4FXKB

Human complement c4
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 Beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
molecule tags Immune system
total genus 143
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 4fxkB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxkB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxkB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxkB04
1UZ8B 4NKDA 5J12C 5MERB 2X4NB 4P9HH 3DBXB 3F6LA 4MJIE 3WFCH 3G6JF 4P2OD 3EYVB 4OJFH 1YEIL 3IAQA 4F7PA 3G5YA 1ZT7B 4R96A 2NMSA 2YD6A 1JNLH 5D7IA 5EBWB 5HHVL 2HTLD 3SKOA 5DC4B 3IU4L 4HGKC 1TZHA 4IHOB 4QOKB 4AL8L 4MQXD 5CGMA 4HEME 4WTZG 4NOBA 3P9LB 4KK9C 1U8PA 4L5FH 2CLRB 2Q8BL 4JKLA 1XF1A 5FYJH 4MA1B 3B5HA 1AQKH 4XNXH 5I1LB 2R0ZL 5KSAC 4ODVL 4G8EA 4YGVB 2MWCA 1AD9A 5D2LA 1OP5H 4FP8H 4X6CB 2V7HB 3V6OC 4IMLB 4H8WL 1FJ1B 2FIKA 4NCC2 4E41B 3BISA 4NQVA 4P4KD 3GMRB 3IDGA 4PJ7F 3RVUC 1G7MA 5C86A 1XMWA 3S96A 2DJ4A 4WEBH 1H15B 4OFDA 1PVHA 4N90E 4BELD 2Q76B 4JFDB 4QOKE 5EIQA 1DFBL 3DYPA 2XN9A 2XQBH 3MA9L 2A2QT 4U1MA 4GG6B 4UBDD 3ZL4H 4P3WA 4DGYL 5AYUH 4N0YH 5B4MC 3O9WC 4KKIA 1C5BH 1KN4L 1RI8A 3CSYA 4XC1H 1J88A 4PJCB 4JQIL 4F15C 2HG5B 3RVXD 4Z95L 1MCFA 4LCWB 4HS6B 1Q9WB 3D48R 4XP6L 1RV6X 4MZ3A 5EIIB 4JRXA 4WI3A 2AXGB 3JXAA 3P11L 2YD7A 4X6CE 5IVZB 5E8EB 2F58H 2NYYC 1VESA 1TVHB 5E0QA 1M7DB 3TVMC 4PJFA 2GSGA 4E41E 3C08H 1VSCA 4CMMA 2D3VA 1FYTB 4HWZB 5AAWA 4WTZA 4MVBD 5FIEA 3V6FB 3S7GA 3O0RH 1NDGA 3OBAA 4JFDE 1KCLA 1H3WM 4E5XB 2ESVD 1I1AD 4GG6E 4UT6H 3JWDL 4M76A 4YIQB 1ZA3A 3VFVA 4CVZA 4EI5D 5DFVC 4NNXB 1Q8MA 4AENB 4PJCE 2VDPH 3DURA 3CU7A 1A7QH 1HINL 3EOTH 1V3LA 4LCWE 1WIUA 4ZOBA 4D0BA 3RWDA 5J56B 3DGCR 2WBJD 4DKDC 3A6CL 3SDDC 3QWQB 5F8RC 2W0LA 3IKKA 1CQKA 5IW1A 5A43C 1C12B 3FQUA 3LEXB 1BQHG 3QT2A 5E1AA 4TRPH 2X89A 4L1DA 4V1RA 1A7NH 2N7AA 1RUPL 3UDWC 4IMKA 3ULVL 3WYRA 4N8CH 3LKPA 3ECBA 2R29L 1GH7A 3AAZB 2Y4SA 3LQZA 4ELKA 4WTXA 1IKNA 5LCVH 2Q7YB 4OF5A 5TDOB 2RHEA 2OTPA 2Y36L 1A4JA 1C7TA 5EB9A 5F1NA 1AY1H 3RPIB 2F0YB 3REWB 4V1DA 5T1MA 1YEDA 3MGAA 5GS0C 4G7VL 2WAHA 1F8TH 1NCUA 4UUJB 3RUGF 1HHIA 4PS4L 4NBZB 1XF3B 2OJEA 5HY9A 4RAHA 1XZ0A 2YMXH 3IJYA 5B38B 1MRDH 4K3JH 5L2KB 1ZT4B 3UTSA 4LLYA 1EPFA 1T1YA 3ULSA 4WWKA 1UMPA 3WV0A 3QUZD 2ZJSH 2P43B 5CZXC 1OLZA 3G08A 5DI8A 1KEGH 3GSXB 2WZPD 1M7XA 5IEKA 2F74B 4M5ZH 5F3BB 1B0GA 1KYOJ 2PTVA 2EZ0C 1OF2A 1D6EA 4C56D 4H5SA 3VDBA 3AXLA 4FXKA 3DVNA 3K74B 5ALBH 1MCWM 2ARJA 1PZ5B 3QXDA 1FFOB 1MQ8A 5IMOB 2NY3D 3O45A 4NDMB 3DV6A 3K8MA 2YD5A 1FO0B 2H6HB 2H2PC 1JWMA 5DVLA 1I1CA 2DWEA 4O2CB 3NTCL 1HHJA 