ZK9A 3X17A 3W9DB 2ZOLA 4LP4A 4XCYB 4F15B 3PHOB 2ADJA 2IQ9H 5ISZA 4D2NA 2D4DA 3SO3C 1LP9E 1ZE3C 4MNQE 4CKVX 4YQXH 5KVEL 3K80A 1T1YB 4MZ3A 5C08B 1RIUH 3WLBA 5CEZH 3U7WL 2PR4H 3GMRB 1KEGL 4KHXL 3CMGA 5B39G 2GAZB 4NM4H 2DB8A 1IEBA 4X80L 4YBLB 4IRSC 1CBVL 4ZFFB 3MXWH 5TF1H 4F9PC 1CR9L 3H42H 3S97C 4J2XA 2EC9U 3B9DA 4GRWE 5JPMB 4Z7UE 4KFZC 3CU7A 5HI3C 3NIFF 1JHTA 5GRJL 3X3GH 1MI5B 1PLGL 2DYPA 3ES6A 3WS6C 5TE7L 2AJ3B 3QG7L 3MRFB 5FYLL 3DO7B 3VWKC 2V9RA 1F6LL 3ZKND 1JCSB 3QUYD 5I1GH 1U8LB 1XMWA 1MAML 1U58A 3FB8A 4LEOA 3NGBB 2GY7B 3QUZD 1MEXL 5JIPA 3QWOB 4FA8A 4MD5B 4JDZB 4WTXA 1K8DA 3O9WB 3DARA 4RX4A 1QG3A 2B0SH 3NPSB 2FO4A 3WS6A 3T4AB 2DQEL 1HILA 4G43B 1A6VL 1JWUB 1AGDA 1E4XH 4Z0BH 5DMKA 4JO3L 3V0WL 2H6GB 4LLVB 5MEPB 5JOPE 2EYSB 3PWJA 5E70A 4OZHE 1YEKH 4R4FL 1A14L 4N0RA 5E2WL 3BGMB 1LK2A 4BK5A 4PYHA 3T4YB 5KSBB 1D8EB 3CX5K 4Z7WF 2W0KA 3BVNB 3QEHB 1SYVA 5LJYH 2LVCA 3U2SA 1MFEH 1YQVH 1LP9F 2GT9A 3ZTJG 1IEAB 1S7RA 4XC3H 2BVTA 3KPSD 3O6LH 4LLUA 1IGTB 1NGXA 4Y5XB 4HQQL 4K9EH 4R8WL 3MQIA 1KPVB 2WINA 3VE0B 3DYMA 2VKWA 4DQOL 1OTUC 3OJVC 1IEHA 5F88B 4O5LH 2A6KB 3O4LD 5HYSG 1EXUA 3GMLA 5KSAB 1U3HA 5JHDB 1I3GH 4HIIB 2FEDD 1Z3GH 4TSAL 1V3LA 1WK0A 4NQDD 4XXCC 4GRWF 3OQ3B 1L6XA 4Z7UF 4ZYKB 4GAGH 1B2WH 4GAJH 4ALAL 5T3ZD 3VMPA 2OTWA 3G6JA 5DHYB 1A5FL 1QFWI 4MD0A 2JK5A 2LV4A 4OQTL 5J0BA 4GRMA 5J12B 4JFFB 4YIQB 1HHKB 4HHAB 2A83A 1MWAH 1ZHKA 2V7HB 1NAMB 2XZZA 3DUHA 3SE4A 3T3PE 1N4RB 3L3JB 3Q3GB 4XXCA 4F7CA 1X5YA 5D9SA 1P4IH 3E6FA 3MV7B 4N0CD 3SQBA 3DIFA 3L5HA 4HGWB 4R7NA 2VITB 3OXSA 1JI2A 3W0WE 2R1WB 3KLAB 1Z6JT 4K8RD 3E30B 5J57B 4HWEH 4LSSL 1G9ML 2OYPA 1DJSA 4OZHF 2R2EB 3C6LB 4WW2F 4NQTA 5JDSB 5L9DH 1J0JA 4U1MA 4UT9H 1JPSL 1J8HB 4ODUB 4LLYA 5CINL 2CKBH 3D69A 2BSRB 4D9RE 1O7VA 5GS1A 1YYML 4X6CE 2GJJA 1MIMH 2WLYA 3BEVA 5IFHL 2F54D 4Y4KB 3RWCA 2WM0A 5ADOL 4O9HH 3WXWL 4EI5B 3MBEC 4HWNA 3VGAC 3WDJA 2WMPA 2IPUG 4JPVH 3JTSA 3QXAB 1GAFL 4P49A 3CLEL 1FORH 5CP7A 5TGBB 3GUTB 1LO2H 2BVOA 3RRQA 2HTLD 4GS7B 4GAFB 4IDLA 3KR3H 3ZKMC 1SYSA 4QRRE 2KH2B 2MHAA 1S7TB 2V5TA 4C4KO 1QO3A 5EIIB 2CK0L 4XI5D 1ETZB 2H1PH 1S5HB 3MOAL 4YHIA 5I1AB 3VXUE 2R2BA 1G7MB 1KCVH 3RWHB 2X41A 1LO3L 3B4NA 2CGRH 3C9NB 1MELA 4KRPC 3U1SL 3OKEA 4UT7H 5L8LB 5E9DB 1FJ1A 1BFOA 1OVZA 4GXVH 3UJIL 43C9B 4DKFH 4WI2A 4IDJL 4S10A 4M1DH 2WAHA 1RZJC 1KYOJ 5BS0A 3INUH 4WUUE 1A47A 2C3VA 1ND0B 2UWEE 3GSWB 3HKFA 1OQXA 4LPVA 2KZWA 1FO0L 3SCMC 3VG9C 1SJEA 4UDTB 3LY6A 5CD5D 4TSBL 4YXKL 3TO2B 5GGQH 4JFOB 5C3LD 2G60H 5C0CD 1IM9A 3PL6B 3TA3B 3HCVB 