4FXGB

Complement c4 in complex with masp-2
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
739
structure length
738
Chain Sequence
VNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
total genus 176
structure length 738
sequence length 739
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.30 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4fxgB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxgB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxgB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxgB04
5DJ8B 3T4AA 3SDXB 5F21B 4FG6D 3VWKD 1Q8MA 3U48A 1AP2B 4NHUB 3DSSB 5E9DD 1A02N 3GFUA 4P57B 4BH8B 2XZQL 1JUFA 1I75A 4NT6A 4CADA 5L9DH 4PB9L 5E94A 2NW3A 1MCWM 3B9KC 4ZAKA 4G43A 3RWFA 1A9BB 3KYOA 3VFPB 1HQRB 1Z0MA 3OMZA 4M1CC 5ADOL 3CLFH 1I1CA 3RKDD 5F1IA 3PG2A 3QQ3A 3TA3A 1CF8H 4ODTH 4ZUWB 4HDIB 1KCUH 4GRWF 5HYSB 3I6LE 3M1BB 4Y2DB 3WS3A 4PJHB 3BZEB 4RMWA 3C2AH 4XH2B 3RVVC 4TULH 2VWEC 1JZ6A 4Y7MA 5JR1H 4G6AD 1FFOA 2B4CC 5DMJB 3VFNB 3V4UH 1KELL 1YEIH 3O6KL 5I15H 3NN8B 1A7OH 2YRZA 4YDVB 1T03H 5ICYA 4LCWB 2YC1A 1ED3A 4I0CC 1AHWA 5C0IB 3MV7D 4U3HA 3CVHH 4M48H 4PRIE 5B3JE 1SBSL 1D5IL 3LMJH 4UT9H 1ZT7B 4RA0C 3EHBD 4WO4D 1KTLA 3IDGA 3U7YL 2M2DA 3EDEA 1SEBA 1CGVA 3B9KA 4S1DC 5IESH 4OFDA 2F74B 1LO5A 4UV7L 3F5WA 4UIKH 1BEYH 15C8H 5I1GH 1A6AB 3TJEH 5E4EB 5IF0A 2Q20A 3C5ZD 3KLDA 4PJAF 3AVEA 5CD5D 2IH3A 4OZIE 2CK2A 3BAEH 5ESAA 3S3SA 1ZLVH 4HUWA 1FO0L 4PGZA 1H35A 1NEZA 4G3YL 4HMDA 5E2JA 4L1DA 4WFFE 4HJ0D 2WWKO 4MD4A 3U46A 2WBJD 1PYWB 3T0EC 3OG4B 1KJMA 1MELA 3QIBB 3QFDA 3LKSB 1KJ2H 2AXFA 1DQQA 3OKKA 5EZOL 3L5XL 4NWUL 3H7LA 2ADFH 3KLSA 4N9GB 4UBDC 2R0KH 4XCYA 1UKQA 3WSQL 5TDOB 4LLWA 4OZFB 5D5MA 4PJGE 3LZFL 1A6ZB 2AKRB 2HLAA 3IT8D 3CU7A 3OB8A 3RVXC 4XBGA 3D5SA 5AG9A 5C0BD 5FKPB 1AQDA 1DLHB 1FL3B 4OAWA 5CLTA 4WUUD 1OAZH 4RSVA 4X99B 4XRCA 5GRJH 1RHFA 4JFDE 5L8JB 2VH5H 5KSVA 1VA9A 2X1OA 2ZCLL 1V3JA 3F7PC 1S7QB 5GZND 4U7SA 1RZ7H 3MLVL 1P1ZB 3FT2A 2Q3AA 3TPUA 4CJ0A 4LSRL 4OBSA 3VFWB 5HJ3A 3RNKA 1H3TA 3RIAF 3QA3A 1GHFL 4MX7A 3RVUC 5DUPH 1PDKA 2JB6A 3O2VH 1IM3B 4P3DB 3KNBA 3BRDA 2NY6C 4U1IA 3O6FB 4HCRA 1IEBA 1JGDA 2H32H 2DQEL 3VMOA 2W59A 5GGRA 1GXNA 1B0GB 2FGWL 4ZUSB 4FA8A 1Z9SA 1CGSH 4G9DA 4XP6L 1NAMB 3FQRA 5E2TH 6FABH 3MGOB 1R76A 1LD9A 4LVHC 1KN4L 5HYSG 4XP5L 1FRGL 4OGYH 1YJDC 1YMME 2YD5A 3R06B 1UXWA 4M9PA 2R1WA 4DZ8B 2JIXD 4ODSL 1V5JA 1A7NH 1O1RB 4JQIL 5E4IA 1C8PA 2EEAA 1CLYH 4P59H 1S64B 4HIHB 4IHOB 5C0CE 3NIDF 2XTJC 4X6DF 5T33H 5L2KE 2V2TA 1FE8L 4H25A 5ALBL 2DQCH 4M8QB 3HB3D 1BQHG 3TESA 1U6AH 3MV8E 5I1KH 5D6CB 4MJID 3ULUC 2B4CL 4H88H 4NQUA 4O2FB 4OCMC 5EH1A 1C5BH 4LMQE 4QTIL 3QDAA 3E8UH 3U36A 5I1DB 2P5EB 4XC1L 2UY7A 4CDGC 2AXGA 3FQXA 2IEJB 4JJHA 4GW4A 2GTZA 3LEVL 2G5BA 4MAYD 2EKJA 2YOCA 4G8FA 5JZ7D 3MA9L 4Y8AA 3EYFA 5B3JF 3KSLB 2AJYL 5FOBB 2OTUB 1CE1L 4HGWA 2FHBA 2NXZB 4N8CH 5KVEH 4Z7OE 5DWUL 1F4YH 3EOBA 3HC4H 4CN6A 1ZSDB 4WENB 1NMCB 3N1FC 4NKDA 2DIBA 1BBDL 1T1ZA 4X6FA 3QDJD 3HAEB 4TOYH 2BNUB 2V9TA 1IC1A 3CVIH 3BWUC 5DZNA 4P46B 2BCKA 5F9AC 1G9NC 1CVSC 1IGFH 4G6ML 4OZIF 2OK0H 3VXQA 5ESVB 4PJFB 4M1DL 2GKIA 1RUML 3MBED 4R4ND 3HMXL 3WO4B 1J8HB 4KK8D 4FQJH 5FUOL 3FMGH 4GG8B 4NNPL 1A8JH 4K23L 1U3HB 2Q7YB 1G9MC 2VXVH 5E00B 3OWEA 4ZMAT 4PJIF 3PGDB 2EDLA 3OGOE 2X4PB 4XHJC 2EDFA 5JW4R 4PTTB 1YY8A 2DQUH 3OB0K 1OQOA 1TVBB 4G7YH 1NCNA 1G7QA 1S5HA 25C8H 5DRNB 3VG9C 3P30L 4PFEA 4OF7A 5HGBB 5F8QC 3FB5A 4OF6A 1UMPA 4QCIB 4NQSA 1AQKL 4ERSL 4LSUL 4U1KA 4UV4H 5L2JA 5C0AB 1ZGLP 2UY6A 1YZZA 4N0YH 3H0TA 4YHOL 5I9QC 5EBLA 3BMWA 3IFPB 3I50L 3ZTNH 1OWRM 5JHDA 4Z7UE 1JFQH 3HZVA 5ESQB 3RPIB 2YK1L 3EYQD 4GO6B 4BSWA 1D5XB 1FAKT 1NGZA 2X6MA 3G08A 4L8DB 1AY1H 4KU1A 3VI3E 3D0VB 4U1MB 3KHOA 3K46A 4ZPTB 3P4MA 2DICA 2XN9B 1UM4H 3CH1B 1MJ7H 4L3CA 2Q87A 3QDMD 4B7LA 1OAUH 4FTVD 5IMOA 3RKPA 1O7SA 4N0FB 5GGTA 1KJVA 4PRPE 3QG6B 2J8OA 2R9HD 2VL4A 1YJDL 1BP3B 2PW1B 2PR4L 5JXAH 3RVTD 3D39E 2GY5A 5AWNH 1UCTA 1X5AA 3HI5H 4J4PD 3LQAC 1JF6A 2IGFH 5F7NC 1ACYL 4XB7A 3LPFA 4UINH 1KZOB 4P2YA 4CUCA 1GCFA 5C1MB 2YPVL 2C26A 4IS6B 4X7DC 1RVFH 1S9VB 3KPSE 5L88H 3TWCL 1EX0A 3W0WA 1AI1H 4HAGA 1QBMH 4I2XA 3BKYL 1T1XA 3GIZH 4P5MA 4XBPB 4ZS6C 3D0LB 4LLDB 1WFTA 3QRGL 4OFPA 1F42A 4OFYD 2F5BH 1DUZA 4PBVC 2EEBA 1ZS8A 4R4FL 1INEH 1SYSA 4Y19A 3HXCB 4XP1H 3S34L 1NBVH 5ALCH 4OLYH 1MSPA 2IPKB 5CBEB 4JM2C 4DGVL 5F96L 5JOFA 4KZDH 1CS6A 5DVKA 4KK5D 3TV3L 1U3JA 4G8EB 1TFHA 4YAQA 3GSXA 3QIWD 1TENA 3ESVF 1JHTB 2FX8L 4LP4A 2AW2A 3VW3H 5FCUH 4GW1A 5EA0H 3F12A 2YSSA 3DSFH 4R2GC 4IOIB 5EU4B 5FHBH 2CLZA 4JVPA 3Q78B 2GAZA 1NFDA 4FG6C 3MLYH 1TN8B 1PJ9A 4NQVA 4WHDA 2VZSA 4XPTL 3VWKC 4HJGB 2OYPA 4ODBD 1CLCA 1EEZA 4F7TA 1QO3B 3X11A 5E8DH 1LO0H 3UBXG 3FB6B 4BZ1L 1G7HA 3CD4A 3QFJB 3RKDC 2Z8SA 4X4YB 5TPWL 3U7WH 4LPWA 2ARJA 1N0XH 1JWUB 4B0MM 1JMZA 1YUHB 1LNUB 3NIFE 2IG2L 2A9NH 1NC2B 5CP7A 4FQXD 4WTZA 1EEUA 2VLKE 2VLJD 4NQCE 3L5WB 4PJXA 1CE6B 4G6AC 2X9YA 1CLOL 1QFUL 1YEJL 1BFOA 3IU3A 4PP1D 3KDMB 1ZLWK 2B1AL 3QWRA 1R0AH 4EI6A 2B1HL 2FJHB 1KFAL 3D87B 2FZ3A 1JRHL 1VACA 4Z7WA 1FSKB 5C08B 4ZTOH 2DQHH 