4FXKB

Human complement c4
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C4 Beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
total genus 143
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 4fxkB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxkB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxkB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxkB04
4FNLL 4OQTH 3EOAA 1UM6H 4LKCB 2OBGA 5CHNA 2AJYL 3DSUB 3BVNB 3WIHH 1RK0B 1AGFA 4RNRA 2PXYC 1CZ8H 2NY7H 4QT5B 2J3SA 3CVIH 2R0LL 4L3CA 1PQZB 3MLWH 1UH2A 1IGTA 1S7XA 4M1GH 4GLRI 4FABH 2A77H 1KB5H 4K3HA 5KANI 4YXHH 2HG5A 5B8CB 5EORL 1XGRA 3QDAA 3ARYA 4PGEB 1U93A 4IOIA 4KTEH 3L5WB 4MHHG 3S4SG 2G5BA 4YHKH 2D03L 2GHWB 3VDBA 4LGSB 2CDEB 4NOFA 3BO8A 4WO4D 4MD4A 2EDNA 4H26A 4L3ED 2OL3B 4KH2A 5C0BB 2X5PA 4Z7VA 1NMCB 5LGJB 2RAMA 2VAAA 5C6TL 5HYFA 4KDVA 1MY7A 5JPNA 2OXGA 5I1GL 3DSNA 1LDPH 1YDPB 3FO1A 4NQVA 3MV9E 4YHYB 3BDYL 5HPMB 4XPAL 2EXYC 3GSQA 5H94A 1JI1A 2BNQA 3G5XB 2XG5A 3FO9B 1EJOH 3QWQB 3JTSA 3L6FA 4JFEE 5CSBA 1BX2A 3FQUA 4ZDHA 5T1DL 4IOFD 2Z92B 4UUJB 1K5NA 1EEYA 3S34H 5FF6A 1JPFB 3GI9H 2EIZA 1ZHKB 1JZ4A 5D7LD 2VDQH 3A6OA 1QQFA 3UJTH 4ZS6D 5FAAA 4XVSL 1SA5B 4L5FL 2IWGA 3OV6A 1YEHL 2OYPA 4G6KH 4K3JL 1NBZA 3ARGD 1G0YR 3TBWA 3HUJB 5DJ8B 5FYKU 1F3RB 3P77B 1HDMB 1MZCB 4FHBD 3OHXB 4YHNB 1D5IL 4LLQA 1FGNL 4YX2H 3P9MA 4QRQB 3OEDA 4F15C 2VZ3A 4G8GE 1LNUB 4JQVA 2ADGA 4HGMA 1U8KB 4PD4K 4OF0A 4MNQD 1GC1C 3KLSA 5EC2A 5B4MD 5GGQL 1IILE 1F02I 4OZGE 1I4FA 1MLBA 3GZKA 5HY9B 3FQXB 3DARA 4CN4A 4R4FL 2F54D 5JXAL 3D39E 3EJJX 3M17A 4OIAA 3BRDA 4J6RL 1OVZA 1T22B 5IFJA 4KQ4H 4Q7DA 4WV1A 4YQXH 3B5TA 4J4PD 4K7PL 2EKJA 5F88B 1RPQA 1OARL 1O6RA 4UT9H 3SOBH 4MNGB 1JZ3A 4QNPF 2B0SL 4ZPTA 1KEMH 4KRPD 3BW9A 3KR3H 4LL9A 4HT1H 4RFOH 4RIRB 3BZ4B 2AI0L 3RWDA 5E5MA 1MLCB 1MF2H 1KCUL 3MUY1 1UKQA 4Y5XA 5IQ7H 3MJ8A 5D2NB 4OZFH 5FYLL 5EBLA 2CGRH 3RVUD 3QFJE 4KKCD 5EU6D 4C56D 5I8KL 4XMKH 2NXYC 1SJVA 4OM1L 3S5LG 4CMMA 1ZKAA 2ZISB 1B6DA 3P11L 3W9EA 4PJGB 2ICES 1KUMA 4I3GA 1SYSA 2OMNA 5E8NB 1RUAH 1CFSA 3B8SA 3EDKA 3UTZA 3DX6A 3PL6D 5HHOD 4G9DB 3T1FA 1QA9A 4WU7B 2X70A 3VXRE 5EOTA 4WI2A 3H3KA 3ABZA 4HWEL 3D25A 3RIAF 5HDLA 4PFEA 2DQFB 5L9DH 4NN6B 5B39G 4EIGB 3RTQA 2VH5H 3OZ9H 5ACLA 1CDUA 4P57A 4NWTH 4Y19E 4PY8I 5CINH 3S35L 3WXWH 3SKOB 4JQVC 4NYLB 5AZEH 1CXIA 1F8TH 3D6GA 4ZS7L 5IMMA 3LPFA 1T5XA 1CFNA 1Y6KR 3MZGB 3W0WB 1W0WB 1G0DA 1CLCA 5FKPA 1J11A 4X99A 3DTXB 5F1KC 3O9WB 3PWPA 3GMLA 2MNUA 2PW1B 4P2RA 4E5XB 3ARED 4WV1C 2IADA 2JCCB 3BOVA 1GAFH 2R2EA 1TCMA 4XP5L 1ACYH 1QYGH 2ZKHL 3KPRA 5KSVA 4PJ9A 1OW0C 1UACL 1RHHB 3V5KA 1EVTC 4PLJC 1LO2L 1J1PL 3P0VH 1IQWH 4GMSL 3DSSB 1OF2A 1T66C 4M9OA 3E1F1 2ZUYA 4Y5XC 1KIRA 4YHLH 1EH9A 3RWGA 1RZFH 4X6BB 3VFPB 4APQB 2DQDL 4QRTA 4M7JL 4OLUH 5HI3D 1Z9SA 3VXUD 2R1WB 3HUJF 4YWGH 1MI5B 5BVJB 1K4CA 4IMKA 4G9FB 5ITFA 1SQ2N 3OJDA 4JPWH 4OF5A 3L5IA 4PJ8D 5D7JD 4RAUA 5K59F 5C07B 1RUML 3CK0H 2R1YA 4PRID 2WBKA 3CLFH 4JE4B 3CPLB 2HKHH 4QRRD 4HS6B 1E6OL 5FM5M 1C5CL 2YD4A 4O4YH 4AT6B 3V0AC 5ACZA 2VLJA 4IDJH 1HINL 2Y36H 1FNSH 4I2XE 3GMMA 3VWJA 4R26H 2R4RH 4IBLT 5ICZB 1BIIA 3FT4B 3RTQC 4WDIA 2CKNA 2E6QA 2IBGA 2P49B 3IF1A 4HIEB 5CUSL 4PRDB 5AWNH 2HRLA 3C2AL 4MSWB 3CH1B 5DJYB 3DX8A 1PKQA 3DX9B 3OKEB 4YDJB 5DJXA 5EULV 4PRHA 1S7TA 1FO0B 1KN2L 1RQ5A 4JFOA 2R0KH 1S9VA 1HHGB 4LP4A 1RUQH 3N50A 3TPUA 3PWUB 1XF5A 1BBDL 5IQ9A 3B5HA 1INEH 2FLRT 4JFFA 1ZS8A 3PP3K 5IMLB 5KSBE 3L95A 2B7DT 2JB5H 2YPVH 3W82A 5JNYA 4Z7NE 4CMHC 5C0RL 2HFGH 3PV6B 5B3JF 5J7CC 1IEBA 2XZCL 5I8OL 1IE5A 5TF1L 5JPMB 3KJ6L 2CR3A 1EERB 3UBXA 1YMMD 2MOVA 2ZUUA 2H9GA 1RY7B 2XI9A 4I77H 3SDXA 1H37A 1H3PL 3FRPG 3EFDH 5A16A 1EHNA 5E9DA 4HBCH 1FFQA 1RZ7H 1TJHL 2R8SH 2QSTA 4YBLC 5IHBA 3ULUE 3SY0A 3VGBA 4IMKC 5K9OB 5E2WL 3EW3B 1MSPA 3QUXB 4YEEA 1DQLH 2DWEB 1QG3A 1ZEAL 5EU5B 2FO1A 1F45A 1I1FB 4JHAL 3RIFK 3UJJL 3U7WL 4YHOL 3VWJC 2HH0H 4NQCD 2FZ3A 4HXBL 4GTMB 1DBKH 3X13A 1KJ2B 4JKWA 1WCBA 5DR5L 4R0LB 3KPMA 5IIEB 1N5AB 3L5XL 3KGRA 5DJDA 4G42A 3E6FB 3QWRA 4RGMB 2DQUH 1T2QH 4DGYH 2FIKA 2X1OA 3S4SA 3TM6A 4AL8L 4G8EA 5L2KD 1HHKB 2D7PA 3KPLB 3WUZA 3VFSB 1RI8A 5E8OB 5H35B 4JZJB 5IB1A 1CFQA 3ZKNC 2AXHA 3TJEL 1LO0L 2JELH 4KK9C 5INCA 4YDIL 2F8XC 1S7WA 3MFFA 4NC2B 4LSVH 1NBYB 3SN6N 4FQXA 3TWCL 1OLZA 1FZOA 3AS3A 1RVFL 2VZVA 4N8VB 3SDCB 3MV9B 2FEEI 1IC7L 4IRSD 4UQ3B 5GISL 4M3JA 4P4KD 4CN1A 4JFEB 5HGBA 2DQIL 2PYEE 1ES0A 4XCNB 3BUTA 1ZGLP 1O1RB 1R5VA 3BGMA 1P4LA 5CBAA 4AG4H 1J8HE 1RIVH 1IGCL 5E0QA 3O2VL 5EFIB 3UTTE 2G2RB 3SKJH 2D0FA 1XAUA 4LF3B 2WIIA 1C7TA 1IM9B 4ZO8A 3KXFD 1LGVA 2ICCA 1D5BA 1A21A 1GGCL 4YNYB 4EI5D 3GO1L 3NCJH 4NQUA 5I1AB 5LWYH 5KW9L 3B5GA 1YJDC 3QXTA 1AQDB 2VZ1A 4MQ7B 4RGND 4HKZA 4G8GB 3HZMA 2VL5A 3IFPA 2XN9D 2ORBH 3BJLA 2AV1B 1AC0A 3UMTA 3QZWG 2Y5TB 2Y7QB 2IANA 3B2VL 4OZGB 1MNUH 1M7DA 1L7IL 2GJ6A 1UWEL 4ZUSB 3MV8D 2D2OA 4WVRA 3Q2CA 3A0OA 3D39B 1KF9B 4D0BB 1UENA 4LVHB 4RRPG 2IPTH 5I76B 1XIWB 3ULVC 4L4TD 1KOAA 1MCOH 5F6IB 2MJWA 4QHMB 4QF1A 2GW5A 3LD8C 5DEGA 5CMAA 4XC1L 3CSYA 2V2XB 1ZLVH 1HZFA 4NNPH 4FQXC 1S9YB 