3MFFB 4QXGL 1JVKA 1UJ3B 3EBAA 3EZJB 2XG5A 4ZUWB 4H20L 1D5ZA 1XGQA 2I07A 2QBWA 2CQVA 2EZ0C 3ARFC 5BV7B 1FGNL 5I75B 1VGEL 5AD0B 3ARVA 1R5VA 3QO1A 4DVBB 1QSZA 4OIIL 5IVZA 4PJ8D 4X6CF 4AEHH 1LEKB 2DJSA 1HQRA 2XWTB 3SCMA 3VD3A 2A74A 1FV1B 3AU1B 4LCWE 4TUJA 3OPZH 4WHDA 3EOBB 5E0QA 1XR8B 1IQDB 2BNUB 1KIUA 1D5IL 3ARXA 2HFFB 2R4RH 2DQFB 5GRUL 3QXDA 4LSUL 3SJVA 3T3ME 3I6LE 1VFOA 2B1AL 3HNTL 3NCYP 4LCIL 4OFIA 4RGMC 1NCCH 4YHYB 3P11L 4X7DC 3RL1A 4S1QH 4O2FA 1TJHH 1QTYT 5E5UB 1N4XH 3C6SB 4G8GD 3RTQD 4H88H 3SKMB 1XH3A 5B22A 4YHPB 4FQXD 5CUSL 1YMMA 3WFHB 1WF5A 2KUTA 4NQCE 3L5WB 1OTSC 4KJWC 2Y6SC 4IRJC 3EDDA 1A64A 2WUBH 4ODWB 4M4RA 2K7PA 1IAIL 3D18B 3CAFA 4HFWA 1E6OH 1G7IB 4H1LH 4R7DB 3G5YA 4JPKH 3TYGH 1AKJB 1XCTB 1U8NA 3GB7A 2J2ZA 1TJGH 5SV4A 3EYUL 4FQQA 4PJ7E 5GRVL 3V7AE 1CF8H 5D7IA 4TVPE 1D6EB 4CNIA 4PP1C 3BE1L 1NCDL 1ADQH 4HX1B 4QHLB 5CSZB 3SDYL 4OLYH 3P9LB 3D9AH 1A3RL 2LU7A 3LV3B 2Z8WC 4IRJA 3EOYG 5EOTA 3EYOB 1MJUH 1IQWH 2EDRA 3RU8H 1C5DB 1YEEL 3PP4H 1CFQB 3I2CL 3MUGB 2M2DA 5INDB 4FTVB 5TDNB 1FL6B 5A2IH 4JO1H 4HDIB 2NR6D 1CGXA 2AEIT 1UXSB 4X9BA 4QHMA 3BXNA 1I7TA 5CJBA 4ODSL 3DX8B 4PLJC 1F4YL 5CGTA 5LQBH 3GI9L 4YK4B 1X81B 3HRZB 3STLA 1EJOL 4F7PB 4KROD 4JY4B 5D6DC 3VFSA 4Z5RA 4QGTA 3RWDA 3W39A 4YH6A 2AJZB 3T3MF 4YR6A 4G9FE 3IAGC 3MLVH 2W07A 3UPRB 1YYLH 4R96B 5HHNA 4OQTA 2CLRB 3IJYB 4GBXC 4PJ5E 3NTCH 4O2CA 2VSCA 1WBYA 1W0VB 1E4WH 2GK0A 1FVEA 3RHWK 5ICXB 3LKNA 1U8MA 3MNVA 3O6FD 1IT9L 3HUJB 2DTML 3C2SA 4XWOD 3WHE1 4OFYA 1DQQB 4PRPA 3PWVA 5D6DA 1WSST 1AI1H 4ENEC 2DLFL 4RQQA 1IGFH 5IQ9A 4FFYL 4NQEE 4MXWH 4XP6H 2DI7A 2E9IA 1JF5A 3P9WB 4G3YH 1VKXB 5SWQB 4GBXA 4PJ7F 5EORL 5EOQL 5EC2A 2XACC 3ARQA 2ESVA 1H15B 2ZUSA 1HEZB 5JNYB 4AQOA 2DIAA 4LCCB 3T8XA 2DL9A 3H7BB 3KYMA 1RIHL 1UEYA 3O6ML 1MCSA 2ADGA 4OT1L 1KN2H 1RY7B 2GOXA 2CRZA 2FHCA 3MRKA 5DGRA 3BPLC 2GJ6B 3OG6B 3EW3B 3VXSE 2EDTA 2XZQH 4XZUB 5I17B 2BSTB 5B39B 5BQ7B 3VXRD 4KRLB 5FOJA 2VKXA 1F42A 5DK0A 4JEGB 5DI8A 4YDLC 2ZSWA 3C8KB 4U1NA 2D0GA 1ZANH 3MLTA 3K4ZA 4WFHE 1INDL 3V6FB 1IGYB 4V1DA 4XPBH 2AK1H 2WV3A 5FYJU 4H5SB 3D0LB 1I7UA 4EOWL 3QO0A 1TZGL 4G6JL 2QQNL 3BKCL 4R4NC 3MCLH 1JZ2A 1LDSA 2YBRA 1FGVL 1CDIA 4HUNB 4AJ0A 4HUVA 1N9AB 2VN7A 5MEQA 3LEYH 5DJAA 3VCLB 3JTTA 4K9EC 1NANH 1NGPL 1S7WB 3BZ4B 5CHNB 4UV4L 4GTVB 1OGTB 3EFDL 2HYMA 4WTWA 1EGJL 5FYKH 4QY8A 1WAAE 2A9MH 1FO0A 4LAJH 3CXHJ 1P69B 3B3IB 4WIQA 2F53B 1VPOH 2EH7H 3FN9A 4W4OC 2GIYA 3SGKA 4ETQA 3P2TA 1ZHLB 4X7TA 2Q87A 1BAFH 2IAMD 2IANA 1FNGA 3A0OA 5AYUH 3O3AB 1OWRM 4URTB 