4FXGB

Complement c4 in complex with masp-2
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
739
structure length
738
Chain Sequence
VNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 176
structure length 738
sequence length 739
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.30 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4fxgB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxgB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxgB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxgB04
1I9RH 3L3DB 3QUKA 3ULVF 4NC1E 1FFRA 3U83A 4WCYH 2FBJH 4LLVB 5JW4Q 3V0VA 3K2UL 2VXTH 3DI3B 1KULA 1GOGA 1S7TB 3VWJC 3HNTH 2RCSL 3PP3H 4LPUA 4OV5B 3WDJA 4X9HA 1VGEH 1CFTA 4Y19E 4JFED 1PX3A 2CDGB 1BFVH 3Q3GA 5T1KB 3IS1X 4K3HA 5K59E 5EU5A 2VDLL 3NTCL 3HXBB 4A6YB 1IAIL 2DQHH 2ZCLL 2P4AB 1FAIH 1ZT1A 4BKLA 3UCRA 5BS0D 3CU7A 4M00A 1I4FA 2BVQA 3JBG7 4LLQA 3PIQA 1JNHA 4HXBL 1NBVL 3FQUA 3CUPB 5J7CC 5F96H 4YHIA 4XCNB 4MVBD 1KEGL 3QIUD 4OZIB 3NIDE 4OD3L 4HK3J 4LDEB 1FL6B 3O9WA 3D18A 1RHFA 2P8MA 2R4RH 3RY4A 2AK4D 1J0HA 4WW2C 2B1HL 4UT7H 1HINH 4NQDA 3X3FL 3KYNB 3QEUB 4LAQL 2NY4D 1FORH 3RJ3A 4NCC2 3QQ9C 3SO5A 4Q74A 3CH1A 1NLBL 1ED3A 1EGJL 4NM4H 4AQOA 1WWBX 3OJDA 3EYOB 4PP2B 1YNKH 2P44B 3DUHA 2H32H 5FYLD 3MBED 5M94B 2YKLL 4YXHH 4X5WA 3UTTD 2R0KH 4POYA 4P5TB 2JE8A 5D7KE 5EO0B 1CGXA 1T21A 4D0BB 4ONHB 5BQ7A 1F4WL 3AU1A 1CF8H 1UKQA 2HG5A 3BHBA 4UV7H 5DYOA 5CJ8A 3ZT5A 1TNMA 1RPQA 5DS8B 3BZFB 5K9QG 4URTB 1A7NL 4XVTL 5HHXH 1DQDL 1FYTA 6CGTA 4ODSL 5GGQH 5IESH 3ALPA 1WK0A 4KTDH 1A64A 4P5KA 1AHWA 3RWFA 2IALA 4K3JH 1T5WA 2PO6A 3RWGA 5HYSG 1MCIA 4MDIB 2YUZA 1X5FA 3FN9A 2ED8A 4LHQB 5SX5K 1YYML 3WL9B 1QPXA 4IRSD 1VGKA 3MRHA 3BXNB 1FNSL 1NJ9B 1PZ5A 2N4IA 5ALBH 2K9UA 4RCAA 1I3VA 1P7HL 3RZCA 2C26A 5TE7H 3I3EA 2ZSWA 3NFNA 4KK5D 1CLYL 3PNWA 1HIMH 2J88H 3BAEL 1DDHB 2HKHL 4DZBA 1G0DA 1P4BH 2EDBA 3DGGB 5HPMB 2UZIL 4WV1C 4QXWA 2F5AH 1KACB 4ERSH 1U8IB 1FO0L 2W1NA 4DAGH 4LVOB 5DJZA 1JZ8A 4LVHB 1KZPB 1U91B 1KTDA 5GS2D 5HYJB 1TCRA 1D8DB 3S36H 3WFBL 4YHLH 4OZHA 2VABA 2P8PA 2Z31A 4OFYD 3RX7A 5FYKD 2PETA 4RGND 3CCHB 4HLJA 3VMNA 3U7YL 5FO8A 3VXUA 3CX2A 3QCVL 3QUXA 3LKSA 3QIUC 1N4QB 2VLJD 3MRMB 1S7RA 4NZRL 3RU8L 3TN0B 1HE7A 1JGVH 5HHME 3SDXE 3UDWC 3CZFA 3EDKA 3KDMA 2GCYA 2GK2A 3EKCA 3MV7A 3ZE2F 3G5XA 3MUHL 4U1LA 4ZUVA 3MMEB 2NY4C 4LCUA 1HSBB 4U1HB 3IYLW 1YEFH 1EHXA 4FTVB 3OXSB 4N8CL 2BNRD 3QXUA 2AXGA 4KHXH 3IAGC 1OF2B 3NPSC 5DJ8B 5E2WH 4L3AA 3MBEC 5I2IA 3JSSA 5A2FA 4ZAKD 4HS6A 2HYMA 3VGFA 4GXUM 1NPUA 4FHBD 1P4IH 1K2DB 5E6ID 1JCKA 2ADGB 2NW2A 2LU7A 4DW2H 1TVHA 5IFAL 3AROA 3QEQA 3MLWH 1AQDB 4HLZG 2W59A 2LU4A 1W0WA 1LK2A 1TZGH 4IOIB 4F37F 4X4YB 1YJDL 4IRJB 3A67H 2FJGA 5J13B 1OSZB 5HYEA 1OAYL 2AI0H 2YD3A 4U0RC 4F7PB 3P73B 3BJLA 3KHQA 1JMXA 3V6BR 1A14H 1JGUH 3VFOA 5C2BH 5JMRA 3D85A 3PGFL 1OAQL 5GPRA 1QRNB 4TUJA 1WAAA 5HYSB 4KJYA 4XP4H 2VUYA 2YPLB 1QACA 4TTDD 1OAXL 4AZ8A 5B4MC 1FHGA 3OHXB 4JN2A 4YHMH 4IRSC 3VFNB 4XNQB 5DT1L 3MR9B 5E2VH 3C72B 4BSVB 1IFHH 4PP1D 2XZQH 5H8DA 1CIDA 5C0BE 3C5JB 2EIDA 3BPNC 4GXVH 4H20L 4YWGL 2DDQH 4P2QE 5CJXA 3RY6C 1F3JB 2D7NA 1B0RA 1DBKL 3LPFA 5I1EH 5DK0A 2V5SA 3D39A 4LU5H 1IGIH 3EYVB 4DZ8B 5D1XB 3Q5OA 3FB5A 1RI8A 4JO2L 4F58H 2FZ3B 4Y19B 1U2HA 5CGMA 4ORGA 4KRPB 3L3GA 2QL1A 4XC1H 3RIAK 1UJTA 3DSFL 3U30C 1VPOH 1B4JH 5H35B 3Q6GH 1KJ2A 4C56A 1CTOA 3VXME 2H3NA 2XA3A 5C0CB 3RVUD 5I76A 4YIQB 4OCYH 3LB6D 1VKXB 4YZFE 3LS5H 3RWHB 1K5NB 3NZ8A 2W65A 4ZYKA 5IW1B 2XPGA 1KN4L 3NBNA 1QG3A 4S11A 4PJFE 3VXNA 1T7XA 5D5MA 1MCOH 3FOMB 2F15A 4YPJA 5TE4L 3HXEB 2OJZL 1PAMA 3GSVB 1JZ2A 2DQCL 2Y1VA 4E41A 4NQCE 3OR7A 3MV8B 4LKXA 4J3XA 3QO0A 3DARA 3SKNB 3QH3B 5L0QB 4BFIB 2Y72A 5C86A 1JWSB 1R3IL 2BSSA 3FB7A 4QNPE 3ABZA 2OI9B 4HUXB 3CFCH 4O2FA 4WW1A 4MJID 2AK1H 3L5IA 4I3SL 4ZXBA 3U4EB 3LSOA 3T65B 1ZT4B 3DGCR 4K94H 4ZAKC 2IGFL 3BSZL 2G2RB 4HUNB 1CGVA 2ICWI 5EUOB 5E6IC 3FQWA 1H37A 4H1LA 2RR3A 1YEGL 2WSKA 4X7EC 1KJMA 3TBSB 5C3LD 2I9LB 4PBWD 1J86A 3L95B 5CZVH 5C9KA 5BV7H 1H5BB 4S0SD 4HZAA 2F53D 1C5CL 2Q8BL 5JORB 1FZOB 1UWGH 5FM8A 2V2XA 1AGFA 4ZUSA 1MREL 5F21B 4FS0A 2CKBA 2AXJA 1NDGA 1DBMH 3HZKB 5L6YH 2EIEA 1OP5K 5IMKB 4WHCA 4PJ7E 4HCRL 4PY7B 3AREB 4S0TD 5EBLA 3GKWL 4M7JH 4X7FC 2V7NB 1NCCH 1EAJA 2Z4QA 1RFDH 4L1HA 4J3TA 3W9EA 2PF6A 3BKJL 2Q8AH 3G6JE 1LEKB 1JN6B 2D9QB 3EBAA 2DL2A 1ZGLP 2Y25A 3EFDH 4JHWH 4PRAA 2VWEC 1DQQA 2GQHA 4NZTL 2IQ9L 3SGDH 1G9NC 3L5WB 4PP1C 2GAZB 5F9DC 1NMBL 4KI5D 3LEYH 4YHNA 2IAND 1MRDH 4FQQB 4O4YH 1QNZL 1E4XL 3L5HA 2Y36L 4KKNA 4TQEL 3AFLA 2VDOH 3QUMB 5AD0A 2YN5A 2OQJA 1NC4A 1IT9L 1OGTA 4N0YH 1QA9A 4BZ1L 3OKNB 1EXUB 1YC7A 1ITBB 4OCWH 1L4IA 5DDHB 5SWSD 3V6OC 1N95B 4K3EH 3HI5H 3GIZH 4P59H 3SKOB 4NKMA 5FA4A 4ZD3L 2C9AA 2DN7A 4GTQB 4HX1B 3RVUC 4KUCD 5ITFB 2VKXA 2BSRA 3LB6C 4WNQB 5HD8D 5E4IA 3GUTB 5DD6B 2NXZD 5I1JH 3L6FA 1FT1B 3MOBH 3SDDA 4LLUB 4I0KA 1X5ZA 3TT1L 1OHQA 3KPSB 2OP4L 5EU6A 4JAMA 1T20A 1H36A 2BSTB 3CD4A 4G6FD 1IM9A 4HH9B 4D9QE 5DMKA 5HHPA 1S78D 2NX5A 3VXOB 1NCNA 1ZLUK 4GRLB 4L5FH 5FKPA 2VZOA 2ICWB 1ETZA 4MAUL 5DJCB 3D69B 