3KYMA 3DROA 4XI5D 3MROB 1P4BH 3SBWA 1D6EB 1W72L 2GQHA 1KV3A 4YDKL 3PWJB 1RJZA 1SBBA 2ERJB 5DC0A 5F7DA 3S5LA 1WBYB 4JN1L 1DQDH 1VENA 1T7VA 4PR5B 3A6CH 1C12B 3RNKA 4QO1A 3UTPE 3ULUH 4H1LG 2B2XL 1KULA 4OQTL 5E2UH 2A6KB 3FN0H 4I3RH 4OT1H 3ILPA 4NO3B 1ITCA 3WIHL 3X14A 4KTYA 1QLEH 3MQIA 3Q78B 3QXDA 1XF3A 4KMQA 5EZJA 5KS9E 1RD6A 2FATH 1CD8A 4N9GA 4N0FB 3TA3A 2HVJA 1FL5A 5CSZA 4FFZH 3HE6D 4YC2B 4JFHD 4PGBB 4NO5A 4LIQE 1PSKH 3TO4A 4FABL 4P46D 3VXRB 3NFNA 1KB5L 2UUDK 2DWDB 1SYVA 5F89B 3F7QA 2NW2B 1AE6L 3QCUH 1UG9A 3GJEA 1H15B 4XNZC 1FH5L 4PJIE 2OP4L 1WZLA 1QPPA 3T0ED 5DI8A 1T7YA 4NZRL 2FO4B 3P4NA 4WHCA 4HWBA 4Y19B 4JQIH 5TE6H 1XCQB 4GRLB 2X4OA 3U48A 3RX5A 1O6QA 5KSUB 5FECA 4NN5C 2ICWJ 2PCPA 3IS0X 3QEHB 1XF1A 2I60H 4EZMA 5I74C 2R1XA 2AJVH 5F7KC 4X6EB 3V6FB 4FFWC 4JM2F 2BSTB 3FQNA 2D31B 4NIKB 1DEEA 3U1SL 1LDPL 4EN3D 3TIDA 1YNKL 3WCYA 4QRPE 1I7TA 2J8UE 2YEZA 4ZO7A 1ZT1A 4TSAL 5K9JH 1B9ZA 1HOCA 4ODVH 3BZFA 1W6JA 1B90A 4F7PB 4HW6A 3D69A 1TTGA 1I7UB 2QQNH 1AGDA 3L3DA 4N8CH 3GKWH 3MXVH 4NKOA 3FB8A 5FOBB 3GI9L 1GGYA 4AIXA 32C2B 1A7NL 3LN5A 4LCWA 2QADC 3UJTL 2V7NB 2VDPH 1QSJA 3D3VA 2NY6C 2JB6B 1I3GH 5DQDH 3ZHKA 3SBWC 3OMZA 2V2TA 3RDTB 3CFKA 4HUMB 2M8XA 4RMQA 1CCZA 4MQTB 2ATPB 1F3DH 1OGAA 2FBJH 5FO9B 3OQ3B 1U95B 4P3WA 2KH2B 5TGBB 5JHLL 2O93L 5E1AB 3TA3C 1LO3H 3GBNL 3LQAL 4PJEE 5JA8B 1G7PB 5D7IF 3RUGF 4MD5B 1XR8A 3TO4C 1QBAA 2EH8H 4I2XB 5E8DL 5HD8D 1A1NA 2HKFH 3MTRA 4OZGF 1N2RB 1P84J 4P5MA 4WWKB 1T2JA 4PJHE 1AGCB 1O5MB 3FHAA 4L9LB 3TV3H 4LPYA 4HQQH 3LQZB 5DUML 4ONFH 4YQXL 3QPXL 4HWNA 3X17A 2F58H 4RMTA 4PJAF 3T2PA 4UT9L 3SOBL 1Q72H 3EOYG 3NOIA 5SX4I 1KEML 5EU3A 3GMNA 3KR3L 3MGTA 5F3BB 3AS1A 1HHHB 5CILH 5IFAH 4ZNCD 2EYRB 3WHE1 1K8DB 4AM0A 1V3MA 1MRFL 2FJGB 1MF2L 1FVEB 1IFHH 5IQ7L 3C8HA 4JFXB 2YHGA 1YY9D 1M71B 4JRYD 3RWHB 4BYHA 4E41D 5KSBB 5BO1H 2OTWA 4HIJA 5A2KH 4OSUL 4XMPH 1G7HA 1E27A 2ID5A 3HE7B 3T0BA 4F3FA 3L9RB 3CZFB 1GZQB 5FHAH 3GJFK 1RUAL 2VDRH 3FRPA 1F2QA 2XA3A 4X6DA 1WZKA 1LD8B 3T1WA 2DL9A 4EI6A 5L9DL 3BPCB 3IU3A 4HAGA 5F9WC 3S3JA 4PJBF 1EBAA 4MA7L 2VH5L 5E95B 5DRXB 1BQUA 4NO0A 3WXWL 3C09B 3DHMA 1FIGL 5DWUL 4WGWB 2VDMH 5AZEL 1F8TL 3T0XA 4KKBC 1ZWIA 3BWAA 3HCVA 1CTNA 1MIEH 1F4HA 2Z31A 4B41A 4K23L 5FB8A 4JAMA 4MJ6B 3SE9H 1AXSB 1BD2E 5CZVH 1FCGA 5BS0D 4IMLA 2FWOB 4O2EB 3WKMH 4G7VH 1N8ZA 4BQCA 3MRGB 4MNHB 2DLEA 1G9MC 3Q5OA 1CICA 1M6OA 3FZUC 4MA8H 4WFGE 3RWCB 1HCFX 4D3CH 4M1CC 1HWGB 2GYSA 1GAFL 4AH2A 1FYTD 1ACYL 1QYGL 1MCCA 5DJAB 3DV4B 4OCSH 5IEHB 1NFDE 2AEWA 1GSZA 2W0PA 2J88L 4WTZG 5FYKL 1R5WA 4RWYH 2GTZB 1EAJA 2ARJB 1S7UB 3HNSL 3P0VL 4JG1L 3VGEA 3BPOB 1WAAE 4YHLL 4MA1C 1RZFL 1TN6B 4KDWA 1UH4A 3F12A 1RZKH 4OLUL 3QNZA 5EO0A 4YWGL 1NDMA 1QBBA 3VFWB 4R8WH 4I0PA 1JWSA 2XA8H 3GBLA 5B4PB 1CD1A 3F5WA 4OCXH 1UEYA 3CK0L 3IDGA 3SDAD 3VRIA 3CLFL 2V3NA 4XXDB 3E37B 4YFDB 1KC5H 1FV1B 4O4YL 5D9SA 4IDJL 4XPTH 1BAFH 4A6YH 4ZPVB 3W5MA 1OB1B 4PTTA 2PYEB 5T1KA 3MRRA 1GXOA 2R4RL 5IB3A 3BQUA 2WBJB 3GHEL 1J8HB 3JWDC 3CFBA 1NAMA 2HJKA 3H3PH 3IJHB 1PAMA 4R2GC 4WW1A 5HGGS 1OQXA 4U49A 3MUGA 1OAKH 3UTTB 2A9NL 2F74A 4I48A 3SHSA 2GT9A 3BIKA 3DO7B 4LLUB 2J8OA 5D1ZC 3MRQB 1DLHA 2IALB 2Z31C 1NDGA 4FFYH 5DF0A 3QEQD 2R0KL 1G7QB 1CGYA 1MHCB 1MFEL 3O4LA 4H0GA 1AKJA 4OFVA 4R7DA 1AD9A 3BT2H 3OTTA 3LY6A 4PLKC 2NY2B 3ZKMC 1Z5LA 5KVEL 3PV7A 4PRNA 2GSIB 3I3DA 3QZWA 1INEL 4NFDA 1HH6A 3NBNA 1F90H 3VJ6A 1A4KA 4WB3A 1A8JH 3WN5B 5KVMC 3DVIA 1CICC 2ZCHL 2JB5L 4KKNA 1U58B 5DD6A 1IL1A 4G7YH 2DB8A 5JIIA 2HFGL 4OCYH 4OBSA 5ICYA 4BUGA 1S5HB 3X3GL 5SWQA 2GSGA 4MAYB 4RRPA 3BH9A 2EIBA 5TDOA 1NJ9B 3NPZB 4AMKH 2UWEE 2AEPL 1YPZA 5C0BD 3EFDL 2DS4A 1CL7I 3Q6GH 3TCLA 2ADJB 25C8H 2DDQL 1RZ7L 1BHGA 3RHWK 2FR4B 1T04A 2ITDB 3T0AA 4QRUB 2H1PH 5JLZB 4MA3A 4I0PC 2EYSB 3RWFA 3WO3B 3GSWB 2J2ZA 5JHDA 1JYVA 4U0RC 3STZA 4MD0B 3NMEA 1U8HA 1V8HA 4NQEE 4H1LA 2BDNH 1MWAH 1B3JA 4BQ6A 5C1MB 1ONQA 4WI6A 3EO9L 4UQ2B 4UIMB 2ZP0T 1P7QD 2EXWC 3O3BA 4Q6IA 5AG9A 3QA3B 1ND0A 2F53E 1EVUA 1CDJA 2HH0L 3BQUC 2ZSWB 3O3DB 4YBQC 3RWIA 2BOCB 1DBKL 3T0VA 3ZZ1A 5KS9B 3MA7B 3UPAA 3QAZC 5GS0H 2OSLB 2HWZL 5L6YH 2CLVB 3AGVA 5C0GB 4JRXA 3PGDB 3A6BH 4QCIB 1ZT7B 2DQUL 4NNYA 4MMXC 1BMGA 4PJIB 3R0MA 4HZLA 3TIEA 3VXSA 5I66B 5C0CA 5GSRA 2NZIA 1JTTA 2JELL 4LMQE 2V5MA 1TQCB 5C92A 1SQCA 2YK1H 3KS0H 4LRIA 4LSVL 1A1OA 3U7YL 3ROOB 2AV7B 1JHTA 3L3OB 2YSSB 4QRPB 2J8UB 3FFCA 2Q3ZA 1D5MB 1GZPA 4KHTH 2OLDA 4HXAL 5FA4A 5TF0A 4UTBL 4Z78B 3SKMA 3H9HB 4ZODA 3UTSA 2WIMA 1YEDA 4RQQA 2ESVE 3F7VA 5HI5C 2ZOKA 5F44A 1M7IA 3MRDB 3OKMA 2FD6L 1RIVL 5CEXA 3GUTB 1FL3A 1R24A 4H0HB 4C54A 3DOSA 4OGZA 2E9WA 5SWSE 3E30B 1DEDA 1GGIH 2Q86B 4Q0XH 1HZHL 2ZG3A 5AAWA 1A7RH 1YECL 3V4VH 1XT5A 3EGSA 4ZAKB 3TO2A 5IW6B 3NCJL 1B0RA 1B0GA 4FXGB 4Q6IC 4JY4A 2JIXD 2G60H 5EUOE 4PPTA 1YUHB 1A7BA 5D1XA 1C8PA 5ITBL 1TVHA 4NJAH 4NQDD 4PJEB 3ZYIA 1HILB 4IDLA 3HNVH 3N1QC 3QQ3A 5DMIH 3AFLA 4LKXB 3OXUA 3QCTL 5FXCH 3D85B 4K8RL 4D4DA 3QIWB 3LRSA 4PJHB 43C9A 1IAIH 5J11C 2EH7H 3JV4B 3LMJH 3QO0B 4HKBA 2IPTL 4DVBA 3SGDH 3X3FH 5D6CB 4J3TA 4TUKH 4P39A 2X09A 3V9FA 4L8SB 2AEQH 