1E27A 5KVDL 5IMOB 2I9LB 3A6OA 1QA9A 4DN4H 1IFHH 2E7LC 2DKSA 1KCRL 1NFDA 5IQ7H 5HHXL 3ARZA 1DVFB 5D1XB 2NY2B 1DL7L 2FECL 3P73A 4HS3A 3PGDA 1U3YA 5IFAL 2RHEA 5E6IA 4XNXL 2UYLA 4JN2B 2JTDA 2KQNA 1KACB 4F7TB 4PJGE 4W4OA 2BHUA 2WLZA 3FL7A 3FTGA 1XCQB 3KJ4C 2NX5A 1R3HA 2D31B 4YEEA 2F19H 4ZNEA 3L5XL 1A6AB 2E7LA 2XOTA 2VL4A 3WN5C 5C0FB 1I3RB 3SDDB 4LHQB 1YNLH 3BZEB 4WRLA 5FDYA 1MI5D 4I4WB 3O11B 5E2VH 1U8KB 3BN9C 4YDJA 3QBTB 3G5XA 3M45A 3RWEB 1LO5B 3U83A 4Y1AA 1J0KA 4BH7A 2W9DH 4DZ8A 1K2DA 3DNKA 1SY6L 4OCSH 2WANA 5ITBH 2X42A 4NNPH 3GBML 5T3XH 4I48A 4JM2C 1I1FA 1MQKH 4JAMA 2YA2A 3WN5A 3O9WD 4OZFH 3MJ8A 5FKAB 4OM0H 1X9QA 4K7FB 4PS4L 1ZVHA 3MFGB 5FDWA 5D8JL 2Z31A 1Z5LA 4XVTL 4ZS7L 4GLRH 4M5ZL 2VZOA 3B9KC 3CH1B 4AG4L 1BFVL 1NC4A 5T3ZL 4TULH 4ELMB 4P9MH 4KZDL 3ZSTA 5C9KA 3QYCA 4HF5H 3BWAB 4FG6C 4JM2A 3Q7AB 5HYFA 4KKCC 4ZSOA 4HPOL 4MJ6B 1KJVB 4XCFH 4OF5A 4PJIE 1FVDA 1PYWB 4KUZL 3I9GH 1MHEB 3JSSA 4YX2H 5IB3A 4EDXA 1KIRA 4LHJB 1JRHH 4R4BA 4X7SH 3B9KA 3P4LA 5CZVL 5KSAD 3WLWD 5JHDD 4L29B 3T0EA 4LRIC 4QYOB 4LL9A 1AIFA 4K8RL 3JV6B 1R3IL 2DQIH 4KHTH 4OD1L 3ZTNL 5GGSA 3K2UL 2R0ZH 3AREC 4PJAB 1N64H 4YDKL 2AJVL 1QSEB 1U91B 4M8QB 4PRIB 3BP4B 2BC4B 2OL3L 4JFFD 4NHCL 3X3FH 5JQ6L 2MNUA 1GZQB 3FO0H 1A7QH 3QUML 1JFQL 3BPNB 2NZ9D 5IBLC 4CADB 1JMXA 2FB4H 5T5FL 3VXPA 4LRIA 4JHAL 1XF4B 2XZCL 4PP2A 2PO6B 2BNRE 3MRPB 3MV7D 4NM8L 3WFDH 4GMTH 3GJFA 5I16B 5B4MC 3ESUF 2AEQH 5B38G 4HFUL 1LK3L 3CSBA 4F57H 4Z7VB 5J4MA 4WW1B 3U4BL 4H26B 1W2KT 3C6LD 3Q78B 4LIQL 2OZ4L 3V5DB 4HBCH 5HPMB 1WCBA 4U6YB 3ALWA 4BH8A 1IM3A 4FP8L 1IVLA 2FATH 2HAZA 2R1YA 1AO7E 3DMMB 4ZFZB 5DJ0A 2D0HA 3EGSB 1NJ9B 2H9GA 5LKNA 5GJSL 3MBXL 5EU6E 4NJAH 1J11A 1N0XL 1OHQA 4FS0A 1OF2B 3KPOA 5GPRA 4PJIF 1NL0H 4HKXA 1UVQB 3DSFL 3G08A 4Y4KD 5IF0B 5HVWA 4EI5D 3V4UL 1BD2D 3KJ6L 5EIQA 4Q2ZB 1MH5B 4XVJL 2EEBA 5CMAB 1M7DB 3D3VE 4NWTL 2PYFB 2IBZX 4MDIB 1RZFH 4RFOL 1JCQB 3ESVF 3ZHLA 1GHFL 2IBZY 3MUJA 5EG6C 4K7PL 1P2CA 3BP5A 3T2PA 4DW2H 1PKQB 4X83A 3AGVA 3CX5J 3PV6B 1T3FB 4WDIB 2CR3A 4RBPK 3TWCL 5ERWA 4MA8L 5CKAA 3VDAA 2J4WL 1JPGA 4U3XA 2O61B 2PXYC 5FO7A 5E9DD 3V95A 4K3HA 1N95B 1J1PH 3S36L 3L1OH 1Y6NR 3QUYC 5IEHB 1NDMB 4QHKJ 1EGJA 4XPTH 2Q8AL 1GXMA 3DURA 3VFTA 4BQCA 5E8NB 5D2NC 4LF3A 4NN7C 1OAXH 1T0NA 2XN9E 3IFNL 2DD8L 4EDWL 2PW2A 3LQAL 4MB4A 3GI8L 2C1OA 4FQ2H 1MF2L 2FJGA 3RUGE 2B20A 4Y4HB 3PL6D 3U9UB 2YD5A 5TE4H 1OB1A 2NTFA 5HDOA 3TA3D 1SJHA 4WEUD 1N7ML 4LLAA 1UYWH 1UM6L 1YN6B 3TNMB 4XWGH 1S7SA 2APTA 3QUYA 2DBLL 3NCJH 3WKMH 3DSNA 3QDMB 1A0QL 3DRTA 