1BZ9B 5GRWA 1C12A 4X6CF 4W6WB 2AJUL 1BIIB 4ELKA 2D7PA 5H94A 1ZLSL 4KQ4H 4UT9L 4Z7VE 4EIGB 1EGJA 1EHLH 1G6RL 4GBXB 3QUZB 4TULH 2XWBB 3LN9A 2VL5B 3E6HA 1S7WA 3TT3H 1QSFE 3I02A 1GZPB 4CGTA 2G60L 3HC3L 5T1DH 1CBVH 2DQUL 3BP5B 3VFUA 5EN2A 2VTFA 2E7LA 3HI6H 1QKZL 3ARGB 1D6EB 1H15B 4BSJA 5CFHA 1S8DB 3Q1SH 1XGYH 1T3FB 4PGEB 5E03A 5FOJA 1J1PL 4H25B 3SGEI 1BQHA 1YEHL 3QO1B 2NY0D 4JKLA 3TLRA 1T2QH 1RZFH 3FO9A 2AJZB 1URLA 4YJZL 1D5ZA 2L7UA 5E8NB 2SEBA 4ZUTB 4ZTOL 4S2SB 1G84A 3V4PH 4M9OA 4V1DE 3RKPA 4N0UB 3C6SB 4DKEH 4PLNC 4KK9D 5MEOB 2F8XC 3B6SB 1FFOA 3RAJH 3H9SE 3SE9H 4X80L 4L8DB 1OW0C 4NN5C 5TDOB 3OAUH 5J11B 4KI5C 3LRHA 3RJQB 1BZQK 2DRUA 2EH8H 4Q6IC 5CSGA 5DF0A 3MRRA 1SHMA 1U8LB 3DVGB 4DEPC 5EWIH 3DX6A 3O2WL 4P2QB 4IM8A 2FX9L 5I9QC 3EJZD 3GM0A 3U46B 4U1JA 4TRPH 5EO1A 4P46A 3T2PA 2VITA 1FO0A 4G8GD 4M3KB 5I8OL 3ECBB 4BFGA 1BX2B 2QQQA 2X09A 1B6DA 2Z35A 5DLMH 1YQVH 5F44A 1TJIL 1RUMH 4WI6A 2ADJA 5DHVA 2ZOKB 4NKOA 1W8NA 3VXMB 3IDMB 1AGEA 4GKZA 3UJJL 5HD8C 2NXZC 3OJ2C 1IAKA 4RMVA 3UJIL 3VRJB 3ARYA 4DCQB 4HGWB 3TO2A 3KJ4C 2IWGA 4YHYC 1AGDA 1K8DA 3A6CL 4PJFB 5TH2B 3VG0H 3C60D 5GSVB 3QT2A 5FKAB 3QAZC 3ARPA 4HS3A 2AEPH 4NQCB 4ZO9A 4RZCA 5GJTH 1N59B 1N7MH 1Z2KA 3IDYB 4AG4L 5E99L 5I1KL 1C5BH 1JWUA 2IAMA 3HRZB 3WFHA 3NIGF 4JM2F 3DVIA 1UM4L 3MLXL 4PREA 4PJ5D 4X8XA 4XH2A 2EXWD 4Y5VA 32C2A 1W6KA 1MWAL 4R7DB 3TIEB 3BEWA 2AABH 4QT5B 5M7QA 3ROLB 4MXQD 2HT4D 1SBSH 3PHQA 1EDQA 1H3AA 5C70A 2APBA 5EZIH 1TQCC 3BZDA 3VFSB 5BXFA 2UWEA 3HUJE 5FUZL 5HJ3B 4NFCA 3WNMA 2NY0C 4LGRB 2UZXB 4TSCH 4PJBB 4OLYH 1L0YA 1A7PL 3WFEH 3DSSB 2VZSA 3MOQA 5HGDB 3AC0A 3GDBA 2X05A 1CXHA 3B2VH 4NSKB 4OCSL 4Z7WF 5IGXH 4ELME 5L7XL 2VH5H 3IRZA 4M6AA 4N8VG 4JZNA 2EO9A 3KYAA 1MJ8L 1MUJA 3HPLB 4KK9C 4EUPA 4YXKH 5I74B 2YXFA 1MCQA 1AP2A 3WS6A 5IB5A 1F2QA 2W0FA 1AXIB 1KENL 1X4XA 1MQKL 1WIPA 3OJMB 4MNGE 4NZUH 5E2TL 5IBTL 2A6IA 3VXSE 4OGZA 3N1QC 3OKOA 4XCEB 3GB7B 3EJZC 5T3XL 1OGAD 3PUCA 3VD4A 4S1QH 1MY7A 4D0CB 4LVNB 1MCHA 4MA7L 4JRYA 3O4OC 4M7LT 4Y1AB 1WICA 1W72L 1IEBA 1MLBB 1F90L 2HFGL 5E8EB 2ITDA 1N3NA 1Y0LB 1MY5A 2D4FA 1NEZB 2EIZA 3GMOA 4M6NL 3RL1A 4P23A 1FSKC 4LLDB 3SO3C 3EIFA 3K1DA 1G7IA 4FFYH 3D5OF 4HGMA 4XWGH 4AL8H 4DVBA 3U9UB 2ATKB 2Q3ZA 4QF1A 3RGHA 1YYLH 3O2DL 3U36B 1ZHNB 3F12B 3JV6A 3QFDA 4NNXA 1A3RL 3OG6B 1I8LA 3GZKA 15C8H 2HJFB 3C60C 4U1MB 1FNAA 1D9KA 2DKMA 1NAML 3VWKD 1MELA 1JMZA 2YA1A 1V7MH 4JFDB 5DQ9A 2XTJB 3MRGA 4JM4H 5DMIL 4EBQH 2BOBB 3GBLA 2A2QT 4XPTL 1M71B 3BD5A 4DTGL 5GS0L 2P8LB 1AXTH 1V3MA 4F7MB 1QZ1A 3UX9B 1DQML 2GHWB 43C9A 4LIQH 1JF1A 2GITA 3WE6A 4TVPH 2M2DA 2P45B 3VGBA 3H42L 4N0FB 3R8QA 4NQDE 2EXWC 4AEIL 1RZGA 4KDTA 4MA8L 4K7PY 5E7BA 3W2DL 4QTHB 4MXQC 2HT4C 4PJBF 5ESVB 5D6DA 3S7GA 5ICZA 4AT6A 4ZUWA 5KSAD 1ZA6B 2VLRA 3MRKB 1QPPA 5K33A 1DUYB 3MLUL 1OTSD 2Y07L 4Z76B 2XFXB 2J8OA 5D1QD 5C0IA 1F6LL 4RFOL 5KTEH 5C6TH 2ZCHH 4LSQL 1U8KA 4HCRA 2CR3A 3BKML 3GMMA 4XNYH 2I07A 3VGAB 5SX4I 4M6OL 3DJ9A 3LD8B 3ZHKA 5I6XC 4Y8AA 4LAJH 4ZFOL 5GXBB 2NQCA 3L3HB 3U9PL 2DMBA 2FD6H 4ODUA 1DTUA 3NMEA 1AD9B 1M6OA 1H8SA 4S1SL 1FYTE 5KANI 1QTYT 2JJVA 3SDYH 2XZCH 4P4KD 5EBWA 3OAZK 3VW3H 4PJDA 1D5MB 3WYRA 4R4FH 4P2OD 1H3WM 4OZGA 4X7DC 1JGDB 1EUTA 4I3RH 4LCWA 1KJ2H 1YC8A 2XZAL 3W0WA 3IVKB 4I2XA 4ZO8A 3R06A 1NUGA 5IB3B 4Q2ZA 5ACZA 4HWZB 5SWQB 4IHOA 2RFXB 3IDGA 4YDIH 5E5MA 1E4JA 2Q76B 5BS0E 3RWDA 5SV4A 3UBXA 2IC2A 2XWJA 4MB3A 4JJ5B 4YX2L 4LEXL 4KFZC 1MAMH 4MZ3A 4QOKD 4EN3D 3G5YB 1IC5L 3EDEA 4R0LC 3HXDB 2EC9T 1J18A 1KCVL 1ZXQA 4PJIB 4I18A 3B43A 3MNWA 2C1OA 2NW3B 3DYOA 2DQEH 5ADOL 3P0VL 5MHSE 4OZHE 2P7TA 5HVHB 2XN9A 4NCDA 5F9JA 3L5XL 2QKIA 3VWKC 4CN4A 4MWFB 4WY7H 5F7HA 5GIRA 4RMSA 3B9KD 3GSUB 3ZE0E 5FYLL 4GAGH 3TJEL 1Q0YL 2R56L 3VFRA 1MCKA 3DSNA 3NCMA 3RDTD 3VXUE 1NGYA 3JWOH 1QR4A 3LHPL 4KVCH 3FTGA 4JFQB 5FO9B 1HHKB 3WUWA 3PWLA 4NQUA 2WIIB 4RMWA 4JPKH 1KPRA 4U6YA 1G6RA 2NZIA 3ZE1E 4PGCA 4WTXA 4EKXA 1ADQH 1FLRL 1JHKH 3P11H 1FT2B 1HOCB 2X4PA 5LCVH 3MV7E 4R4BB 1RUKL 3PL6B 4CMMB 2PXYB 2V3NA 2CKBH 1NCDL 2JCCA 2I9TB 1CLZL 3O2VH 2ARWA 1X81B 3AM8C 1IQWH 1SJEB 3GFUA 1FYHB 4M03A 5A16A 4P4RB 5LWYH 3ET9F 1YMHB 1OTSC 3HUJB 1WCQA 1I1YA 4HDIA 3QDMD 5D1QC 5F9OL 3QI9A 2DM7A 4JFYB 3TBVB 4MD4A 3QEQE 1RU9H 5TF1H 4L8BA 3WO4C 4XMLL 2Q20A 4LIQE 1C16A 4Y2DA 4TVPE 3KLAA 3IFOA 4ELMB 1GXMA 1HHIA 4LSRH 3S35L 3QJFB 4BH8A 4BQ8A 3QXAA 3TF7C 5BRZA 1C08A 5AYUH 3QJHA 4FABL 3O6FA 2K7QA 2MQ0A 2DLHA 2VZUA 1IM3A 4YQXL 1WAAE 3O81A 1JWMB 4FQ1H 2ARJA 5KVGL 1AR2A 1IC1A 2Q7NA 3MGTA 2XI9A 4OI9A 4U6HB 3EAKA 2VN7A 3NTCH 4FFZL 4MNHB 2E7HA 2HN7A 4JRXE 1IAIH 3MJ9L 4RMUA 5MEQA 4P48A 3QEHB 1UKSA 4JGUA 4M02A 4GTVB 4HXBH 3QUKB 1NBVH 3NA9L 1BMGA 2AJ3A 3HZMA 4PJIF 4HC1L 1ZHLB 2GTWA 4KK8D 4KJWC 3P3YA 1LD8B 1KEGH 3GMLA 4OD3H 1G1CA 3D39E 2HRPL 3IJHA 1G0YR 4EN3C 3SGKA 5I1IH 5TQ0L 5J8OA 3G6AA 2R4SL 3I6GA 2BNQB 4XT1C 3C6LA 5DK3A 3B9DA 2FJFA 1UJ3A 3BT2L 3X3FH 5JHLL 4GTRB 1BM3L 4LAQH 4C56E 5I71B 1IARB 3HCVA 1JNLL 3B9KC 2EKSB 1NLBH 1EGJH 1ZT1B 1MHCB 2XXCB 2FRGP 1EZVX 1S9XA 2EYSB 2XG4A 2VZTA 3RDTC 3E2HC 4LLQB 3WO3B 3MRLB 3FQUB 3OAYH 4YHIB 5JOEA 4N90E 