1S9WB 2X1QA 2DTSA 3W0WD 4OV5B 3U83A 5FM5O 4NNPL 4JHBA 4EOWH 4LRIC 3O9WD 5A3ID 1IGIH 1XEDA 5EBMA 4ZFGH 1QFWH 3MMEB 1I8MA 4JGMA 3DECA 3LIZH 4Z95H 5IWLA 3MNZA 1N9AB 1DQDL 3QQ9D 3A6CL 3OL2A 4TSCL 1XGUA 5IEKB 5E2UL 2A74A 3QHFL 4CDHA 4UBDD 3FN0L 2H6HB 5F7HA 5ALCL 1BVLB 1FZJA 4OT1L 2EZ0C 1CU4H 3O3AA 5EBWA 4ODSH 4XP6L 3TC9A 2FATL 2YWZA 1GIGH 4KDTA 2WLYA 2R2LB 1OAZH 3B9EA 3U36A 5BW7A 1INQB 4P23B 2A83A 3H42L 4ZUWA 4APQD 1PSKL 3FRUB 5IKCA 2EIDA 4JDVA 1R3IH 4NZUH 43CAA 3U0TA 4TOYL 5EO1B 3SDXF 5FGBA 4M7KL 3QCUL 4YAQA 5CBEB 1MWAB 4G9FD 3BDXA 1I9RH 2J1KA 4M48H 1KPUB 5I15L 2VO5A 2VLKA 4PJCE 5C07D 1QLFA 3RZCC 2X44D 3QI9B 4X7CC 4JQIL 3HFML 4KTDL 3FT2B 4EXPX 1QEWA 4K9EH 3MV7D 1D3CA 4U6TA 2I60L 3LHPL 4P2QA 3KPQA 1LK2A 5KJRL 2VWEE 2AABL 1BD2B 3GNMH 2DLHA 3K80A 3QH3A 4BSVA 1G6RL 4ORZC 3BMWA 4P9MH 4YHMH 4NQSA 4D0DA 4P5TD 3PNWB 4ODVL 3IDMB 5EZOH 3DV6B 4AJ0A 3F7PC 5LXGH 1P2CB 1URLA 3O4OB 4RAHA 1DSFH 4UU9A 4WTZA 3KLAB 4LP5A 3F6IA 5JORB 3L3IA 5HHPA 4N8CL 4HK0B 4JKMA 3MXVL 1NFDB 3GM8A 1O79A 3RJDA 5C0FB 5DQ9B 3MJ6A 1N4PB 5HI4C 4PBXA 2C3WA 2VDPL 2K7PA 4NGHH 3RKDD 1SHMA 4FXKA 1I3GL 5DQDL 1JK8A 3BN3B 4NO2B 5IWLC 1B2WH 3ULVF 4UNVA 4ZG1A 3UTQB 2W60B 1JVKA 3BP4B 3RVVC 3V6ZB 1BFVH 1CE1H 3MRJA 3LOWA 4OGXL 1PY9A 1VFAA 1BQLL 4HEME 4XNXH 5CD5D 4HFUH 4P4RA 4R97B 2AJZA 3REWB 4HLZG 3SQOH 4KDTC 1LO3L 2H3NA 3KPPA 4GBXB 5BW7C 1K4DB 4N1CA 3A67L 5IB4B 2VDLH 1YEGL 4E42A 3U2SA 5I9QB 1W0YT 2AGJH 2EYTA 4HQQL 4WFHD 3MLRH 4PJHF 1EXUB 2P5EE 3HQAA 5E6IA 5HDOA 4QEGA 4ONFL 3OKDA 1MQ8A 3VXOA 1PD6A 2F58L 5DT1L 1Q72L 5DQJB 1UT9A 4XP1L 3IJSB 3UXFA 2WINB 1A5FL 5T3ZE 1XGTB 1UM5H 1WISA 5IFAL 2AAVA 4DAGH 3O6MH 3NFSH 4NC1C 5HYIA 5DC9B 4JFQB 1IFHL 3TFKC 4TSBH 4NSKB 3KPSA 1SVZA 5BO1L 1AHWA 1QSFE 2P43B 4NT6A 2OXHA 3SGEH 4U1HB 5GS1A 1CGUA 1C5AA 3JSSA 4L8DA 4XMPL 1F6AB 4Z0XB 2HT2D 3WHXA 1XGPA 4O2FB 3MLYH 3VFUA 1R5IA 4YHIA 3MSPA 2JJSA 4GMTH 3DYMA 2NLJA 3CXDH 2UWEB 3QUZD 5HHVH 5J1AA 3EO1B 2E9IA 2NTFA 4NRYA 1NCWL 1EO7A 1CG9B 1QHPA 1JGVL 2NY1B 3SDCD 1QOKA 3MV9D 4N0UE 3OJ2C 3G6JE 4AK1A 2Y23A 3FKUS 1JUFA 15C8H 3KHOA 4EUPG 1CK0H 4H25B 5DEFB 4ELME 4NQEB 1I9IH 3CVHB 4JFED 1MIEL 1X81B 2OM5A 1FNHA 2MCPH 4HUVB 2FL5B 5EWIL 4C59B 4GAJH 3B9KD 3C6LB 3S96B 5DJ6B 2APBA 3O41B 5GRVK 3WKML 2F53B 1A0QL 2FH6A 4G7VL 1ITBB 3DXAA 1DANT 2FYYB 4YFLF 1TPXB 1HYSD 1WUNT 1JWMB 3UAJD 5IW1B 5E6IC 3TBSA 4GRWE 1GXMA 5FUCE 4MA8L 3QXVA 4D3CL 3TT1H 1IM9D 1AD0B 3ARBB 2I9LB 4QHLA 3C5SA 1W72A 3MFGB 1EZVX 2QSVA 3VCLA 4XC3L 1BWMA 3U4EB 3KYOB 4X6FA 2X9WA 3VFMB 4G8GD 3B4NA 1CLZH 5C0IB 1S3KL 1EFXB 1E4WH 4FTVE 1TIUA 4U1KA 1RZKL 1AHWC 5GS1C 1R3HB 5H8DA 4R8WL 5DD5H 5F9OL 4YO0A 1NEZG 1F11A 2XA8L 2HT3D 3V6OA 3D39D 2VLRE 4J3SA 1DUYB 4OCXL 4XBEL 4F37F 3MLZH 1A6TB 2H6FB 3NZ8B 4FS0A 1XIWD 3O6FA 1A9BA 3LDBC 5CSGA 3ZYOA 3SQCA 1X4ZA 3O3EA 2IAMB 1C08B 3RVXD 2JJSC 3QUKA 4XPTL 1BAFL 3TVMA 4UILH 3QJHA 4OGAC 3OKKA 2ESVB 1AJ7L 1NGXB 4PBWD 5BZDB 1EZVY 5MEQB 2VRAA 4ZD3L 4QGTA 3H3PL 2XWTA 3EFFB 3FONA 2R56L 1D9KB 4M8QA 3QDJA 5SWSB 5DMJB 3GFUA 3HZVA 4M03A 1CDBA 3DBXA 3MRFA 2GY7B 2IG2L 2BVOA 2X7LA 4FFYL 4LLYA 3G5VB 4K3GA 1KTRL 2IC2A 3E0GA 4KZEH 3LKOA 4XP9L 1TNBB 4XHQA 3QXAB 1L6ZA 3NA9H 2ZZUT 4ZUVA 3N85H 4LRNH 5EUOB 1DE4A 1EX0A 1JPSL 1F90L 5GXBB 4WEBH 3VXRD 2HFEB 2VABB 2F19L 4HUUA 4BFGA 4LVEA 1FFOA 1KJSA 2ZIRB 1IKFH 4RAVA 1EO5A 5DK2A 1A3LH 4OCYL 5FKAA 1T3FB 5DJ2A 3Q6FA 1KTLB 3MOBL 5EIVA 3PABA 3V4UL 1HHJB 2WW8A 5CWSB 4JVPA 4ZFFB 1MFNA 1MJ7L 3OGCB 4Y19D 3Q3GA 4NKDB 1OP5H 5JW5A 5F6HI 5HYSB 4Z7UE 3MNWB 4YPGA 4AMKL 4FRWA 4M93B 4BM7A 1FT2B 1Q9WA 3P30H 4UDUB 4BZYA 3Q6GL 4X98A 25C8L 1U92B 4OCWL 2QQKH 2PYFB 2X6MA 3TYGH 5KOMC 4L3EA 3E3QC 5BV7L 1TNNA 3VA2C 2XZQH 2AJ3B 2P42B 1VCAA 3RGVB 3VFNA 4JY6A 4DZBB 4OAWA 5FHBH 2BDNL 4DEPC 5ISZE 3O6FC 4XAWH 3RL1A 3MOAL 1RZ8A 1NFIA 1IGYA 2O5YH 4KU1A 2ZUQB 3DYOA 4ODWB 5DTFA 4RZCA 3TVMC 4PJFA 4YHZL 3HC0B 1P1ZA 4HJGA 1IAIM 3U9UA 3WEXB 2XACC 5L6YL 1LD7B 5E5UB 5I2IB 3GSRA 4MLIA 3MNVB 4MYWB 4X6DF 4HV8A 1MRCL 4N5EC 3WFZA 5DRWA 3DUSA 1CGSH 2D4DA 1X4YA 2XV6B 5F7UA 2L4OA 1DLFL 3U0PA 4YXKH 5I6XC 1K8IB 1F3DJ 3V7AE 2QR0B 1SEQH 4KJWC 4M9PA 5GGTH 2LTQC 4X7EC 5D96C 4F9PA 2YK1L 3OXRB 3T8XB 4XHJD 1EBPA 3QWOA 4C83A 3EYFA 1CWVA 4MNQA 4D0CA 2YD7A 1H8SA 3CCHB 4OD2B 1DR9A 2VXQL 3FQRA 1NH6A 1MCWW 2NXZB 4LNRB 3GIVA 5TPWL 4XNUH 5BJTB 1FN4A 2O61B 4KHTL 4L4JA 1H8NA 2G75B 2F54A 1GC1H 4PGCB 1I8KB 3S36X 2EE3A 1F3JB 1BVKB 4H0IA 3T77A 4X9HA 3EHBD 4J4PA 3LQAC 4XCEB 1NUGA 1MVFA 3BHBA 4M7ZC 1O5DT 1NBVH 4GW4B 4U1JA 4XPGL 3KWWA 4TNWF 3ET9F 3L3JB 3PWNA 4ZNEE 1GGIL 4Q0XL 5BVPH 2X4QA 4DN3L 3B6SA 1A7RL 4HKXB 5IBTH 3C72B 1RJLA 3FMGH 3HE7D 1ED3A 2GTWB 5B38B 3UDWA 4LSTL 5EU6A 5ICXA 4C56A 4M7LH 4RMVA 5T3XE 1WT5A 2H32A 4Z7WE 2G60L 3GMQA 3RL2B 2CIIA 4F7MA 2PW2B 5F9AC 3HRZB 2GUOA 5EZIL 1S7QA 3H7BA 3ULSB 4AIOA 3B3IA 3IDJB 5TFSH 3BFOA 3VFVB 2CK2A 2IEJB 3PL6A 5HHOA 5SV3A 1VACA 2YC1A 4ZS6C 3CXHK 4JJ5B 5E2VL 3ULUD 1HSAB 4U3XA 1IAIL 2VTFA 2EH7L 3LMJL 2P5EB 4IRJA 1K2DB 1I3UA 1CDYA 3X3FL 4P2OB 1A1MB 4TUKL 1T4KB 4WRLA 3STLB 2VXSH 2EKSB 4PJXE 2AEQL 1X5XA 4PG9A 2NQCA 