4MGXA 1BQHA 2NZ9D 4XMKL 1NAMA 3VGHA 5L2KE 5A2KH 4OT1H 3L7EB 2BNQA 4DW2L 4GKOA 4OLVL 4PRAA 4M6OH 2VJXA 5JIIA 4NQCA 2WNGA 4LK4A 4OGYL 3FOMB 5GGUA 3VXTB 4D0DB 3BYTA 2IADB 1QA9A 5MHSE 1FC1A 4WY7L 5L2JB 1S8DA 3ZSTA 1FQ9C 1SA5B 3E6FB 4M62H 4PLNC 3L3OA 4PG2A 4X7SL 3NN8B 4Y5VC 4FQ1H 3EJZC 1HKFA 3C2AH 3W2DH 3OX8A 2D7MA 1IKFL 3C5ZD 1RJLA 3NCJH 4R2GC 1J8HD 4QRQA 3SQOH 4M7LT 4HKBA 4O5LL 4L3CA 1R76A 4UDUB 2VZTA 4P5KB 5DEFA 3S4SB 3CAFA 3DUHA 5IB5A 3GO1L 1CLYH 2ENYA 1NGXB 4MWFB 1DL7H 5T1KD 4F9LA 3SHSA 1NGWB 3EO9L 3TP4A 5K59E 1CDHA 1CCZA 4F80A 4LARH 3TN0B 2DBJA 3BP6A 4HPYH 1N3NB 2YUZA 5I8KH 5HYSB 1FFNB 1TTUA 3D39D 3ABZA 1YMMB 1O7VA 4HDIB 1YN7B 2VLJD 1M4KA 5DVKA 2ZCLL 1IAIH 5AWNH 3X11A 4JFXB 2APXA 1Q0YL 2BY1A 1TNOB 2IGFL 2MPAH 3P0YL 3U0PA 2HFFB 4M4PA 5IVOA 5HHOB 2OR9H 3QQNA 3KPPA 5F9JB 4WHTA 5AG9A 4X9FA 4KK8C 4L8CA 2NY5L 1S9KC 2BRRH 3FTGB 1Q9OA 3MJ9L 3QIBA 5JOPE 4MD5A 3MNZA 1H8SA 4NZJA 4WI9A 4PG9A 2GKIA 1JGUL 4G6JL 4APQC 5BXFB 2DQUL 5HGAA 2YXMA 2A6JA 3T04D 1B88A 3IXTA 5FKPB 1SQCA 1IAII 1RPQA 5DURD 2P8MB 2WK2A 4KJQC 3WN5C 2F54B 4NKOB 1YMME 1C08B 4XVJL 5TFSL 3FZUC 1T22A 4KPHL 1D5ZA 1BQLL 1MHEA 2XV6B 5F7NC 3NVQA 2A9NL 1JYWA 3V4VL 2CK0H 1QOKA 4MHHG 5ICXB 2ZSWA 3BSZL 4ZO8A 1TJGL 1UXSB 1HZFA 4YDIL 5HHOE 4MAYD 3MX0A 3MCKB 4UINH 4YFLI 2FJGA 4LF3A 4QGYA 2DI8A 4KQ4H 4Y5XC 4AG4L 5F72S 1GC1L 2HRLA 4F57L 2MKLC 4WJ5A 3UPAA 1RK1A 3ARDB 1I1RA 3F7QA 2ADIB 1VCAA 1J0JA 1YEGH 4TVPL 1BM3L 2YK1L 1C5DA 1CGYA 3ARXA 4LIQH 2HMID 4X7CC 5BZDA 4XGZB 1DUYA 3VXNA 2LAAA 2J4WL 3P30H 5IHZA 2F54E 2VITB 1L7IL 4X9BA 9CGTA 1AGCB 3CFKB 3TNNB 5BVJB 1R3HA 4OQTL 5CJQH 4FTVA 1KEML 1VFUA 1W72L 2FHCA 3T08A 2X5PA 2YN3A 1A6ZB 3MRPB 3SPVA 1MQKL 2W60B 4PY8I 4NUGL 4Q6IA 1MLCB 1DBKH 2DM4A 4UV4H 4U6HB 1HHHA 2HH0L 2PXYA 2XIDA 5E9DD 5HI5C 1LK2A 5ENWB 5CGTA 5BVPL 3RL2A 1AQDA 3QHTC 2X41A 4P57A 5TE4L 4G5ZL 4PJBA 1MEXH 3ZLQC 1G7QB 3LKOA 4O2EB 2XG5A 3CDGB 2R23B 4H25A 3HS0A 1DUZA 2AK4B 4O58H 4DN3L 1EJOH 1G7IA 1DQJB 1DSFL 2RR3A 5DRXB 1FZOB 3VXUD 5IGXL 4POUB 4PLJC 1U8IB 4I9WD 4ODHH 2VKXA 2IWGA 3JWOC 3MRIA 5I16B 3EO0B 5KVDL 2Z8SA 3IXAA 4HWUA 1LEIB 4JG1H 5IVXA 3GMQA 4NRZB 4BH8B 1LK3H 1KV3A 1JNNL 4JVPA 4WENB 3HAEA 3NCMA 4U1IA 5A16A 5E00A 4KK9D 3SBWC 2XI9A 3G5XB 2ICEA 4P49A 5GRJL 3TBYB 4C57C 3B8SA 5IIEA 1KENL 4Y19B 2G2RB 5KS9B 5DO2C 4MDIA 1GXOA 5CILH 3TA3B 4KMLB 4Q74A 3QI9C 5TF1L 1IRAY 2AK4E 1R3LB 1A5FH 4PRIB 4IOSD 4Q2ZA 1S9VB 3TYGH 2ZOKA 3VI3E 4XBPB 5T33L 2O61A 3PQYA 1BAFL 3U0TA 3S36X 3BKYH 4NUJA 4RIRA 2FGZA 3HI1B 1K3ZA 4HIJB 2VIRB 3CFCL 4CJ0A 4LSTL 1WCBB 3SEPA 2I26N 5H8DA 1D5BA 3DX6B 3U9PL 