1LD9B 3VFPA 3PJSA 1F4WH 1VFMA 2VDKL 5D5ME 4LHUG 4Z7UF 2D3VA 3TO4D 2AV7A 4OD2B 4TNWF 5D7SL 3ULSA 4I4WA 3V0AC 4E41E 2F19L 5GS3A 4NFDA 2ILLA 2B5IC 3DHJA 4LCYB 3DSTB 2E7BA 2OXHA 4HJ0D 1DQDH 3EZJB 3DV6A 3T0EC 4ODSH 1MWAA 3OWEA 5F7DB 3D2UA 3P9LA 3CH1B 3OX8B 3GK8L 4JVPA 4HJGB 3QBTB 3OJDB 4TSBL 4Q7DA 1I1AD 2PYED 5K9KA 5F89A 5JZ7D 1JP5A 1GL4B 3S3JA 1T21B 2AGJL 2EECA 2VXVH 3AU1B 1FNSH 1OL0A 4V1SA 1I9IL 5DYOB 4GW4A 3HNSL 4UIKL 1IVLA 3ZYJA 3WIFB 5IIEA 2BZDA 3ORJA 4JR9H 5GGSA 1UM5H 1CLYH 3V6ZB 1L9MA 3BAEH 5DTFA 1VFUA 2UYLA 2HKHH 12E8L 2EDHA 2YC1A 4WWKB 4AEHH 2V8JA 1FYTB 3TYGL 4BZ2L 2UZIH 4LCCB 1T2JA 1FO0H 3ETBF 4LRIC 3QNZA 5E2UL 3VXRA 5D9SB 4EDWL 5KVEH 1D8EB 1T5WB 1YECH 5EOTA 2RGSA 3BYYA 4ZDHB 3WFBH 1YY9D 5E8DL 3QIWC 5F97E 2F0YB 4OT1L 3RL2A 3V6OE 1PZ5B 5A2IH 1MFBH 4EZMA 1AI1L 3RZCB 4PGZA 4W68A 3U7YH 2ZSWB 4KK8C 1JZ4A 3PNWB 3QCVH 4IS6A 4GTSB 4JQVC 2V6HA 1NFDB 3EO1B 3F7RA 5IJVB 4QHUB 2AJSL 3BIBX 4JM2D 4NZRH 2FWOB 3HE6A 1MVUA 3IETA 3RU8H 5F8RC 1HK6A 2IF7A 4W81A 3GGWA 4J8RA 1EJOL 3O2DA 5IVXB 5DJZB 4UNUA 1V05A 1KTDB 1MCCA 4OLWL 1U8QA 2NLJA 3SDAB 5FF6A 4N8CH 1U3HD 4H88L 1NAMA 5I8EB 2P8PB 2Z31B 1H3PL 4FOMA 1A9BA 4PJCA 4KHTH 4NRZB 1PFCA 2Y5EA 4NO0D 4XP6L 2ICWJ 2X9XA 3PWVA 2DQTL 5EC1A 4F3FA 1X6NA 2ITCA 4HKXA 1IKNA 3JVGA 3QUXB 5EU6E 3MOAH 5B39B 1JIBA 1S7RB 3G08A 3TO4C 4HJJH 3H3BC 4NIKB 2P43B 4JHAL 2ZUQC 5LVEA 3QIBB 4OCRL 1OVZA 1FDLL 4B50A 4F2MB 2NX5E 3C08L 1FVEA 4I8DA 2GCYB 5LKNA 3KWWA 3MV7B 2FO1A 4TNVF 3JTSB 2FX7L 3G5XB 1HSAB 4G8EA 4AEEA 4HJ0C 1QO3B 5KJRL 4LCUB 3U4BL 1UEYA 2F54A 3JZ7A 1B90A 2NXYB 3GMRB 3QQ4B 1RIUL 2VR9A 3PGFH 4YGAB 1OAQH 2AXGB 5D7IA 4GTMB 2ORBL 1ZLUH 3MTRA 4PRID 4NO5A 2CR6A 2O61A 1AKJA 1BREA 4HS6B 2LQRA 4K2UL 4WFHD 5JZ7C 2DQDL 1L9NA 3L5JA 4ONGL 1FVCB 5DT1H 4Z7QE 2LFGA 1TVHB 4EUPH 3DURB 3P30H 1UB5A 3TPUA 1SBBA 1A1NA 1KC5L 3OPZH 4LFHD 4MLSA 1R3JA 1LK2B 4ZFOA 4HAFA 4H20H 4YWGH 1U58B 1H3GA 1DBKH 4TTGA 4HPYL 2I24N 2EE2A 3EUUA 3TZVB 3VFOB 3D85B 3RGVD 3BP7B 1I7ZA 1CDCA 5D2NA 4JO2H 4Y2OA 1NCWL 2JIXB 1AFVH 2WP3T 3X17A 1CGTA 3DSFH 3BP4A 4JDTL 5MEND 3DPYB 1YY9C 3LKNB 4JN2B 4YBLB 4M4RA 3LDBB 1NFDF 1K3IA 2DWEB 2ZKHL 4NQEA 5JXAL 4CKVX 4UTAH 4X9FA 3B5HA 5C71A 2NY6B 4MXWL 4KROD 1I3RA 5IVXF 3DX7B 5DQDL 5CIPB 1GC1L 4PGDA 3X11A 1KN4H 4JM2C 1V5JA 4M9PA 3UTSD 2GEEA 2P5WA 4WFGE 5I1LA 4APQD 2OJZH 1PKQA 2DQCH 4XVSL 4M1CD 5KVFL 2E8YA 4ORGB 3N85H 4L4VD 5JA8B 1WTLA 4Z5RB 1ACYL 3MLVL 3RQ3A 5JLZA 1T66D 4GSDH 2PTUA 3NFSL 2ZG2A 3TIDB 1U3HC 4MAYD 4MSWB 1AO7B 2EDYA 2NY1D 3LQZA 2H3NB 1R3IH 3H3KA 3KPMB 1XF3A 2N56A 5E24E 5CBEA 4I3SH 1P7QA 4C55A 1CFBA 2IGFH 5B38G 1F2XK 3UTTA 3NZ8B 2G02A 5HI5D 3PQYA 5JQHC 2ZNWA 2XPGB 3ULVL 4X83A 3WHXA 1A5FL 1WCBB 4PJXB 1YEGH 5LGHL 5D5MB 4FQPA 4LASL 5IMLA 1HHJA 4G5ZH 1ZLWH 4PRPB 2PCPA 4JFPA 2Q8BH 3OR7B 5T1MA 4GTOB 1Q9LA 1WITA 1A2YB 5I18L 3VI3E 1MREH 1CQYA 3SPVA 2D9CA 5BOPA 3U4AA 1HN1A 2B4CH 3FB7B 4HCRH 4U6VL 2ICEA 4R7NA 3HI1A 2KKQA 4L9LC 2Y9RT 5JHDB 2WBKA 1I1FA 3RTQA 3LSOB 3MRFA 1LE9B 3VFGL 3BZEA 3QFJD 1IILE 5FGCE 3ARBA 4NT6B 2LABA 3BKJH 1RK1A 3FQWB 1KXTB 5DEGA 4H1LB 3ARDB 3MYZA 2KQMA 4NHCL 2F8OA 1P1ZA 1KJMB 4NZTH 5IEKB 5IB1B 2IQ9H 4U1GC 4YHOL 1NMBH 4O02L 3ARRA 1R3KA 4OZFA 4U7SA 2UWEE 3FQNB 1HDMB 1QFWH 1AGFB 1QNZH 4ZUSB 1G7MA 2Y36H 4F80A 3D1MC 4TQEH 4Y16D 1E6OH 1JBJA 1RJYA 1DBJL 3IDXL 5FHAL 3RGVC 1IT9H 1BQHG 3T8XA 4Y4FA 4BZ1H 1BP3B 2HT2D 3E3QE 5IHUL 5D7LA 1BJ1H 3LKOA 4QXTA 4M8VA 3O4LD 3SFXB 4ZD3H 4YO0A 5CLWA 4OFYA 5D96B 4PRAB 3GSWA 3HAEG 5FYJD 3WFCH 4KROC 2HT3D 5F1OB 3G5VB 4HC1A 4YHNB 4WFFD 1QSED 1TTFA 1EUUA 4IDLA 3TT1H 5AZEL 1T1XA 2OP4H 1S3KL 3KJ6L 4JRYE 2OQJB 1NC4B 4APQC 1TFHA 1NFIA 1OGTB 3I75A 5C08D 4M1CC 4P2YA 3C5SA 1DP0A 4QRRA 3SKUD 1T66C 1KELH 5JPMB 4E9LA 2XZZA 3QDAA 4MAUH 4MAYC 4NKMB 1RIHL 4X6EA 4XX1E 2NY1C 2AJUH 1ZLSH 4PJXF 2DI7A 2BSRB 1T0MA 3K8LA 2AXFA 3ESUF 3SDDB 5HI5C 2BCKA 2G60H 1BAFL 5FUCE 3R0MA 3T4AB 3HC3H 2NY3C 1T20B 4HKBB 3SKJL 3ZL4L 4O51B 1A7RL 4WTWA 4CU8A 4YR6B 5BZWA 5DMKB 5C7XL 3OF6A 3MRQA 3QUYD 2WNGA 1AGBA 4LSDA 4A6YL 4F8TA 5H37H 4O5LL 4HG4J 1J1PH 3O3DA 2WP3O 3HN3A 1P9MA 3MO1A 3T77A 2WBJD 3OR6B 4YDLC 4X98A 4GMSL 5H94B 2GSIA 3RPKA 1J12A 4JFFA 1HYSD 1DQLL 2FR4B 2MKLC 3P4LA 5T1LB 5FIEA 2WWKT 4U49A 4ZTOH 1KIRB 1YN6B 3M1BA 3GIVA 3LMJL 4KRMB 1UCBL 1BFSA 3SGJA 4KKJA 5DWUL 3VFUB 4FQLL 1HCFX 2AKRA 4X80H 1ZA3A 2E9WA 3D5RA 2PTTB 3EOBB 3SQCA 2X7LA 1QFOA 1QQFA 2VLRE 4P3DA 2HFFA 1T0PB 2WINA 2V8IA 1X5LA 5F88B 4AK1A 1E4WL 4DGYL 3FCTA 3O2WH 4Y16C 3DXAD 5C07A 3QDHA 2H8PA 3BGFB 4NQVA 2R2LB 4EJ1C 2HT2C 4XPBL 2NTFA 1RZ7H 1BBDL 4MHHG 2A74B 2AV1A 2SEBB 1DJSA 2ADFL 1MHEA 3VXPB 3GBNL 4ZFFA 1TJIH 1I3UA 3IFLL 4HK0B 4PJHA 5C0FA 5EOCJ 4ZPVB 4L9DA 1Z3GH 3I6LD 4NKQB 4RX4A 4QXGL 3UJJH 1ZSDB 4XCYA 4EUPG 5A1AA 4PJDE 3UJIH 3MLSL 4OZGE 5K59F 2ADIA 4F9PC 5FECB 4UDTB 4IMLA 4GH7B 5J9PB 4MS8D 1F42A 1ND0B 4EVNA 3Q0HA 4EEEA 1F97A 5DJ2A 4LCWE 1ULVA 2C4XA 3W0WE 2Y5TB 4I2XE 4J3OC 3A6CH 3HE7B 1IAOA 4U7MA 1N4PB 3CLEL 4N0CD 1RURL 2DQFA 1BVZA 4U1JB 4EXKA 3BPOB 4OJFH 4PJ9D 5FFLA 1JPST 2VITB 3SBWC 5C6PB 1J0YA 4JN1L 4K7PL 43CAA 3NIDF 2Z35B 2AEQH 