4ZUTB 1A3LL 4TNVK 3X3FL 2NMSA 4D0BA 3UTTB 1G1YA 2QTEA 3VWKA 4ZRQA 1NLBL 4LKCA 3VGBA 5E9DA 5E99H 2APFA 3CSBA 3EHBC 3K0WA 4FQQA 4P4KA 4WO4C 4U0QB 3VXNB 3QUMB 3U6RA 3MRNB 5T3XL 4GG6E 4Z7UF 1S9XA 3U83A 1A6PA 5D7JB 4XVJL 1QKZH 1EIBA 1T21B 1MCQA 1PEZA 3C5ZC 2DS4A 4EOWL 1IAMA 3KXFA 3O4LE 5CD5C 3AMLA 4NWTL 2GFBA 4RMQA 3VI3F 1T4KB 2X09A 5DK0A 5I71B 1UZ8A 2NLJA 4Y8DC 4HJ0C 2YUWA 5CD3B 1GIGH 2WBJC 5DHYA 3SDYL 1DQJA 3S4SA 3L5IA 2R69L 5EO0B 3FL7A 2J3SA 3MV7A 1IAKA 2RIKA 5GIRB 4LKXB 4IRJB 3TT3H 1MCOH 5K9JL 1IAII 4M43L 4MD5A 3S36L 1JWSA 2XQBH 4LVNB 4TUKL 3IJHA 1N2RB 1DVFB 3MLXL 5E6IB 2Z91B 4HS3B 5GGSY 1FPTH 1II4E 4LCUB 2R29L 1T04B 4O9HL 2EIZA 1FH5H 5DJCB 5IMKB 3DVGA 3C5ZA 1CFQB 4U6VL 1KIQA 4KAQH 5E95B 5GZNC 2XY2A 5I1JL 4OD2B 3TBYA 1MFDL 3DXAE 4WTWA 4OJFL 3GIVB 3C9NA 4GMTL 4R8WL 2YKLH 3DV6A 4ACPA 4YHYB 3S35L 4F7EB 5J3HD 1CDCA 2WBJA 3FHQA 5E8OB 1U8JB 4FABL 1CCZA 4LK4A 2ED9A 3NZHH 4XPHH 4HHAB 3TP4A 2J8UF 3B9EA 4LVEA 1NGPH 5CJOL 3VCLA 2BVYA 4OLWL 4K7PH 3BQUD 3RY6C 1CGWA 1RZ8B 3JXAA 3DSVB 1MJUH 3ARVA 3AROA 5HI4D 4EIZC 1GOHA 3V5DA 1Q9OA 2QHRL 3C8KB 2FR4B 2BY1A 1SY6A 1JHLH 2YRPA 5TE7H 3ZKND 4AT6B 2R23A 3QNZB 4CMHC 5I1IH 2ZSVA 4YDJA 1WCBB 4TQEH 1DDHA 3GB7B 5HYQB 2QQNH 5C0BA 3MRMB 2FL5A 5SX5H 3HRPA 4YC2B 3RGVA 2YA0A 5HSFA 3GJFA 4HEME 3WL9B 3QULA 1CD1B 1MIEH 5J6HB 1J0KA 1NBYA 5FAAA 2V2WA 4FXKB 1A7PL 5LCVH 3WXWL 2WQRA 5IW6A 2MTPA 1PKQB 4OLVL 4X80L 4FOMA 5EU3A 1HZFA 4NM4L 2P45B 4HSQA 3HB3C 3IDIA 3NIFF 1KEGH 4K9EH 5EC2B 4WV1C 2C4FU 4U7KA 4HBCH 4XAKD 1ZVHA 4YHZL 1RULL 1BVKB 1NDGA 5AYUL 2I25N 3ZDYE 1KUMA 3RY6A 1I9JL 3BKCL 4U1GB 4MAYC 2YBRB 4J23A 2NNAA 1T0NA 5JZ7C 4OLEA 3K8MA 2MMXA 4J7RA 5C0ND 4MD0A 3BT2L 3HNVH 5EO1A 1AFVH 1VADA 1BD2D 3MRGB 4IDLA 2JIXA 4MJ5B 3C87A 4QHUA 4HXBH 4PJAB 1OM3L 1FYHB 4NYLB 4K8RD 4HMEA 5JDSB 2OTWB 5DDHB 4I0KA 3OXUA 3C5JB 3ULVD 5BV7B 1O5MB 4JO4H 1OLLA 4I9WE 3DO3A 4LSSH 3V0VB 3ZT6A 4PJEF 2P24A 3BEVB 5DQDL 4MJIA 2R2BA 1LDPH 5BRZD 5GS0L 1FZMA 2V2XB 1ZGLB 1HCFX 3MBEC 4LPVA 4R4NC 4FZEL 2IAMA 3Q6GH 1PD6A 4HWBL 4I18C 1NGQL 5IQ9A 3VXMB 4KK8C 4HPOH 5MENB 4XP9H 5IB5B 2HP4A 3D18A 2DWEB 4HS6A 1M7XA 1DBBL 2BK8A 2OI9C 4BELD 3SE8H 1BREA 1DFBL 3C6LD 3G6DH 4F9PA 4XCFH 1N6UA 4G80B 3GMNA 3NABL 4PJ5B 1CGXA 3KPNB 1TNZB 4X6EB 1Q0YH 2B0SH 5D2NC 2BSTB 2XNAA 5LWYL 3NA4A 5IW1B 1C5CL 1C5DB 5F6IB 5B4MD 3OKEA 1QBQB 3BP6B 5BS0E 5ITBL 3QDJA 3CZFA 3SKMB 1KB5A 4PJ7E 4AIZA 3S96B 2YR3A 5BJTB 3EYQC 4KMTL 4Z76B 3FO1A 4MNQB 4PV8A 5KW9H 2VKXA 1KCKA 2D7OA 5JNYA 1SBBA 4H1LG 3MBEA 4UT6H 4LPUA 4OIIL 4I18A 4GKNA 1SA4B 1HHJA 2X4QA 1QBLH 4PJCA 4KJWD 3MLRL 3HE7A 4FP8H 1I1FB 4X8JA 4XNZC 4JAMA 3BUTA 2Q8AL 2QR0A 1MCJA 3WYRA 2AXJA 4OUUA 3ZKQD 3M07A 1CLZH 3CFCL 2R9HC 3HPLB 4RAHA 1Q9LB 3L3HB 5JUEH 4LHUG 4NC1C 5KAQF 3RVTC 2HRPL 4IMLB 4PJBA 3QNYA 4YPGB 4QRUB 4J4PC 5B39B 3O3AA 4DKFL 1GRWA 4J1UB 5I8OH 1QVOA 4FFVC 4L9DA 4EXKA 2EYRA 2NTFB 2ATPA 4FQ1H 5HYJA 1FQ9C 3Q5OA 4JDTH 3MUY1 4D9LL 4MZ2A 3JV4A 2IADB 2VXTL 3IYLW 5IB3A 3MRPB 3GSNH 4NM8H 4XPAH 5JMOC 4FQLH 4TTGA 4RISH 3V6OE 4R7DB 4AYFA 5H35A 4Y2DD 5DJDB 1D5ZA 1DBKL 1PEWA 4QRPD 5BQ7A 1QZ1A 1JNLH 4YDOB 5IGXL 4PBWD 1XGUA 1XR9B 4ZQKA 3HZYA 2R2LB 5T1DL 4PRIB 1A7RL 3QDMA 2DKMA 4FTVA 4JREC 1MCFA 4LCWD 2V3NA 1MCHA 3GI9L 3RUGF 2HJFA 4KK5C 1YNTB 3MJ7A 3H6JA 3Q3GA 2C3VB 2DQFA 3QIWC 5H37G 4NQEB 5CINH 4J4PA 3G6AA 4E0RB 4WFGD 5JOPD 1LMKA 4TSCL 3WD5L 1QYGH 1T5XB 1UYWL 3FAWA 3SHSA 1GGCL 1G6VK 2A6KB 4RZCB 4Y5VC 1V3MA 4OZIB 1DBAL 4JZOA 2PN5A 1JGVH 5CKGA 3V9FA 5CSBA 4YFEA 3OKMA 5TE4L 4JKPL 1F6AB 1OGTB 1RZKH 1YEEH 3BD3A 3UPCA 4PG9A 4OFYA 3FRUB 1XGRA 3ULSA 5HPMB 2ZCHL 1KCRH 1U8QA 5EOCH 5CFHA 4PJIB 1S7TB 1UM5H 3C72B 1T22A 5ACZA 5ID1B 4KUCF 4HC1H 2CKBB 1A14L 3QIBD 4PJGB 1ZOXA 1HXMB 5CIPH 4YHIA 4PP1C 3OPZH 4JFHE 2BOCB 4UOJA 3WFDL 5KS9A 3L95A 2OL3A 1ZA6B 3QIWA 4TSBH 5F97E 1QHPA 5DMYA 43C9A 3PWNB 1XH3A 4U4BA 3PZ2B 4F58H 5HDLA 1PQZB 1WEJH 2KQMA 1JPFA 5DSCB 2VWEE 5EU5A 3T2NH 3BEWB 1QBAA 1JZ5A 2BDNH 4J6RL 2FX7H 2Z4QA 1RFDH 5TJWK 4XMKL 1F2XK 1K4DA 2XWTB 3B83A 2FX9H 2HFEB 4PRAB 3JWDC 4NQTA 4QTHB 2B2XH 3AAZB 4PJ7F 4WTXA 1KOAA 1AGFA 1F8TL 1LP9A 2NY0B 5E2WL 4YDKH 1WZLA 4NGHH 3E3QE 1CL7I 4FQXA 5BVJB 1NCDH 1UA6L 1MCCA 5GRWA 2DLFH 4JY5H 2VLJA 5F70A 5ID0A 1OSPH 2D7NA 1W72B 1O6HA 2LAGB 2NY3B 1JF1A 2PTVA 3ZLQC 3SKNA 1OTUD 1FV1B 3OXSB 2AJZB 3ZYOA 4ONFL 3N85H 3QNXB 1YMMB 3SE3A 4HWEH 1TETH 4HS8L 3KS0J 3LSOB 3RP1A 1NFKA 2LAAA 3QPXL 3J8F7 2HJLB 3FO2B 5CCKL 1JNNH 4HUUB 3I3EA 3LN9A 3LKPA 5C0CB 1KCVH 1CD8A 3SE4C 2H3NB 3EFFA 4O58L 3DUSA 2Q86B 4N5UA 3ROLA 1IRAY 3MV8B 3WBDA 1UWXK 5JW3H 3BH8B 2FO4A 4OM1H 3IVKA 1QBBA 3CSYB 5BZWA 1D9KA 1AGCB 1TZHB 3QHZH 1AD0A 5HHQB 4BM7A 2EE3A 5T3ZE 4LRIC 4YHKL 3F7VA 4NZDA 1N5YL 1NJ9A 2C3HA 3G5VB 3I75B 2EO9A 2A6DB 4HIIA 3PHQB 3VXOA 1HZHL 4RAUB 1RK0B 3PWLA 4X5WB 5J3HC 3FB8A 5HHXL 2P5WB 2EDNA 2P5ED 5C0RH 3U0TA 5ADPL 1YQ2A 4S1QL 2DBLL 4RNRA 5D7LD 1BLNA 3DWTA 1DP0A 3EOTH 2D7TH 1DR9A 4ZO7A 2D7QA 4CNIA 3BQUC 5HI4C 2AQ3A 4LNRB 3GSQB 4JPIA 2DF3A 3G5ZA 3KYNA 4K3EL 3BWAB 3SCMB 3SE4A 4K3JL 3BPOC 3ZKNC 3EYUL 1TPXB 2NXZD 3DX6B 4RGNE 3MRCB 1XF3A 4X5XB 