3HE7C 5D7LD 4JG0H 3U36B 5CJOH 5GGVH 4Z5RA 3DSVB 1AGBB 1P4IH 2AV7A 2VE6A 5B4MD 4PJ5A 5D2NC 4EI6B 5IF0B 3KXFD 4KY1H 1M6OB 1VFOA 3FFDB 3W0WA 4Y19E 1JK8A 5KS9E 3JBG7 2AKRA 2IMNA 4XNQB 5JA9A 4X6CF 4D8PB 4Y5YA 2PYEA 4P0DA 5J6GA 1Q9KA 3RDTA 1YY8B 4PRIE 1GZQA 5EOQH 1LE9B 5L88L 2NYYD 1L0QA 1ZT1A 3TVMD 4UILL 3G9VA 1TXKA 5C7XL 1NFDA 3ARBA 1ZHLA 3FT3B 3BH9B 1JI1A 5BOPA 5HJ3B 4R6UA 1ZTXH 4JLRB 3RIFK 3RRQA 5I15L 1JTPA 1OAKL 2HT3C 1MJ8H 2HFGL 1BVKB 5KG9A 4GG6F 1IGTA 3ARQA 2VXUL 1OSPH 4HQQH 5FKAB 5D71H 3CVHH 4HAGA 2L4OA 2DL2A 3FB7A 4QXWA 5SV4A 4KDWA 3CDFA 4PJCF 2DLGA 4KTDL 4M8QA 3GMMA 1DN2A 2XKSA 1Z9OA 5J6HA 2FGWL 3CMOL 2J8UA 2P8LB 4G43B 2YSSB 1CE1L 3DMMA 2EDTA 4JRYA 3SDDD 5INCB 2Z93B 4HK0A 2VLKA 3ARFD 3IS0X 4JDVA 2B0SL 1L7TH 3ARUA 4MNQB 5CSZB 3V4PH 4BSWA 3VFPB 5KJRL 1GPOH 2DQEL 2V8JA 2DAVA 1XFPA 2XY1A 2R69H 4K9EC 3HXFB 1DVFB 3O3BA 1AD0A 5IROA 1O7SA 1CGSH 1YNKL 4NO0A 3CIQA 5ESQA 2P44B 3V7MA 4HUUB 2RIKA 4OV5A 1X7QB 4IRSD 4KROB 1T03H 4YHIA 4OM1H 1Z0NA 4Y2DA 1UB6B 3P4LA 3RY6A 3PG2A 3OKLB 4KAQH 2DICA 3TO4C 1OTSC 5GS0D 2DJUA 2GUOB 2NTSP 4G6ML 4UNTA 4XPFL 1D5MA 5CJ5A 5BV7C 4Z0XB 5D6CB 5CP3A 2YD9A 3VWJA 5GRZA 2J6EA 3LEVL 4ZAKB 2RQ8A 1WWCA 4DAGH 4R4BB 1FNAA 4I3RL 1K3IA 2GJ6A 4PYHA 15C8L 2C7UA 1KTDB 2XYCA 2VZ1A 1F90H 4YHLH 5CZXD 5HHXL 4RZCB 5L8KB 5FDYA 5HDQH 5JOFB 1UG9A 3MOQA 5E8PA 3MTRA 3SFYB 3BMVA 4ACPA 2NY2C 4H0GA 1R5IB 4JJ5B 2FYYB 1SEQH 1RZIA 4C55A 3MR9B 3T8XB 1RVFH 1U42A 4J4PC 1NBYB 1TVDA 1T20A 3UJJL 2BP3A 5FDWA 2IPKB 3CFIC 1UWXH 2HJLA 3DSFL 1MHPH 3NIGE 1I7ZA 4PRHA 4MCZB 4KRLB 5EU5A 5HVGB 3Q5OA 1YNLH 5SWSD 3ZSSA 4K3HA 3RZCA 1JTTA 4EIZC 4R26H 3PP4H 2BY0A 2QR0B 4LGSB 4WW2B 1HCFX 3WFHA 5CFHA 3RAJH 5HGBB 2EDQA 3SY0B 4YEFA 3QH3A 1G6RH 1HH9B 4LSDA 3BIAX 2A9MH 3CXHK 3O6LH 2XTLA 1J1XH 3A6OA 4LQFL 4BOKA 4M6AA 2EIDA 2VDQH 2MJWA 4KKJA 4OCNC 3PZ2B 1F4HA 1PX3A 4U4BA 4NC1E 3I6KB 4W4OA 4EQ2A 3HI5H 3OGCA 3EDJA 3DX9B 4K94H 1U92A 4JRWA 5JXEC 2FH6A 3CH1A 5I1KL 4CU7A 3NZ8A 3ULVE 4CADB 1RIVH 5K59F 4WFFD 4HUXB 1PYWA 5I17B 3MV9A 1VHPA 5CHNB 3TJHD 4X7TA 3HLAB 3BJLA 3EYQD 1K2DA 2J5LB 1IGJB 8FABA 4I18C 4OBRA 2WBWB 2X4SB 5EUOB 3L95A 4EXKA 3SCMC 3SDAB 3WLWD 2E7LA 1OM3H 3ARGA 1MZCB 4MHHI 4CVWA 1G9NC 4YXLL 2EDRA 3MRRB 4POYA 3MLUH 4X80H 3TWCL 4RBPK 2C4XA 2QQKH 3STZA 3VH8B 3TBVA 1GZPA 2A38A 1OPGH 3E8UL 4RISL 3D0VB 4RGNB 2CLZB 7FABH 1PD6A 5ELIA 3Q79B 2HAZA 4OCWH 3TT1L 3OXRA 4QYOB 2I9TB 2MKWA 2G0DA 4L8SB 2X7LB 2PCPB 2F53D 4WVRA 4WI8A 5EU4A 4NHUA 2YEZA 3PUCA 5TE7H 4BZ1H 1P4BL 1G7LB 2J7LA 4GRLD 1AR1D 2XZQL 1OY3B 1QQDA 1T83C 3IFNH 4JAMA 4NQED 5EUOE 3WFZA 2BX5A 1HQ4B 2BJML 