4G6KL 5GGVY 4DKDC 2A38A 2B1AL 1J8HD 3O3BA 2YWYA 5C0RL 4Q6YA 1MJJA 1BZ7A 4NPYA 5DHVB 4J4PA 4NKOB 4GKZB 5I1KH 1GXNA 4XX1G 3S5LB 3GBML 4UUJA 5DA0B 5E9DD 1RUPH 2JJUA 2AJYL 4NP4L 2CO7B 1UM4H 3MLXH 3MUGA 4HF5L 4JO4L 4K23H 4YK4B 3W11D 2XN9E 2ERJB 1MWAH 1K8DB 3CSPA 2CUMA 3ZKXB 3KNBA 2LU3A 3E1F1 3QUYC 3EHBD 2F53A 4OAWA 5DRWB 4HS3B 2FSEB 4AH2B 1DLFL 3MRDA 5FUZH 4RZCB 1P7KA 5E2JA 2P24A 4PR5A 2WBJC 1DN0A 1XCQB 2GY7B 4L29B 4YNYA 3DMMA 1A7PH 4HKZA 1HYSC 1XT5A 1JWUB 1FBIL 2IAMB 1X4YA 2LTQC 4OCSH 2SQCA 3WFHB 5L7XH 5KSUB 2A6DA 4JFHE 4PREB 1MJ8H 1EFXB 4XI5D 5JW5B 3UPAA 2JCCE 4PRNA 3BEWB 1QR1A 4UAOB 5D6CA 4OLUL 1MQKH 1GSZA 5DI8A 5IBTH 3BIKA 1MCLA 1MCDA 4ODVH 4Y4KD 2UWEB 3OZ9H 1IJ9A 5DZLA 5T3XH 5FA3A 5A3ID 3GMPA 4DKFL 4GS7C 3PGDA 3MFFA 4U3XA 2HFGH 2BVPA 4M48L 5EU4A 3SY0A 4JZNB 4M6NH 3ME0A 4PGBA 1JI1A 3CFDB 4MJ5A 4XXCA 1XR8A 5BRZE 1MUJB 5IV2A 5GGTL 1AP2B 1JTPA 5IB5B 2C5DC 2W0FB 2W91A 1J88A 3MNZB 1VESA 3O2DH 3HG1D 5ESAA 2VIRA 3F7PC 4MS8C 2A6IB 4XP9H 4LLYB 3WS3A 3DHMA 3OKOB 1JVKA 5ENWA 5C0JA 3MCLH 2IH1A 1KIUA 1IQDA 1NAMH 4K7PX 2NY2B 4PJ9C 1FGNL 4D4CA 2X5PA 1IEBB 4XMKL 5HI3D 3GJFH 4MQXC 5DMIH 1E4XI 1N3NB 2A1WL 3KPLB 1UENA 2ZP0T 3L3JB 3UPRB 2WWKO 2BFVL 1M7DB 4DTGH 1U8OA 5GS0H 3UBXG 1G7IB 4JZJB 4NDMB 4NNYA 4DVBB 4DUXA 4JFOB 3CFEA 1DQMH 1PQZA 4M8QA 4Q0XL 4QF1B 3JWDC 3GSXA 3H2WA 4X9BA 1MI5D 4V2CB 4ZRPA 3H42H 4JKMA 3WIHL 2WLYA 2FEEI 3W11C 4AEIH 4QY8A 3QZWB 3CDGA 1A1MB 4MA8H 3P0YL 1G7JA 4L4TD 4BQCA 4LLAA 3UAJD 1G9MC 3EHBC 3NCFB 2BP3A 4XCCL 1LP9F 3VI4E 4W70A 3T0EE 5DJDA 3DECA 3OXRA 3MLUH 2W07A 3QDGB 2Q7YA 1SVZA 2Y07H 4OKVA 5I1HL 4RFOH 2A6JA 4PJ8D 4XC3L 3FN3A 4LSQH 2GUOA 2J5LB 3BKMH 4XNMA 4AIXA 3WUWG 3HMXA 1I3GL 4JKWA 4M6OH 3KLHD 2CK0L 3UC0H 2GITB 3WE6B 1I8IB 4XI5C 1YPZB 3U9PH 3FJTA 4GAJH 1DZBA 4S1SH 1T1WA 4P9HC 4F37K 1NI1B 2Y23A 3SOBL 1T89A 1O1TB 2ESVD 2V7HB 3W39A 3SCMD 5C0EB 1YY8A 3BKCH 2DAVA 4WO4A 5CD3A 1U3JA 3GHBH 3STZA 4O2CB 1N64L 2B39A 1ZS8A 3NA4A 4Y4KC 1KXQE 3RA7L 2VLKB 1X5AA 1OAKL 4WFEE 3BQUA 1HI6A 5DJAA 5H37G 1HILB 5A3IC 4Z77B 1XIWB 2QJDA 2XZAH 5C0IB 2AEWA 4DOHE 2YA0A 1U8KB 1KG0B 1XGPB 4G8GA 2I25N 1WZ1H 2I07B 1GCFA 4EI5D 4YFLI 3ALWA 4MMZC 1P69B 1O79A 2VC2L 1SQ2N 2IPTH 1CL7L 1M6OB 1YMMD 4QRQA 4YX2H 4YBQD 5K9OB 4LEXH 4U1IA 1LTXB 1I7UA 1U8NA 4G9FD 3W82A 3VXRE 1IC5H 2Z91A 2H6HB 5SWZB 5JQ6L 2MSPA 1KCVH 1BFOA 4YEFA 3MXWH 1A1OB 1UQSA 2VRAA 3P0VH 1O6HA 1TJGL 4NBYB 4NRYA 5T3XE 3TA3D 3MLYL 3L5XH 2VXQL 3W0WB 4MX7A 4YZFF 1T1YB 5INDA 3DSUB 1G0XA 5E1AB 1MHHA 5HI3C 5D1ZB 4Y4HD 1QVOA 1RIVL 4HV8B 2R56H 4IHOB 3IDGB 5E5MB 3O0RL 5K93A 2CDEB 3LHPH 1YDPA 3S3PA 5C09D 2XWJB 1NCBL 2A73B 2G5BB 3M07A 5ERWB 4LLVA 4FZ8L 3SE3A 1FPTL 1MRFL 1REIA 1GYAA 1FIEA 1FLRH 1S7TA 2HTKD 2XIDA 3QUML 4R4ND 4I18B 1RUKH 1LWRA 2PKDA 2C1OB 1V3JA 1KV3A 4NO2B 1NCDH 2V2TA 1CDJA 2XN9B 5F9JB 1CLZH 4BOJA 1LO0L 3UAJC 5T1KA 4PJCE 1T7ZA 2RIKA 1UM6L 1J8KA 4A6YA 1JFQL 3TNMA 1WJ3A 2HVJA 4PRHB 5F9OH 3ZO0A 4PJ8C 3CUPA 3ZYOA 4XCNA 2X1QA 5KAQG 1KPRB 4U6YB 1G6RB 5J56B 3KLHC 4PGCB 4NZJA 1PEWA 2P46B 1FL6A 4R2GD 5HYJD 4OZFH 4Z7OF 3S35H 2KH2B 4PJ7F 3ZLQC 2F54E 2AQ2A 5FV1L 2JCCB 2PW2B 1GPOL 3SCMC 5DEZA 5BJTB 3FFCB 5FGBC 2YPKB 3C2AL 4YQXH 4FXKB 3KYNA 5D7IE 4JO3L 4WI4A 5AWNL 4F8QA 1CGSL 5KVGH 4HIEA 5I15L 3FMGL 4I48B 4RFEB 2D31B 1B9ZA 3MV9D 3OB0K 3GJEB 1J0KA 5I75C 5ID0A 3BIAX 4NJ9L 1NLDL 4MD4B 4XCFL 1VFAA 4L8BB 2R15A 3TWCH 4KY1L 5EO0A 1S9WB 1JCRB 4Z95L 1NMCC 4D0BA 4UTBL 4Y2DB 5GGUB 4CADB 3IFOB 1HHIB 1PW3A 4HC1H 2HRLA 3H9YA 5CJOH 4YBQC 5J3HD 2HRPH 1C08B 1VFOA 4QHKI 3QJHB 5DS8A 3O6FB 3BZFA 1BFTA 4L3CB 4PJGF 4FQCL 3KXFB 5TQ0H 2APWA 5D2NE 4M5YH 2EC8A 3BH8A 2ARJB 2R4SH 4XXDA 3CDCA 3BT2H 4P5TC 3TA3C 5JHLH 4HMDA 4H0GA 3MRPB 2C4FT 4NQEE 1XH3A 1JNLH 4HUVA 4MDIA 4LGSB 4Y4HC 5E6ZA 5DQJB 2WY7A 5F1IA 3WL9A 4FG6D 3MUJA 3ZTJH 3BXNA 3EOYG 4LPVA 2GTWB 3GMLB 3PHSA 1JCSB 5IJKC 5D72H 1CICD 2P5WE 2J8HA 1YA5A 1PKQE 4NOBA 5D7SH 1DDHA 2HTKC 3CMOL 5I17A 3DGGA 4R4NC 5HPMA 3JUZA 4UQ2B 3C8DA 3G6AB 3NCJL 3I6GB 1CDYA 5KN5A 1U8IA 1UJ3B 2BVYA 3QHFL 4Z7VF 4ZO7A 3AMKA 2DQGH 1U91A 5F7LB 2X4NA 4KZEL 1MJUL 3HCVB 4OCNC 4XPAL 4KMLB 3JV0A 5KSAA 4PY8I 2G5RA 1S9XB 2IEJB 4TSBH 5HHOB 5EOQL 2FH8A 5F3HA 4OGYL 3S4SG 3PQYE 4DN4L 3UJTL 5HHVL 5L9DL 1CGYA 3U0WH 4JY6A 3VFPB 1J05B 2AGJH 4YDKL 1MH5A 3PJSB 3T04D 1U42A 3PABA 3Q5TA 1I9IH 1ORSB 3CC5B 5FDWA 4UIKH 4I4WB 4R2GC 5ICYA 2ZUXA 4LVHC 1SM3L 1ZWIB 4Y19D 3TN0A 1MCNA 2RJMA 12E8H 4G42B 3I84A 1F02I 4YFLF 4P2CG 3TYGH 4P4KA 5CEYB 4QRUB 3KR3L 3MMEA 4ODTL 1HSBA 4P2OA 5DRZA 4JPVL 1RZKC 2P1YA 3SDCA 1N5YL 4FTVA 3OXSA 2OMNA 5ECJE 5KVMC 1MFEH 3I3DA 2P5EA 5T33H 5F89B 1I85A 5E8DH 1JTTA 4CVWA 4OT1H 3CVIH 5JPNA 4XTRD 1AI1H 2ADGA 3DIFA 4GW4B 5CGTA 4R8WL 1JZ6A 2YD6A 3PXHA 5IIEB 3MACL 2VMFA 3L9RB 2UYLB 1ZGLM 2YC1B 2AJSH 4IOIA 1QBBA 4YHKL 4X4YA 4IRJA 3VWJB 1O6QA 1MSPA 1OSZA 3CVHL 4ESKA 5GGTA 3P73A 5D7LE 3I9GL 2CD0A 1EJOH 2V5YA 3QNZB 1TZHA 1U8MA 4M4PA 2VJXA 3BPCA 3GSNL 5J4MA 3I2CL 4R3SA 5DEFB 2D7TL 3O6LL 3PDOB 5EOTB 1AE6L 3ZDXE 3WIIL 2Y6SD 4PUBL 5D7KD 3L1OL 2YPLA 1P4LB 5JNYB 5DUPL 1NANH 4JQXA 2B0SL 1Q9KB 1H3PH 1W72B 2O5YL 