3E2HB 3DURA 2VQ1A 1Q94A 3RI5F 4F9PC 5HGDB 2BSRB 4EOWL 4LSPL 3BEVB 4Y0GA 1KACB 4NQTA 1QFWL 5B4MC 1T1XB 3BAEH 1IBGH 5DVKA 3LIZL 3N06B 4NZTH 2X4PB 4U1IA 4GKSA 2NY4B 1U3JA 4GKZA 5I8EB 4OUUB 4ZXBB 1QSFB 1DBAH 4AEHL 1JF1A 2LV4A 4NHCH 5F7NC 5E7BA 3D0LA 5F71A 1FZMA 1CFBA 4J4PC 1CU4L 5JO5A 5IBLD 1MCHA 1WLHA 1QRNE 1GIGL 3VMPA 4KRPC 4W70A 1OAZL 1YNTA 4BSWB 2EE9A 5HGAB 2WBWB 3VFRA 2CUHA 2F5BH 3X11A 1UVQB 4GG8B 3MRHB 4NZUL 3BPNC 1QZ1A 2NX5A 1I9RL 2XZZA 4HHAB 4ODXA 4M48L 3UDWC 4EUPA 3WNKA 4OF3A 4KKCC 1QR1A 1S9XA 4N0UB 3SJVB 3VXUA 5I1KL 1WT5C 3TN0D 1CT8B 2XWJA 4ZSOE 2Q87A 4PJCF 3G6JB 1PLGH 2CXGA 5KSAB 3VXPA 5JW3H 2Y06H 5T1MB 4ELMB 4IOSD 4HX1B 1KLFA 1J8KA 1VPOH 4PJ8A 1P7KA 4KJPD 5D7JA 1IC5L 1YEJH 1Q9KA 2Z93A 3MRNB 5M95B 2OZ4A 1HH9A 2I5YH 3EDDA 3Q73B 4PRIA 2WBJD 3GNML 1J8HD 3V4PH 3PL6C 3RWJA 2JF1A 4Y4FB 1MQKL 3MJ7B 3UTTD 3WS3A 1V7MH 5EZOL 4IRJC 5LXGL 2G9HA 4GRWB 1MVUA 1OSPL 3HZYA 4K7PX 2DMKA 3DSFH 3K74B 5D7LE 2R4SH 4YDLC 2NY2D 4HUWB 2WQRA 2OI9B 3ZHLA 1IAOA 4N0YH 4JY5L 1PW3A 4NGHL 4Z0BL 1TNMA 5FCUL 3EOAB 4GKNB 3MBXH 4JR9H 4UNUA 4P5KB 1B2WL 3K2UH 5TE4H 3QFDB 2VR5A 4FTVB 3BESR 4K94C 1FFNB 2AKRB 2X4UB 1FE8H 1FNEA 4MAYD 3WLWD 3AAZA 4Y7MA 2VLRB 3ZKXB 5AG8A 4JZNB 3LN4B 2VR4A 2D9CA 1EO8H 1JNLH 1RIHL 2HA1A 1UZ8A 4KAQL 4LNGB 1U93B 1ZLUK 4POUB 1HKLH 1MCQA 4WNQB 2DLGA 1YMMA 2VDLL 4K7PY 3RZWA 4EHMB 1WIUA 4Y5VB 2CK0L 4LSDA 1X5JA 2AGJL 3ZDZE 3IJYA 2H41A 1Q9OA 5F8QC 3MLRL 1B4RA 2HMID 1OGTA 8FABA 1H35A 5HI3C 5FO8A 2PTTA 4LVNB 3S35X 3W39B 4J3XA 4GAYA 3U4BH 4OZ4B 4NWUH 4DUWA 4QHUB 5C7XH 4XBPB 1UM5L 5J06A 4G6FD 2Q7NA 5CP7A 4DAGL 3BZDA 2HTKD 3O6ML 3NFSL 4FQ1H 1E6JL 1KPRA 4PRAA 2CLRA 1H8OA 5ILTH 4TSBL 1VADA 3GSNB 4OFKA 4XVUD 4AQOA 4BQBA 4TQEH 5CIPB 4YR6A 4P9HL 3WIIH 3WDHA 5IVXE 3MRMA 1AY1H 3OR7B 3QUYB 2CD0A 5IFHH 3MLYL 5A2LH 4G8FB 2Y6SD 4Z7UB 4GMTL 3CXDL 4MX7B 4PLNC 5E4IA 2R23B 4YDVA 3BZEB 3OX8A 2CDGA 4KUZL 3BRFA 1I3RB 4Z77A 1UFUA 2NZ9D 4PV8A 1AGEB 5C08D 4QRPD 1O1TB 1KLUA 2BXYA 1CK0L 3KS0J 2UY6A 5F1NA 1I9IL 3WS6A 3MRBB 5GGSY 5ISZB 1E4XL 1WTLA 3OKOB 4JDZB 1S9KC 1JNHA 4UAOC 2MCPL 2WP3T 1J5OL 4BH8A 3I2CH 3DPYB 4GAJL 4IRSA 3V6BR 3ZTNH 4P4KA 3M45A 4CADB 3TNMB 5I1DA 3DVNB 4YHPB 4BFBD 5L8JB 4XCFH 3FFDB 1KT2A 2BVPA 1KLGB 3TT1L 2P24A 1TQBB 5GSVB 5SWZA 1U2HA 4PS4L 4ZAKD 2WK2A 3FB6B 4Q9QL 2FJHA 4F8TA 1AFVH 4MJ5B 1NLBH 5DEZA 2YMXH 1WCQA 3KXFA 4OCMC 5M7QA 1KCSH 1CLZL 2DD8H 1CXEA 5HDBE 3UO1L 1AGBB 4LLWB 2PR4H 1Q9LB 5C86A 2VUYA 1IZKA 4BOJA 5BXFB 3DX6B 4F80A 5DD5L 2XN9A 3QIWD 1MAMH 1T0NB 4QRRE 4MJ4A 4F7CA 4OLZL 5HYJE 3OAYH 1V3LA 1YJDH 3ARWA 1BZQK 3KPTA 1ZGLB 5AGDA 4PUBL 3OWEA 3MYJB 3KLDA 3VDAA 3CNKA 1A02N 1NL4B 4Y5YB 4QRSA 3RVWC 3MXWH 3AUVA 4PYGA 5GJSH 4ZFOB 3MV8A 4P57B 5CEZL 2L7JA 3NIDF 3DUUA 4UILL 1FNGB 4JKLA 3QEUB 4BJLA 5HHQA 4L4TA 3LKPB 5KG9B 1LE5A 1N94B 2VUOA 4N1HB 1G7MB 4YDEB 1F4YH 1G6RA 4QXGL 2BHYA 5LG1A 2Y1VA 2C3GA 1J1XH 4K8RC 5C0EB 3ULVH 4M43H 4NHUA 4ETQA 1FAIL 3WS6C 1U8IB 5TDNB 5DHVA 3LKRA 2VJXA 4DQOH 4ZUTB 2VOTA 3NACL 1A4JB 1SA4B 4P2RB 2HLAB 3HRPA 5I1LA 3E32B 3T4AB 4IRSC 3NA9L 4P4KC 1TJGH 4Z7WB 4LRNL 4P23D 1QP1A 1AXTH 3B9AA 3VRJA 4HH9B 4R4NC 3S98A 3KSQB 2EDKA 5HJ3A 3I6KB 5ERWA 1IAKB 3HE6A 4MWFB 3TH4T 5IROA 1G7LA 4U6XB 3T2NH 2EE6A 2E9JA 3P9LA 3DVGA 4P46A 2VISB 3QI9D 3Q7FB 4L8CA 1AO7E 2VXVL 3FT3B 4RFNC 5AD0A 3LB6D 4YK4C 3TYFA 3V0VA 1G9EA 4S10A 4I0KA 3P30L 5F3HA 5GS0D 3T0EA 4K2UH 4ODHH 4PJXB 1PDKA 3JWNC 4JO2H 4DK6A 1PYWB 2GFBB 3KYKH 4RAUB 1XGQB 4U6VH 2Z0BA 1LTXB 4M61B 5EN2B 3IDYC 1J05B 4PG2A 5I30L 1L4IA 2P47B 1YEFH 5HDQH 1I8IB 2XZQL 5IP4A 3WXVH 3ARQA 1PX3A 2C3XA 5EPMA 4WFGD 5FHBL 3VWJB 5J9PA 3U30C 4G6ML 4EN3A 4ONHA 4NQCE 2O5YL 1S7VB 2A2QT 3GMRB 3BD3A 4PY7A 3WFCL 1ZTXL 2VN7A 4KVCL 5F93C 3TBTB 3V52H 1QRNB 4PJ7E 1MCRA 1R3LA 5L2KE 4Z6AT 1HQRA 1S7RB 3QIBA 3WE6A 4B0MM 4Y16A 2V8KA 3WD5H 1XCTB 1L0YA 1BFSA 3GI8H 4XI5C 3NFPA 2VMFA 2MHAA 4DK3A 3QHTC 4Y89A 3UPRA 1XFPA 1ZVSA 5C6WH 4JPIB 2Q7YA 4LPCA 4GBXD 4UV4H 4ZSOB 4ELKB 4QXUH 3L1OH 2DM3A 2H2PD 1E28B 1SEQL 1XZ0A 3GSVA 5HYEA 3NCEB 5GGTL 2B5IC 1KNOB 3MRPA 3PGFL 2FDBP 3CMGA 4Q58C 1A3QA 3HE6C 2EIEA 5IROC 2BK8A 1TCRA 3HG1D 2ZUVA 4P46C 4NBYB 4XNUL 1BFOB 4G43A 4PLOB 4X6CA 2NMSA 1FQ9C 2AK4D 3IGAB 3SDYH 1N95B 1VEPA 4OD1L 3R0NA 1GC1L 4H88L 3L5HA 3MRIB 2WUCL 2HFFA 2PKDA 3T0EC 1X6LA 1HN1A 3LPWA 4CRPA 3KLHD 5D7LB 4X5WB 2Q8AH 2DLFH 4PG2C 1NBVL 2BRRH 3BMVA 4KI5F 3HR5B 3ARGB 5HHMD 3DSXB 5IUSA 3FB5A 5E4EC 3ARTA 4HUNB 2YD8A 3RY4A 4UMGA 4DW2H 5HGHA 5BVPL 3IAPA 3WIFB 1ZHLB 2EDWA 4HWBH 3QQ4B 1J88A 1CDGA 1OAYL 5ID0A 3FMGL 3I3BA 4EN3C 3ZKQD 2XQWA 1JZ6A 3MRLA 2CJUH 4ONGH 3WHE0 1EPFA 3AXLB 5MI0C 3QDME 4M7LL 5DJDB 4E41A 5KVDH 5L7XL 2AJSL 1ZSDB 2DQCL 3P9WB 1YNLL 1YY8A 5L0QC 1MH5B 5AUMB 3IKKA 1MREH 5HVGB 1HQ4A 5MENE 3QIBC 5TFSL 4Y16C 4WI8A 2HN7B 2GCYA 1OPGL 5IMKB 4KY1L 2NY1D 5INCB 2BCKB 4MDIA 2GY5A 1S7WB 5TH2A 4NQED 2QJDA 1QVOA 3C9NB 4D8PB 5IB2B 1MHEA 1TVDA 4XTRD 1H3BA 4B5EA 5I17B 1MRDH 1BLNB 3KJ4B 3C6SB 2AW2A 3C6LD 1S7SB 4NKIL 2F53D 1C16B 2MQ0A 3MLTB 3TCXA 4UDTA 4XVJH 2BMKA 3KYAA 1IBGL 3I6GB 3GSUA 1U8QA 4HFWB 1R5VB 4I8DA 4ORGA 