5I6XB 1HSBA 4MNHB 4U1GC 5D2NA 5IV2A 4NUJB 3QDGB 3QUZA 4HUWA 4UTAL 1N4PB 1BMGA 5CEZE 5HTSA 1A7PL 1CFTA 2FO1A 4XVSH 3BGAA 4I8DA 2BX5A 4KTEH 2PCPB 4R9HA 4OZIE 1IARB 4LARL 3SKNB 5D96B 4HJ0D 2QKIA 4WEBL 1OQOA 4LVNC 1OARL 2QQQA 5F8QC 4NZUL 4QHNA 1G0YR 1MFCL 5HHPB 3B6SA 4HKZA 4N0YL 4XT1C 4OZ4B 1KC5L 4C55A 4OCWL 1NGZA 4NN5C 4Y2OA 3ZLQC 3H9HA 2CDGA 2VDRL 1FNFA 5D7JB 4WENB 1SY6A 3MTRA 3BHBB 1CZ8L 3GJEA 3RNQA 1I75A 4LPYA 1CTOA 3LKPB 5DURD 3UTQA 3KPSA 3L7FB 1AGFB 4GTQB 3MLZH 1NDGB 2MMXA 3GBNH 3LKSB 4N0UB 2W0FB 2CUMA 1F6AB 4NZRL 3ZL4L 2X1XR 2HJKB 3FB7A 3LRSA 5DHVB 5DJYA 1I8MB 1J1XH 1KJ2L 2YS4A 1JZ7A 2I25N 2JJTC 1MQ8A 3O4LA 1AKJD 1RPQA 1ZHNB 1OPGL 2ZOKA 4K3JL 2R4SH 1QHPA 1IGML 5D72L 4NQDA 1RUPH 4HKJB 5C0BE 1NGYA 1QLFA 3BP7B 4I0CC 3HC4H 3RNKB 5F89B 4R90L 3MNWA 3WNNA 3PZ1B 1MCKA 4G8EA 3GSRA 2NCMA 2VC2L 4K8RC 1CDHA 3VXMB 2RQ8A 1T2XA 2BK8A 4PGEA 3GSUB 2VZUA 1NSNL 4ZAKC 3P30H 3HG1E 3SY0B 4XNZC 4KKAC 4FTVD 2BVUA 2EDJA 3WL9A 3ARGC 5KVEH 5T1LB 1CK0L 4LEXH 4OZGA 3WNPA 2Y4SA 1X6LA 2W60B 1KEGH 4KHXH 4OFKA 1KLGA 5FFLA 1NGWB 2VXSL 3ZDXE 4NJ9H 4X80H 4M62L 4CAGA 3GSQA 5IMLB 1X5HA 2VLRD 3JV5A 4OZIF 3VGHA 1CBVH 1E4KC 4MD4B 2FDBP 4FQCL 5FECA 4XMKL 4A2LA 5B8CB 3CVHH 3H2WA 4HWZA 1FYTB 1S8DB 4PGDB 3VJ6B 3HR5A 4W6YB 3EDFA 4ZTPH 4X6BA 2OL3A 1TTUA 3S4SG 3CU1A 1NLDH 2Y07L 4XAWL 2XV6B 3QG7H 3V7AG 5FYLH 4NKQB 1V3KA 3QUMA 3D85B 2IPKA 5C0EB 3E1F1 1VFBA 2MSPA 2F54A 4YPGB 4YHOL 4I9WD 1MEXH 2J6EH 1TN6B 1FG2B 4KI5D 5JXEC 3GMMB 1X5XA 2EDOA 2DQEH 5JUEL 1A6VH 5DHXB 4PGBB 1U92A 5ID1B 2OZ4A 3V0WH 3UC0L 1QRKA 3QNZB 5DZNA 2XQYG 4R4FH 4EEEA 5E2WH 3I6KA 2JELL 4JY5L 3V0VB 1BFTA 2EIZA 3V5KB 1OSPL 1D9KB 5CD5C 5I0ZA 3UTPD 3UTSE 5GGUA 3BP6A 3MNZB 4M61A 1MPAL 4NQVA 4BKLB 3HAEA 1O6QA 4GSDL 4U1KB 5C0GA 1RZGB 1W72L 1KPRA 2V8JA 3FQNA 4HQQH 4QCIA 5C92A 5GIRA 4Q97A 4L3CB 2WY8A 3FOLB 1LDPL 4DQOH 4PJ8C 3TCXA 3ZDXF 1KB5L 4OLWL 3IRZA 4IIQC 4ZFGH 4LCUB 2JB6A 3UEZA 5C86A 4TSAH 3LMJL 1BX2A 2Z93A 4N8PA 5C0CA 2A6IA 4JPWL 3QIBD 4U0RB 3RWGB 4Q74A 5KVGL 1AJ7L 3TIEB 2E6JA 1H3CA 4JFPA 1U8HB 1UH3A 1A5FH 2X6MA 3LEXA 2E6QA 2R2CA 3B9AA 3H9SE 3J7HA 1G7LB 4PRDB 3O4OB 4PJ8A 5E94B 3WYRA 2XY1A 5DJ8B 5C0AD 4IIQA 3HLAB 3FCTA 4ZPTB 5C07D 4NUGL 1QR1B 1R3KA 2EKSA 3IU4L 3CFEA 1F11B 1JE6A 3GMPB 4Z7WB 5C6TL 3FRPA 4NRYB 2CSPA 5DVOA 1I1CA 2X4OA 1QQDB 4AYFA 4QXUL 3MACL 1BHGA 2F53D 4MNQB 1K4CA 4OGAD 3A6CL 4LSSH 1G9MH 2YD1A 4XX1E 4G42B 1II4E 4PJBA 3AXLB 3RI5F 3E37B 1NCNA 4X6DA 1SJXA 1JPSH 4G8GA 3RTQA 2ICEA 1DN0A 1IBGL 2VLLB 1S7QA 2B4CC 2XNAA 3QUKA 4NO2B 