3ZSTA 1KJ3L 1B3JA 4KZEH 1F90H 2GITA 1OD9A 2VNCA 1A21A 1V7NL 4MLSA 3QG7H 4MJ6A 1R3KA 5F7KC 4WWKB 4I5BB 5L9DL 1MRCL 1TJIL 4LRIA 1MCWW 2VLMD 1IC7L 1ROWA 4L5FH 4P46D 5AAMA 1EGJA 2KBGA 4O4YH 2P8MA 4ODTL 3N1QC 2RR3A 4N8VA 1KCUL 1AXTH 3TNNB 3HXDB 1FGNH 4NRYB 4S2SA 3C2AL 1H15B 2EDWA 1V8HA 1ZEAH 5JR1L 4F2MA 1U3HD 1M6OB 3V4UL 1YEIL 4FFWD 3BQUA 1U0QA 5I16B 5I15L 4M4RA 1A7OL 5DA0B 3P9LB 3CFEB 3TYFB 3ULUE 1R24A 2XWBA 5DMIL 3HE6A 1NH6A 2FATH 3CVHL 4M48L 2L4OA 4Z7UB 5C0NC 3VRJB 3GSRB 2DOCA 2AS5M 3LMJL 4X7TA 4N0UA 3B8YA 5ICXB 1MJJA 4GTMB 1H3PH 1ZVSA 1MFNA 1EHAA 2NZ9D 4K8RC 5IESL 1N9AB 5EIIA 5FDYA 5FA4A 4TSAH 3DVFA 4H8WH 3W81A 1BEYL 5IP4A 15C8L 4CKVX 2IWGA 4F7MB 4MMXC 4YZFE 3TJEL 1FORH 5I19H 1FAIH 2GUOB 2EICA 5SWSE 2X1QA 2JJWA 4PRPB 3G5YB 1H5BC 4YXHL 5CJQH 4Q6IC 3FO0H 2MSPA 3DPYB 2XN9D 3D39B 1FBIH 1D8DB 1TZIB 4JHAH 4P2OB 1F02I 3GMOA 1YN6B 1CK0L 2CO6B 5JHDE 3U0PA 1NL4B 4XP4H 3RWGB 1NC4B 3HS0A 3C6LC 2ADFL 1MFCL 4OV5A 2HT3D 2EC8A 5DUMH 2R0KL 1Q0XL 1MVUB 3PGCB 3KPSB 4MA8H 2ZUWA 1T5WA 4NOFA 1BD2A 4R97B 1HXYB 4FQ2H 5ERWB 2OJZH 4OCSL 3WFHA 4U1HA 5DRZB 5HPOA 1RZIA 3DUUB 4F8TA 5IM7B 5SWZE 3W11D 2R4RH 3VFTB 5B4MC 2BVQB 1OAZL 2JTDA 4MDIA 3RL2A 4OIBA 2VH5L 2IFFH 4FQIL 5FK9B 2FB4L 4M6NH 5BRZA 4YXLH 1C12B 2O5XH 1HK6A 4YXKL 5F3BB 1KGCE 1X5XA 4XPBH 1K9TA 3UJJH 1EFXB 4Q6IA 4F7PB 4LLQB 1T0MA 2VQ1B 1IAOA 5DI8B 1MWAH 5DRXB 3O2VL 1JTPA 5DJ2B 1EMTH 4KJWC 4NO0B 3BN3B 5K9OA 1G6RH 4LVOB 4Z7NE 3QXTA 5JIPA 2FRGP 2WLYA 2I9LA 1YYMH 3C6LA 3QSKB 2IH1A 3IDXH 4EUPH 5IK3B 3AC0A 1CGSL 6FABL 3QZWG 4MJ2A 3RAJH 3AFLA 4Z0BL 1HKLL 3HUJA 3EJJX 4H20H 3GSOA 4LCYA 5IKCA 5ITFB 5LXGH 5LQBL 3KJ4B 5CGYD 3O9WB 3U79A 2CR3A 3STZA 1IEAA 2RFXB 3HC0A 4YEEA 4ALAH 3D48R 4KC3B 5F9WB 4AG4H 2VLKB 5DFTA 4NQCB 1CLYL 3QT2A 3QFJD 1XCTB 2XPGA 5T33L 3RNQB 5IIEA 2DQCL 1SA5B 2EE2A 4CRPA 3U2SB 1I3RB 1NC2D 1I9RH 4YPJA 1ETZB 5I1KL 4Y2DC 1NFDE 4UQ2B 2UZXB 4H88L 2MCPH 4PG2C 2YD4A 4ZO6A 5J6GA 4LGRB 1OHQA 3RA7H 1H0DB 4C59B 3F62A 4A6YA 5B38A 1M7DB 2Z8RA 3BI9X 3T4YB 2YZ8A 5C08D 2DI7A 4RWHA 5DJAA 2F53A 4HFWB 4JFZL 2V7HA 4OFKA 2Y5TA 5DJ8A 4G8IA 3UTTD 2R1XB 3QCTH 1UB6B 1AP2A 1XGQB 4MA3B 4NHUA 2QLVB 1S7RB 1UADC 5D1ZB 4BH8A 3PGFH 3P77B 3N9GH 5KOVC 3LD8B 4J3TA 3O4LB 1RHHB 4D9QD 2PYFB 4HQQH 5IBUG 1P53A 1HQRA 1F4YL 3HC4L 1NFIA 3L1OL 1R3LA 4Y2OA 5D7JD 3T08A 4HDIA 3X13B 2R4SH 5E4EC 5HYSA 3M1BA 4Y2DA 1HINH 4PJHA 4QRPA 1IGFL 1AO7A 4XH2A 2OK0L 1JV5B 4PG2A 2OCFD 5E9DE 4TYUA 2I07A 3LQMA 3FKUS 2HKFH 4KKJA 3IS1X 3MNWB 4U2YA 1HNGA 3OAYH 4QO1A 3NN8A 5M95B 1U8LA 3QIBC 3FMGL 1JGLL 2R56H 4LCWA 5GRZA 3KPLB 1U3ZA 3WS6A 1G7PA 1BQHA 5C0IA 4ORGB 3GUTB 3WNMA 5FYJL 3KXFE 4KK9D 2DQUL 3H2WA 3ZL4L 4PJDF 3GGWA 3L7FB 4G7YL 25C8L 3ARFB 3FONA 3LPWA 2AV7B 1XF1A 1DVFD 1XEDA 5E6ID 4ELMF 4Y4FD 2F74A 2ATKB 3BOVA 3PXHA 1ZHLA 1TJGL 3DXAB 1OSZB 2AJUH 4UV4L 3QPQD 2Y36L 3DX8B 4GTTB 3B3IB 1QA9A 3SQOL 4TUOB 2O5ZH 4UILH 1EEYB 3L5JA 3M17B 1UXSB 1JFQL 4CVZB 1BM3H 3S37L 3T0VA 1BVZA 4U1NB 3U1SL 1EJOL 3JVGC 3IDJB 1U2CA 4GXVH 1NBQA 2J6EA 4LSQH 3P0GB 3IU4L 3MRIB 5CSZA 1AY1L 1PYWA 4ZFGH 4PUBH 4Z6AT 1QLRB 3QIBA 3LKSA 2AEWA 3O2WH 3NGBB 4GTVB 1OTUC 1HSBB 1UM4L 3MREA 3MV11 2ICWJ 3HA0A 3OX8A 3O6FC 5ELIA 4N9GA 4A2LA 3NIGE 1OAUL 4RQQB 2YD1A 5AUMA 1EO8L 5TDOA 4OZFA 1FCGA 4PRDB 1F4XH 1A6ZA 4J8RA 2AKRA 3JWOC 4BZ2H 5JXAL 3MBXL 4JRYD 5CAYB 5FM8A 3H7BB 4M61B 5AWNL 2LVCA 3LHPH 1TNOB 3HI5L 3I3DA 1Q9KA 4P3CL 2ZIRB 1DLHA 1FL3A 2IGFL 2Z35A 4UINL 4WW2F 3SDCA 4B50A 4JDVA 2QADD 3VGAB 1DQDL 5FB8A 3ZHLA 3ZE1E 2IALA 3PABB 1RVFL 3MOAH 1JPTH 3UO1H 5L88L 1EXUB 1WIOA 2XXMB 3JVGA 1AI1L 4YBQD 2KZ1B 5C8JB 3UTQA 2BVUA 3RL1B 1CDBA 1NFDF 5AYQA 3UCRA 2F5BL 3T0AA 5C0BE 2E7HA 5C0FB 1INEL 4XP1L 5HHPA 2HTLD 1MFBL 4G6KH 1QSFE 4ZUSA 4KZDL 4LCCA 1VPOH 3NZ8A 1NAMA 2CDEA 3HCVB 3QO1A 3NH7H 3MGOA 1N64H 3FTGB 2CDGB 2GSIB 4OV6F 4Q9RH 4KWUA 3R06A 2F15A 2R0ZH 4MQ7A 4X6CE 5FHBL 4DZ8A 1MHEA 1B0RB 4WI7A 2NXZC 5D72H 5C2BL 2ITCB 3MLYL 3KPQB 4HIHA 4HK3J 1QOKA 4L9LB 1M7IB 1NMCC 3FT4A 3LCYA 4PRNB 3NOIA 4JG1H 4X9FA 4F80A 4KVCH 4P46C 3OB0H 2X70A 4OFIA 1PG7W 3LRGA 4M03A 3U7WL 2YN5A 1N0XL 2OBGA 1BWWA 3MOBH 4C4KT 4X7SL 5F89B 1G7IB 5IMMB 2P5EA 1S9YA 4W4NA 2BY0A 3PL6D 2V9QA 5D7LA 1IC4L 1U3HC 5I30H 1CXKA 3A67H 3K2MC 1R0AL 2VLRA 3GRWH 4TVPE 1RUQH 1XIWB 3IGAA 4MJIE 3AXLA 3T8XB 2FJFB 2GJ6B 2OTUA 5DMGD 5FOBA 4ZTOL 5BS0B 4KRMB 5KSAB 4JKLA 4PJ7B 3EKCA 2G9HB 1I8LA 4HEPG 4UOW1 1ZTXL 3CMGA 5E99L 4OZ4A 4XVUD 2D4FA 1EA9C 5SWQA 1TMCB 2NZ9C 3HAEA 3MA7B 2BNUA 1U8MB 3KLAA 2W9LA 4P3WA 4WU5B 5DRWA 2NY4B 4MNQD 3EYVB 2EXYD 1QKZL 2P49B 4MCZB 3RWHA 1IKFL 1EZVY 1NL0L 4DN4H 4MAUH 3TIEA 4Y16B 3STLB 5ICZB 4GG8A 4ZOAA 2RCSH 4OD3H 2EYTA 3FFCA 5D8JL 3ZHKA 3WEXA 2MNUA 5KVDH 1U3HA 4K7FA 4POZD 3QEQE 2Y07H 2P8LB 3MNZA 2GTWB 2X4PA 4M6AA 4PTTA 2YHGA 1CFTB 1TVBA 4UAOB 3MJ6A 5DRNA 3RZCA 4U6HB 3BPLB 1IGCH 1FNGB 2HT3C 1MCOL 4QCIA 3WV0A 5E8EA 1TDQA 2CLRB 5JW5A 2H6PB 5FYLE 4JEGB 1LQSR 3SY0A 4OT1H 4HUVB 4JY4B 4OTXH 4PJCE 4GSDH 4YO0B 3L3OB 3IFPA 1WUNT 2VDRH 3KPTA 1IC5H 3ZE1F 1AJ7H 5C9KA 3W11C 4I77H 4FQPA 5ESQA 1FPTL 1I7TA 1VEPA 3K80A 4NT6B 4CADB 3QQNA 2ZUTA 