3VRLE 3N50A 2M8XA 4XP6H 3VFNA 2NNAA 4PTUB 4BSVA 3DO3A 5J13C 1U8PB 4G8FA 5HYFA 1IEHA 2XKNA 1ITCA 4IS6B 3SEPA 3W9DB 1KCKA 4HUWB 4ZQKA 3C5JA 2EYTA 1Q9WB 4P9ML 3QP3A 1DVFA 2EDNA 1KB5L 3FO1B 4J8RB 4OCRH 1FDLH 2YRLA 4IMKC 4JDVA 4QRRE 1AH1A 4DZ8A 5I8CB 3WIHA 3ZSSA 5D1XA 2F9BT 3VXQB 3DI2B 2FX7H 3IU3B 4TUKL 1U8QB 5KJRH 3U4BH 2FZ3A 1NC2D 5FF6B 3Q2CA 4KRLB 1NAMB 4D9RE 5EC2B 4O58H 4M7KL 1FC1A 2ORBH 1N5AA 3KPQA 4NC1C 3PWVB 4TSAL 5C0CA 2ITCB 4YIQA 4HKXB 4K2UH 3VFWB 2DQDH 4ONGH 1VKXA 1K5NA 1FVDA 3G08B 5GISH 2CUIA 4K55A 2OX5A 3MBXH 5IW1A 1WZKA 1F4HA 2L4OA 2DJSA 1QP1A 2DYPA 1NUNB 2NY7L 3KPOA 2B2XL 4U2YA 3FOMA 3FO0L 3NPZB 4AEFA 2XKSA 5GRVL 5E4EB 3K4DA 3GSVA 4HPYH 2F54B 3MV8A 5JXED 4LFHG 5D7IB 4JFFE 4BFIA 1NCWH 3U6RA 1JWSA 4KDWA 2VR4A 1A4KB 1HH6A 4JDTH 4EDXB 3C2SA 2JJTA 4UZGA 3T65A 2ZKHH 4IDJH 2G2RA 2H45A 3S96B 5JXAH 1CD1B 4XTRC 5EUOA 3TPUB 5FM5O 1OT1A 3UROR 1QBMH 1A1NB 5D2LB 5HHMD 3DUUB 4X6CA 5D70L 2PYFA 4C58B 1R3JB 1JRHI 2VAAB 5DQDH 3T09A 5IQ9B 2I9LA 3L95A 2AAVA 5C07E 4I5BB 4OZFG 1A6ZA 5JORA 4Z7NE 3ZDZE 4LQFL 1JYNA 2OI9C 2R29L 3FKUS 3EOAA 3HZKA 4JFEB 4XVSH 5KVFH 4NNPL 5IMKA 3T0VA 4RIRB 4IIQA 1ACYH 1XAUA 3AREA 4PJHE 5I1AA 1DSFL 2Y6SC 1PDKA 5CP7A 2IBZY 3NFSH 2N7AA 3PGCB 4NWTL 1T6WA 1H5BC 3BMWA 4PJAF 2FYYA 4WI3A 1JN6A 4HT1L 4JGJA 4PRBB 1SMOA 1I3RB 4WW2F 2NY5H 3FZUD 4K8RC 4NN7B 4PGDB 5J6GA 3QIUB 4NHUB 3ULVH 4YC2B 3TH3T 1A5FH 2VSCA 2YMXL 3PE9A 5LGHH 8CGTA 4LASH 2P5WB 4FQQA 3VMOA 5FV2A 3QUMA 1MIML 1FNLA 1KLFA 1XF2B 4M5ZH 3TCLB 3QCUL 4IEFB 5I18H 5EOCL 5JLZB 2DLFL 2C3HA 2FJHB 1KZOB 3LQZB 1DEEA 3ZT6A 4U6VH 1MOEA 1S7XA 2IPKA 1L7TL 3SKOA 4PRDB 1Y6KR 2BB6A 3NPSB 3HMXH 1WUNT 4M61A 4RGOL 4JE4B 1I1AA 3I6KB 5C0BD 3VFGH 5ITFA 5L88H 4UILL 3UTTB 4WNQA 1ZEAH 3ZTJG 5DD6A 4P2QD 3V5HA 4X9GA 1NMAL 3WHXB 3GMNB 4NHCH 4Y5XA 3QB7C 4LLUA 4UB0L 3KPSA 4KQ3H 1WFNA 2DWDA 5ISZE 1H8OA 2PCPB 4JFPB 4O02H 4HH9A 3GSRB 4GRWB 5IFJB 3DVFA 2VDNH 4AMKH 4U0RB 5JIKA 1L0XA 3SPVB 5JXEC 3VXOA 2OMBA 5DRNA 4GRLA 1DBJH 3IDXH 2DBLL 5FHAH 1WSST 1S9VB 3RIFF 3VXMD 4GTTB 2ICWA 4R7NB 5IHUH 1BZ9A 1U0QA 3BDYH 1I1FB 3MRFB 3BZEB 5J6HB 3QWRA 2YR3A 4GBXA 3QUZA 4TOYL 2VL5A 2PR4L 3IDIA 4IRSB 5GGVL 1YEKL 4LOUD 5TJWK 1P1ZB 1GZPA 4W4NA 4WENB 2HKFH 2XKUA 3TYFB 3G04B 1R3KB 4YXLL 4NQCD 4DGVH 1ZKAA 5AZEH 3ARGA 1D6EA 4LSSL 1H15A 1INQA 4F57L 1S8DA 4C1SA 1VB9A 2XQYG 3KJ6H 3B9EA 1T3FA 1RJYB 1E4KC 2H2SD 4K7FB 4PLJD 2HA1A 4H25A 3QO1A 4FXGB 3EZ8A 1T83C 4OF0A 2X2YA 4QXTB 1SY6L 4M1DL 4GO6B 5JUEH 3ULUC 1CDUA 1RIHH 3K74B 2APTA 5E8NA 1GIGH 1FCCA 4OTXL 3GSWB 3FO2A 2JJSA 2Q3AA 2DTSA 5L8JB 4RGNB 4QTIL 4N0UA 2R1YB 3C6SA 1C5DB 2IBGA 2R9HD 3FZUC 3BW9B 3S37L 4L8DA 5DJXA 1BAFH 3CXHK 1FN4B 25C8L 2BB5A 4Z7WA 1K8IA 5GRVK 5TDOA 1BJ8A 3TH2T 4MNQA 1B0GB 4HIJB 3ZL4H 3G9VA 2CIIB 1A7RH 3DVGA 3EYUH 4K3DH 5FB8A 5C7XH 3Q6FA 5D7JD 4JHBA 3RWEA 1UFUA 4QRRB 1GZQA 4A6YH 2OL3L 3J8F7 3CPLA 4O5LH 5HDBF 3IDNA 4HWBL 4WWID 5ID1B 1BX2A 4X6EB 3X13A 1S64B 3UTZB 3IRPX 1T0NB 2BNRB 4GMSH 2LAGB 7CGTA 5J11C 1T0MB 3VE0B 3DUSB 1DQLH 2ZOKA 4J12A 2AXFB 3IDMA 4ZAKB 1IMHC 2QSTA 5TFSL 4HG4K 5HGBA 1KPVB 3ULVE 5E6IB 3LMJH 3PV6A 3DVNB 1NANI 1AC0A 4G9DB 3BDXA 1RY7B 1TVBA 1UCBH 4G7YL 5DWUH 4FQLH 4CU7A 2Z8WC 5AUMA 4DCQA 4HGWA 1C1EH 3V7MA 3MRQB 3VD7A 1AGBB 4OM0L 5GHWL 5TH2A 5GSVA 4L3EA 1NAKL 2YHGA 4OV6F 3OSKA 2GW5A 4PG2A 4X98B 4XPBH 3ZTNH 2GSIB 3OQ3B 2EZ0C 1YN7A 3DYMA 1BBDH 2YSSB 3WJJC 4JFFB 4F15C 3RWCB 2ADFH 3GBNH 3HLAB 3IFLH 4OZ4B 5C2UB 3M1BB 3LPWA 3HRZA 4N9OB 4LOUC 4LSTL 4RA3A 3C5ZD 4QXGH 2AQ1A 1TIUA 4JY5H 1D5XB 3DSVB 2AKRB 4D9QD 1LGVA 4X99A 2DTML 2WINB 2OBGA 3TIEA 3FCTB 5C9JA 5C8JA 1ZGLB 4LNRB 3DX8B 2H2SC 1JF5A 1KYOK 3CVHA 4PLJC 2ZUTA 2CO6B 3D25A 3VFSA 3ZKQD 4XBEH 1RURH 4KVNH 2X4TB 5HJ3A 1UWXH 2VAJA 4NYLA 1QLEL 1MNUH 2NTFB 3D3VA 4LSPL 3KHOA 4JN1H 4K7PH 4PJBA 2L7JA 4P2RA 4G6KH 2E3VA 4QGTA 4LCIL 4ZFFB 1QSFD 5C0RH 5HGDA 1F3DH 4BQBA 3WBDA 5HDOA 1FGVH 1N0LA 2GJ6A 4KAQL 1RV6X 4XBGB 4XCYB 1XGTA 3SKMA 5TGBA 3S37X 2EIBA 4ZS6D 3I85A 2AJYH 4RSVA 3KPPA 3EJYD 4HF5H 4IMLB 4NP4H 1OP3H 3BO8A 2OJEB 4EVNB 2P48B 3WUZA 3PG2A 2V8KA 1O5DT 4N8PA 1MIEH 5CCKH 3E6FA 1R5VA 2BMKB 4JREC 1IAOB 4XCEA 3GB7A 1KB5A 5E7FA 3QWOA 3MGOA 2VDML 1X5XA 3WD5L 4D0CA 4LPWA 5JW3L 1F6FB 4OCMC 4JVWA 1DLFH 2HWZL 5CINH 4Y1AA 3UPCA 2NZ9C 3O3BB 4U4BA 3P77A 3DO7B 4Z0XA 4LQ1A 4V1DD 1BZ7B 4NPYB 5I74C 1WVZA 1Y0LA 3HNVH 4RQQB 4GG6B 3S88L 3JTTB 3H9SD 3IF1B 4LLDA 2MMXA 4MJIB 4PLOB 4BA8A 2QSCH 1GOFA 2JK5B 3WEXB 1RJCA 1PJ9A 1ORQA 3LEVL 4TNWK 3MUGB 2ATKA 3TVMD 1ZHNA 1WGOA 1BOGA 2NMSA 4ONOA 5I1CL 2I5YL 2F53B 4OLUH 4OAWB 2W60B 2HJFA 4KXZI 1PY4A 1ZOXA 4ZFZA 3HXCB 3MRDB 4WHDA 4JFDA 3MJGX 4ODHL 3SFYB 2P24B 4HD9A 4PR5B 1DN0B 1BOYA 5E94B 4JB9L 1ZHBA 2W9LA 4DKFH 4CJ0A 3V9FA 5DZOA 2FIKB 4OF8A 3ZHLA 2C1PA 2WIMA 4M48H 5T3ZL 1KCRL 2MFNA 1IGFH 5JOPE 4H0HB 1BIHA 4HS8L 4GJTB 1CZ8L 3C5ZC 2E7MA 4PRNB 4N0FA 2PNDA 1N4XH 5GGTH 4KV5E 5I0DA 2FX8L 2XTJC 4NN5B 5IWLC 2ED7A 3X3GL 1K4DB 3WXVL 2IANB 4Q6IB 1TQBC 5ESVA 4DEPB 5FOBA 1ZA6A 4LPCA 5FA3B 3LY6A 3ZE2E 4Q9BA 5I9QB 3MRKA 1WV7T 2OXGA 1FGNH 3PGDB 1OD7A 4XMKH 4Z76A 3HHRB 4XPGL 5EU4B 5CEZL 