2X4OB 2H6PA 1H3GA 5TQ0L 3CVIH 5CKGA 3NA9L 2RFXB 1EX0A 4YUEH 1AC6A 4QXGH 5GPRA 3VJ6B 3ZMRA 4ONTA 3GIVA 5LGKA 5DRZA 1OCWL 5K9OA 1AO7B 3J7HA 1DQLL 1OTTD 1PLGH 4UOJA 1QVOB 3VWKA 2L7UA 3LKNA 4PJ8B 2BC4A 1BPVA 2DLHA 1XAUA 1MCOL 4LGPB 4LEOA 4RGNE 2DKSA 5DVOA 3QHZL 1TN8B 1TJHL 4X9GA 2R0WL 3NH7L 1PQZA 4HC1H 2CSPA 4GW4B 1Q0XH 5C2BL 3MRNA 4WU5A 1VFAB 4G6FD 1OOAA 4ZUTB 1AXTL 5HVWA 1OGAD 2FX8H 1IVLA 1S3KH 2NY6C 3CFDA 3NFSH 2E27L 2JB5H 4M61B 4IS6B 4DKEH 1KNOB 4TUKL 4X6FB 4LNGB 3UEZA 1WVZA 1S7WB 1XR8A 2BVQB 3OTTA 1OARH 4OLWH 4WGWB 4O51B 1RJZA 2R9HC 5EN2B 4QRSB 1CLOH 1RD6A 4M6MH 5GIRB 5F1SA 2ZPKH 2J3SA 1AO7E 4P23A 3HC3H 1EUUA 1FAIH 3QQ4B 5E5MA 4PJXB 5JMOC 4JY5H 3WE6B 2V17H 4PJDB 1E27B 3FQNA 3MBXH 3MOBH 3GSNA 4RNRB 1XGPB 3Q6GL 5EU6B 4E42A 1F2QA 3IGAA 5I74B 2VISB 3E2HC 3KYMB 4I5BB 3X13B 3CMGA 5L6YH 2LTQC 4UU9C 4JZJA 1A6VL 1R5WB 3VD4A 4L8DB 3VXRA 4LLQA 2IFFH 2P45B 5F9OH 2CGRL 3MXVL 5CIPA 2R2HA 4CAGA 4PGBA 4DCQB 2LU7A 5KAQG 5EZLB 4WW1B 3NCEB 5LQBH 4JDTL 1F58L 3N1GC 4P46B 4U1JA 4KI5F 4M4RA 2VLRA 3H9HB 4FQLH 4NC0B 3MNVA 4NRYA 5CP3H 1YZZA 2FIRT 4I0PB 3O4LA 2J6EH 4XCEA 4PJXE 5GJSH 4PJDE 2AP2A 1DBMH 2WV3A 4MA1C 1JUFB 5EU6E 2D4FA 3X12A 2H6FB 2VDLH 5C07D 3CPLA 3Q1SL 1YEHH 1F97A 4R4NC 5D7SL 2WWMC 3IDXL 2IBZX 4NKMB 1MRFH 1W72B 4JANB 3QI9D 2VZVA 1KBGH 2DQTH 3O2VH 3NCYS 4P2OA 4NO3B 4TNVF 1BZ9A 3BAEH 4BH7B 5DQJB 4HWJA 3FQRA 1I9EA 4Z77A 2BXZA 2FH8A 4Y4FA 1BZQK 2K9UA 4RRPG 3D0LA 1HCVA 3D2UA 3MV7D 3KYKL 1JV5B 2UYLB 3H0TB 3QUYB 5I9QB 2CRYA 1FVDA 1DDHA 3C9NB 4JN1H 3HE6A 1J1PL 5KS9F 3UPCA 2CXGA 3O8XD 4R0LC 2DL9A 5EC1A 3OF6D 4CDGC 4R4FL 3DWTA 3OB8A 4RFEB 2I9LB 1ODAA 4X4MA 3MRGB 4GAYA 5EO9B 2XNAA 4XVUC 2BDNL 3CC5A 1ZLSL 3G04B 1AP2B 4PJIA 4XC1L 5KSBB 3L7FA 5GGRA 2P8PA 2QQLL 3FCTB 4KUCD 2BOBB 5MP6L 2ZNXA 2NW2B 1SBSH 4HS3B 4KRPD 1OW0C 2VXSH 4CW1A 1WZ1H 3UAJD 3VXSA 2B20A 1L0YA 4ERSH 2CUIA 5E8NA 3K2UH 5DD1H 1A1MA 2VN4A 1G7JB 5E6IA 3S97C 3CZFB 4KVNL 3O3DB 3PGFH 5BMFH 5JW4Q 1GXMA 1QNZH 3TZVD 2GAZA 5IW6A 3BRFA 4OCXH 5BRZD 2P5WB 1MFCL 1IGIL 1KJ3H 1X4ZA 2GT9B 3ARRA 3LMJH 5FYJU 5MEQA 12E8H 3OKOA 5J89A 5KSBE 3VW3L 3CCHA 3DRTB 1BZ7A 1I85A 5GJTH 5C9JB 2D31B 5DC9B 2C3XA 4AEIH 1JF1A 1UZ6E 1ZHKB 1JPFA 2X4PA 4P2RE 4ORGA 4QCIB 3PL6C 5JPNB 5GGSY 5JNYA 4N1CA 1DLHA 4ZSOB 5AUMA 1I1AA 5D1ZB 3MMEB 4YXHL 5D5MA 1X5YA 3MXWH 5HI3C 4QF1A 1HE7A 4RMRA 3CX5K 2WINA 4PFEA 1MWAL 5HYEA 1FYHB 4PB9L 3LS4L 3U46A 1RZ7L 4J3VA 4WRLA 1OTSD 2WLYA 1OTUC 2CJUL 4D94A 1T89C 2P5WE 1JWSB 5FUCE 5SWQB 3O11B 1QFHA 3HR6A 2YUXA 1BIIA 1M71A 4HKJA 3VD7A 1RIUH 3MCLL 2M26A 4L8BA 3ZDZF 3HPLA 1OAYL 4PJAA 4C54A 