2NW3B 1T83A 5LAXA 4BUGA 1TNMA 3KPOB 3D0VA 4PJBE 4L3AA 4G42A 4NN5B 2HRLA 4QRSB 5F1IB 3IJSA 3QQ3B 1CFSB 3O11A 1O79A 2XN9A 3ARWA 4QXTB 4PRID 5JPMA 1KSRA 5FCSH 3NZHL 4XPHL 5HYJE 1GAFH 4N0FA 5H8DA 4K2UL 3QG6A 4CVXA 2MJWA 3I6KB 1NGPL 1FFOB 1HN1A 4KPHH 5LGKA 2PW1A 4OF8A 4CMMB 1N6VA 5HI5D 3AMKA 1MJUL 1E4WH 1NGYA 2VDMH 4NQED 3BFOA 5ICYB 4IDJH 1D7FA 4TUJA 3VWJB 1JHLL 4X6CF 1AHWB 5TE7L 4AJ0A 3G6JF 1CDJA 3B6SA 2GJZA 4TQEL 4PYHA 4BSVB 1HOCB 2QQNL 5EBMA 5CGYC 3SEPA 3QDME 4IS6A 1OF2B 1B90A 1T7VA 1S9VA 2FLRT 3U7AA 2V9RA 4WFFD 5FYKL 1ZLWH 1SEBB 3B9KB 4XBPA 5LCVL 1H3CA 4LLDA 1LO5B 4OCRH 5GHWH 1W6JA 5SX4H 2VB5A 4EDXB 4NZRL 5DJ0B 1KEGL 4K9EL 1ZLUK 3ABZA 3B5HA 3CSPA 2EH8L 2BX5A 4XNQB 5CBEA 5ESAB 1CICB 2HFTA 5AZEL 4HUWB 4ZOEA 1XF2A 3MJ9A 3B2VH 3MR9B 4G8EA 4ETYA 2ZCKH 2D7MA 5DD6A 1KJMB 1FSKC 3QFDB 3F6IA 4U3CA 3WMSA 2AXFB 3UC0L 1LE5A 2HAZA 3VGFA 1S7SB 3OKKB 4NUJB 3CAFA 2ORBL 4O00A 1VFOA 3TNMB 3HNVL 1IBGH 4HJGA 1MH5B 1QD0A 3RWDA 5I1EH 1AXIB 3P73B 4QYOA 1U42A 4LFHD 2IBZY 3GDBA 1QO3A 1RZGB 4RFEA 1RZFH 4HKXA 4XBGB 4Z7QF 3HR5B 5KS9E 1XF4A 3QFJA 4NNXA 4OAWB 5IJVB 3CDFA 5D7JC 4LPTA 5EUOF 2NY0D 1YUHA 2X7LB 5I1AA 1NC2A 3PWVA 4WI6A 3BHBA 1LDPL 1KENH 4FFZH 4Y4KB 5T1LA 1LO4L 5I71C 5MEPB 1NMAL 3L5WA 1CE6A 3FT2B 4KY1H 4YFLI 2NY3D 2A77H 2AGJH 4ZRPA 3NFPA 5IQ7H 1YMMD 4XP9L 2FJHA 1MFEL 5HJ3B 1JZ8A 1XF5B 4MX7B 2X5PA 5HHNA 4RGMC 2JB6B 3I9GL 1LP9E 1N59A 2M1KA 4KTDL 4E42B 4U1IB 1JGDB 3RU8H 5GGRB 3ARED 4KK9C 3UTTA 4ODUB 1INQB 1BWMA 5C0CD 1LEKB 2IC2A 4LVNC 3FQRB 2AEPH 1ZLVK 3VXNA 3QUMA 1DVFC 1EK3A 1MHHA 3EYSH 3MRNA 4Y4FC 4FZ8H 5E6IC 5HDQH 5C6WH 3GNMH 3KR3H 4U6YB 2R1WB 1JIBA 3QPQC 5D7JA 4LEXH 4NSKB 1T21A 2D03H 4KQ4H 2X1WL 2NY1B 2E9WA 4NKIH 4AMKH 4XCCH 1LO2L 1T4KA 5FV1L 2PKDA 2V2TB 1C16B 1F5WA 5CWSA 4NQDD 2YXMA 4H25B 4YHYC 4DCQB 1H9VA 2P5WD 5HGAB 1A0QH 1QEWB 4KHXH 1MQ8A 4RGNB 2DIJA 4FP8L 4LKXA 1X4ZA 5IBTH 3PUCA 3WIHA 4JZJB 2AXGB 3FQXB 1CLZL 2C1OA 5FXCH 4GW4B 2GTZB 3QQ4A 4NP4H 5JUEL 4U6TA 5I76A 1DVFA 1DN0B 5E6IA 4Y4FA 4V1DD 3OKLA 4HS3A 2RQ8A 1IZJA 2FD6H 5DC9B 4YC2C 3DSTB 4LCUA 4G6JL 4OBRA 4WWKD 4HH8A 5DJCA 5IMKA 4FQ1L 3Q5TA 3FOMA 1CFQA 4JDTL 3CNKA 5ADOH 4OD2A 2HJKB 4S1RH 5CGTA 1NUDA 3GIVA 4NKDB 3GSNL 4X6FB 1T1ZB 4X7EC 4YBQC 5A1AA 4F7EA 4M7ZB 5HI3D 1NCCL 4RISL 4TNVF 2BCKB 4U31A 3SOBH 5DD5H 1EAPB 2ZUSA 4HHAA 2QSQA 5JHLH 2N56A 2V5MA 1KELH 5D93B 2HTLC 3MODL 2HT2D 3O6KH 5JQHC 1TZGL 4U1GC 1UKSA 2FR4A 4H1LA 4AT6A 3QNZA 4JRYA 4RRPG 3L3DB 3GB7A 5HYQA 5DYOB 3MRMA 2PETA 4KGJA 5DD0H 1S5HB 2WZPD 1QYGL 3WL9A 4U3XA 3EU5B 1CD1A 3IB4A 5J6HA 1SQCA 3FB5B 4FXKA 5SWSB 4W6WB 2JCCE 4XHQA 5BV7C 5DGQA 4U1KB 4LHUA 2VE6B 5L2JB 3H0TB 4GTOB 5EC2A 1B4JH 1RZKL 2Y1VA 5C0GA 1DQLH 5JHDB 4PRPD 2F54A 1O1TB 3MO1A 1DL7L 3R1GH 5HGGS 1BVKA 1KCRL 4N0UE 1VB9A 5EOCL 3NTCH 3D39D 1RIUH 3KPRD 4I4WA 1UM5L 3G08B 3PE9A 1TN6B 2ESVB 4P2OD 2J88H 3PL6C 3R0NA 5L7XH 2FH8A 1SQ2N 1I1YA 1VESA 3P4MB 2J5LB 2YBRA 5EZOH 3OPZL 2NW2A 3MV9D 1NC4D 4GTQB 2HT4D 4L3CB 4O51A 5SWZB 2GJJA 4F58L 3V7AG 5DMGC 5KN5A 1WEJL 3VU2A 1XZ0B 4XAKE 2NTSP 3BKMH 4PJAA 3PWUB 4NFDA 1OW0C 3CJJA 1U91A 4D4BA 2APWA 2OTWA 5DDHA 5F6IC 1RFDL 1JRHI 3U9PH 2QKIA 2HFGH 3STBA 4XVUC 4PV9A 4L8BB 1J1XL 1G7LB 2F58H 3V0VA 2WW8A 1UEMA 2B2XL 1TCMA 2BVTA 3MLVH 4KJPD 2AAVA 2V2XA 4YDKL 2EXYC 1ZGLA 3EDDA 1KBGH 3AS3A 3E30B 2GHWB 1EFXD 1A5FH 4LSRH 4P5MB 5CSGA 1REIA 1TQCC 3OBAA 4Q9CA 2PTTA 4JY5L 3PL6A 1GHFH 2Q1EA 4OI7A 3QO0B 1A6TA 3ULVE 3MTRA 2KPNA 4POZC 1SYSB 5IBLD 4P2RE 4C1SA 2DQEH 4HWEL 1TETL 2BNQB 2FGWH 2N7BA 2ZKHH 4QEGA 1QFWI 4ISVB 4WW2B 2EH7H 3KPNA 2XG4A 3V6FA 3D3VA 4X6EA 3DI2B 3EYOA 4FXGA 1JNNL 5GRVL 3GSXB 1KN4H 1OW0A 4XP5H 5IW1A 1KCVL 3F12B 1PX4A 2CLZB 3BP6A 1DLFH 1HWHB 4ODSH 5JDJA 1BVLB 1NFDB 4XNYH 1M05B 2XQYK 5JIHA 3SKMA 3CFKA 5JW3L 3DYMA 2VLKD 4OM1L 4NQCD 3S96A 5BJTA 3QHZL 1NANH 4Z76A 4MNQA 1EEZB 1KXQE 1FE8H 3UBXI 4IRZH 3HUJE 5F7UA 2B4CH 1G7HB 1L0XA 4XBEL 3VGDA 1CT8B 3JTSB 2ARJB 3UPRB 3FB7A 2VR5A 4QTIH 3FN9A 3AGVA 1HCVA 5C0RL 2XY1A 4QNPE 4XC1H 1BIHA 3HPLA 1Q9LA 2XTLA 3L3HA 3EOTL 3LEVH 4FQHB 4HWUA 1BFOB 1RMFH 1U58B 4IMLA 3MA9H 4M62H 3ARGB 4QRUA 1GPOL 4YPGA 2OSLA 4GKSA 4X6DA 4J1UA 3JSSA 2AI0H 3FOLA 5BVPL 2IPTL 5IB1B 5D1ZD 1CE1H 4YDLB 2YWYA 5BV7L 1DQTA 5C9JA 3O4LD 5EFIB 4GAYB 4D0BB 1F90L 4WJ5A 2JCCF 4JKMA 3E37B 1MAMH 3JV0A 5E9DB 3QG7L 5JLZA 4M7KH 4JHWH 4P4KB 4DOHE 1BBDH 3U6RB 3VI4E 1YNKH 2F53E 3MROB 4Y5VA 1MRDH 4R7DA 1T1YA 2NY5C 3TO4B 3O6ML 1S9XB 5F71A 1T6VN 4O4YL 1XR9A 1RUMH 3ILPA 4PRIA 1AXTL 5MP6H 3GO1H 3KXFB 3TLRA 2V8IA 4OB5L 5DK0B 4K23H 1ZEAL 3T1FA 1UZ8B 4XMLH 1EJ6A 5J89A 1EHNA 1GL4B 4MU9A 2P48B 5DHYB 4P99A 3W5MA 3C60A 1DQJB 1N26A 4NQEA 5GXBB 4E0RA 2ENSA 2P47B 4QRPE 1AO7E 3VFUB 2FATL 3ARFD 1T5XA 3P30H 1UKTA 1IAKB 4NZTH 3DX7A 3K81A 4OGZA 1AQKH 4OZIA 2FECI 2HN7A 2ITDB 4LSUH 4MD5B 2H45A 2CRZA 3DXAD 5INCA 4EUPG 2Y25A 2BY3A 1ZT4A 3IJHB 1H3PL 4G7VH 4XI5D 3ZDZE 2Q6WB 3H3KA 5AAWA 2UWEE 1CWVA 3I50H 5GISH 3ARBD 4TSAL 2NY0C 3FRUA 4H8WL 3NCBB 2DLIA 3QJHA 1KJ2A 1CIUA 3CPLA 5JOPE 5E2VL 3QJFA 4PJIA 4TNWK 4D2NA 2ZSWA 1AXSA 5I19L 3BO8B 1KIQB 5ID1A 1UM6H 4U1SA 1F2QA 1CDIA 