5DXWA 1RZJC 5SWSB 3SY0B 2DLEA 2A1WH 4XWOD 3ARVA 4PGBB 5F71A 4MJ5B 1XR8B 2BFVH 4MCYB 2VOTA 4TPRH 1V8HA 5IV2B 3L3HA 3Q7FB 3LKPA 4OGXL 2NXZB 3V7AE 4Q0XH 5HBBA 1AD9A 3T3PF 2MKWA 5ESAB 3EJYC 3WNNA 5LJYH 3WIHH 5DVMA 4M7ZC 3WS3B 5GRUH 3VU2A 2GI7A 1GGCL 4OKDA 3KJ4B 2IH1B 3P0YH 4G6FB 2X89A 3UO1L 4YHYB 1JGDA 1KCUL 4XCCH 5TQ2L 3VGAC 3BWAA 3QAZB 1OM3L 1C7TA 4K94C 3IVKA 4P5MA 2DLIA 5IB3A 3UYOD 2IPUG 1IGMH 5SWQA 1CGWA 1U8OB 5BW7C 2BRRL 5IG7A 3OGCB 4XC3H 2Q76A 2FH6A 4UINH 5BV7C 1JNJA 4PV9A 3B5TA 1I3GH 3CFEB 4L8SA 1PQZB 4M8QB 3F58H 5JW4N 2V5MA 3R1GL 4JJ5A 3T2NL 2CK0H 2NPLX 3ARSA 3VXSD 3G5YA 3U7AA 1QSZA 2IFFL 3TVMC 3SOBH 4PJIA 1G7JB 3WDIA 1Y18B 4TNVK 2NW3A 4FQJL 1VEMA 2DLTA 4OFDA 4XHQA 5C0GB 4I0PD 1N64H 5DJDB 1RZKL 3OXRB 3VMPA 3QRGL 3RA7H 3CX5K 1TQCB 2QQLL 3GSUA 1D7FA 1M05B 1H3UA 4X7SL 5KBNC 3VDBA 1A3LL 1JTOA 2NY0B 1PLGL 4UIMB 2A6JB 5HHNA 2GUOB 4XNMB 1NGQL 3MA9L 3GSQB 1FG9C 1HHKA 2X70B 4MMXC 4WI9A 1TNOB 1NGZA 4U3CA 4NGHH 5B8CA 1WT5A 5HVHC 1T1WB 1HOCA 2EDEA 4M7LH 5I73C 4MQTB 3F5WA 4R4BA 2VXSL 3D5SA 2DB8A 3W39B 1PSKL 2K1MA 3QA3A 4K8RH 1D5BA 2PXYA 5CD3B 1AXSB 5JQ6H 4Z7UA 3STZB 2DMCA 3OTTA 4FTVE 4GAFB 1ZS8B 2V17H 4LK4A 1OARL 1SJEA 3CFJB 1LO4L 1TJGH 2P5EE 1HI6B 5DJAB 2DMKA 3H7LA 3MLYH 4LL9A 1LEGA 2DM2A 2VXQH 3GHEL 5TE6L 2ZUSA 1YMHA 3O9WD 3OKMB 4Z8FH 4KUCF 4ZUUA 5DSCB 5LGKA 4G8GB 1RIVH 4DK6A 2C3VB 3HZYA 1QHPA 1SY6A 4JFYA 3TBVA 2EKJA 3H0TB 4XWOC 3PL6C 4ODBD 1PG7L 3O0RH 3OV6A 1J8HA 4M43L 2O26U 4NQDD 3SO3B 4B0MM 4QRQB 4FZ8H 3RNKB 3GNML 3QJFA 1MRFH 1JYXA 5E9DA 2O5ZL 3QUMH 1TVDA 1BFOB 3WXWL 3V7AG 1ZAGA 5IB4B 1RVFL 4O9HL 1QRNE 3EDJA 1UQSB 4NRYB 1VEPA 4ZPTB 1JWMA 4JZOA 4M6ML 2YPLE 5ADPL 1LO0H 4WIQA 2QSVA 4PY8J 2R0ZH 3C60B 1J87A 2QADB 5FM4A 1MHHB 3KS0J 1UM6H 4CMHB 1P53A 4D2NA 5JOFB 1JFQH 3D9AL 4HWBA 1NBZA 1YDPB 3NIFF 3QEHA 5EPMA 1FYTD 1HWHB 3IT8D 1ZHLA 4GRMA 3CSYB 3QPQD 3U48A 1ZVHA 2PO6D 1OLZA 1A4JA 4RDQF 2EDKA 2V2TB 1GPOH 2BNQA 1CGUA 5E5RB 3C2AH 3HB3D 3FONB 1KF9B 4I0PC 2Y7QA 2FDBP 4D8PA 1R3HB 4JO3H 5AWNH 3RZCD 1V7NL 1U8JB 3LV3A 5C0CE 2E8ZA 1TNYB 2EKSA 4HAGA 2Y4SA 4C83B 4WUUA 1MHCA 3TNMB 1RSFA 2EYSA 2HVJB 5CEXB 3LS4L 4D4DA 1E27B 4YDVB 3MRLA 3F6LA 4NJ9H 5ALCL 4XCFH 4R9HA 1LD9A 4KY1H 5LG1A 1FNEB 3ULUH 4PYGA 4UTBH 4OFKA 2QLVB 4OD2A 3V6FB 5I71C 3I50L 5MHSD 1J5OL 3MV8E 1UCTA 3LIZL 1Z9SA 4LCYA 4O2EB 1A0QL 4MLIA 5J89A 3WSQL 2APXA 1EVTC 4HIEB 2D0HA 5F7DA 3KQ4A 2ZSVB 1PGRB 3VXUD 3OX8A 4HJGA 1BGXL 1OGAB 4LHUD 1BD2A 3O9WC 2XACC 4ISVA 5ID0B 5EUOE 5FK9B 2UY6A 2DD8L 1QLRB 1VFAB 1WISA 2BJML 4X6CE 3UEZA 4XAKE 2VE6B 1J1OL 2X4RA 4LNGB 3MV7D 4OF5A 3WIFA 3CAFA 1Z9MA 3V6ZA 2RB8A 4Q9CA 3JXAA 3BP6B 1IGCL 3CMOH 5MI0C 4WWKA 2F74B 3BH8B 4R0LB 1BLNB 3GEWB 4XXDB 4LCCA 3BRFA 3NAAL 3D87B 1GAFL 2CKNA 3QHFH 5D9SA 2ED9A 1HZFA 4KZEH 1XH3B 3VWKB 3C09B 4HUVB 4XPAH 4ZDHA 3QEQD 5B4MD 4I0CC 5CJQL 4YFEA 2F5BL 5F1IB 5BVPH 3IKCB 4IJ3C 1X7QA 5EOQH 4YHZL 4TVPD 4OGYH 1XR9A 4DN4H 3UJTH 2N7BA 5FUOL 5L9DH 1J0IA 2R2CA 3LQAL 4YDKH 1NFKA 3EGSA 3D85D 3DYPA 4NUJA 1NFDA 1AHWC 2DM4A 3BJ91 3EO1A 3NH7L 3QPQC 5DJYA 4QHUA 3KPRA 1ZLVH 5I17B 2FWOA 2PO6C 1SM3H 1CDBA 3HPJA 4HWEL 1V3KA 5IP4A 5KN5B 2A77H 2QEJA 3T3MF 2X1PA 5IVXA 3MXVH 2ESVA 2EE9A 5IK3B 4JRXD 3HB3C 2X4NB 2YA2A 3FRPA 3KR3H 3QHZH 3RZCC 5KSAB 3SDAA 4ODTH 5D4QA 4JPVH 1N5YH 5EIQA 5F3HB 2GK0B 5EB9A 5I8EA 1NQBA 2FBJL 3S34L 1Q72L 1FAKT 5KOMC 4NRZA 2VXTL 3EYSL 1X5HA 3NCYS 1FFNA 5D1QB 4JY6B 4PBVC 3VH8A 5DRXB 3HNTL 1O0VA 1MH5B 3D39D 3PABB 3KPSE 2UY7A 3VD9A 2ZIRB 2BC4A 5FDWB 5B39A 5ICYB 4R8WH 3SGEH 3MACH 4EI5A 3PV7A 1BFVL 1BBJA 1RJLA 3QIBA 4F2MA 2BEDB 4YHKH 3SE4A 1RHHB 4C56D 3IU4H 1YNTB 3CVHH 2Z31C 1FRGH 3KPTA 3JTSA 4P4KB 3T4YA 1HSAA 1QO3A 2DICA 4F9LA 4MB5A 4P2OB 5DRZB 1H0DA 2VQ1A 3GMRA 3QQ4A 1CN4A 2WWMC 3SDCB 3I2CH 2D7TH 1YEIL 3O6LH 3QUXC 3LN5B 4HKJA 3W5NA 1AE6H 2P5EB 3WIIH 2WQRA 4PUBH 4N90D 5F6IB 3GRWL 5DUPH 4PJDF 3SHSA 4JPIB 4X7TB 1BEYH 1KPUA 1QHOA 2B0SH 5JPNB 3ULUE 5DD0H 5GS1A 1MCBA 1FVCA 3DIFB 3BD3A 3DURA 4E41D 2NTSP 1FNGB 3CSGA 4JRWA 3C87A 3NIGE 2NXYC 3WCYA 1LO2H 1U58A 3WN5A 4P9MH 4ZOBA 3DBXB 4EN3B 1C3DA 3K7XA 4PJEB 1KB5H 1FE8L 1E28B 4PLKD 1TZHB 1U8MB 4QRTA 4K71B 4ZXBD 3BPCB 3TZVA 3KPNA 2BERA 5IMMA 4R3SB 2VUOA 1CL7I 1F4XL 3BPLC 3BP7A 4TUKH 4OCXH 4M3JA 2C3WA 2JIXA 4HXAH 3BN3B 2J1KA 1CXLA 3WKML 3B9KB 2FLRT 3LKNA 1OB1B 4N0UE 2EDFA 4QHLB 2D0GA 2DWEA 3E2HB 4TSAH 2NNAB 3RDTB 1FL3A 4G8FB 3VGGA 2DOCA 2XKNB 4Z7WE 4KJQD 4NCC1 4MNQE 4ZQKB 5HHXL 5TDNA 3DTXB 1F11B 3KLSA 1CVSC 1WIOA 2EYTB 3DX7A 5DVLA 3CDFA 5CIPA 1O1SB 1DVFB 5CZKA 5KSBF 1MJ7L 5IHZB 4RFNC 4JDVB 2NOJA 2NY7H 2DM3A 2B2XH 1UH3A 3FO0H 2D0FA 2R8SL 4F33B 4GMTL 2B5IB 1CT8A 2H6PB 3AS3A 4YBLC 2VLME 2D7QA 1JPGB 4Z5RA 5JDSB 2NY6C 4YAQB 4AM0B 3EYFA 5TE7L 3TIDA 1N5AB 3KPQB 4MSWA 1AO7A 4A2LA 3PZ1B 1H3VA 5F7WC 5CJXC 3KPMA 5ESQA 1N8ZB 1P4BL 5HY9B 1FVDB 4NUGL 1A6UL 1NC4D 1RZJH 2F5AL 4ERSL 1GHQA 3V4VL 5D70H 4DAGL 5DK2A 1WCBA 4M93C 4PJXA 2DYPB 3HC4L 1GXEA 3KPOB 2Z92B 3QQ3B 4L3EE 2AJVL 1EFQA 3S36L 4OF3A 4YHLL 1EERB 4ZOCA 1HXMB 4PRPA 3TH4T 1A2YA 4LQFH 1LDPL 2R29H 4N9GA 5D93C 5MEPA 1BVKA 1QD0A 2WANA 5IFHL 3U6RB 