2R2BA 3ARBD 5HD8C 3IDNA 4U1LB 4AENB 3HZKB 1DBAL 1A7OH 5FK9B 2D9QB 4NHCL 5TE7H 3DJ9A 1EEQA 5E2TL 3OKYA 2P8PA 5IVXB 2ITCB 4JFHE 4R3SA 3T2QA 5EO9A 4CW1B 1FYTA 4XT1C 3BKYH 4ODUB 1NKRA 1M05A 5D2LE 5A2FA 1G9MH 3S7GA 1F6LL 2F5BL 4YIQB 1D6VL 2HJLA 3BPLC 1PG7H 1GRWA 1NC2B 3HLAA 2X4SB 4Z7OE 2FECI 1PZ5B 1EEZA 3LKNB 2YR3A 1JL8A 5IF0A 2X1WL 3IFLH 3KDMB 4N8PA 3V5DA 5DDHA 3SGDI 3LKQA 2V6HA 5JQ6L 5F96H 3ALXA 1VFOA 3CFJA 2OR8A 4OLWH 5KN5B 2IAMD 4JEGB 2F9BT 2Y06L 1JHLH 1YYMH 3RWEA 1J0ZA 2AXGA 3MGOB 4QHNB 1YEJL 3WL9B 1X4XA 3QNXA 3SDAA 1NGZB 2I5YL 2ESVD 5EZLB 4OKVB 3V4PL 5MP6H 4PRBA 4JFDE 2X4TB 3AREB 1DQML 3WLBA 4M62H 2KUTA 1V7ML 3HPJB 4R96B 4L9DA 5DMGD 4LK4A 4RA0C 4X8JB 3P4OB 1Z3GL 2BY0A 3H6JA 1H3WM 4HIIB 4QOKE 4OIIL 1IM3B 4D4AA 1LD9B 3HA0A 3B9VA 2R4SL 3KYNB 4JLRA 4NQXB 5D71L 4U2YA 1WICA 2CH8A 2XXMB 5IB5B 2VDKH 4HIHB 5DD0H 1JI2A 1RJYB 2XKNB 3QNYB 3JWDH 3ARFB 4N0YL 4LKCA 1ZVYA 1DBBH 4L9PB 3H0TB 4QHKJ 3BVNA 1JGUH 1RK0A 5FDYA 3RIFF 4JR9L 4Q9RL 5C8JB 3R8QA 3D18B 4QT5A 5TE4L 3U46B 4PGDB 1U8NB 3WFBH 1QNZH 2EDLA 1FE8L 1PQZA 3S36H 4D9RE 4CNIB 3EAKA 5B39B 1N26A 2NR6D 3LVEA 1WTGT 4JHZA 5B8CA 5INDB 5HYJB 5FYLE 4PGEA 1JNLL 3WDJA 2P5WE 5FDWB 4C4KO 3L5WA 4L8BB 1HKLL 4XH2B 2CDEA 4WCYL 3MC0A 4GG6E 2FHFA 3C08H 2OL3A 2HT4C 3NGBC 3F7RA 5C0BA 3PIQB 5LGJA 1V3KA 3RGVD 2DM4A 3OBAA 4UI2A 4FNLH 2D3VA 4D9LH 1GPOH 1PY4A 1CDHA 2AJYH 3UZVB 1AXIB 1YDPA 3U4BL 4E0RB 5HPMA 3O8XB 12E8H 4G6AC 4N8VG 2R0ZL 5C7XL 3G5XA 4QXWA 3FO9A 3SDAC 4OZHE 3L7FB 5E08L 4JRYE 2Z92A 4UUJA 2DIBA 4M6OL 4OBRA 1JPFA 5ETUB 2V5YA 5ILTL 1ZHKA 3WJJA 5BV7C 3D5SA 3DI2B 3GRWL 5C09E 2X10A 1TNOB 2G5RA 3WIIL 1OWWA 3RNQB 5I1CH 3VWKB 2XYCA 2NY3B 3GHBH 3HUJA 5DJ8A 2N7AA 5IFHL 3P77A 4LBEB 1HSBB 1JPST 1AO7B 4YHNA 4W6YB 1NAMH 3ROLB 1IVLA 3CUPB 4QRQA 5DC4B 1LNUA 4YE4H 2IBZX 3BDYH 1QSEE 5FM8A 1SJHB 2FX9L 5J12C 4LHQB 2NXZD 3BKML 3BUYB 3VXNB 5T1DH 2WWKO 4TRPH 5GRWA 5HY9A 1C5BL 1DL7H 3FQXA 5B8CC 3VH8B 2DICA 4QY8B 1OSZA 1A1NB 4QKXB 5BS0E 2EDQA 1YYLL 4JANA 2C1PB 1CGVA 1T22A 4NQCB 2VE6B 5F88A 1H3GA 4BQ8A 3P0YH 3I2CL 2CKBB 3C60D 4MNGA 2BVQB 3ZTNL 1L9NA 2KZWA 1NMCC 1W0VB 3RP1A 1HIMH 4PJ7B 3BZ4A 1I3VA 4XCFL 3WDIA 3QISA 4XB7A 5L2KB 1FGNH 1MLCA 1EUTA 5CJQH 1IGJB 5CGYC 3OG6B 2DI8A 5D2NA 5DD1L 1AFVL 1JPGA 3PG2A 1CFAA 4MA1B 4LFHG 3OF6D 1NLBL 2YMXL 4OLXL 5GGQH 2DKUA 1KCSL 4PJGA 2X4RB 4NPYA 3D5RA 4NRXB 3GJFB 1DBJH 1CXLA 2DD8L 4F3FB 2JJUA 3UZEA 1BF2A 1P9MA 5E8NA 2PR4L 5J1TC 4V1SA 4R4FH 5JXAH 4H1LH 3WJJC 4J6RH 4YLQT 4G9DA 2EECA 4FQCH 4WU7A 1DFBH 4K7PH 1MAML 3CLEL 1NUDA 5IM7B 2B0SH 2DQFA 2P5ED 2FHCA 2C9AA 2BC4B 3L7EB 4P2OD 3QEGH 5GJTL 1KZPB 2VAJA 3BD4A 3IDUA 5GJSL 4X8XA 4PB0H 3SKOA 5T3ZD 1AR2A 4CN6A 3K46A 5FYLH 1W8OA 4OJFH 5D1ZB 4CAGA 2ZOLB 4LHJB 3Q5YA 4YGAB 5MEPB 1F4YL 1FORH 4RGOH 5DK0B 1LEIB 4KVNH 1W0WA 3QEQE 1J1XL 1EGJA 2NY4D 3DTXA 3QUML 3ULVL 4ZXBD 3O9WA 3PWLB 5JOPE 2PW1A 3E6HB 4DQOL 4E5XA 4KGLA 2COQA 4BZ2H 2XKUA 2JCCA 2GOXA 2Y4SA 4U7MA 3QDMB 5JOEA 1TJGL 1ADQA 3GSXB 1TETL 1RHHA 3MLPA 4ONOA 1AXTL 1X7QA 3KPNB 1LILA 5MENB 4X83A 1NGWB 4G8IB 2RIKA 4LGRB 4BQ9A 5D2NC 1T1ZB 4HIXH 4ZS7H 5F7WC 5LCVH 4X6BA 4U7KA 3T2NL 3VFPA 4APQA 3SJVD 2OR9L 4QYOB 2R1WA 1X5YA 1AQKH 5DRZB 3IFOB 3BKJH 1RK1B 1MI5A 5BVJA 4G9FA 5DJCB 5DUBB 4NRZB 4L29B 4K2UL 3G9AB 2EXYD 1P9MC 1T20B 4JO2L 4MGXA 2QKIB 3CPLA 1UCTA 4HS6A 3SEPA 4Y4FD 4AT6A 1YEFL 3STBA 3WFDH 4XP5H 4BFIB 2NCMA 4QTIL 3WXVL 4DFHA 3AS2A 1FRGH 2ZKHH 5E6YA 4CU8A 3BP5B 3MO1B 4BKLB 5ICZA 1UACH 5T5FL 3BQUB 4HIEA 4PRDA 3IRZA 4MSWA 1V05A 3CH1A 3QAZB 1CTOA 1J1PH 3MGAA 5DJYA 5GPRA 4KK5C 3DX9A 3L3KA 4FOMA 2DMBA 4NCC1 3OKEA 3AM8A 5MEOB 1FO0A 2DQDH 3V52L 4OFYD 1DLHB 1HHGA 5D2LB 2NOJA 2LU3A 3PWUA 4FTVD 2BJMH 1BQHB 3W9DB 2AXFB 3O9WC 5E8PB 3WD5L 5A3IC 3N1FC 3ZHDA 5IMLA 1CGTA 4FQPA 1E6OH 2VLRD 3G6AB 3PV6A 4TVSa 1KJMA 5HHXL 5DS8B 1IL1B 1HINH 3DO3A 4U05A 4N68A 3DETD 1R3KB 3CSGA 4UV4L 5JPMA 4UBDC 4QXUL 1PFCA 3L1OL 2DBLL 3ZE0F 5IVZB 3W11D 4OQ1A 5TDOB 4GO6B 5E1HB 1J1OH 5DYOB 4P3AA 5DUPL 5CCKH 2K7QA 5IJVB 4JFDB 4X0KB 1RUPL 1YPZB 5AYUL 4APQC 3CMOL 4R9HA 3VA6A 1EDQA 1CD9B 5IV2A 1UCBH 1ZLSH 1GOGA 3SDYL 2E5EA 1T89A 3EYQC 5K9OA 4QOKB 3QUXA 1N5YH 3O3UN 2DWEA 3VI3E 3WFEH 2NXYD 5EU5A 1U6AL 1LO5A 4J8RB 2A0LD 2XZCH 4DW2L 4HWBL 1KJ2A 4ZYKB 3KJ6H 1DQTA 4R0LA 1N5AA 1NGYB 1FVDA 3Q48A 1KG0B 3QUYD 4ONGL 1YEEL 3SFYB 4LARH 5KVDL 5BCAA 1UB6B 4NQDE 4K71B 3AM8C 1IAMA 3VXQB 1BREA 1SM3H 3P73B 4DZ8B 1NCTA 3KPLA 4PV9B 2P5WB 5E8OA 3VFSA 3ARSA 4JZJA 5H35A 4GXUN 1MREL 2BNRE 3T4YB 4MAUH 5J11B 3PWVB 3OJMB 4GG6B 4GJTB 1T83A 4XB8A 3ARPA 1ZEAH 4P9HC 1XR9B 3MUJA 1L6XA 2UVFA 1NBYA 5FYJH 3W0WE 5ISZD 4LU5H 3UJJH 4O51B 3U7WH 3GSOB 4N8VA 2UYLB 4HXBH 2F8VA 3SDCA 3MV9A 1MRDL 5CD5C 3ZDYF 5H37G 1NSNH 4YXLL 2XKSA 4UQ3A 4JFEA 4OZHB 2XFXB 5IW3A 3DSVB 1D5XB 2X9YA 1Y6MR 4JRYB 4XVJL 4M3KB 2DQTH 5J13B 5CJOH 1NLDH 4NOBA 3NN8B 2H26B 3O6KL 4XP4H 5EFIA 2G2RA 5CEXB 1T89C 5IT2H 2BZDA 1A7OL 5C09B 3X12B 4WI9A 5TE7L 2DJSA 3QUXC 3TJEH 1LO0H 5GGSB 4TVPH 3VGHA 1IM9A 1OP3K 5F8RC 4YDIH 1GOFA 4O02H 5L2JB 5I1AA 1A22B 4CVZB 1I1AB 1TLKA 4P2YA 5D2LF 2VITB 1B0GB 5J6GB 