2XWJA 3TBYB 1A1OA 1HXMA 2A83A 4RIRB 2NY3C 4XWGL 1Q72L 3DV6B 1FBIL 4NO3B 1KCSH 2N4IA 1OARL 1X44A 4JHAL 1ZA6A 1JZ3A 3PWNA 1GZQA 3HPJB 2CMRL 1I3GH 3VCLB 3MRLA 1C3DA 2MPAL 1YJDH 2PR4H 4LIQE 1YMHA 3AREC 1A6VL 5DUML 4MWFB 3V5DB 3HNTH 1Q9OB 3H9YA 1JPST 3SDDA 2XWTA 1ACYH 3DSUB 4FQ2L 4WI2A 1JTTA 2R23B 2OJZL 3DGCR 2HFEA 2XXCB 3RJQB 2YPVH 4QTHA 4BA8A 3RGVB 2R4RL 3GJFB 1JI1A 2AP2A 5I8CB 3BE1H 1UG9A 3ULUH 3GSWA 5CJ8A 2IFFL 5BVJA 3BKYH 3L9RB 2AJVL 1QSFB 1ZANL 2H32A 3O2DA 3QRGH 4M6NL 5H2BB 3VE0B 5IW6B 5JQ6H 3ARRA 2O5XL 1W72A 3TN0B 3MRDB 1HDMA 3UJJL 4MB5A 4R4FH 1R5IA 1FV1A 3OXSA 1K5NB 3S34H 1MWAL 4QNPF 4X6CB 4DGVH 4HKBA 3K4DA 4YGVB 1G6RL 2ZOLB 1NDGB 2YA1A 1YYML 3O41B 4HUUA 1S7UA 1J87A 1EBAA 2ZJSH 3AREA 1MZCB 2FX8H 5C0CA 5D1XB 2LFGA 4I9WD 2H3NA 2Q86A 3RAJL 4RFNB 2NNAB 1E6OH 2E3VA 2FBOJ 4FN0A 4CMHB 3MLWH 1JK8A 4F15B 4H20L 2CSPA 3Q2CA 3BH8A 5FV2A 5EO1B 3QQ9D 2YD6A 4EXPX 1VADB 2ZNXA 4LHJB 5TQ0H 1CYGA 4WWKC 5CP3H 1D6VH 2VLLB 1DBML 1G9NH 4ALAL 1B9ZA 3VI4F 4TN9A 4YFLF 2VOTA 1FL6A 4BZ1H 1IGIL 3G5VA 3KLHD 1F4HA 2A6DA 5TPWH 5D7IE 1FIGH 3MJ8B 2LQRA 4NQDA 2CKBL 3TYGL 4X5WA 1J0IA 2P24B 5HI3C 2P5WA 1OAQL 1G9MH 1T2QH 1QACA 4I3GA 1YEJH 2IAMB 4PGJA 5IQ9B 1TVDA 2HT2C 5HVGB 1F00I 5DHVH 3BGAA 2B1HH 3F58L 3GSQA 1XIWD 1HYSD 1Y0LB 3BWAA 2GJ6D 4GAJH 5BS0D 5KSAD 2JE8A 3U30B 1FNLA 3MRCA 3OAUH 3X3FH 1IGYB 2E27H 4V1DA 4U6XB 4I3RL 2JB5L 5EUOB 5BW7C 3GMNB 3S6CA 3GSUA 1FFNA 3UTOA 3PGFL 1T7WA 2HYMA 4I5BA 4WWKA 5D7LE 1LTXB 3ZSSA 2CLVA 3N9GL 4XXDB 3ZDZF 2WY8A 4V2BA 5J4MA 4IMKC 2UWEF 4HQQL 5T3XH 2IAND 2VLRE 3QZWA 2F8XC 4NUGL 3N0PB 2X41A 1IQWL 4R96B 3OKEB 4CN1A 3QEQB 1X5IA 4J3WA 3V6BR 1LEIB 3CZFB 1A1MB 2N1KA 1ORSA 4EOWH 3DOSA 4Y16D 3FO1B 4PV8B 1TXKA 4Z18A 5JNYB 1HH6A 1RSFA 3S37X 3LN4B 1F97A 3KG5A 4NJAH 3BIAX 4P2OC 1TCRA 3QUZD 1C7TA 2R69H 1HHJB 1E4XI 3P9LA 4XXCC 4WHYH 5E08H 3HE7B 3QUYB 3LQAH 2HT4C 4X8JB 4MVBD 1RIHL 3D9AL 4Z7UA 5JTWA 4WY7L 3VRJA 1PGRB 1Y6MR 5BW7A 4GKZB 4OUUB 4M43H 1N94B 4TUKH 3FFCE 3BGMA 3DRQA 2DLGA 2DYPA 2HWZL 4PJBB 4RMSA 3QNYB 5TQ2H 5I8EA 4IMKA 2X4SB 3O3AB 3MRRB 5FO8A 5LGJA 2VAAB 2AJUL 4GMSL 5TFSL 2R29H 2UYLA 2EYRB 1MRFL 2O5ZL 4UILL 5HYJB 4U6VH 5KVMC 1HIMH 2GUOA 3EDJA 2XZZA 4M7JL 4PRPA 4YFDB 4ZG1A 4KJPC 3G5YA 1WWBX 3H42H 3ZE0E 1BM3L 5E03A 5IB3B 4MA7H 4OJFH 4GMTH 4R8WH 3DSWB 3D39A 1H8NA 3ARDB 3KPRA 1TZIA 1IARB 2PYEA 3VFOA 4P2OA 4LLUB 1D5ZB 4PUBL 5BQ7B 1JL8A 3O2WL 1OQXA 3W9DB 4LVOC 8FABB 4XXCA 4ZQKB 3RWGA 4O02H 3MV9A 5IBLC 2RHEA 1HHGB 4XNZB 1N6QH 3QDMB 4JQVC 3PGCA 4D8PA 3FQUB 4J3SA 3VWJD 5IEHB 4NKQB 3MJ7B 2BMKA 1AC6A 2K7PA 5ERWA 1F4XL 2E9BA 4BZ2L 5FA3A 2BSSB 3DUUA 3LHPL 5IM7A 3KJ4C 3O9WC 1JWMA 3SGDH 1ITBB 3ROOA 3VFTA 4A2MA 3ECBB 1A3RL 5DT1H 2LU4A 2PNDA 3LV3A 4PR5B 5F9WC 2J8UA 5FK9A 3GKWH 3I2CH 4JZOB 1P4IL 4KMLB 1A22B 3RWIA 4O5LH 5T1MA 5D7IF 3OKMB 2B5IB 1E4KC 1EFXA 5EZIH 2W9DH 4ZS7H 1WWWX 1HHKB 4W70A 5DI8A 1H3UA 1XGRB 1CICD 4PRHB 4X5LA 5GS1C 1F11B 1QNZH 2IPUK 5ACZB 4JLRA 4JQVA 1I9JH 5A2KH 3HZMA 5IK3A 5FUCE 2R2HB 4CU8A 2W91A 4YHIB 3K2UH 1ZHBB 3NH7L 4MNGE 5IHZA 5KS9B 2OL3B 4M7LT 1J11A 2ERJB 5AZ2L 3BT2H 1F4WL 1XH3B 1I7UB 2R0LH 5D1ZC 2GI7A 2RFXA 2C5DC 5D72L 3LD8C 3Q7FB 1OM3H 5DQ9A 5I1LA 4PYGA 1MCPH 4NQCA 4X9IA 3G04A 3O4OB 2Z4QB 1J12A 1K4DB 1L0QA 4NO5B 3TT1H 4DVRL 4JO3L 1I3RA 5BZDB 5DQDH 2PW2A 5F1SA 3Q48A 1AGFB 4Y4KD 1LP9B 4DVBB 3T3ME 5E1AB 1DZBA 3MOBL 1PVHA 4FZEH 2JK5A 5GS1A 3QEGH 4FQXB 4XAWH 1NGQH 1T0PB 3SGEH 1H0DA 4XGZB 3BMVA 1M7DA 5ID0B 3QXVA 1CQKA 4PLOB 1GGIH 1DBBH 1MLBB 3RY5A 3A67L 1DFBH 1K4CA 1SY6H 2OP4L 1ONQA 3MPCA 3K3QA 2R1XA 1E4JA 5EO9B 2XYCA 4AEIL 4D3CL 4MA3A 2Y7QA 5DR5H 5T3ZD 2VISA 1S7RA 3ARFC 4PJEA 4HULB 4NBYB 1J18A 1DTUA 1T1WB 3P77A 4J3XA 5MEQB 1RHHA 2PYFA 1OAYL 5IVZB 3KYMA 4LARL 3DUSB 4XI5C 5ITBH 2X4TB 3IXAA 2L7JA 3CMOH 2M8XA 4MQXD 3VRLE 4F3FB 2FO4B 2NY1D 4BKLB 1U95A 4E5XB 3ARBC 5DZOA 3THMH 3IVKB 3UTTE 3Q6FB 1D9KB 1JV5A 4NDMB 2XA8L 3DUHA 3MJGX 5B22A 1GXEA 2DLTA 3EOYG 3MNWA 4GRLD 4WGVB 4D9QE 4JM2F 4MAUL 4CU7A 3BGFB 2RCSL 4OD3L 1U8OB 3NGBC 4ZFOB 4RGND 3VXOB 4YH6A 4ORGA 3GUTA 4JANA 1A6WL 2Q8AH 3U0TB 1BLNB 1X5YA 3ARFA 4OI8A 4JGMA 1IGCL 4ONOA 2HRPH 4H26B 3QXAB 4JPIB 1T80A 4ZXBA 2Z31B 3PV6A 4DKFH 3DXAA 4ZO8A 2ED8A 3VGAC 1MY7A 3W39B 4HUXA 2XQWA 3DX8A 4OTXL 1MQKL 2VRAA 4LP5A 1XF3B 4TUOA 2DTSA 2DI8A 2VDRL 1PW3A 2HG5B 2OZ4A 3M17A 1AJ7L 3ARBA 4I77L 4MJ6B 1R3KB 3R8QA 2VXTH 1LWRA 1BIIB 1C1EL 4U1NA 2C4FT 3IDJA 1EZVX 3MGTA 4LF3A 3LRSB 3GMPB 4NO2B 2YD3A 5GRVK 1Q94A 1QLRA 2CXGA 2P8MB 1RUKL 5ANMA 4N8VB 5T1DH 4P23D 5C92A 2EIBA 4KXZH 1GAFL 3DVNB 3VA2C 4OQTL 4PRDA 5DA4A 4KPHL 5FIEA 5DMKA 2JCCB 1NBZA 3SO3B 3H7BA 4M61A 1E4WL 3BZ4A 2VDML 4IDJL 1F3DJ 1P5UA 2XWBB 3HE6B 4TSCH 1UB5B 4Y5YB 4Q58C 2OLDA 4PS4L 3GKZA 4QWWD 1FT1B 4OZHF 5SWSD 4P2QD 3QQ9C 5J1AA 3SDAD 1CN4A 5D70H 4X7TB 1N7MH 1PG7X 1KB5H 1I85A 4N0UB 2DTML 1EXUA 1MJJB 3QWQB 1FO0B 2H2PC 3T1WA 1ZVSB 4KHTH 3QI9B 3RBSA 5C8JA 3NCYS 4JRYE 1KIRB 3RL1A 5FA4B 3RUGA 4OCRL 3KLHC 1BJ1J 5GHWL 1ADQL 3BVNB 1FC2D 2CDFB 2D9QB 2JJSC 2EDJA 4JDZB 4GRWE 4CBPA 4P5KA 3O3DA 2ESVD 1X4YA 4M7LL 2DLEA 1WQVT 1RUPH 5J06A 5HXMA 3B2VL 