2X1WL 4NJAL 3SDDD 4JANB 4Y8DC 1PY9A 5H2BB 4AIZA 1FZKA 1DSFH 5JHDA 1HH6B 1N26A 5F70A 5EU6D 2XA8L 4NWTH 5DD3L 2YN3A 1LE9A 1IM9D 4NT6A 2NCMA 2AXHA 1QLFB 4X6CB 2PYFB 3ARDA 4PJEF 4HT1H 1LE5A 2NX5D 1PX4A 5BOZG 5IEKA 5IB1A 4H8WH 5CKGA 3VD5A 3D48R 4DN3L 3AY4A 1SJXA 2MWCA 1TTGA 1CICA 1A6ZB 1S7SA 2YMXH 3RNQB 3P4MB 1UACL 3FQNA 1HDMA 4NQXA 4KHXL 4CDHA 5FXCH 4QRPA 3D3VE 2ARJQ 4PLKC 3T0WA 5E2WL 4ZXBC 5DFTA 1MIMH 3EOAB 4PJBE 4P2RE 3RVTD 4K9EL 3JWOC 1PKOA 4IIQB 4J1UB 5EOCH 1U2CA 5I1AB 5CP7B 4YUEL 5JA9A 2EYRA 2GJ6E 3MLWL 3PP3K 2IADA 1IRAY 1EJ6A 2FYYB 1PG7W 4X4XB 4RGOH 1U8HB 3A67L 4KJQC 4UILH 2AI0L 5JO5B 3L7FB 2A9ML 1RULL 5J6GB 4HQQL 4NC0B 1NMAH 1SYSA 3G5VA 2VZ3A 3PWPA 3VI4F 3G6DL 1A14L 1JGUL 3TO4B 4JPWL 4UB0H 2OK0L 1FZMA 2EH7H 1YEEL 2VO5A 5EUKA 4QRSA 4OM1L 3WJLA 4LKCB 4GW1B 1X5KA 4Y1AE 5KAQF 4U1SB 1WQVT 5TPWL 1CLOL 1JHLL 5D96C 5E2VL 1INDL 2DBLH 4IOFD 1DEEB 5JPMA 1S7XB 2IPKB 1UVQB 2FEEL 5HYQA 2QSQA 2XZQL 4M61B 5FYJU 1I1AB 1MCRA 1FP5A 2DDQL 2PYEB 1WWWX 4BZYA 4TOYH 3V5HB 4L1DA 5I1EL 2PR4H 4X6DF 4PYHA 5GGVH 1YEKH 4Y5XB 4OIBA 3IJSB 5HPOA 4WFGD 3OKDB 3N0PB 1FQ9C 2APVA 3T4AA 4P46D 4U6XA 4HKBA 4F58L 2DWDB 3F62A 2FEDD 4HSQA 3QEGL 3CFKB 4O51A 1KBGL 4RISH 4YXLH 1ZT7B 4YR6A 4JFDE 2J3SA 2XTJE 3WLBB 4PIRF 1DE4A 4F57H 3QDJA 5SX4H 4FRWA 5DRNB 3WFZA 1SA5B 2LVEA 1G7LA 1BQUA 1NKOA 4XP1H 3EOTH 4G8IB 2HJKA 3SDDC 1SY6H 3OR6A 4U05A 3O6KH 4M1DH 5DD5H 3LH2L 4XBPB 4D3CL 2FR4A 5EFIB 1TZIA 3IDIB 1RJZB 4OTXH 5T1LA 1KIRA 1YN6A 3B8SA 3VRIA 3SJVA 3S37H 5DMGD 4BK4A 1MCFA 2PTTA 1U3YA 3EOBA 25C8H 3CSBA 1EAPA 2DQJL 4JM2B 3PXJA 4GKSB 1INQB 4MB4A 5F88A 5GGRY 2VISB 4EI6A 3NCYP 1FJ1A 3QCTL 5L2KA 3V4UL 5AYQA 3RVTC 1VADA 2IAMD 4OQ1A 5FHBL 3VFTA 4W4OA 1UXWB 1BHGA 2EEDA 2A74A 1NC2A 2QTEA 1VEOA 1GVIA 4RBPH 3VXPA 5F7UA 4D4AA 3OEDA 1JF6A 4HK0A 2E7LC 3FO2B 4ETQA 4JY4A 3WLWD 2V9QA 4ZPVA 5DURD 2EO1A 3TESA 5TFSH 3K4ZA 1ZSDA 3FB6B 5DJXB 4Z7WB 5DUML 1K8IB 1UADC 2YS4A 4MNQB 4PJCF 5FECA 4UDTA 2MHAB 5J9PA 1ND0A 2K3TA 1CFVL 3ILPB 5FB8B 2H41A 3RBSA 4UV4L 3Q6FB 3FT4B 3NFPB 2Y5TA 3RWEB 1HQ4B 2ZISB 1JPFB 1G6VK 3HE7A 1GZQB 4N5UA 4OM0H 5GHWH 3CPLB 1RFDL 2IBBA 3N06B 3IDNB 1NAKH 2W38A 3MYJA 3HR5B 3X13B 4IOFC 2OR9H 3F7YB 4JO1L 3SQBA 5IROA 1NEZG 4L9LB 2DIJA 4FMFA 5IT2L 4PRIB 1B2WL 1XGQB 1MRDL 3JV5A 5HGBB 3S5LA 4CVZB 2YUWA 3PV6B 2ENSA 1PYWB 1TVBB 4PJIE 4LSTH 4AQ1B 2CXKA 1OWWA 4BFEA 4HZLA 2QV2A 1FNFA 3BPOC 4JRYD 4W6XB 4P46C 4U1GB 5AUMB 1TN6B 3MJ8A 3BEVA 4G6ML 2FEDC 4IRZL 5T5FL 2DTMH 4PG9B 3MFGB 1LNUA 5CP3A 1X6LA 4KZDL 4L3EB 2FIRT 4P23D 5DRWA 2FSEA 4AH2A 4RAHA 3RGVB 1AD0B 3QPXL 4NM8L 4MD5B 5KSVA 1QLEH 3MCG1 1YN7B 2IMNA 1R76A 4LSPH 1P2CA 2HLFC 1XCQA 2I60H 3GI9L 4L29A 3CK0L 3AB0C 1LP9A 4LCIH 5MENB 3GRWA 5KSUA 3TV3L 4LLMB 1CE1L 5IW6B 1D9KD 3D0LB 3QNYA 3QWQB 3TCXA 1EFXA 5JW5A 4KROB 4Z7UE 4MXVF 3IXTA 4X99B 5DMGC 2QQKH 1DFBL 5IW3A 4XPFL 5C9JB 5C8JB 3MLZL 3T0AA 3UTSB 2VR5A 2OTWA 3CVHB 3D25B 4APQB 5EIIA 2H2PD 4DGIL 4NYLB 3D3VB 2IAMC 2VDMH 4Y0GA 2A83B 2H32A 4TULL 4Z78B 4U33A 3GSNB 1CXEA 4P2RB 2HWZH 4L4VB 3TT3L 2ZUVA 1TN8B 4X9IA 3K8KA 4MAYB 5T1DL 1T80A 4Y5VC 1CBVL 2NY1B 1N2RB 2GJ6B 3KGRA 3CFDA 3WLWC 3HI6L 4ODWA 1XGTB 3SKMB 5TGBB 2W9DL 2VLRD 4C59B 3Q1SL 3KPPB 3LEVH 1ERNA 3UTQB 5KS9F 3BO8B 4KMTL 3MNZA 3O3EB 2X6MA 3E6FB 1R5VB 4LLYA 1T2QL 2J8UB 1RZFL 4F7CA 4QHNA 1KB5B 5I1CH 3QWOB 2I5YH 1FG2B 3E3QC 3MGOB 4YGVA 1GJIA 3BUTA 1S5HB 3REWA 1JYVA 1UT9A 3P77B 1RUAL 2P49B 4Z0XB 4JB9H 5HHQB 1D3CA 3FAXA 4BYHA 5IJVA 2DQIL 3KPLA 3SE9L 3WS6C 4YDLB 3AXLB 3L3JA 3VFVB 8FABB 3UPRA 1M7DA 3OAUL 1LILA 5T3ZH 5LGJB 4JZJA 3QFJB 4NDMA 2I26N 2XWTB 4W6YB 1ORQB 4JFOA 1I1RA 1OSPH 1CZ8H 1LMKA 4F7EB 4LCWD 1QQDA 2BNQE 1TCMA 5BO1L 3W0WD 1BOGB 4UDUB 3QZWA 1D6VL 2FX8H 1A1MA 3X3GH 4RAUA 4ZFGH 3O3AB 4WU7A 4WUUE 4ZFZB 4P23C 1QFPA 5JW4R 3T2QA 1KTRL 4Y16B 4LF3A 4KI1A 4RMTA 4EOWH 1ZHBB 2MTPA 5LQBL 3QDGA 2X44D 4KTEL 1A6PA 3MODL 3IXAA 2C1PB 1J9CT 4XPGH 4GT7A 1RZ8A 4G6AD 2EDWA 4Q58C 5CEZH 4EIZC 3KYMB 4BQ6A 5FUCC 5JMOC 1I8LC 5GZOC 5JIIA 1MEXL 2XN9D 1A9EA 1I8IA 1D9KC 3EO9L 1JPSH 1YPZA 4OGXH 1MFAL 4NQTA 1KLUA 2V7HA 1QSEB 5C0EA 5GRYA 4LEOA 5FOBB 4O2CA 1BD2E 1UZ6E 2YD5A 4OCLC 5F9AC 3VRLF 2AEIT 5L2JA 2ATPB 3UO1H 2J5LC 2H2PC 2VLKA 1KCUH 3X14B 5TQ2H 3MNVB 5D7JA 5C08B 5JIPA 1CFQB 1HILA 5CUSL 4Z77A 1XIWA 3U2SB 3P4NA 4QEGA 1A7BA 1K4CB 1KG0A 1XGPA 4KDTC 1MHPL 5KANG 2K7PA 4JFHD 1N94B 2YZ1A 2HMID 1UXSB 2C3GA 5CIPH 5D6DC 4HBCH 3LKPB 5EZOH 2Q86B 2GFBB 4OF6A 2J8UF 3R1GH 3T2NH 5K9OA 2BXYA 4C57C 3V5DB 1KNOB 5KVDL 4KGLA 1AQKL 1E6JL 3FFDA 5SWZA 2IFFH 1NGXA 4PFEA 4OLYL 2B4CC 3QI9D 3VD3A 1RUQL 1A1OA 4Y5YA 5JIHA 3WFEL 1XF1A 3VXTA 4RGMB 3BWAB 3X12A 5IGXL 4PJGA 4P5MB 3QRGH 1T1YA 3HFMH 5EBGA 5E1AA 2QQLH 2JJWA 5D1ZA 1T22B 4HV8A 4NFBA 1A3LH 1T7YA 3GO1L 5BRZD 2GJZA 5IG7B 1MFDL 3FQTA 1X5YA 5EZJB 2CDEA 1NFDE 2QHRL 1NGQH 3RWIB 5SX5H 4PV9B 4KJWD 3KPRE 4NO3B 2G5BA 2A73A 3PWUB 4L8SB 1UG9A 4KKLD 4EQ3A 1PBYA 2LTQB 1OLLA 5EORH 5ERWA 4XNZC 4G7VL 1HEZB 1DUZB 4F7TB 1A6VL 1F45A 4KPHL 5F93C 5IVXE 1GGIH 1F5WA 2VXSH 5I1GH 1PSKH 1Q0XL 4NO2A 3K81A 3NGBC 1M7XA 1PEZA 1OARH 3V0WL 1LO4H 3DXAB 5MP6H 