4RFOH 2Y06H 4S1RH 1EIBA 4FZEH 1NGYA 4YDKH 1NBQA 2XY2A 4U31A 1I1YB 5FGSA 2DD8H 5EWIL 3I9GL 1QSFE 4K3JL 3IKCA 4ZSOE 1BVZA 4PJHA 1N6VA 4L9PB 5C0JA 2CD0A 5KOMC 2F5BL 3CK0L 4HIXL 4IOIA 5L9DL 1KC5L 4M7ZB 1OAXL 4M9OA 4XVSH 2CMRH 1AKJA 4FQIH 43CAB 3MODH 5EDXA 4J4PD 5GISL 4AEHH 2AJZB 2H32H 3NIGF 2SEBB 1TZIB 1Q72H 3QCUL 4DVRH 3LB6C 3ZE2E 3QO1B 1NLBH 3KYAA 5F71A 4LLVA 2HTKC 3H6JA 4TUOA 1NJ9B 4N0UA 3OWEA 3RJ3A 4R7DB 2PO6D 3OKNA 2R2EB 1CZ8H 1S7RA 4QRPA 1NQBA 4HIEB 2P5EE 1VGEL 4QXUH 3WEXA 1H37A 3LV3A 4HZLB 3B6SB 3BN9D 5DQ9B 1PEWA 1QBLH 5ECJE 1AHWA 1BOGB 2HLAA 1XT5A 1LP9B 1C7SA 3MLTA 4HJ0D 5HSFA 2B39A 3W82A 3QG6A 1RUAH 2FATH 1A21A 3QJFB 2BHZA 1LWRA 3SDYH 1JGDB 5HD8C 3B9KB 3K4AA 4JO2L 4MNGB 5IJVA 4LHJB 1K9TA 1UFUA 3GBML 2FL5A 3TN0C 1U41A 2EDDA 2CKBB 1T1ZB 1T1XB 2D7TH 1N4SB 2ZUVA 3MRQB 1S5HA 4OZIA 5CP7B 3U0WH 2UUDK 3ZO0A 3GSWB 1E4JA 1BP3B 3RZWA 1OAZL 5IB4A 3P0VL 5EFIA 4WFED 1A9BA 4RQQB 3T65B 1KIPA 1JPTL 5ACZB 4ZUVA 3QUMA 2B7DT 3K7UA 2IAND 5DMJB 3FMGL 2DTSA 4NGHL 2OYPA 3TBWB 1LP9E 5KW9L 2X09A 4HIIB 2KPNA 3U79A 1MAMH 4HPOL 5C6TH 1LO4L 4QRRD 4MNGE 3BZ4B 3P4NB 2A0LC 4LSQH 2JJUA 4EEEA 4OLXL 1NDMB 3Q3GA 5T1KA 1NL4B 4LDOB 2CH8A 2WIMA 2ZOLA 5EUOF 4YXKL 4LBEA 4ONHA 5F96H 1CDBA 4Y16B 1RZKC 4L9LA 4KWUA 4NKIH 4F33A 1FNGA 1HIML 1FL5B 3LRSA 1RK0B 1U36A 3MNWB 1VEMA 4NT6B 3ZYJA 2KZ1B 1FDLH 3STLB 1AI1H 4O9HL 3ZT5A 1QFPA 2XFXB 3U6RB 4XPGL 5SWZB 4NBXB 4K23H 5KVGH 4LFHG 5J8OA 3O2WL 4LKXB 2EIZA 4KH2A 2V5MA 4NO2B 4FFYH 2UWEA 1HILB 4ALAH 1H3TA 3ARDC 1FNLA 3KSLB 3PDOB 2OMBA 2A83A 4N0FB 5MEOA 2DMKA 5EOCH 3MLXL 4ZUSA 3BXNA 3JV5A 1YPZA 1MJ7H 3MJ8B 3KYOB 4QRUA 3B3IB 4ZQKB 4MJID 3RL1B 4PTUA 5FF6A 1TITA 3FT2B 3ZE0F 1P7KB 1MUJA 5D6DC 3HNSL 5TF0A 2EXYC 4CVUA 4OZ4B 4KJYB 4X7EC 5L8JB 4KI5C 3T0ED 5DHYB 1KPRA 1F00I 5SWZE 5SX4I 4TUJB 1BVLA 1KIRB 1VPOH 3LN4B 1FIEA 1Q9LB 1L4IA 2GITB 4HKXB 5E94B 4JFYA 5EUKB 4XPAH 3GSRB 4GRWH 1FN4A 2GTWA 2OL3B 3BVNA 3MZTA 5JW5B 4QWWC 2FSEB 5I1AB 3RWFB 2MHAB 4WFHE 1K8DA 1UWGL 1KB9K 1QRNA 3QRGH 4OLYH 2G60L 1FV1B 3AUVA 3UBXG 3EOAB 2OR7A 1UYWH 5F3HA 5CEZE 5FO7B 2R1XA 3O3EB 2HYMA 2WANA 3LPFA 4TN9A 2QKIB 1QLRA 3DX7B 1F4YL 2NNAB 4HT1L 5DD5L 4L4VB 5CD5D 4PJXF 2VLLA 2B5IB 4JO1H 1FZMB 2KKQA 3GJEA 3SKMB 3MROA 3U2SA 5E9DA 2OTUA 3MREB 4LPCA 4L4TA 1FL3A 3ZKXB 5DMKB 3FN0L 3WXWL 1I8MA 4F58H 3TA3C 4S10A 3RVTD 4HWEH 5JLZB 4JG1L 4JREB 4S1QH 1U58B 4S2SB 1TN7B 1KJ2A 1QBAA 4I77H 1IEHA 4A6YB 1T4KB 4K7FA 1HDMA 5IR1A 1W0WB 1F4XH 3WL9A 4E41D 5LGHL 2X4TA 3NFPB 1NCDL 2D9QB 1FSKB 5DJXA 3FRPG 5DSCA 4JKPH 1N4XL 5EO1B 3I6LE 1VDGA 4L4VE 4JFDD 1EO8H 3AROA 4LRNL 3TYGL 1CR9H 