4QXTB 1AQDA 4MQ7A 4NBZB 1PG7L 3ARDB 4G8GA 3RZCB 5C07E 1G7JB 4R0LC 1QSEB 5IGXL 3IFLL 2AV1A 3T3PF 2Y5TA 2Y7QA 5GISH 2CMRH 1YN6B 3MV7E 5I0ZA 3PZ3B 3VFOB 2Z9TA 4HEPG 4OZGA 5F96L 4RGMC 1A64A 1TFHA 2K9UA 1FGVL 3FQTB 1X5ZA 4L1HA 4ZUSA 5BS0B 1XF2B 2HT2C 3D39A 4D0BA 2MKLC 5I73B 5I76A 1XIWA 1EFQA 1LEKB 2ICWB 2RCSL 4IRZL 5MP6L 3RRQA 4KK6C 4KKAD 4R4BB 1NMBH 1WWAX 1T83C 4M62L 1GGCH 3QIUB 2V2XA 2DYPB 3R1GH 5KW9H 1NFKA 3RHWF 1S9YA 2HFTA 5ADPH 2NYYD 3MROA 3SDCC 4EKXA 1D6EA 4IM8A 1YQVL 2XXCB 3PWJA 4P2RD 5F7YC 1WBYA 1A6UH 2A6JB 5CZXD 4PR5A 2VDKL 4HAFA 1C12A 4GRMB 3IVKB 5DD0L 5T3XD 3DRAB 2A1WL 5F1IB 1GJIA 4XZUB 5D8JL 2A6KA 3TBYB 4Z7QE 2A6IB 2P8LB 4PJDE 4NO3A 5I16B 1IZJA 1L7IH 1UWEH 3MLVH 2BVEA 1EAPB 4N0FA 4NBXB 5DHYB 3WFBL 5JZ7D 4PGBA 1JE6A 3ESVF 1R3JB 4HC1A 3UAJC 2RBLA 3VXRA 2V2WB 3GMPB 2DWDA 4U31A 5TJWK 1KIPB 2HVKB 5F89A 1KJVB 2NW2A 3U0TB 1H15A 1LE9B 4KK8C 1ETZB 4CU6A 4U1MB 1J9CT 2MPAH 5BOZG 2FO4A 1FC1A 4Y19A 1XCQA 1CN4A 3BGAA 4GRLA 5T5NF 1JV5B 1W72H 2YUXA 4GLRH 5KSUA 4YDKH 1JZ8A 3CZJA 3QEHA 3UYPA 4JN1H 4OGYH 5JW4N 5LVEA 4PJ5E 1ZANL 2BVTA 4X6EA 3V6FA 2B2XH 2BSTA 2D31A 3VWJD 2QLVB 4D9LL 1GPOL 3QEQB 5C9JB 5D7KD 5BRZE 1NANI 12E8L 2HT3C 2V17H 1MJJB 3I02B 4LVHC 1XIWC 4F7PA 4TUOB 4TTGA 1I7UA 1QRND 4PRHD 5EA0H 3RVXC 5H2BB 5FOBA 1AE6H 2CRZA 1FH5H 2OP4H 32C2A 2V7NA 1OM3H 4NZRH 2JB6A 4JFFD 3JUYA 5I1CL 1KYOK 4GW5A 3RDTA 3LEVH 4DCQB 2V5RA 1Y6NR 3GHBL 4XNMB 4F33B 3TT3H 2MWCA 3WJLA 4ACPA 1NC4B 2ATPA 3EIFA 3NPSB 1NAML 4MJIE 3EJYC 5FO9A 3V5HB 4HPOL 1U95A 3U1SH 4YE4L 4LSRL 1YNKH 5TGBA 5E1AA 1QBML 2HRPH 4BH7B 1CVRA 3AU1B 1FFRA 4TSAH 3SPVB 4OIBA 1BOGB 3ZYZA 4OTXL 5DO2D 5C0AE 1G7PA 4YC2C 4MD5A 5GIRB 5HPOA 4X7TB 3R8BB 4I2XA 4TRPL 1DL7L 1N2RA 3CH8A 4WWKA 1P7QB 1AGCA 1PEWA 2XRAH 5F1SA 3MV01 3IETB 3LQZA 1A7NH 2X40A 4JKPH 3HS0A 3CC5B 3P0YL 4XRCB 5HBBA 2C26A 4GRLC 1C5DB 4GW1B 5C3TA 1OAXL 5F3BA 5LGHL 1HHHA 1HIML 4J3VA 2WQ8A 2EYRA 1K8DA 4LASH 4AIZB 2FJGA 3S3PA 1LP9E 5CJQL 1FDLL 1FVEA 1JYNA 3K8LA 1TZGH 2XZAH 4JFXA 5JHLH 1M71A 3RWHA 3GBNH 3LQAH 5KSBA 3PP3H 3DSWB 1I1YB 1MELA 5GZOD 3QWRD 3DI3B 3HE7A 4JKKA 3L9RA 2LFGA 1T7WA 5E8DH 3NIFF 2EO9A 1DBJL 1VESA 1L7TH 2IH1B 2UZXB 1GYAA 5DUMH 4FQCL 4LVOB 1DFBL 3QPXH 5EB9A 2DQGH 2GITB 2XTJE 3RDTC 2OTPA 3MRKB 4S2SB 2PF6A 5GGRY 3BPCA 3JZ7A 3B83A 3PHSA 5J1AB 2X89D 2IPUK 3QEGL 2APFA 1MCEA 3VRLE 1YN7B 4FQHB 1MRFH 4PB0L 4BELD 1JNJA 1A9EB 4R6UA 1VEOA 3WNNA 3U4AA 3CX5J 4WUKH 3SDDB 4P2CG 5FEBA 1TDQA 4OJFL 4ISVB 4EBQL 4MJ6A 1AXSA 4LSUH 1CDIA 1FORL 4OSUH 4RGOL 4KVNL 3GMOB 2FWOA 4O2EA 3RX8A 6CGTA 1XH3B 4WWKC 4XHJC 1CGWA 4CU7A 3MRGA 1A14H 4MNHA 2AJUH 4MXQD 3NCFB 1T0MA 1X5HA 2JIXB 3RWCA 1A6VH 3L5JA 4BZ2L 4LEXH 1UXSB 2EDTA 5J8OA 4NQDB 5DJAA 3DV4A 5IEHA 1W72B 1CXKA 1A6WL 4M5ZL 2GTZA 2ARJA 3EHBC 5GRYA 4MA7H 1NC2D 1ZK9A 3Q75B 2BNRB 3QULB 5D93B 1S7UA 5MERB 1T6WA 1J0HA 2Z8RA 2EEBA 1GCFA 1OP9A 5GRUL 3NCMA 1FIGH 4HWJA 4M7LT 5DWUH 4HIXL 5LCVL 4K23H 2MSPA 1AQKL 4U1KB 4IEFB 3BKJL 3VFWA 1KBGH 1R6VA 3G5ZB 3HE7C 4ZUUB 5FUOH 4YGVB 1O0VA 1KB5B 3BIAX 1F11B 4XXDA 2QQLH 4DEPB 1FV1A 3G04A 1IGMH 2ARWA 3OKNB 4ZPVA 1OB1A 3WFDL 4HLZH 2PYEA 2I9TB 1X3DA 2VZSA 1FRGL 5CJXA 4NM8L 2EE2A 2WBJA 2H32H 2J88H 4OKDA 1J8HA 5FYKH 3RQ3A 3LKSB 3IJHA 3UTTA 1CLOL 3GK8L 2LU4A 3FQWB 3HNSH 3C09C 3M07A 4LPTA 3DO7A 1LHZA 2A73B 1QKZH 4JG1H 4LLUA 1WFTA 1J87A 1I1CA 3PF2A 3MRQA 3ARFD 2IALA 4GTPB 5B3NA 1G7QA 4G6JH 1N0XH 1BP3B 2MCG1 3O0RH 4LCYB 5DFVC 4NP4L 5F7LB 2BJML 2GSIA 5DFTA 5JXEA 3NVQA 4GTOB 4QTHB 4U1GB 3TNNB 3WN5A 5I6XB 1DQQB 3K4DA 3FTGB 3GRWA 4OFPA 1U58A 1YEKH 5GRJL 2VIRB 3MV7B 5HYJD 2JJTA 5C0NC 1S5HA 1I8LA 4ZH1A 2Z91B 1T1WB 4MAYA 5DXWA 1WBZB 3GHEH 3E8UL 3ARZA 3LCYA 1NJ9A 3LPGA 5IBLC 3TZVB 2A9NH 1FFPB 3NCCB 4K94H 4J23A 3EOTH 1J1OL 4P5TB 3BPOC 3R4DA 5CCKL 1S8DB 2VXTH 2JKXA 3P0GB 2ADJA 4MDJB 1BBJB 4NM4L 1ZHBB 4FMFA 2FR4A 2ITDA 1OLLA 2FB4L 1UCBL 1ZLSL 1MFEH 4QRUA 1U8OB 5JLZA 3HXDB 2EYSA 2EDOA 3O8XD 3GSWA 4S1RH 4TTDD 4GTSB 4MD0A 5KVEH 1N4XH 1N5YL 3AB0C 4WIQA 2AJXH 5GRZA 3WFEL 4UQ2A 2ZCHH 1VSCA 1EMTL 4UIMA 3QT2A 3VXME 1EHAA 4EUPH 3IAQA 3QA3A 2P46B 4PJDB 5CJXC 5ESAB 3X3GH 2ZSWA 3O3DA 4MJ2A 4O9HH 4PJ9C 3VGAB 1NUNB 2WBJC 5KS9A 3MA7A 4PJGF 2X9XA 4PJFB 5A2IH 3BSZL 4JREB 2OSLA 4Y4HB 3VWKD 3K4AA 2NY3D 2ZG1A 2CLVA 5C0GA 1KXQE 4LARL 3PGDA 2OZ4H 4QCIA 1ZT7A 4PREB 2AEPH 2MTPA 2F0YB 4OI8A 4FQ2H 1AO7D 5CGTA 3S9DB 1SM3L 4OZFB 2DDQH 2ED9A 4HV8B 4PJIA 5CEYB 1FBIL 1IC4H 5I66A 4MAUL 4KMTL 3LEXB 3NIGF 2VYRE 5JXEC 1ZT4B 1H9VA 2IQAB 3WN5C 4I3SH 2AQ1A 3W2DH 3EO9H 4PJ5B 2JJTC 3C8KB 4W6XB 5FYJL 3ROOA 4LU5L 2AV7A 4OLYH 4P59L 3JV5A 4MAYC 3WLWC 1A6PA 3L3OA 3EDJA 2YSSA 4QRPA 5BRZB 2J8UA 1D5MA 1NSNL 3FZUD 4N9OB 3GIVB 3BYYA 4M1CD 2FGZA 2FSEB 3UC0H 4Z78A 2HWZH 3H9HA 2BY3A 2EDBA 2JCCF 2P8MB 2DQTL 5FO7B 5F72S 4JFYB 5CJOL 1NLDL 3MRDA 3GUTA 4XP4L 1CXHA 2FX7H 2Q6WA 2YA0A 3ETBF 1T21B 1ZGLM 5IT2L 1ZHNA 3QUMA 1SEBA 3DX7B 2Q86A 4HG4J 2P48B 1U9KA 4TVPL 3EYSH 1GOHA 2YPLE 1AIFB 4O02L 4ZAKA 5IW6A 2W9LA 3QUZB 5F7EH 4XCYB 1GXEA 4FXGA 2FCBA 4MJIB 4UV7H 4U33A 3EYUL 3U7YH 3CFCH 3INUL 1WQVT 4JO3H 2HTKC 2H32B 