2HJLA 3GHEH 3L3IA 5TE6H 1ES0B 5F9WC 4Z7VA 5HHNB 4PRHA 5T3ZE 1ZVSB 3S9DB 4G6AC 4EQ2A 4H1LH 4I18C 2WK2A 1PG7H 4M43H 1NGZB 3C6LD 4LMQI 5B8CB 2JB6A 3T0DA 1UC6A 4MU9A 3F5WB 4I3GA 4OI7A 2BVTA 3QA3B 4NKIL 5KZCD 1D5BB 2O5ZH 4HFWA 4PJHF 3AS0A 4Z7UB 2PW2A 3T0ED 4MQSB 5BJTA 3WXWH 3N1FC 4EBQL 3FFCA 1RVFH 2YPKA 4FXKA 2ZZUT 2DJUA 3TNNA 4M6MH 4OLVL 3RWJB 4G3YL 5ADPH 3RFZC 4YDJB 1LEGB 2BNUB 1EV2E 4I48A 4MA3A 4RFEA 2D31A 1JRHL 3FL7A 1W0YT 3GJEA 4PJ9B 4ZUUB 4FQXA 4E0RA 4OBRA 3O8XA 5CEZE 4LIQL 3HZYB 3D9AH 4XZUA 1J8HB 2HMIC 3WDHA 1S9WA 2W0PA 1EK3A 5GGUA 4CADA 4FNLL 4HWNA 4KKCD 3D2UD 1M4KA 3H9SA 3K2UH 4WGVB 1JGEB 4BUHA 5E9DB 3EW3B 3HTLX 5GSRB 5JR1L 2RCSH 5AG9A 4L3CA 3KXFA 3K8MA 2XY1A 4WFED 4JZOB 3QI9C 1MFNA 3MRPA 2EXYD 2VDLH 1HHHB 4Y2DC 5J12C 1V7NH 2VN4A 4XNXL 2OL3B 2DKUA 3MV01 3QIWD 2ZCLH 2OR8A 5FYKL 5DQJA 2KZWA 1KTKE 3V95A 2FD6L 1NBZB 2CLZA 3LS4H 2DS4A 3O6FC 3CLFL 4OD1L 5ALCH 5EPMB 5DD1L 3VW3L 4GRMB 4KKLC 1N0XL 1Z0NA 3FB8B 3QYCA 3VXRD 4R4FL 5MERA 2LE9A 4OLZL 5IM7B 1TNBB 2BSED 2B20A 1A4JB 5T3XD 3I50H 4MCZB 1J5OH 1KJ2L 4UQ2A 2B1HH 4U2ZA 2J6EL 1ONQB 3QG6A 3EFFB 2ICES 1A0QH 4C4KT 1T03L 3RKDD 2Y7QB 3WSQH 4D8PB 3FRPG 1AO7E 3LV3B 3RIFK 3FT3B 2XT1B 4Y4KB 2NR6D 4TYUA 4WUUB 1BGXH 3RVVD 5J06A 1EX0A 3UTPE 5HHOA 2RHEA 2YKLH 3HE6D 1N4SB 3SGKC 2DD8H 1JK8B 5EBMB 4JHZA 4PJXE 1J05A 1J1OH 4YPGB 3L3OA 5B39G 3C6LC 1ORSA 1WZMA 3ES6A 1UJ3C 3CC5A 2DQEL 1KFAL 4PRPE 1ZWIA 5E8PB 1VERA 4WY7L 1LO5A 1CK0L 1IGCH 2IG2L 1A7NH 4G42A 4XVTH 3HG1B 3OKYA 5SV3A 4DQOL 5CEYA 5DC4B 4QRUA 1U93A 4K07A 3CU1A 5JHDE 1XEDA 5GS0D 1BD2B 1FNHA 4ISVB 1OD9A 4AIOA 3MJ7B 5CJQH 2F5BH 2Z93B 1ADQL 1YYMH 4QXUL 4YHZH 1LO3L 2X9WA 1BF2A 2H6GB 2X4RB 3ARFA 1G9NL 5FUOH 3S35X 4MD0A 3LQAH 4X4MA 2F54D 4KKCC 1H9VA 5F7FA 3L9RA 1IQWL 1T04A 3NH7H 3V8CA 4CW1B 3VWJA 2DI9A 3C9NA 5LWYL 1H35A 4HWEH 1AKJD 3VDCA 2JELL 3LKRB 1S7VB 5IVOA 2X1XR 1MCJA 4CVXB 1RD6A 2GSGB 5DEFA 3PDOA 4YFDB 3DSWB 2EXYC 1CYGA 2BHZA 1OP5H 4WU5A 1P4LA 5JNYA 1X7QB 2OM5A 5DHVH 5ETUB 1Q9KA 2X9YA 3S34H 2MOVA 1XR9B 1Q72H 1W72A 5F6HJ 4LSRL 3RUGB 4ALAL 2MPAL 1KUMA 4XNUL 2R39A 3EYSH 3PWPE 4PTUA 5AYUL 6FABL 4PJ8B 1U8PA 3EGSB 4X4ZA 5CJBA 1MVFA 4CRPA 3W9DA 4HUWA 4NUJB 5DJYB 4LPXA 2R2EA 4FQ1L 3KPRB 3LKQB 4PTTB 4OI8A 1Q9WA 4PJAA 5CP3H 5C0AA 3HPJB 3FO1A 1SJVA 1O7SA 1ZHKB 4POZC 4WW2A 4FFWD 5I8CA 1T5XA 4CN6A 2ESVB 4NQED 3SCMB 3VXQA 3IU3A 3RKDC 3IFNL 1XCTB 1FIGL 2NR6C 3EDDA 1YEJL 1YEIH 4XAWL 1KSRA 3QR2A 2Q87A 1TENA 3RVVC 2CXGA 5EC2A 1MCSA 5CILL 1FFNB 4ORZC 3HE6C 3GRWH 5I75B 3VH8B 1FZJA 1DL7L 3TJHD 2P5WD 2ENYA 3VFWA 5EA0L 2VERN 4AY0A 2BC4B 5I1IL 2E6QA 3BYTA 1MLCA 4WI7A 1NMCB 5IFAH 3VG9C 4EI5B 1BBJB 4RNRB 1MFCL 1IE5A 1RJLB 1T2XA 2AJXL 1YMMB 5F1NB 3QDJE 2RQ8A 5AAMA 1YJDH 1BWWA 3ZSTA 2E7CA 1R5WB 1YEDB 1OAYH 4KKAD 4G9FB 3N9GL 3T4YB 1I7RB 1FE8H 4I9WE 1IKFL 4WJ5B 1EEZA 1H0DB 1X5JA 2V5TA 1P7QD 2VQ1B 3O11A 5I1DB 1IKNC 3JVGC 1IZKA 4HKJB 1F4XH 4UT6L 1U92B 3PQYD 3TA3B 5GS0C 1GHFL 1YZZA 1OAXH 1U95B 4WVRA 2FHBA 3TBWB 3WKMH 3TBTB 1KPUB 2VLLB 1A4KA 4DFHA 4Y4HB 5GS1B 2EE3A 4EDXA 4FQ2L 3S96A 3SJVE 1CD1A 1VDGA 4H1LG 4JG1L 1CE6B 5E4EC 3ZKND 5D2LA 5C09B 3DUUA 3STLB 5AAWA 4JG0L 5HTSA 2VAAA 3U0PB 2WUCL 5FCUL 5IQ9A 1KJVA 3WN5B 5B3JE 3ARWA 3WV0A 1EZVY 5L2KE 1MJ7H 4I5BA 4C4KO 5K9QI 1ZTXL 5ACMA 2R2HB 2WUBL 4QRTB 3KPNB 3RTQD 1CU4L 5ANMB 4WV1A 5IMMB 2R8SH 4GMTH 3ARBD 1NUDA 5DJ0A 1EHAA 4J2XA 2J12B 3L7EB 3RUGF 4JFEA 4PD4J 2VXVL 2HH0L 2GTZB 4RIRA 3SE8L 3BOVA 5CGYD 3PGCA 4JR9L 1J0ZA 1UM5L 1AY1L 1FL3B 5BS0A 1VENA 4ONFL 4AEHL 3M45A 4GLRI 4EHMB 4PRBA 5C0ND 5TDNB 1ACZA 1T1ZA 4NUGH 1A6UH 3QNXB 1JL8A 3QIUA 4NHUA 3V4VH 4Y4FD 5D2NC 5KVEL 4R2GB 5D7LD 2QBWA 3HC4H 1FFPA 1YECL 2AJVH 5TE4H 4MBGB 1FLTX 1N4RB 2AK4A 3KG5A 1XMWA 1JI2A 2B8OT 1CT8B 4FFWC 3UDWA 1I7TB 4OZIF 2WLZA 4UU9A 2Q6WB 1XF2A 3TCLA 1LDPH 2OLDA 1MFBL 5ABDE 3EYFB 3P9MB 2FJHA 1X9QA 5IFHH 2LVCA 3NCBB 1RZIA 3MV9B 4NJAH 3DV4B 2H6FB 3FQRB 4MVBC 4NN7C 5ESQB 4LHUA 4PRDA 1T6VN 4YC2C 3MBEA 2XA8H 5DD3H 4KV5F 3I6KA 3TJHC 3BSZH 4P3WA 2CLVB 5C6WH 3GMNA 5DK2B 5F1KC 2NY3D 3OKEA 4QRRD 4CJ1A 4V2BA 1F00I 1JCQB 4DN3H 5L8KB 1GGBL 1C5CH 4PB9L 1EIBA 1UACH 3GSRA 4KKAC 5IFJA 2FBOJ 4N1HB 1IGJA 1WWCA 3WMSA 2EC9U 4N9GB 4KHTL 3RHWF 4D9RD 5BCAA 4FN0A 5MEPB 1BVKB 4R96B 1J11A 1LP9E 4K9EH 2V2WA 1S9VA 4KKBD 4AIZB 1FZKB 3HS0B 1CXIA 4WGWB 3MOAL 3GKWH 4YUEH 2YEZA 5IBLD 1OP9A 4HJJL 4LLWA 5J6HA 1NDMA 2QQNL 3OF6D 3MRJA 3T1WA 4IRSA 1LE5B 3ZKNC 1KOAA 3VCLB 2A9MH 1RULH 3F7VA 4HQQH 5BZDB 3TYFA 3H7BA 3G04A 1CICB 1S7SB 4NN6B 5F7MC 3G6DH 3C8KA 1NH6A 4JPWH 2OK0H 4N1EA 4NQXB 1R3LB 3RY6A 1E4XH 1YEEH 4S1DD 1CD9B 4QRPB 3A6BL 4XMPL 4OM1H 5F7KC 4OB5L 3MX0A 3RTQC 4JFFD 2RBLA 4KH2A 2PW1B 2YUXA 3NACL 3ARBC 4K7FA 3DROA 1FV1B 4JLRA 1SMAA 5TPWH 5HSFA 4FXGA 1P5VA 1CLOH 1JHLH 4JRXA 1INDH 2EYRB 3P30L 5CGYC 2CGRL 2IADB 1JJUA 3OPZL 4KK5C 1DLHB 1NL4B 5E00B 1Q9OA 3MREA 3MJ9A 1I9JL 1H8NA 2H6IB 5C0NC 2R1YA 1QEWA 5C07D 1C5DA 1SYSB 3L3KA 2KDGA 3BW9A 3PWPB 1SA4B 4Y4FC 2VLJA 1FN4A 3QRFM 1FZMB 5EUKB 4QRSB 4XB8A 1B0GA 5F8QC 3WFDL 4HIJA 5EU7E 4FA8A 2CIIA 1CIUA 3QEGH 4C54A 1KBGH 1AFVL 4UNTA 3OAYK 9CGTA