4ODXB 1DQMH 5DJ0B 5IG7A 4K8RC 5DD3H 5IJKC 3MRCA 1NCBL 1A02N 2JCCB 4PREB 5JTWA 3QXWA 3ARVA 2ATPB 1NGZB 1IEBB 1DE4B 1SEBB 3ET9F 3A6BL 4MCYB 1D9KA 3VGAB 3U9UB 5TJWK 4EDWL 2NX5A 1UH2A 1KXVC 2DBLH 5KSAA 1NAML 4TTDC 1I3GH 1ORSB 4NQXA 4OCRH 4XVUD 2ZUXA 3V8OA 1P4IL 3V6OA 3HTLX 3AU1A 5TDNA 4KY1L 3MLPA 2QQNL 5I8EB 4X5XA 1HYRC 2XWJB 4DUVA 4Z76B 2FR4B 5T3ZE 3P4MB 5T1DH 4ZXBB 4Q9BA 4QT5A 1YNTA 5I30H 3MRHA 1FYTD 3LIZL 1PKQA 1RULL 4FQ2H 1CVSC 3QFJB 4KZDL 4NZTH 5CMAB 4OLZL 3IETB 5D7LA 1CDIA 3ULUH 1I7UA 4TSCL 1G7PA 3MACH 2VABA 2CQVA 3F7RA 4R97B 2JCCE 1MF2H 3O9WA 4G8GA 4AM0A 2IBGA 3PIQB 2C1PB 4GXVL 4U1GB 1P4LB 2XRAL 1FGNH 5DXWA 3QEGH 5TQ2H 2BMKB 5BO1H 2ZUQB 5CEYA 3GHBL 1OP9A 4LPXA 4KMQA 1ACYH 2VH5H 3KPNB 2BSSA 4F37F 3D25B 3QWRA 1BBJB 1ITBB 1UZ6F 3KPSA 4IRZL 3TVMA 1NC4B 3QUKB 3FRPA 3Q6FA 1DVFC 3MC0A 2VRAA 4XVTL 4KC3B 1SYVB 1RU9L 3VDCA 4UAOB 1KB5A 1FC2D 4H26B 1LVEA 3MV8D 4Z7UF 1ED3B 3QFJE 3F58H 3UJIL 4HFWB 4KROC 4M7KL 4KZEL 1TCRB 2X9XA 4M7JH 3QIUD 4PLKD 3UYRH 1A7PH 4NN7B 3OKEB 4PJBF 5T1LA 4ZNCD 5D8JL 2E6PA 2FB4L 1W6KA 2V7NA 4OGAD 2DLIA 4X99A 4AMKL 5FYJE 4JFFB 1CGSL 2W59A 4ZFOB 4XBGB 3S37L 3WDJA 4LDLB 1FZKA 2VDML 2O5ZH 4QTIH 3GSVB 1OTUD 3UXFA 4PJEF 5A2IH 1A3LH 3TBSB 4WI2A 4GAGH 2LVCA 3H42H 3GI9H 1IBGL 4ZNEA 5DD6A 4KAQL 3LS5H 5DD0H 4XCFH 1TLKA 4QNPF 3WKNA 4DKFH 1U8LA 3A67H 3UDWA 4H1LH 4X4YB 3PGDA 1T66C 2ZG3A 2EKJA 4NC1C 3KAAA 1F3JB 1JHLH 2R2BB 3WLBB 3QRFM 1F90L 2EH8H 5F8QC 4JFFE 2ADGB 3OR7B 4P3DA 5JXAH 1LEKA 2WWKO 5ICZA 5DJZB 1DBJL 4Q9CA 3GBNH 4Q9RL 5D72L 2IG2H 4GKSB 1BLNB 3ZE2F 4YDLB 4X4ZA 4YAQA 1YDPA 4P4KB 1I9IL 4GW5A 5DJ6B 5KSUA 3LB6D 4MA8H 3P73A 4FQJH 4WW2C 3GJFK 1QHOA 1DBBL 2XKUA 3SGDH 4JFEA 2C3VB 4LOUD 4Z78A 2HTKD 5LGJA 1A9EB 4Y8AA 1IZKA 1MREL 3HG1A 1MI5D 1IGYB 3EOBB 4BQ6A 1FH5L 1JN6A 3LQAL 4Z6AT 3DRQB 5I1CL 2D4DA 1QPXA 4PRBA 5ALCH 4Z7WB 3RJQB 3S5LA 5IB1B 3BPOB 2V5RA 1S7TA 2E3VA 5M95B 1RUML 4RSVA 2HRPH 4ZFFB 1BJMA 1IEAB 3GMPB 1TMCB 4CN6A 1F4WL 3N1QC 2J5LC 3TN0D 3QEUB 4LLMA 1FLTX 1S7SA 3SDAC 1YMMD 3OXSB 4YK4B 2ESVB 2ORBH 5ITBH 1AH1A 3V5DA 5DT1H 3FB8B 4LASL 1AE6L 1RHHA 3BD4A 2Y5TB 1A2YB 1E6OH 4JPVL 1VACA 4Y5VA 5HHOD 4LP4A 2NTFA 1JF5A 4HBCL 2WBJB 3RGVA 5AEAA 2KQMA 1V05A 3OKKB 4RGNC 4Z7WE 1R0AL 1T04B 3WDHA 1FNEA 4U1LA 3IJSB 4L8SC 5HYQA 2Q20A 3IDMA 4IOFC 2R2CA 3QULB 3RWCA 5K9QG 1EAPA 5EBLA 2W38A 4PV8B 5I1GH 4X6EB 1KJVB 1HQRA 5F88A 4C83A 4N68A 2P24A 5FM4A 2EYTB 4JN2A 5E8DL 2I60H 1X6NA 2EICA 5TDPB 2GY5A 4J6RH 4I4WB 2IH1A 4X7DC 4R90H 2AK1L 1RHFA 2ESVE 2DQFB 3S35X 4MS8C 3MJ7B 2WWKT 2E7HA 4NZUL 5A3ID 5I71C 5LBSH 1T3FA 5MENA 4JQVC 1U8KA 