3VGFA 4FQXA 3IETB 5CINH 5CJXA 5KW9L 1ZA3B 4X4YB 5D1XD 1DVFD 3C5SB 2NY2D 4RMTA 1NUGA 5KSVA 5CILH 4D3CL 4M03A 4Z7UB 1YYMH 5DDHB 1I8KA 4X4ME 1XIWB 2ITCA 1A6PA 4DAGL 4GUPB 5IFHH 4XCEB 3ZYZA 5HHOB 3FAWA 3S7GA 4R0LC 3GBLA 1X6NA 4WI5A 3WXWH 4OCNC 4F33A 1O5DT 1U8IB 4M76A 3ZT7A 4D0BB 3L3IB 4BOJA 3DVIA 5D71L 4OF7A 4NQXA 1FCGA 1GAFH 2ZZUT 3CLEH 3MYZA 3TBYA 4UBDC 5FOBB 3OR7B 3VH8G 1OP5K 4KMTL 3GMQA 1XZ0B 4KROC 3RJ3A 1JNJA 4Y4FB 1QD0A 4ONHB 2NY4B 4N1HB 5IOPB 2J7LA 2CK0H 1T7ZA 1GCFA 3QFJA 4QXWA 4QT5B 2RAMA 2CIIA 1YA5A 4OZHB 4RFNC 4JRXD 4WW2B 5EU7E 1LO3H 2PETA 1KJ2A 1CVSC 3U1SH 1LEGA 4FABH 5LGJA 3UJIH 2HT4D 3QJFA 1CI5A 4IDJH 3GKZA 4FNLL 3Q1SL 4M9OA 4XWOC 1W8NA 3EO1B 4XCCH 1BBDL 4CDGC 3WHXB 1FZJA 3REVB 4TSBH 1S7UA 1Q9LA 4XPFH 5DRXA 4YXKH 1V7NH 1JPTL 3NZ8A 1P84K 1A6UL 4HLZH 5ANMA 3IJSA 2V9QA 4QXGH 1FN4B 2B5IC 5JPNB 3ISWA 3AMKA 3HPLA 5AZ2L 1MHPH 1FGNH 4JJ5A 1VGEH 3O6FA 3RIFF 4Q9CA 1AC0A 1YECL 5J6GB 4JFEE 1G7PA 4OIIH 3JWOL 5ILTL 2CUIA 1OAYH 2Q86A 5IMMB 3ZKXB 3QZWA 2X9YA 3GFUA 3I75A 4F80A 3GHEL 4UZGA 3EJYD 1JNHB 2ATPB 4HD9A 4I3GA 1IKNA 3B5TA 1Z2KA 5E8EB 4HWUA 5D1ZB 2V6HA 2VAAA 4JHWL 5IB2B 1A1NA 5BO1L 4GFTB 2NY5L 3NPZB 4XPGL 5J9PB 3BPCB 5F44A 5F3BB 5GRUH 4LSUH 1YY9D 1ULVA 3FRUA 3HNTH 3MGTB 2FJHA 3FO9A 4HUKB 1H3PH 1KLUA 3WFEL 1PSKL 2R9HD 2G9HA 1AR1C 3H9YA 3K8MA 2E27L 3IDMA 5LWYL 2JJSC 2QSCL 2X4SA 3B2UD 1MLCB 3OR6A 3RGVB 1FL5B 1U9KA 2PKDA 4P2QB 4WV1B 4TTDD 4CW1B 3HXBB 5CUSH 1BVKB 3DV6B 3KNBB 4YBQD 3GSOA 1JHKL 3PWLA 1KNOA 2FWOB 4AM0A 3JVGA 5I8CA 4ZPVA 2PO6D 4Q9RL 5EOCL 3X11A 2BEDB 4U3CA 4ZUUA 1GGCL 3BQUB 1PY9A 3VXRA 1YEJL 1UACH 5IESL 1FZOB 4HCRL 4XNMB 4WO4B 1RJZA 5F1KC 3S3PA 5HJ3A 1FP5A 5EU5B 2R2LB 4NHUA 3CFBA 4X6CB 3IAQA 3EYUH 1KEML 2RIKA 2C7UB 2R69L 3RY5A 4WWKC 1UEMA 1HE7A 2VABB 3BE1H 3PGFH 5DJCA 5K9KB 3HB3D 4AEFA 3DMMD 2L7JA 3QIUB 3SDYH 1F90L 3B5GA 1A3RH 1IGJB 1CT8A 4F15C 3F12B 1A3QA 1I7ZB 1WC7B 3REWA 1YEEH 4WFFD 5EWIL 4YXHL 1W72A 3I2CH 3LZFL 3BZFB 3IGAB 3OKOB 1MUJB 1BVLB 2VDOL 3PHQB 4RAUB 2H26A 4S11A 1A4KA 4OQ1A 4QRRB 1KB5A 2ICWJ 2AV1B 3CFDB 1OW0A 3K8KA 4EBQH 1W0WA 4ODSH 4EQ3A 1ZT7A 3GI9H 3MGAA 3VXQB 3DPYB 1FL3B 1EJOH 1U8JB 5A43C 3RDTB 1GGBL 4P9HH 4MJIE 3ULVD 4L4VD 1BOYA 5F7FA 5KJRL 2IAMA 2X70B 2A9NL 4XP1L 4YBLC 3W9DA 1N5YL 4MAUH 4XCYA 3S37X 1C16B 4XP5L 3PHOA 4E9LA 4QLRA 2VZSA 3VFUB 4L3EE 3U4AA 3N50A 3VXOB 4NKMB 4B53A 4NGHH 4W70A 1JCKA 1MY5A 4J12A 3FFCB 5GRYA 5JZ7D 2X4PB 3EO0B 4S0SD 2HH0L 2L7UA 3OB0H 4R97B 3GMRA 2V5SA 3AS1A 3H9ZA 1IT9H 2GAZA 2NNAB 2DTMH 2F0YB 3E2HC 1NEZG 3D5SA 