2J8HA 3GBML 4PJEA 3VFGH 3K4ZA 1HILA 5C0AB 2CMRL 4HXAH 4UTBH 4RFEB 3TH3T 4F57H 1YA5A 1JGDB 4LKXA 3B3IB 1JPTL 2WM0A 3D85A 4WHDA 5F9JB 1KCKA 3WUWB 1KN4L 1AR1D 4PJHA 2FD6H 3B9DA 3B9KB 4ZOEA 1JRHL 3JV4A 1G9NL 5E94B 2CO6B 5IBUB 5D6CA 3OKLB 4IRJB 2NW3B 2B39A 5D1ZD 1HZHH 1FT1B 4L8SA 5HYSG 1S9WA 1NMBL 4HGWB 4J3OC 1YECH 1TQCC 4OV5A 4PLKD 3ZKMD 3R1GL 2AEIT 3M1BB 3N0PB 3MMEA 5ADPL 3EJZD 4RWHA 1ORQB 2NZ9C 1LP9B 3KQ4A 2EEAA 4GQ9L 3HR6A 4U6HB 1QBLH 4I0CC 1YC8A 1A6UL 1F2XK 3QDMD 5ITBH 2D7QA 4HMDA 2W0FB 4GKSB 4PB9H 5IEKA 2VQUA 3BGFB 4NDMB 3MZTA 4YZFE 1BVLA 3T2OA 1G1CA 5JIHA 3UJIH 3QCTH 4TN9A 1CQYA 3MLVL 4K8RH 3VU2A 3VD4A 1INDH 5MEND 3HB3C 1INQA 4P23A 1MCBA 1YNTB 3FRUA 3TJHD 2XTJB 4LCIL 1FNFA 3X11B 1NCBH 5EO1A 1G6VK 5ANME 2MPAL 1KPUA 4JN2B 5GGUB 3I84A 4ODXB 3QI9A 3T09A 1OT2A 1QR1B 3ELAT 3FT2A 4ZTOH 2D0HA 3WO4B 5TQ0L 3VG9B 4OGYL 1JYXA 1CVSC 5I71B 2I24N 2EXWD 4TSCH 3VFTB 2SQCA 2Q20A 1BD2A 3HMWL 4NN7B 1Q9KB 3QHFH 3BQUD 5ALCH 3JV6B 4TNVK 4XP6H 1K6QH 4PTUB 2V17L 3PNWA 3IDMA 3IS1X 3G08B 3DV6A 1D5ZB 3NH7H 3PP4L 1P2CA 4K7FB 2F5AH 1TXKA 3KLAA 3H42H 5DZNA 2Y07H 4L8SC 5DK3A 5EA0L 1PG7W 2X4NB 4HK0A 4TOYH 5D6DA 1NFDA 5E99H 2M26A 4M7KH 1BZ7B 5C0FA 5DQ9A 3O4LD 2AQ2A 4YEFA 7CGTA 1AKJD 2IH3B 5GS3A 1CIUA 3MA9H 4CUCA 3QPQD 1OM3L 5I15H 5GS2D 4L4VE 4XBGB 1IAOB 3HFMH 4UTAL 4KTDH 1WAAA 3LEVL 4NO2A 1MCIA 3NCYS 3TT3L 3UTQA 2W60A 3BP4A 2VR9A 3V6ZA 4DVRL 2G02A 3LHPH 1NEZB 4LEOB 3J8F7 5KJRH 1J0KA 2AABH 5DGQA 1VERA 3THML 1G6RH 3AAZB 3K1DA 5B38G 3VGDA 4P0DA 3REWA 1SJEB 5C08E 4FQQB 2CPCA 2HRPL 5DHVH 4GBXA 3V95A 1BZ9B 2VLLB 4JFDD 4P23C 4NKMB 1JZ5A 2ZCKH 3TLRA 5DHXB 5IB4A 4K55A 4U1SB 3U7AA 2XRAL 1RZGB 4QOKD 1Y18A 3OG4B 1EXUA 2JJWA 4WW2B 4Y1AE 2UVEA 3U0WH 4C1SA 3VW3L 1O1SB 1MCPL 4JKPL 3QI9C 1JN6B 5L8KB 2QQQA 3CFEB 2ZNWA 5DQJA 3LS5H 3IJSA 2WINA 4GAYB 3BP7B 3C8DA 1XGTA 2ZPKH 5M94B 5D1QA 4HMCA 1P6AB 4NUJB 4OGXH 4LASL 5J3HD 1BQLH 4JVWA 4WUUE 2IJ0C 4I18B 4JFQA 4U4BA 1TZGL 2XZAL 3SCMA 4NKQB 1AC6A 4NSKA 4D9RD 1CE6B 5SX4H 3O4OC 4XNYH 3ZE2E 4U1HA 4JRXD 1F6AA 5FYLD 4Z0XA 3A67H 4GXUM 2YD3A 1FSKC 1YEGH 2P5WD 3O6LH 5L88H 4IS6B 4O2FA 1FG2B 1L7TL 4ZO9A 1TZHB 2JK5B 3VXSD 1ERNA 4DGVH 5HVFB 2XQBH 3BI9X 2ADFL 4X4ME 2DQGL 2UWEA 5DT1H 3FB7B 5JOFA 1H3AA 1DTUA 3EO1A 1PZUB 3OGOE 1WGOA 2CIKB 4XP1H 1A5FH 1XF4B 3H9YA 1CG9A 2FHBA 5TDPB 3NABH 5JMOC 1EV2E 3EYOB 4DWHA 4R97C 4I5BB 5C2BH 2FJFB 5DEFA 4H25A 3VRLF 4NQEA 4WUKL 4UOW1 2ATKA 1Z0MA 3CVHA 4HKJB 2GK0B 3K8KA 3UTSD 5JDSB 4LSUL 2H2PC 4KROB 3VXMB 4HUVA 2FL5A 4WFEE 2EZ0D 1T0PB 1Z9OA 3QDHA 5DJ6A 3S96A 3O41A 1NGQL 2F53A 3RGHA 5I9QC 2GAZB 2FYYA 4ODBD 5C09D 1A14L 1HHIB 1EUUA 1JWMA 5IJKA 2AJUL 1M4KA 5DJ0A 5IW1A 1A6VL 1JZ2A 1Y0LB 4LEXL 5GGVH 1FLRH 1AD0A 3ARBA 2I9LA 1GGTA 1RV6X 1DN0B 4GTRB 1I1RA 4Q6YA 1DP0A 3U4EA 3KYOA 1I1AD 1NCWH 3MJGX 3QJFB 5D1QC 3VFMA 3E34B 1WFNA 1JGVH 3ARDD 4JM4L 3RZCD 4ESKA 2RGSA 5CGMA 5IMOB 1QSED 3WV0A 5C0IA 1FPTH 1B4JH 1EFXA 3D0VB 3SCMC 4KWUA 1JTPA 4WI5A 1WIPA 2W59A 5FCSH 3RAJL 2LU7A 1A6ZB 1R3HA 4J1UB 1KBGL 1SJXA 2PNDA 5EWIH 5FUOL 1N7MH 4HLJA 4PD4J 1DUYA 1L9MA 4BZ1H 4M5YL 1T1YB 4DUXA 1A0QH 1A6TA 3NZ8A 1CLYH 5DURB 3MLUL 2QQLL 5KAQG 2IAMA 1C08A 2DJUA 4X4YB 2NY0B 1U3HB 5I19H 4MS8D 4QRSB 1IGML 3H9SE 3CDCA 3QIUD 1EIBA 2R0WL 3WFHB 2OS7A 3U6RB 4MZ3A 2ESVA 1KFAH 2DYPD 4XC3H 1NGXA 2J6EA 4AEIL 5BZDA 1RUKH 5CS7A 4JPVL 1SY6L 3EFFA 5ESVB 4M6ML 1D9KA 1K9TA 3C5ZB 2XNAB 3D2UB 3MPCA 5SWSA 4LHUB 5FA3B 1FJ1B 1QKZL 1S3KH 3PDDA 3P4MB 2YPLB 2D7TH 5LJYH 3G5VA 2B1HH 4FA8A 1DCLA 4G80A 4G6JL 4DGIH 2I27N 1KJ3H 2H8PB 1N0XL 3QXAA 5F9OH 1TN8B 2IBBA 1NKOA 3C5JB 3O0RL 3RY5A 4OF6A 2VXUH 2FNBA 4XBEH 5EUOA 3MCKB 5IJKC 3T3ME 1MUJB 1G7IB 1FHGA 3TN0B 4LCUB 2W1NA 2HFEA 1YEKL 2VABA 3R06B 3P4LA 3ARBC 2H2SD 4UT7L 1T3FA 1KSRA 1KTLA 4ZQKB 4K9EC 4HGKC 1HHJA 5CWSA 4CL7A 4ZFFA 1AJ7H 3HC4H 3KSLB 3OGCA 4ZD3H 3HN3A 5BQ7B 4NKDA 3HG1E 4PP1D 4Q9CA 2R56H 5HYSA 3MNWA 3AC0A 4K94L 5D70H 5JW4M 3EOTL 3MRCB 2AK4E 2VXTL 1TN7B 2HTLD 2YD6A 4J2XA 2IG2H 1U92A 2PYFA 1TNZB 2LE9A 4RDQF 1UEMA 1W8NA 1KGCE 4S1DD 4XP9H 4S1RL 5JOPD 2AJ3A 3RGVA 1N4XL 1VEMA 4DZBA 3TFKD 5HHME 5F21B 3GGWB 2AJXL 1J0YA 4DOHE 1JPSH 2I25N 1LEGB 1JGLL 1BEYH 1CL7H 2IAMC 1UWXK 2F19H 4ONHB 2ICWI 5KSBF 2ZCLH 4Z7NF 4KXZH 3MOBH 4O9HL 4H5SB 3V4UH 3HC0A 3PQYE 1MJ7H 1YMHB 1D9KC 2APXA 3WEXA 3MUHL 3RPIB 2WWMD 4RX4D 5DMGC 2OZ4L 1TENA 4WI7A 4MXWH 1HQRB 1NC4D 3MNVA 4FQ2L 3QIBB 3CIQA 3OXSB 1SBSH 1H3XA 5ANMB 1FVCB 4OCWH 3ZKSD 1HEZB 2KPNA 4DN4L 1U8LB 4QWWD 2ADIB 2MHAB 1IC4L 1NMAH 4PJCA 1L0QA 5KVFL 4WY7L 5BV7H 4MCYB 3ULUF 3P2TA 5EU7E 1TJIL 1K8IA 4P3DB 2Z8WC 1LK3L 2QR0A 5JIKA 2HJFB 3FOMB 4I3SL 3MOAH 4D4BA 1KTDB 3F58H 3W2DL 1RZIA 4W81A 3T8XA 3V7AG 3JWOC 1DQJB 3MRPB 4OLYL 4OD2A 3CCHA 2DOCA 4G6FB 4LNRA 1UB5B 4LDEB 3QDGE 4HD9A 4YHZH 5HYQB 3BN9C 4I6OA 3EO0B 5E6ID 3DUHA 4W6WB 2Z35B 2O61A 3IB4A 4Z18A 3TPKA 2G75A 4M93C 3UC0L 2J7LA 4X6CB 4PGCA 1I8KA 2BNUB 3UP1A 4PRPE 5BZWB 1H5BB 1F3JA 1BVKA 4F7TB 2OJEB 4XCEA 1RHFA 1QQDB 1MRCH 4KKIA 4O5LH 2FX7L 4GW4A 1QFPA 5KANG 2FEEL 3L3JA 3K0WA 1EHXA 4L4VB 3RGVC 1TZIB 1DLFH 3SGKA 3W5NA 3EYSL 3O11B 