4PJ8C 1YYLL 3ZKNC 3SDCB 2FJHB 2CDFB 3BP5A 2HN7A 3T4YA 4YE4H 3RI5K 3CVIL 4DQOH 3MLYH 4N8PA 3MBEC 1QTYT 1KPUB 4MD4B 3GMOB 2VYRE 2DQJH 2F53A 1P7HL 1AGFA 2BCKA 2A6IB 3BD3A 4APQA 4WUUA 2Z31B 2GHWB 4PBWD 3SKOB 3RU8H 5LXGL 5JW4M 2MTPA 1PLGL 2KBGA 3AB0C 1XGYH 4M3KB 1TZHB 3PWPB 4YDVB 2PW1B 1IM9A 5FHAL 4EBQL 1ZANL 4U1SA 4JHBA 2Q3AA 2XZCL 3WN5A 1C5CL 1U8PB 3UBXI 3MUJA 1B0RA 3JTTA 1S5IH 3PDDA 43C9A 4CUCA 2R56H 1MFAL 4K71B 2AAVA 3C8DA 4LHUG 5D2LB 3LN5A 4G80A 5MEPA 2JB5L 5GHWH 4NPYB 4BK5A 6FABH 4FZ8H 1UEYA 3GNMH 4DEPB 4KKLC 1TPXB 1HSBB 5E4EB 4BQBA 4Y5XA 1INDL 2F8VA 2DKUA 5I8CB 2H3NA 4NQVB 2Y23A 3W9DA 3IDGB 1F02I 5J9PB 3SKJL 1G7MB 1M05B 1ZK9A 3S96B 3MRJA 4YHZH 1FAIL 3BJ91 3HRZA 4NJAH 1JPSH 1UACL 5SX5K 3INUL 2E5EA 3PWPE 4GAJH 1WISA 3MRKB 1G9ML 4M02A 4U1NA 4WU7A 4LAJH 1D5XA 3EIFA 4MDJA 2XN9B 4XC3L 1NBZB 3HMXA 3NIFE 4MXVE 3CSYB 4P46C 1S7XA 3G6JA 4U6XA 1KGCE 1B4JL 3PHQA 5FCUL 3EUUA 3QDMD 5KZCD 4LCIH 3SGKC 1CD8A 35C8H 3FRUB 2DTMH 5IOPB 3V0WH 2AGJL 4EOWH 5D2LE 5EZOL 5DTFB 2IALA 1INQB 1SJEA 1A1OA 4J3XA 2GSGB 4ETQB 1RUQL 4Y19D 4CMMB 5BS0D 5I1EL 3HR5A 3TA3D 3P77A 1TETH 1LDPH 1QFWM 2J6EL 2NQCA 2VXVH 4UIKH 2X4RB 3N0PB 4PRID 3UTZA 3BT2L 2XN9E 5C0CA 3KPTA 2VDLL 4HHAB 1X6LA 1N7ML 1ZA3B 4TNWF 4CVZB 2NY0B 4OQ1A 1ERNA 2Q86A 2DWDA 1A6TA 5E2UH 3EYSL 3F6IA 4LVHC 3DURB 3RY4A 1NMBH 3FFCA 4PJ7A 4D0BB 3RWDB 3QUYC 2NCMA 4KKAD 2X1WL 1TNUB 1IFHH 1WQVT 4ZD3H 4YBLC 3BHBA 3QEHA 2ID5A 3MPCA 4K8RD 3CH8A 4PTTA 3FQUB 1N26A 2YPVL 3SBWA 4HMEA 1CTNA 3MLVL 3FO0H 1UENA 2E9IA 4TULH 5B39A 3L5HA 1JRHH 4LSPH 5IUSA 3EYFA 3KJ6H 3TGXA 1S9YA 2AABH 3LKPB 3ECBB 4CJ1A 4FMKA 4MD0B 4OZHB 5EBMB 3MRDB 1R6VA 3VRLE 4NYLB 4LIQE 3V0VA 1V3KA 2R0KL 1N59A 2CR6A 1TJIH 4F2MA 5F89A 1T0MB 4Z7QE 2E7MA 2AI0L 5FA3A 4P2QA 3ZKQD 3GI8H 4KUZH 1CICD 1JNHA 1KACB 1SYSA 3I50H 1YN6B 1RMFH 3SDXF 5ID1B 1MOEA 4LRIA 4W81A 5HY9B 4MB4A 3VA6A 1XZ0B 2F5AH 3HNVH 3HE7A 1JHKH 4QKXB 4QRTB 3EGSB 5C0AD 3UTSB 3VFSB 3PABA 1AIFB 3ULSB 3WUWB 5D2NA 1SBSL 1E4XH 3BEWB 1KCUL 3G08B 2PTTA 4TOYH 4GMTL 5E56A 5FUCC 4AJ0A 5I2IA 4MX7B 2O5XH 5IEKB 4LEXL 1B0GB 1OD9A 4OZHE 3IVKA 4M1GH 1UKSA 2EE9A 1OF2B 3MJ6A 4H5SB 4FXKB 1YC7A 3WO3B 3PZ1B 4XXDA 4MNQD 1TNMA 3UROR 1WWBX 4AIOA 3WD5L 4X5LA 1XIWC 4TSBH 3S35L 3WIIL 4OCXL 2VAAA 1EZVX 1DVFD 1JWMB 4HG4K 4LAQH 3P4OA 3WHXA 3LKSA 4MA3B 4JFOA 1X5KA 1E4XI 3BH8A 4OFPA 4N1EA 4CVXB 1IC1A 4KK5D 5GRVK 1YEIH 4AEIL 4B7LA 4N8VG 5CCKL 3JUYA 4R7NA 4PRAB 2G02A 1KJMB 4NQCB 4QHUA 2VDKL 3IU4H 5GGUB 1IC4L 5BRZA 2XKNA 3QYCA 4AL8H 3VXUB 3RUGA 1S8DB 1E28B 2N4IA 3ARTA 1A1NB 3T0WA 2ZKHL 2EYRA 3B2UD 3L3OB 4LPYA 2Q8BH 4O2FA 