3C87A 2DLFH 2YXFA 3HI5L 3KS0J 3RVTC 4ZFFA 4PG9B 4FFYH 3UTTD 1CFNA 5JPMA 1ZVSB 5HGHB 1WFTA 3O9WC 3S5LB 1CL7L 3IDNB 1VFUA 5FYKE 4PV8A 1MI5A 1RQ5A 3NPSC 3WUZA 5EORH 5EOQH 3UBXI 1A1MA 2IH1B 4BELD 4C56D 3MRFA 3DO7A 4F9LC 4QRQB 3QRFM 4LCWB 2XYCA 4OFVA 1U93A 5KS9E 4HIEB 1U8LA 4XXDB 3QDMD 1RIHH 3PGCA 3PWPD 1PJ9A 2H32B 3QDGD 3QWOA 4MD5A 1M4KA 4OT1H 5M95B 3SPVB 3THML 3AS3A 1TN8B 3O9WA 2OI9C 5F7KC 3EFFB 2WW8A 1F00I 4Y5XC 4YE4L 3T4AA 4G43A 5GISL 5FCUL 2ZUTA 2EYSA 3VRJB 3WBDA 3TBWB 3OAZH 3SKUD 4LGSB 1J1OL 4JZJB 4NQCB 5DEFA 4JLRB 1DBML 5KSBA 4P57B 4G5ZL 5DQ9B 1JN6B 4JFHD 5KSAC 3BVNA 2FHFA 4NDMB 1R3JB 1F8TL 1UZ8B 4X5XB 2IJ0C 1LTXB 4OI8A 1INDH 1IEAA 3QP3A 1BECA 3FO2B 3S4SB 3LN5B 4DK6A 5DQDL 3O3EB 1B0RB 1IGTA 4PJ7B 4Y5XA 1MIEH 4G6JH 1TZGH 4EOWH 2QQNH 3BKCH 2FBJL 5CEYA 4D9QD 1KPVA 5JW5B 3RWJA 5J12C 1FGVH 3PP3K 4P3DB 1N0LA 2ZNXA 5F88A 5DFVC 4GG6E 5J89A 1NGPH 5J1AB 2NZ9C 4LDOB 5EO9B 3R06B 4K3EL 5KSAA 5EPMB 4UV4H 5JHDA 4ONFL 3EFDH 5DZLA 4XNYL 3TBTB 4L5FL 1EGJH 5E56A 5H94B 2AVGA 4ZYKA 3Q5YA 3QRGL 3U4EA 4BUHA 1TNNA 4PRNA 3IXTB 2X4RA 1HDMA 3ARBB 5MENE 5FXCH 3MRGB 4CU6A 3ULUE 5KVDH 5SWSB 3C6LC 4JFFA 5KS9F 4U1LB 4YIQA 5FCSH 3LRHA 1HHKA 4HHAA 1KCRH 2V7HA 1DL7H 5T1LD 3L3JA 3Q3GA 5IFAH 4G9FB 1WBZB 5ISZE 2HMID 2VL5B 2IADB 1DE4B 2EDBA 3OZ9L 3MV7A 2BRQA 3KLHC 3K46A 1ROWA 3NFPB 3QDAA 2VITA 4HH8A 1IAOB 4MB3A 3KLAA 3MUZ1 1Q8MA 5FAAA 4UQ2B 2CDFB 4Y4KC 4LVHC 1N59A 2R2EA 3C6LA 5JDSA 3L5XH 4M8VA 2W65A 2JIXB 1E6JL 4LSPL 1FYTD 4I3SL 4ODUA 5DRNA 2IEJB 3NIGE 1A6TA 1EH9A 4NQEB 4U6VL 5H37H 4GS7C 2NW3B 1TVHB 3RGHA 2CR6A 3L3DB 1GGIL 2J8OA 1R5WB 1FZKA 1SY6H 1P6FA 1RK1B 3N9GH 3JUZA 4L8DA 1I1AC 4EI5A 4B7LA 1BD2A 3LPGA 3PF2A 1HNGA 4GG6F 2F8OA 4HCRA 4CU8A 4WFGE 1RVFL 3OG4B 3C2AH 4PR5A 1EX0A 2YZ1A 3LEVL 5HHQA 4PS4H 5TGBA 3GUTA 5AUMB 5D8JH 4XVTH 4QRTB 2DQHL 4KWUA 4E0RB 4YZFE 3FQRA 5IROC 1JGLH 4ZS7H 3E8UL 4AG4H 1BFVH 1D9KD 3ULUF 5EIIA 3BH8B 3VXSB 1CN4A 4KZDH 5I1AA 1JF1A 4EIGB 1G7MA 3ARDB 2WZPD 3TA3C 3RWHA 1UJ3C 2HFTA 4HPOH 4PTTA 5F1SA 5C0RL 5KSUB 5E9DA 5TQ2L 43C9A 5JOFA 2OXGA 4R6UA 5BV7C 3CK0L 4KUZH 5I75C 2KPNA 3NCEB 5LAXB 1AXSB 1ND0A 2D4FA 5CJ5A 3GSWA 4F8TA 4DK3A 3PJSA 5DC9B 2FZ3B 3U0PA 1KCKA 2EYTB 1B4JL 4UDTA 5CZVH 5BMFL 3TO2A 4I18A 4QTIL 4JFOA 4FXKA 4YFLF 3PL6A 4OD1H 3CH8A 3TA3A 3HCVA 3MFFA 3VFNB 3ZTNH 1UM5L 3K2UH 1UJ3A 4ZFOL 3QI9B 2X7LA 3N06B 4PRAB 4ZUWA 2VQ1B 5EUOF 4FRWA 4HJ0C 1HHIA 2YPKA 4HK0A 1G9NC 3NIGF 3VH8B 3UJJL 2OQJB 2AJVH 4YDKH 4YHYC 1QBAA 1N6VA 4DVBA 2OL3H 5CGMA 1U2HA 2XTJD 3UPAA 5JQ6H 3IFPA 1LEKA 