3WFDH 4Y1AE 3H8NA 1XIWC 3FTGA 2ZCKL 2GSIA 3GMOB 5SWZD 1HYSC 5LBSH 5SV3A 2APVA 3U0PB 1H3XA 2F54E 3WFZA 1AGDA 3FRPG 5KSAC 1B0RA 2RGSA 3CDGB 4DK6A 2ITCA 1FYTD 3KPQA 1YQVL 2CQVA 2Q3ZA 3IDNA 3P0YL 4J6RH 3KPPA 1IBGL 2WBKA 1T5WB 1KGCD 2ICES 1NCUA 5I1EL 3VGEA 5HYFA 4YR6B 1NCAL 1YNLL 1ZVYA 3WFHB 5MEOA 4U1HB 1RZFL 4PGDB 2X89D 1FIEA 4JFOA 2EECA 3LN5B 1QLFB 5E2WH 3RL2B 4NKMA 2JJSA 4P2RB 5F89A 1G7IA 3NAAH 5GGUA 1UA6H 2HVJA 2ZG3A 1KENL 1L9NA 4FFZL 1I9IH 1L7TH 3QCUH 4Y16C 5DTFA 4BZYA 1WF5A 1X7QA 5E8PA 2BRRH 2B39A 2QSCH 3UJIH 4M5ZH 3ZTJH 4ONFH 1XIWA 4JFPB 4ODHL 2BNQD 3T8XA 4UAOC 5GQBA 2GJ6A 1D5MB 1Z6JT 5BS0A 3BPLC 2DKSA 4MVBC 2I9LB 4PJ7A 2VDKL 1F13A 3RU8L 5F88A 3V7MA 3IFNL 2IBZX 2A2QT 4L9PB 3HUJB 3V6OC 3EYSL 1K8IA 4FZ8L 3EIFA 3MA7A 5HDQL 2XRAH 3GNML 3KR3L 3EJYC 2IANA 4LCYB 4XZUA 1OCWH 5IKCB 2H9GB 1LO3H 2CJUL 1T20A 2MQ0A 5CEYB 4LEXL 5AEAA 5IHUH 1P7QA 3WN5B 4MCZA 2PXYD 4YHKH 4KQ4L 3RX5A 3D3VE 3DYOA 3Q7AB 1NPUA 1CDUA 4WI4A 3WXVL 1CVRA 4N90D 4NN5C 3WUWG 4XCCL 4Y16A 3STLA 5ICZA 2BC4A 4QXUH 5IIEB 1NCWH 2CD0A 5J57B 4YNYA 5C09A 1FZOB 3QUZA 1A0QL 3QH3B 2EDDA 1CFTA 2MFNA 4KHXL 5IMLA 4KJQD 4U6HA 3GK8L 1FNGA 3DRTB 1K2DB 1P6FA 2GQHA 3IRZA 3O45A 2AK4E 5IBTL 4L3EA 3EGSB 4Y0GA 4UB0H 3ARGD 4PB0L 1PZ5B 2HLFD 2H6PA 3VWJC 4K3JH 5DK3A 1AHWC 1IT9H 3CX5J 3PF2A 5F6HI 4JY4A 4NP4L 3GBNL 2F53B 5DJAB 1G84A 1WC7A 2V7HB 3K1DA 1ZLUH 2Y5TB 4XB8A 3V6OA 4ZTPH 4YO0A 2NX5D 3L3OA 1KJ3H 3MUZ1 4G8IB 2FD6L 2VZOA 4K3HA 5EG6C 1V7NH 5C3LD 4N1EA 3U4AA 4JFQA 4P4KD 4XCNA 1MRCH 1TJIH 4HGMA 2HH0H 3LS4H 1IC7H 3KPOA 2FJGB 3TO4D 1NFIB 3NIDE 4QRSA 4X6DE 1R3LB 2E6JA 4S1RL 1CFSA 3PDGA 2YD7A 3S3PA 4GRMA 2G2RB 2OMNA 4QXTA 1MCKA 4YE4H 3SBWC 4UNUA 4WCYH 4XX1G 2DMCA 3KXFD 5GGQH 3SOBL 4QRPB 5DD5L 2BVOA 2FNBA 1AO7B 4RFOL 7CGTA 3HXBB 1CICC 5JHLL 1W0YT 5I18L 3I6KA 2I07B 3BSZL 4PGCB 1LD7B 3WO3B 4WNQA 4L8CA 3GMMB 4CMMA 3SGJC 4DKEL 1FT2B 3FN3A 5C07B 1U8LB 3MXWL 2BVEA 3CFJB 3VWJA 5DMIH 2P7TB 3GJEA 1G7PB 2IQ9H 2WSKA 5BXFB 1BQHB 2UWEB 5DF0A 5MI0B 3RJDA 4Q74A 4BSVA 1HOCA 4ZO9A 2DD8H 1OF2A 3GGWB 3E3QC 1X4XA 1IAIM 3JWDH 5DD0L 5KANG 3FONB 3NCJL 1BAFL 3MSPA 2LTQB 3IJYB 1ZHLB 4HC1A 4NQEE 5L0QB 4Y4HD 2Y6SD 4EDXA 1QA9B 5DJ0A 5JO5B 3SBWA 1WICA 1X5KA 5INDA 1B4JL 4Y4KC 4JHZA 1DQLL 4XNQA 5C6TL 1CICA 1MI5E 4YXHH 3E32B 3R1GL 1N8ZB 2D0FA 3MR9A 3NTCL 3SJVD 1RIUL 2ADJA 5CSZB 5D96B 1UWGL 2YPKB 3SGJA 2J88L 4NZJA 5L7XL 3MYJA 1CK0H 4AM0B 1S7SA 4NUJA 3MREB 3OX8B 4IM8A 1MFCH 4PJIE 3TNMA 1Q0XH 5BO1L 2CIIB 5AUMB 1MH5A 1VSCA 2Y06H 3P73A 1W0WB 3ARTA 5M7QA 3V6ZA 5IG7B 3BKML 4J8RB 4OCSH 1QFOA 1RZGA 4LLVB 3HR5A 2BB5A 1Q9KB 3OAYK 3U9PL 2HFGL 3T2OA 3BP5A 5IJVA 3RGVD 2Z35B 2XA3A 3DTXB 3UEZA 4I48A 3SDCB 3PIQB 2BHUA 2F58L 4JDVB 2X7LA 4RRPA 4MQXC 2X44D 5FB8B 4OF3A 1T66D 2NY1C 4FQIH 4OKDA 5HGDB 1QSFD 2FB4H 2IALB 4Y4KA 2KH2B 5HDBF 5MEPA 4YXKH 4X7CC 3MRJB 1OVZA 3TN0D 1KBGL 3IDYB 1A5FL 3UTQB 3OAZK 3V4VL 3P2TA 1XF5A 1E28B 2DL9A 2YRLA 3W9EB 1P2CA 2VXQL 4RGNC 3W2DL 1LD8B 1PLGH 3DHMA 4E42A 4OI9A 5HHPB 3KYKL 4NPYB 4ODUA 4JZJC 1G0DA 1INQA 2ZKHL 5D1XD 1QRNE 4LCCB 1KNOA 4FXLA 1LEKA 3NZ8B 3D25B 5F7DB 5T5FL 2CDEB 2EH7L 4V1RA 4J12A 1T2XA 4UUJB 4Z0BH 1HKLH 1OGAA 3QO1B 1P7HL 2PUQT 5GGRY 3DURA 1P6AB 1HWGB 2FGZA 4GJTB 1IJ9A 5D7IB 5LQBH 3MRKB 2BFVH 4U6YA 3UP1A 3UXFA 4MQ7B 1MHEB 2NZIA 4NSKA 2VL5A 1DLFL 1IAIL 2A0LD 3KJ6H 4HJJL 4XNYL 4DK3A 1PX3A 4JN2A 4LLMB 2VTFA 2GK0B 1WV7T 2I24N 4AENB 3FT4B 1C16A 3EUUA 3O81A 1YC7A 4DCQA 4WEBL 4IRZL 4TVPD 4M7ZC 4PREB 3SKOB 4GRLA 5E0QA 1KCLA 4AIXA 1PSKL 5HGAA 1U8HA 2X70B 1QEWA 5KVGL 3QXDB 3LAFA 3B9AA 4NC0B 2IAMD 3OXRB 2C7UA 5D93C 4KTYA 1S9YB 1WWCA 3ARSA 4LBEA 5CJXC 4TTDD 1TNBB 4JZJA 5D7LB 3FJTA 2R1YB 1H8OA 3V4PL 5CILL 4JFZH 1RMFL 4NQDE 1DN0A 1I1RA 4POUB 4M62L 2VLRB 4JJ5B 2D3VA 1SM3L 3IGAB 4RWYL 2P5WE 3AXLB 2AI0L 4K8RH 3WJJC 5KZCD 3S3JA 4FQCH 1OY3B 3ZHDA 4OUOA 3SDAC 4KV5F 3VG0L 1MAML 4OZ4B 4M7KL 4JHWL 3L1OH 2HJKA 1WISA 3QHFL 1EO7A 4HKJA 4EN3B 3QEQD 3GEWB 5SWQB 5C2UB 1Z3GH 4LQ1A 5F7FA 1YNKL 1MRDL 3BIKB 2NYYD 3RWEA 3KLAB 4V1DE 5IVNA 3ZDXE 5DRWB 1EAPA 1JYNA 3ILQD 4KQ3L 3RWHB 4P23A 5MP6L 3GO1L 1BOGA 4WI3A 1NUNB 1JYVA 4OSUH 5FYLD 3TIEB 1LE9A 1MLCB 1JGLH 4HGKC 5CJXA 3QEHA 4HCRL 2EYTB 3FFCB 3WEXB 4Z78A 2J5LC 4XMLL 2YD8A 1WTGT 4UQ3B 5I17B 4K7FB 3HE7D 4DTGH 3CFBA 3QUYD 4RBPK 3UBXB 4OD1L 5T5NF 3MNZB 3L3DA 1X9QA 5FYJH 5DYOA 3S8WA 4UIMB 3P4LA 3ZL4H 4ZUVA 4UI2A 3RZCB 3WJJA 4LQFL 5CEZD 4NZTL 1MCIA 2VQTA 4M6OL 5EWIL 3J7HA 5SWSA 5B3NA 3VFRA 4P2QA 5E8EB 3SDAA 5EDXA 3GZKA 3HI6H 1TJGH 5JW5B 3ZE2E 1W8OA 1FZKA 3SY0B 2FEEI 2Y36H 2VE6A 2X9XA 4G7VL 1MIML 3SQOH 1CR9L 5HYJD 5GISL 1I7TB 1BF2A 4F9LC 5KSBF 3S37H 1NLDL 3HN3A 3U1SH 1EJOH 4DGYL 5I2IB 3VGGA 3ARDD 5LAXB 3IU4H 5E5UB 1EAJA 3C5SB 4GS7B 4PJDA 2ESVA 1UM6L 4G42B 4HZLA 4NNYB 3IJSB 3LEXB 4A6YH 3O11B 2QSTA 4ELMA 4MHHI 1KCSL 3SO5A 5JPMB 2WANA 5E56A 5SWZA 4WW2C 1EO8H 4CVXB 1L0YA 1I3GL 1XZ0A 2Z92A 5TDNB 4TRPH 3RX8A 4L4VB 3MBXH 3PWUA 1FYTA 3KPRE 1NGYB 4JG0L 2PYEE 3HNSH 3HNTL 4IRSB 4P3CH 3MMEA 3DIFB 4Q6YA 3BW9A 4TUJB 4L8BA 1KPVB 1G7LA 1DQDH 1QTYT 3B6SB 2SEBA 2GJZB 3MV9E 3L7EB 2X89A 5EBMB 4UT7H 