1BVZA 1U3YA 4HKXA 4KHXL 4M1DL 4WU5B 3HI1B 2GTWA 2OL3H 2VNCA 5B38A 2YRLA 3DSTB 2ZUQC 5F7EL 4TYUA 1UJTA 1MJUH 4UV7L 3T65B 1U91B 3CFCL 3HAEH 3OF6A 5BOPA 2M1KA 1II4E 1MIML 4HS3B 2VXQH 4JFZL 1I7RB 2PW2A 4JO3L 5C08B 5TPWH 3U79A 3HRZA 5I8CB 3VFGL 4XNQB 1JTOA 4LCCB 3ULSA 4N90D 1JWUB 3VFVA 4F57L 4JJ5A 1HSAA 1YEIH 5IESH 1DN2A 4X4ZA 2NY5C 1NAKH 4Y1AB 2P5EA 1K2DA 4XPGH 3SDDD 3QO1B 3G6DL 4FFVD 4P2OA 1A1MA 1T4KA 3STLA 2EKSA 4DN3H 1Q0XH 3SKNB 2FEDD 3SO3B 5HGDA 2BSRA 5DVMA 2VWEC 4LSTH 3BEVA 5D5ME 1U8PB 4A6YB 5GGRB 1N6QL 4HDIB 4WUUB 1T1XA 2BHZA 1N64H 1QBLL 3HXFB 3PUCA 2X4PA 5I8EA 4OUUA 4ZXBA 1CFTB 1QSFA 4LSSL 4PYHA 4WGVB 3HPLB 4PY8J 5EZIH 4PB9L 4RBPK 2ZNXA 3MLXH 4U6YB 4LLVB 3UJIL 4YZFF 5E2VH 1A47A 2BNRD 4KC3B 4Y2DB 3HXEB 1INDL 1O6HA 4BSWA 4RMSA 5HGAA 3QHZL 4V1DE 3EOBA 1QLRB 1UVQA 2OR7A 4GG8A 3MRHA 1VKXB 1NCBL 3MREB 1OY3B 3DIFB 4G5ZH 4JO4H 4X5XB 4LSPH 4N0UA 3LKQB 1CT8A 1UH3A 2V9TA 3G6JA 5KSAA 2BHUA 5EU4B 5T1MA 4ELMA 4ZTOL 4HX1A 1MHHA 1EK3A 5A43C 3MRNA 3TVMD 4AEHH 1OWRM 5EOQL 2VZUA 4Y4FA 2W0KA 5E8EB 3MJ7A 3QG6B 3D1MC 4FZEH 2YPKB 1K6QL 3B43A 1H0DB 3NH7L 4WHTB 4LOUD 5KS9F 2QSQA 1WC7B 2F5AL 1FL6B 4P2OC 5BV7B 1QFUL 2J4WH 3CDGB 2Y07L 4JGJA 4OF8A 3B2UC 5E99L 1IEAB 1OTSC 2MQ3A 2ZUXA 2DLTA 4HUWA 3JUZA 4LLDB 4P3BA 4ZFZB 1BWWA 5FGCE 3MA9L 1S5IH 3BYTA 4LNVA 4HJ0D 1D8DB 4PJIF 3O2DA 4OFYA 5I1KH 1UGNA 3VGFA 4GKNA 4KJYA 1I9JL 4P5KA 1BGXH 4KJWD 2WY7A 3QFDA 5D1XC 4FTVA 2NY4C 2EC9T 4HWZB 2Y9RT 1FFNA 4ZXBC 2AKRA 2X4UA 1IC5H 3CFDB 4WHYG 2E7BA 5EC1B 5J12B 1EA9C 3DWTA 1P84K 4R7NB 4B50A 2X1XR 5DMKB 2VLRA 2KDGA 3ZT5A 4JZNA 3LN4A 1MQKH 4Y2OA 3TZVD 1EGJH 3S37H 4GH7B 4X9FA 4HPYH 3HMXA 1MY5A 5ESQB 1IRAY 2J8UF 1OSPH 1QACA 2ZCKL 4F7EB 5CD3B 4WNQA 3H9SB 1N4QB 2H6GB 4Y5VA 2PO6B 1ADQH 5FM4A 1QR4A 3U0WL 3MJ9A 3QXUA 1KTKE 4JY5H 1YC7A 1MCFA 4Z0BH 5CJ8A 5FCUH 3W39A 5KSAC 3HAEB 2IPKB 1U8MB 2GIYA 3LS5L 4OZ4A 3MACL 3MR9B 3WBDA 4DKFL 4QHUA 1JGEA 3LSOB 2ZPKL 4XBPA 1HXYB 1WEJH 5E00B 2HLFD 5CEZE 5HHNB 2YUWA 4Y4FC 2IFGA 4Y4HD 2ZG2A 1RIHH 3GSNA 4KAQH 4XNYL 1MAKA 3BH8A 5FUCC 2ICEB 4GUPA 5CIPA 2GI7A 4PJEF 5AEAA 3ZE2F 2NNAB 3BJ91 1N6VA 3HTLX 3OR7A 5A40E 3QUYA 3BX7C 3ZE1E 3LH2L 5FGBC 3O6LL 5L88L 2CK0H 4G8FA 3DPBA 4KQ3L 2OI9C 5ABDE 1F13A 3HG1B 4W4NA 4DGVL 2XQBL 4Z7UA 4FZ8H 2IFFH 4LGPB 5HVHB 2OJZH 4MX7A 2K3TA 2C1OB 2AK4B 2R23A 4PJ5D 3BZEA 3BEWB 1DVFB 5JIPA 1RSFA 1I3RA 1JIBA 1C1EL 1FO0H 5D7IE 3RUGE 5D72L 4JZOB 3NABL 1AGEA 3MBEA 5BRZD 1J12A 2OQJB 2H6PB 4X7FC 5LAXB 5EUKA 3ZKXC 1Z2KA 1E6JH 5C2BL 1IQDB 5HHMB 3FN3A 3DETC 3MRBA 5ISZA 3TF7C 3DRQB 4DOHB 3OKOA 2R69H 1OSZB 2NTSP 4JDZA 2J5LB 4JANB 3W81A 3IXTB 4UU9C 1A6AB 4O2CA 4P9HH 3QSKB 4PJAE 4Z5RB 3W11C 4XCCH 4Y5VC 2BOBB 2E27H 4CADA 1OTTC 4LDLB 2OTUB 3TNMA 3DVNA 4YHPA 3O45B 1KIQA 3PDOB 2X05A 3PQYB 1OW0A 3ILQD 4XVTL 3FFDA 3L3GB 1OTUD 3DRTB 1KLGA 1F4XH 1UADC 5GGVL 1FLRL 1ACZA 5GSVA 4P3CL 4LVNC 6FABH 3FB6A 4XWOC 4H20H 2H45A 3DVFA 4WFFE 4MJ5A 3ALWA 4MJID 2GJZB 4KUZH 1ZOXA 1JPGB 2VDNH 3CJJA 4XGZB 5CFHA 5I75B 5FYKD 3ZT6A 3SJVE 4OZIE 1FPTL 1B4JL 5E2JA 5C0AD 1AGBA 4LLWA 1TMCB 4NPYB 3T0WA 2A0LC 1Q9LA 4TUJB 1E4XH 1TTFA 3HXCB 3EYVA 5BXFA 1SMOA 4Y4KA 4JRWA 4KRNA 4YBHA 1T0NA 1J5OH 2BEDB 1N7ML 3CFIC 1UQSB 4BZ1L 3QUYC 1U41A 3QDGB 1CLYL 4PJBE 4XX1E 1ZGLA 5CZKA 4IRJD 1KJ2H 3MYJA 4WTXA 1EEUA 4LLMB 4Y5YA 4M76A 1QO3B 1Q8MA 4FQLH 2BSSB 4ZFOA 3FOLB 5I19L 1CR9L 4PRPB 4PS4H 3MCLH 1FNGA 4Q9QH 2BVYA 2P1YA 4GAGH 3QEUA 1KFAL 4F8QA 2W92A 3LKPA 1RUKL 5KG9A 1FP5A 4GTQB 1NFDF 1G7MA 1RZJL 4PP2B 3FO2B 5IHUH 3MBEC 4ZNEA 4V2BA 5C0EA 4GTTB 2D7MA 4OCRH 1U8IA 3UO1H 2YKLH 1HI6B 2D7TL 5TDNA 4ZUTA 5A1AA 1G9NC 1WAAF 2B1HL 3PHQB 4KUCD 2P7TB 1A4JA 3LV3B 4DGIL 4N0RA 2HLAA 1KJ3L 3T4AA 1X5LA 5IHLB 2LAGB 4XPBH 5DA0B 1H3UA 5IR1B 4Z7WA 2VXUL 1W2KT 4GS7B 4OLZH 3TESA 4PUBH 3VD5A 2C3VB 2XTJD 4HH9A 4N0CD 3I50H 5IK3B 4V1RA 2VSDA 3EBAA 3K1KC 3T3MF 1TQBC 1UWGL 1X7QB 3I6KA 4LPWA 1UXWB 1IAKA 2FX8L 4MWFA 5CEZH 1C3DA 2I07B 3EKCA 1REIA 2Q76B 4U6XA 5K9QI 2NX5D 4YDOB 2VISA 1JF6A 3HC4L 3VXTB 2DRUA 3FT3A 4D9QE 5LQBL 4Z7VE 1U8JB 1PVHA 4QXGH 5D70L 3REVB 1X5GA 2MKWA 2CO7B 4KRMB 4PJXA 1FAIH 1PYWA 2GFBA 5EN2A 1XGQA 4H8WC 4M61A 4Q74A 2Z4QB 35C8H 4MCZB 1J05A 3NACH 3G5YB 1UYWH 2W9DH 4Y4KC 2BNQE 1ZAGA 1I8IA 5D5MB 5T1LB 2DJ4A 5ALBH 1NL0H 3N1GC 3IKCB 3DLQR 4Y5YC 1K3IA 1BEYL 1CL7L 5JMRA 1S7VA 4ALAL 3VH8G 3WNLA 3GMRA 3VG0H 2YOCA 2CLZA 1TVBB 2ZCLL 1WV7T 3Q79B 3L3KB 3ARVA 4KI5C 3TBTA 3NZHH 1QRNA 1F6FB 3AMKA 4KKAC 2ZSVB 2VXVH 1PKOA 2D7NA 1MCSA 1S7RA 4V1DB 2B4CC 4EEEA 4ERSH 4MXWL 1XCTA 4ZMAT 1OQOA 2X42A 2UWEF 2RFXB 1SBSL 3DMMB 2NYYC 3JV0A 1N3NB 5DSCB 4S1SL 4WO4A 4QLRA 5I30H 3QG7L 1NMAL 5CZXC 2AP2A 1KJMB 4JPIA 3V6OC 4ZSOA 1NCDH 1PG7X 2E7MA 4ELKA 1E28A 3GEWB 1F4WL 5DA4A 4R90H 2UY7A 4G6MH 3F58L 1KNOA 2EDRA 3KNBB 3IRPX 3WFCH 1ZA6B 4CVUA 1SVCP 5JZ7C 4ODTL 1ZTXH 5DRNB 5GRXG 4KVCH 2V7HB 1BFOA 3SE3A 3WSQL 4EVNB 3IGAA 3S8WA 3QCVH 5IV2B 4JFPB 3MRIA 2X1PA 4M02A 3GB7A 4HC1H 4CVXB 2W65B 5D7LA 1V5JA 4ZOCA 5E03A 4X5WA 3NAAL 2VN4A 4O5LL 1DDHB 1QHOA 3HR5A 4JPKL 3ARGA 4K07A 5FGCB 1DUZB 1HNFA 1LO5B 3QRFM 3WIFA 1ZHLA 4HCRL