1PVHA 2VWEC 4HZLB 4LHUG 4XMLL 3G6JE 2KL6A 1RSFA 1JFQH 3O2VH 1L0QA 4MA3B 1ITCA 5T5FH 3AU1A 4XBPB 2GSIB 2H6IB 5GS3A 3EOBA 2SQCA 4JHAH 1UB5B 1ERNA 5L2JB 2XZCH 1WBXB 2M8XA 1IQDA 2BNUA 4NM8H 1D6VL 1UH2A 1A9BB 4KTYA 2YC1B 3CDFA 3GMOB 1IC7L 2DQFA 4LPUA 4MNQD 1DLHB 4HFUH 4HIJB 3M8OH 1LK3H 1VGKB 2X4UB 1H37A 1JF6A 2W9LA 1JK8A 5C0IB 3U4BH 1VA9A 1RZ7L 5EBLB 4LIQH 4YZFF 2NQCA 1A7RH 2IALB 3QPXH 3SKMA 1CICC 1SM3H 1D5XA 4FP8H 1DSFH 1U2CA 4JRWA 5EZJB 3VGBA 3WFHA 1XGUB 5MHSD 3IVKB 3L5WA 1NMBL 3PV7A 1P5UA 1XIWD 5DFWH 5GJSH 3Q73B 3TPUB 3PE9A 5HHOD 4BSVB 3DSFH 2PYEB 1HH9B 5EZLB 2FJFB 3ARTA 3V4UH 4GG8B 3KJ6H 1AKJA 1XCTA 4NFDA 5SWZB 3WJJC 4ACPA 4HG4K 1AQKL 4XVJH 8FABB 3O81A 4NWTH 3FQTB 1HIML 4YHZH 4RFOH 5F6HJ 1GHFH 1R24B 4YK4C 3CX2A 5DK3A 1VADB 4K7PH 4HX1A 4QHLA 4NOFA 1I4FA 5CSZA 3E3QC 4Y4FD 5JHLL 3LV3A 2NY4D 1IGIL 4MYWB 5IT2L 1VSCA 1IC5L 3C08L 1C5DA 3BPOB 3MO1B 4GOSA 1D3CA 4Z7QE 5DD1L 4N9OB 3U0WL 3TWCH 2DBJA 4MMZC 4MA8H 5A3IC 3C09B 1RJLB 4JVUA 4FTVA 5INDA 5TDNA 4XX1G 1FL6A 2J4WH 5CCKH 2AV7B 1B0GB 1UXSA 3CUPB 1ODAA 3S36H 2MCPH 3DX8A 3LS4H 3FT2B 3AC0A 2EO9A 3RY6A 3EDEA 2Q8AH 1Q94B 2VLRA 4N8VG 1T7XA 1ZT4B 4JY4A 4L8SC 3RL2B 2AJZA 3MCKB 3CPLB 4M6NH 2BNQB 3IFNH 2EE3A 5D70L 2DD8H 4XP9L 3KS0H 4EDWH 1QFWL 5FA3B 3UPRA 3GI8H 4R96A 2HLAA 4Z7NF 4KRPB 2CO7B 2CLRA 1PAMA 2WWMD 1WWBX 4X7EC 3L3GA 1N7MH 2BB6A 1UM6H 4GW4B 3VWJB 1ZTXH 4FOMA 5DSCA 3HUJA 1HYSD 1YJDC 2Y5TB 4F3FB 2DWDA 3T0AA 4PJFB 1A0QH 1DQQA 4LCCC 1I9JH 5GGRB 4DTGL 4HS8L 4UUJB 4JN1L 1AXTL 3QNYB 3VRLE 5ADPL 4OLUL 4CDHA 3O45B 1FRGL 1J9CT 2X1OA 1A7PH 1VKXA 5SWQA 1VEPA 2FIKB 1WIPA 4LARH 4MQSB 1WZ1L 4KDTC 4NWUH 5C09B 2YUVA 4NZUH 3QAZB 1HEZA 2MFNA 1JZ8A 5JNYA 3TCLB 3V6OC 3CZFB 3V6ZB 3DSUB 1RFDH 1S7VA 4LCCA 5I8KL 5F1IB 1KC5H 5I73B 2GY5A 1JPFB 1N3NB 3VFPA 1I9IL 3SJVE 3RGVD 1UGNA 2DI8A 2VDRH 3KQ4A 4P2QD 4Z7QF 1KJMB 2ZNWA 1EO5A 1P7HL 1CZ8H 3S88L 5EOCJ 4KH2A 5FYLE 3NACL 1F58L 1U8OB 2DKMA 3MUY1 4K07A 3ZL4H 5F7DA 4DOHE 4RGMB 2E5EA 4RGOL 4XZUA 5I17A 2BSTA 5B39A 5BQ7A 1YMME 3BQUD 1NEZB 4PLKC 1KJ2H 1YEIL 4EN3A 1QRNB 4WO4D 3ELAT 5CWSA 4NCDA 4YDEB 3CSYB 1CE6B 1J5OL 4PJEF 4F7MA 5D72H 4M6ML 4Z9KB 3QIBA 1NCBL 3C8KA 3N1MC 4R90H 5D1QC 2GJZB 5CIPB 1KCUH 1KT2B 4GO6B 1IGYA 3BUYB 2NOJA 2VC2H 3QIUD 4ZDHA 4H5SA 3C8HA 4QF1B 4M7KL 3D3VB 2OX5A 5D7IE 4LNBB 3GMNB 1CLZL 3S35X 1BIIB 2ZSVB 1NSNH 1I8IB 4E5XB 5C0AA 4PB0L 5A2LH 5GS2H 5C07A 3VCLA 4NBYB 1CK0H 1S7WA 1GC1L 2CPCA 3BZ4A 1DVFC 4RBPH 5CHNA 5D1XC 4QRRD 4RIRB 3VRLF 5M7QA 1TZIB 1CLYL 2DQJL 2CLZB 3HXFB 1IAMA 2VXSH 