3MXVH 2W07A 2G75A 3DV4A 1RY7B 2BXZA 2CO7B 1DCEB 4F9LA 2CGRH 3BE1L 3ULUL 2PXYC 2IBBA 4IIQB 3FZUD 5JQ6L 3V2AR 3O3BB 4P9HC 4EUPA 3QO0A 3PNWB 4PRHD 4ZYKA 4MNGB 3IFLH 3JTTB 3NPSB 5M94B 5A2IH 2D9CA 1MFBH 1RK1A 2JJTC 2DMKA 2BNQA 2J8UE 4WW2A 1JCKA 4ISVA 1AH1A 2W0LA 4JB9H 1XF2B 4KJQC 3P11H 4MBGB 1I9EA 2E7BA 3RTQA 2ZUXA 1GGBL 1ZHKA 3ARGC 2ZJSL 4UOW0 2HLFC 5DD6B 3EO1B 1GSZA 2BBCA 1AGEB 2G60H 1IILE 1LE5B 4YDLC 1E6OL 4R3SB 2UUDK 1BVLA 3MLWL 4WHYG 5C2BH 1M05A 2P46B 4KROD 2E7LC 3RWDB 5TQ0L 1ZHNB 4P4KC 4QYOB 2I9TB 5J7CC 4D4DA 1D6VL 1G9NL 2D31A 2PXYA 4M4PA 4RFEB 2YEZA 1S7VB 4HKXB 1XF4B 4LIQH 3I3BA 2ZPKL 3TO4C 2J6EH 5IR1A 4NNXB 1CT8A 3CDCA 3ZDXF 5F6HJ 1FIGL 2VSCA 3JTSA 3LPGA 3UPRA 1FLTX 3NCEB 3E6FA 2AK1H 5B8CA 4X7SH 5I1AB 5FO9B 5F7EH 1D6EB 3PWVB 3DRAB 1AIFA 2ICWA 3BHBB 1JHKH 3UROR 4QHMB 1G9ML 1T2QL 1XFPA 5T1LB 2JJTA 2E7MA 1CIDA 5IFHL 5EU7C 3WHE1 1IC4H 1JE6A 4F37K 4FQHA 5GGTL 3NFPB 1U58A 4OZFH 2KQNA 3ARGA 4PTUA 5HHNB 1FNEB 4GAJL 5IB1A 2AV1B 3H3PH 1N59B 2K7QA 2PO6D 3V8OA 3OAUL 2NX5A 2E27L 5EFIA 4G5ZL 4GAYA 5DEZA 2CRMA 2E7LA 1J86A 1ZTXH 4LASH 3JV6B 3ZE2F 4QRQA 3DETD 1FC1A 1MHHB 3MROA 3EO0A 1NGWA 3TO4A 1D9KD 4Y4HC 5JOEA 2Y6SC 3QDGE 4TPRH 4EEEA 1QSEE 4PJEE 5TH2A 2O61A 1W8NA 1O6QA 1R3JB 1IKFH 1NL0H 1BZ7A 4NCC1 4U05A 4AL8L 5HGHA 5D8JH 4LSPH 2J1KA 5CWSB 4DQOH 3PXJA 4NJAL 1NAMH 4MDJA 3VXPA 2I26N 2UVEA 3JWOH 4RGMB 2YA2A 5E08L 3VFUA 1DQMH 2BY2A 3LQAL 3SDXF 1P84K 3S4SG 2KDGA 1AGBB 4H0IA 3D69A 3TIDA 1R5WB 2ITDA 3HZKB 2Z31D 4IOSD 2C1OB 4L8SB 1AKJA 3QQ4B 2X4OB 5I6XB 5I76B 2VUYA 2Q6WA 1S78D 4Y4FB 3UJTH 5TQ2L 3OKLB 1S8DA 4WDIB 4ZFFB 1BECA 5DC4B 3HG1B 4EQ3A 3RGVC 1X5GA 4Y4HA 2I60L 3TPKA 1T66C 5KSUB 4LOUD 3FOMB 3BO8A 1SEQH 4LGSB 1HIML 3QAZB 4BQ8A 4EIGB 4QRRB 1BQSA 3H42L 3TN0C 4RIRA 1RURL 4MA7L 1EHXA 4QOKD 3NFNA 3A6OA 2UZIH 5LJYH 3SJVA 4NO3A 1S7WB 3I85A 3OJMB 4QF1B 2I27N 1NMBL 3BD5A 4OLXL 1CL7L 1BX2A 3VD3A 3HPJA 3S7GA 4K2UH 2FCBA 3BP7B 1DBJH 1UVQB 4JFFD 4O02L 4RAVA 1L6XA 3UTSA 3DGGA 1N6QL 4X4XA 5D1XC 2VERN 4MWFA 4BFBD 4JM4H 4H1LB 3NPZB 3C08H 3HE6D 4RFNC 3Q5YA 4F15C 3QIUA 2GY7B 1I1AD 1UWEL 4ONTA 4JRYB 5ANME 1FVEB 3HAEH 4UTBL 1QSVA 4GRWB 5I8CA 5DT1L 5FYKH 2QADB 2A0LC 4X83A 1BGXL 3QI9D 5HHMB 4K55A 3L9RA 1QSFA 5H2BA 3GKWL 3VE0A 3I2CL 2NY2B 1JGEA 7FABH 1A3QA 1A7BA 4O5LL 3TN0A 4LHUB 3MRDA 2C3GA 4Y1AB 5EZIL 3GMRA 3V5HA 4NZRH 5C70A 1K5NA 2W9DL 5D9SB 4ZS7L 1URLA 1B2WH 2EH8H 3C09C 5C0GB 4GAGL 3V52L 2F54B 4X6CA 3CLEL 1F6FB 1LHZA 3MO1B 3G6JA 4MCYA 5AZEH 3B5TA 4C57C 2IAMC 4YGVA 2VKWA 2VZ1A 2ZOLA 3OSKA 1QPPA 5HY9B 4I4WB 1QNZL 2I5YH 3O41A 1ZXQA 5E70A 3HXEB 4TTDC 4R4BA 2EYSB 5D1XA 2BHYA 3RUGE 2EKSB 1YEFL 2V3PA 1I1YB 3UC0H 3PWPB 2NW2B 4OCXL 3K2UL 2ORBH 3U30C 4ZOBA 1GJIA 4O51B 4F9PC 4TNWF 1B6UA 1PG7H 2R0LL 2AJSL 5KN5B 3TCXA 4X98B 2VLLA 4M5YL 5EU6A 3P4OA 3HMWL 1U91B 5C3TA 1MCPL 2QKIB 2AEQH 4ELKB 5F9JB 1H3GA 1K3IA 3MJ8A 4PV9B 3TT1L 4C83B 3WNOA 4P2RD 4HIJB 2NYYC 5HD8D 1N5AB 3GRWA 1DE4B 1KLUA 4NJ9L 4CVWA 4X4MA 1LO4H 2EZ0D 3DX9A 4KI5E 1NMAH 4OCYH 3ILQC 5JIIA 2CUIA 3QEGL 2DRUA 1QPXA 4XAWL 4QXGH 4PJ9D 3K8KA 3T0BA 1U8IB 2PTTB 1MFEH 3PL6B 4I0PA 3AU1B 1Y0LA 1I4FB 1ZLSL 3UAJD 1KLGB 1A6TB 2VDPH 3I9GH 2XZCL 1GGIL 3HE7C 3QUYC 4KTDH 2EDHA 1CU4H 1SY6L 1IGYA 4U6XA 5J8OA 5EUOA 4YGAB 1QRKA 5IT2L 5ILTL 3REVB 5DR5L 3V6FB 3D3VB 3EYOB 4FXGB 1QLEH 2A1WL 4XXDA 5F9DC 1NKRA 1IVLA 4FNLH 3WJLA 4R90H 5I0ZA 2GJ6E 4R96A 3QEQA 5J56B 1LEIA 4W81A 1YYLH 1Y6NR 3OGCA 3CMOL 1A1MA 4NFCA 3CFKB 3CZJA 4NOBA 1N0LA 3TBSA 4Z0XA 1FNHA 3THML 1LO2H 1JTOA 2YPLE 3VFVB 4WUKL 1MVFA 3BKJL 1S5IL 2AK4B 3ARDC 3FT3A 3LN4A 3ZYIA 1P4LB 3BJ91 4PP2A 3OEDA 5H94A 1OB1B 1TQCB 2DMBA 2Y23A 2IANE 2B20A 5FGSA 2W0KA 3S98A 3OKYA 3N1MC 3FB7B 3CSGA 3DECA 1RZJC 1XAUA 3QUYA 2W38A 1KTRL 1YY9D 1N95B 4GKZA 4P48A 1OPGL 3GBMH 2V7NB 1HSAA 2F53D 2MHAA 3CXHJ 5FGCE 1W2KT 3EW3B 2X4SA 1EDQA 2OSLB 5C09E 4GKSB 3E1F1 3H9SE 3MRRA 4X6DB 4NZUH 2EDXA 3FOLB 2VAAA 2CXKA 5HBBA 4G6JH 3OR6A 1V7MH 5C9JB 3MLTB 4WJ5B 3QUKA 5F1NB 4L3EE 5K9KB 5JLZB 4PJFF 5KTEL 2B5IC 1GC1C 1KN2L 3TBTB 1HKFA 3ARDA 4Y5VB 4ESKA 4GLRH 3FZUC 1NCCH 1T1YB 4LLUA 3OR7A 1AO7D 1CXHA 1OL0A 3W9DA 8FABA 3ILPB 1U92B 3CVHB 1VGKA 1HHGA 3MODH 3H9ZA 1L7IH 5C07D 1TZGH 3FQUA 1YEGL 3T1FB 5ACMA 1L9MA 3KWWB 5IEHA 2J8HA 1SVCP 1F58L 3GMQB 2BSSA 2ERJC 3ZTJG 3C60B 3QUMH 1HH9B 3ECBA 3DX7B 4PR5A 3RJ3A 4KROC 1TTUA 3DLQR 3O4OC 2HN7B 1MI5B 5D70L 2IMMA 5INCB 1N7ML 1KB5L 4KKNA 5DLMH 1ZT4B 5J13B 4KHTL 4GUPA 2XOTA 1HHKA 2VZUA 1WTLA 1NAKL 4H0GA 4KI5F 1DL7H 4PJ8B 3QJHB 1KJ2B 4DGIL 4PRHA 3CPLB 5FYLL 5ENWA 3QJFB 1F11A 2JF1A 4FQXC 1YPZE 1FGVL 3QXUA 1K3ZA 2ZSWB 1AXSB 2V5RA 2GEEA 4U1SB 5F3HA 2XWJB 3OKOA 1A1OB 2A83B 2R2HA 3CIQA 1RUPL 4MLIA 1ACZA 1Q38A 4JY6A 1ZHBA 2IBGA 4S10A 3SE3C 5ISZA 3DSXB 2VMFA 5F9OH 5LBSL 1GZQB 1INDH 1I7UA 3RRQA 2Q76A 5K9QG 3LEYH 1HYRC 3T04D 2PO6C 3MRLB 5E1HB 1IGJA 4W6YB 4LSTH 1EVTC 1YMHB 3VA6A 3H9HB 1WSST 5DUBB 3D2UD 4MSWA 3CCHA 1WJ3A 3SDDB 4BQ9A 3DETC 4NO5A 1J1XH 2F5AH 3SDCD 2XKSA 1ZK9A 1NUGA 5BZDA 2ICWI 1U36A 3A6CH 5A16B 4P4RA 5ETUA 1MHCB 4FMFA 1D9KC 4YBHA 4EVNA 4DVBA 3CXDL 2EDYA 4M9OA 5E1AA 2DQTL 2ZUVA 4WU7B 3GSWB 3NAAL 4JRXD 5JW4M 2H32B 3JUZA 4XGZA 1QRNB 4PD4K 1I9IL 1L7TL 3QCUL 1I7RB 1D5BB 3BGFC 2V8JA 3JZ7A 5EOQH 2BRRL 2QSCL 4YHMH 1HDMB 3UJIL 4MS8D 1CQYA 1R5IB 3GM8A 1CDYA 1MLBA 4LDEB 4M5ZL 1IL1A 4JPVH 1SHMA 1XGYH 3EOAA 5EO9A 4MA1B 4HKBB 4M1GL 2OXHA 4BQBA 1BZ9A 4GFTB 4WI8A 2PO6A 3B4NA 1T1WA 5MEQA 1S7UB 3AREB 1EH9A 4AQOA 2Z31C 5IVZA 4M8VA 4XVTL 2Z9TA 2R2EA 1JK8B 1S78C 4HF5H 5JPNB 2X4TA 1GC1L 2XRAL 3T77B 4F3FA 3PWJB 4BKLA 1OCWL 4E5XA 1LO3L 3LRHA 3AB0B 3Q6FA 3ARPA 3FRPA 3VDAA 2VYRE 1HEZB 4NDMA 1MF2H 5EOCJ 5IHUL 3AUVA 4LOUC 2EC9U 2WUBL 1OGAE 4LMQI 1JZ2A 5TE6L 1FL6B 5I74B 4XBEH 4P0DA 1U8OA 4EBQH 4QXUL 4ZFOA 1YEHH 4NQDB 1NCWL 1MAKA 5JORB 1HQ4B 2VABB 1I8KB 2OL3L 4X8XA 3V7AE 4JHBA 4JO2H 3UDWA 4E41E 5DQJA 4H26A 3FQTA 3SO3C 2VLRD 3PDOB 3QXAA 1GGYA 2LU3A 4UB0L 4GQ9L 1GPOH 4RMUA 3BYTA 2Z31A 3BDXA 1TITA 3RWJA 3HE6C 5BVPH 4Y5YC 2IPTH 1IT9L 4FRWA 1CXLA 3LB6D 4WW1A 4JKKA 3W39A 5BV7H 5T5NG 1IKNC 5DXWA 4ZTPL 3WLWD 4V1DB 2X1XR 2J12B 3MRBB 1OWWA 2HG5A 2EDRA 5H37H 2Z8WC 3GSUB 1FFNB 4G9FB 1P69B 8CGTA 4NKOA 1BIIA 1W6KA 1ZAGA 4GTSB 2CLVB 4EN3D 3QI9C 1NDMB 2HH0L 3LS4L 5IFJB 3LRSA 4WHTA 3GMPA 4NO2A 4CJ1A 5BOZG 4YDIH 3QZWB 3O6MH 5TF0A 5FUZH 4QOKA 3GHEH 3EO9L 4YE4L 4WCYL 5EZJA 1ORSB 1YPZF 3JWNC 1M71A 3CK0H 5GGQL 4DN3H 2AABH 4G6FB 4OB5H 1KIUA 3DVNA 3FFCD 2YN3A 4WI5A 1HH6B 5IB4B 4JFFA 2JCCA 1K8DB 4X9HA 3WUWA 1TCRB 4YWGH 3V8CA 5C0EA 2EXWD 3EZ8A 1UB5A 4Y5YA 2IQ9L 3RZCD 4HMCA 1I1AA 1CG9A 4HIXH 1IKNA 3FCTA 5FGBC 2Q7NA 2DD8L 3JWDL 1HHIA 1A47A 3BGMB 1FO0A 3LIZL 3DRQB 5E7BA 2DYPB 3QI9A 4JM2D 5I8EB 1KIRA 3ULVC 2XZAH 3BESR 5FO8B 5LGJB 3BVNA 1VFMA 1OOAA 2CDFA 2UYLB 3QUXB 5E2VH 3DI3B 4JDZA 4JZNB 5HD8C 4NBZB 3S88H 1UEYA 4MXQD 2EZ0C 3RIFK 3GSVB 3ORJA 4P2QE 4Z7VE 1N4RB 2E6PA 2VN7A 4LSVH 2Y72A 1WIUA 4XWGH 1Q72H 1LK2B 3KPRB 6CGTA 1GXOA 1FN4B 4PJ9C 1OARH 2PYEB 5IBUB 3V5KA 2YMXL 3VFOB 3WDIA 4NQXA 3UAJC 1IM9B 3PZ3B 2CMRH 4TVSa 4APQA 4YBLB 3CDGA 3MV9B 5J1TC 2MPAH 4KUZL 5K59E 4EZMA 4L4VD 2Q8BH 1V3LA 4K07A 4JFED 1A6VH 5FGBA 2CR6A 2F19H 3NCCB 4PJDE 2ESVE 2OMBA 4IRSD 4D8PB 2Y06L 4YR6A 2BMKB 1MFAL 5GJSL 5KJRH 3DHJA 3K7UA 5FA3B 4YHPA 4ELME 4PGDA 5IWLC 3VDBA 5DEGB 1KB9J 2VDLL 1JWMB 2XFXA 2CKNA 3LN5A 1QLFA 1VDGA 3ROOB 3LKQB 3WN5C 5DJ6B 1EGJL 3LV3B 4P2RA 1J88A 4Y88A 2AJVH 2J8UB 1ZANH 1FYTE 1CD9B 1OP3K 4HG4K 3RWIB 5T1MB 3TH3T 1EFQA 1DSFH 1VFAB 1OTTD 3U0WH 3O6LH 4PJ9A 4JFPA 1QR1A 3I02A 1D5MA 5CUSH 4B5EA 5F72S 1PLGL 4OKVA 5GS2D 3WNPA 3FQWA 1YY9C 4JLRB 3U9UA 1HILA 3DARA 3HZMB 2IEPA 12E8L 5IHZB 2HVKA 5DVOA 4YLQT 2VR9A 3NA9H 5IWLA 2H9GA 2BFVL 3AS1A 1IQDB 5GS0D 2PCPB 4AZ8A 2BNQE 5CEYA 4BK5A 2NY5H 1DBMH 2RBLA 4X9GA 3WN5A 3KJ6L 5DQ9B 5I1LB 3GMLA 1IGIH 3G04B 3VXTB 3VXSD 3EDFA 4C4KO 2ZUYA 4NRZA 2CKBH 3W5NA 3TYGH 3TCLA 5EBGA 5FECA 1FZOA 2PW2B 5J11B 4JFXA 1OAQH 5FM5O 3QH3A 5T1LD 4W68A 1BQUA 3VXUD 1UQSB 4LPXA 4PY7B 3SN6N 2JK5B 5GS1B 1A7QH 2FBJH 3DRTA 1K2DA 5EIQA 3EGSA 3BRFA 1FG2A 3F58H 3WUZA 1PZ5A 4N90E 1FZJA 4QKXB 1XGPA 3WS6C 4P5TB 5MI0C 4ZUUA 1ES0B 2X9WA 1K4CB 4DW2H 2XQYG 5B38G 3S5LG 1PY4A 1ONQB 4I3RH 2JB5H 3VMPA 1X3DA 3QDGB 1PFCA 2Y7QB 1QSEB 2FYYA 2VISB 3N06B 4K8RL 4PJEB 3T0EA 3ULVL 4FQCL 1N4SB 2LTQC 4EI5B 3HMXA 3MRHB 4H5SB 3KYMB 1CXEA 2FJGA 4NUGH 5F44A 4BQCA 5L0QC 3O2DH 4KVNH 4X7FC 1IQWH 1Z3GL 2G2RA 3IXAB 3ETBF 1W72H 1FFPA 2MQ3A 3D6GA 1EPFA 1U95B 2NX5E 3O0RH 4V2CB 5CKAA 5K93A 3L3IB 4G8GE 4Z7VF 5E6ZA 3UTPE 3S97C 4PGCA 1SVZA 3M8OH 5D96C 3GMMA 1KC5H 3GBLA 4OSUL 5C07A 3TVMB 3QCVL 3CFJA 5SX4I 2P7TA 5BXFA 1YN7B 4AH2B 2UWEA 4DTGL 5K59F 1RIHH 3D9AH 3NFSH 4HPYL 5FO7B 4JANB 4WY7H 3LS5L 5L8KB 4Q97A 1CFVH 2YWZA 2NXYB 2ZOKB 4AY0A 4ZSOE 2E9IA 5EU7E 4PBXA 2HWZH 3OAZH 2DWDA 2W60B 4ZXBB 3IJYA 3HG1D 3HI6L 3PV6B 4GMSH 5TFSH 3SDCC 4K71B 1N4PB 3TH2T 4HUXB 3S9DB 5DHXB 3IXTB 1JF5A 1MRFH 5JO5A 5IUSA 3ARBB 3MZGB 4M7JH 3ZMRA 5JW4N 4QRRD 3KQ4A 43CAA 1N8ZA 3IDYC 1FJ1A 2HKHH 3MGTB 4PRBA 4LF3B 1EHLH 4Q7DA 3QDHA 3BJLA 2YPKA 1ZE3C 3GJFK 1AE6H 5LGHL 5A40E 2ZG2A 1Q94B 2BHZA 1I8MA 1MOEA 4AM0A 4A6YL 5D71L 2XT1B 4MS8C 1JPSH 5ANMB 2UZYB 1Z0NA 3PZ1B 1FLRH 1YEKH 2IFGA 2C4XA 5A3ID 2CIIA 4LCCC 1I8IA 3RPKA 5IJKC 5D6DC 4JFYA 1W0WA 4NFBA 5IG7A 1KPUA 4TRPL 4DEPB 5DMKB 1MCDA 1NBZB 4LLVA 3SJVE 1J0JA 3BZ4B 4OZFG 3D2UA 3HNSL 1BJ8A 1JZ4A 4DZBA 1JNJA 4LAQL 2WQ8A 4HXAL 3DTXA 1A3RH 3PIQA 2L0DA 5HGDA 3UTSE 1NGXA 3PP3K 5HHMD 2WP3O 5J1AB 4UT7L 1OAKH 3MXVL 2NY2D 1P4IH 3UYRH 4OZGE 3MRJA 4LHUD 2CGRL 4Y1AD 2BOBB 4C56D 1U8NA 2WIIA 4JRXA 4QHLB 2JELL 3IFOA 1TNUB 3RUGB 4PJGF 2VXSL 2F54D 1E28A 5EC1A 2ID5A 3W9EA 3IFLL 5D7KE 3WHXA 4WIQA 1A64A 4P5KB 3O3DB 4NPYA 4X0KA 2EDTA 4XPFL 1A4JB 1U93B 5IJKA 1GOFA 4JB9L 4XTRD 5D6DA 3D25A 3P11L 5F7DA 4DAGL 4XVSH 5CP3A 3PWPD 4UUJA 1KXVC 1OLZA 4Z77B 3V95A 2IF7A 2VITB 4NC2B 2N7AA 4KTEH 5AZ2H 5D7IA 2MKLC 3WFEH 3MRKA 1F4WH 2G60L 3LB6C 1AGDB 3G6JE 1WK0A 1J0ZA 1NUFA 3WLWC 5C0JB 1I8LC 4LLMA 3IDNB 3KPPB 3QISA 2DBJA 1FP5A 2GK0A 4R26H 1WCQA 4E9LA 2WWKT 1SYVB 4AENA 2BVPA 4RBPH 4EN3C 3SPVB 4DVRH 3E2HC 5MEOB 4JO3H 4OCWL 1DN2A 4PREA 3SKOA 5EZLA 3VXRD 4LIQL 4YUEL 4MQTB 5DHVA 2J6EL 4JFOB 3QXDA 4XNMA 1MUJB 4NKMB 2AK1L