3Q79B 1DCLA 3B3IA 3OXRB 2F53A 2D7QA 3NVQA 4M62H 5I8EB 3SE3A 3K8LA 3RDTD 4FQ1L 1OTTD 2VDLL 2XA8L 2ZCKL 3MRLA 4ZD3L 5I1IL 1BQHA 5L7XH 4FQCH 3LAFA 1MCIA 2WQRA 4DZBA 4XMKH 3O3AA 4RDQF 4ZFOA 2OTUB 4GKZB 3MOBH 4UTBL 5IMOA 3D0VB 5CZXC 2P4AB 1D5BB 1P84J 3T2NH 2FGZA 3P9MA 3SDDC 5D1XA 3FFCD 3TEUA 4XAWH 4XTRC 2X4NB 2FYYB 4JN2A 1A3LL 3DYOA 4M00A 3DROB 4F7TA 1NANI 3TT1L 4GKSB 2NY6C 3EJZD 4YHOH 1N2RB 4XPAH 1QBLL 4U1SA 3MYJA 3X13A 1FFNA 4LNGB 5ICYB 4AT6B 1A6AA 4PRPE 4NNYB 5C0FA 2V2TB 2HT4C 3BZEA 4DGYL 4I4WA 5JUEH 3O11A 1U8KA 4NN6B 3TFKC 3UC0H 2DN7A 3CJJA 1YNTA 2XA3A 3GIVA 4G8FB 4LCWD 2JELH 4JY5H 3RWEA 1LO5A 1OSPH 5D7IF 3OGCB 3TNNB 2V5MA 4OZIB 3RPIA 2ESVE 3DTXB 1A7OL 4WCYL 4JRXA 1MPAH 5I1HL 1VENA 4GSDH 4K71B 1C3DA 2JF1A 3LCYA 5FKAA 2QQKL 2AP2A 4RZCB 4RRPA 4UOW0 2P5WD 1LDPH 5JMOC 1TJIH 1KB5H 2ADIA 3LKOB 4OLWH 5H35B 5EBWA 2A1WL 2A6JB 3JXAA 1WTGT 2V5YA 5F7EL 5D4QA 1F4WL 1N8ZA 1ZA6B 3MRMB 5FB8B 4KK5D 3CH1A 4ZUVA 3EJYC 1S9XA 1LEIB 3LMJH 4N1CA 4X6EB 15C8L 3HZMB 4PY7B 4JPWH 4RAHA 1OLLA 4DFIA 3QEGH 1ZVYA 2K9UA 2AXFB 5KVGH 5HGDA 1V5JA 2BB5A 3HZKB 1HHHB 1SJVA 1AJ7H 1HCFX 1AH1A 4MJ6A 1KJVA 2VQTA 1B6UA 1LO4L 3H3KA 2D7TL 2E9JA 1PYWA 4NCC2 4JZNA 5C0BB 1MHEA 5IB1B 5EBGA 1QNZH 3B2UC 4V1DE 3MX0A 4YDLB 4NUGH 1NBYB 5H2BA 4WFEE 4GRLB 2FL5B 3RIFK 3GRWL 4YBQC 3PIQB 5FIEA 3WIFA 4L29A 4HULB 5I30L 4QYOA 1U41A 2BSSB 2YEZB 4KUCF 3NCBB 2H41A 4ZXBB 3HG1B 4QXUH 2X4TB 1T2QL 2X1QA 3MACH 5HDBE 3UYRL 3V8CA 4G7YL 3A6CH 4LQ1A 5T1KD 3BMVA 2YK1L 5D5MA 3KGRA 4PJAA 1KN4L 1YDPB 5IHLB 1JIBA 4O2EA 4AK1A 3LKQA 3E6HA 5CBEB 3I6GB 5SWSD 1A6ZB 1IBGH 3EYSL 4KK8C 1GZQA 2OP4L 1RUAH 3MLXL 1OGAB 1T7VA 5KW9H 2IANE 5CD3B 1UWXK 3F6LA 3U9PL 3HB3C 1SEBB 2Z4QB 4IS6B 1XF4A 4OLVL 4HMEA 2PO6A 3N85L 1NFDE 4DAGH 4OD3L 4MCZB 1T1XB 4M48L 5FO9B 4J4PA 3O6KL 6CGTA 4CUCA 5I16A 4WNQB 1NLBL 5TH2A 4K3DL 4Z7VA 4OF8A 4WW1A 2C4FT 4H26A 5TDPA 1BOGA 4NKOB 2G75B 2JIXD 3V5DA 5D71H 5HPMA 1KXTB 4Y16B 5KANG 4BFIB 1Q38A 1QFOA 4JDVA 3ECBB 4KMTH 3DMMA 3LSOB 3GSVB 1MWAB 4NQED 4XAKD 1TIUA 4ZFZA 4ZNEE 3ULVC 1HOCB 3NH7H 5HHMD 1XGRA 4IRSD 2DLEA 12E8L 5HI3D 1DTUA 4FN0A 2QL1A 5CP3A 5CZKA 2Y7QA 4DCQB 3TVMC 1XR9B 4Q2ZA 4HXAL 1MH5A 3MRDB 2XFXA 4Y1AE 1NCAL 2PYFA 4YEFA 4MDIA 4U7SA 4AENB 3Q1SH 3KPMB 4PV9B 3VWKD 5J3HD 2F8VA 4KTDL 1T7YA 4L4VA 5D7LE 5HDBF 2CKBB 1PKQA 3D48R 4EQ2A 1I8LA 1IAKB 2ICCA 5DJXA 3HS0B 1MLBB 2D03H 3M17B 3UJTL 3PV6A 1YY8B 1XFPA 3SE8H 1JPTH 3VXSD 5LBSL 2J5LC 4LLQA 3NZHL 3ARDD 4Y4HC 4X0KB 4UB0L 2O61A 3V7MA 4EJ1C 1EDQA 5AZ2H 1V7MH 5ICZB 3EOAA 1DQML 3UDWA