4OLEA 1G6VK 3N1MC 4ZAKD 1KT2A 2B4CL 4L3EB 1GRWA 3IF1A 2MNUA 4G9DA 2R0ZH 5EO0A 5EU7E 4ODVH 1RJLB 1QO3B 4QRQB 1T0NA 3BWAA 5DJDA 1LHZA 3EHBC 3V5HB 5CD3A 4H8WH 5DF0A 3CVHB 3IT8D 4RFOL 3QQ9D 5DEFB 3MJ9A 4Y1AA 5IB5B 3TC9A 4R9HA 4NQCE 3C6LC 3IFPA 2NXZC 5I1IL 2D2OA 3TO4A 3GUTB 1KSRA 3V2AR 1UXWA 3VXUE 1DFBH 2GJJA 4X8JA 3ULVD 3MA9H 5GRWA 4DGYH 4OD2B 4Q0XL 5ESVA 1CD1A 4FNLL 4F8QA 1KN4H 1ZA6B 3U0PB 1X5ZA 3QIWD 4JQIH 2ZIRB 1ZVHA 4L3EE 5FO9A 4JJHA 4Z95H 1JGEB 4C4KO 1CYGA 2EC9U 4L8CB 5DFTA 4GT7A 3AGVA 3QIBB 3OMZA 3MNZB 3P11H 3OKYA 5DDHB 4N8VA 5A1AA 3OJMB 4RMQA 4HUVA 5JDSB 4ZUUB 1FG2B 4I48B 1OGTA 3KXFB 5HGAB 2A6JB 3QNYA 3GSNL 4MNHB 1KYOK 3HMXH 4FQQA 4J4PA 3B9KC 5FGBC 5EBGA 5E8OA 4YDJB 4UQ2A 3JWDH 5K9QI 1A6AB 4XB8A 1G9EA 4WHCA 1A0QL 4KTEL 1ZVSA 2W9DL 1WC7B 3L9RA 3PWVA 1HINH 4XP5L 1PGRB 4YBQD 2BSTA 2JK5B 4X8XA 1WFOA 4LF3B 3A6CH 5CINL 4ZUWB 2CRZA 5HPMB 3BP7A 3SE3C 3GEWB 4D3CL 5EZJB 1TIUA 1UADC 1O1RB 1EHLL 2NY4D 4WJ5B 1RK1B 2OK0L 3KXFE 4Z7WF 2DLFL 3N50A 1HK6A 1RUPH 1MFDL 3VI4E 5BZDB 5IB3A 1T7ZA 3PJSA 3ULVH 5AGDA 1XGUB 2R29H 2Z92A 5KVEL 2B8OT 3FAXA 5JXEA 5DJ8A 5KSVA 3ARFB 5FUZL 1PG7L 5JW3L 2PF6A 5FCSH 1U8MB 2Y36H 1A6PA 2AQ1A 4RAUA 2C1OA 1GOGA 1I9RL 4F7TA 3SPVB 4Y16C 4G7VH 2DKMA 1H3BA 3Q48A 2IAMB 5KTEL 4I18A 3K8LA 3MGTA 4KDTC 3SCMA 1T5WB 3EDEA 1AQDB 1G6RB 5A2FA 1NUGA 2DQHH 1DBAL 3M17A 4MS8D 1ETZA 4F3FA 2Z8RA 3IDUA 3RKDC 1AO7D 4H25B 4HF5L 2CLVB 1DUZB 4GW1A 4AIZA 1S7VB 3VFMB 4ODBD 2OMNA 4M3JA 4PJ8D 3ZKND 4RWYL 2JIXA 5FGCE 1LO0H 5C0BB 4C4KT 4MQ7B 3FO9A 4JZNB 3TIDA 4PJ9C 4EJ1C 4HAFA 3MRIB 3MRBA 5DWUH 4OZFG 3JV6A 3PWLB 1B0WA 6CGTA 2YRZA 2ITCA 5IVXB 3GMQB 4PJHF 4H20L 1T83A 5C08B 5JIPA 3FQWA 3LQMA 4RMWA 5E00B 3NTCH 1BECA 2EDWA 1MCWW 2WM0A 3LAFA 2OBGA 5T5NF 1O79A 1CK0L 5GZND 3RVWC 3RWGA 4XMLH 1IQWL 4LKCA 2CIIB 5J1AA 4DW2H 1QFUL 4OLVH 5HGHA 1ZSDA 5C3TA 5F1IA 2GFBA 4OGYH 1A7BA 5GS1B 2H2SD 3O3AB 2ZOKB 5C8JB 1UWEL 1H5BC 2O61B 4WY7H 5DRNA 2IQ9H 2NLJA 3KYNA 4KKLD 5C0BE 2X70A 3D5RA 1S9XB 5SWSB 4QHKJ 1ADQA 4X7SH 4FQXA 3DX8B 1K4CB 1JMXA 4UOW1 2DQIL 3HZKB 3NIFF 4XPAL 3G5ZA 4GKZA 4XMPL 5IVXE 1IKFH 4MQTB 1PEZA 4MJIA 1ZOXA 4N0CC 5C70A 5C08E 1ZVYA 2VQTA 3LHPL 2YPLB 4EUPG 1DQDL 3IB4A 4O5LH 3VXOA 3M1BA 3CUPB 3ZZ1A 1FIGL 4PJ5B 5D7JD 5F7DA 1BX2A 5D1XC 5HI4D 4X6BA 2WSKA 3FB5B 3MFFA 3W0WB 1W8OA 3GO1H 4KQ3L 2A6DB 2B5IC 4LMQI 2AKRB 4OUUA 3EO9H 4NBYB 4YZFE 4RBPH 1A3RL 3T3ME 4TVSa 4I0PD 1FFPB 3H9SB 5FECA 4RGOL 3ZKXC 3L3KA 3NGBB 5IMMB 2ZCLH 5T3XH 3U83A 5DK0B 4OZFA 1NFDB 4JREC 1K6QL 1ZHLB 3ARBB 5SWSE 1Q0YH 4ZMAT 4UU9A 2IGFH 3P0YH 1RZFL 1A6WL 4JQXC 4AK1A 4IS6A 5KG9B 1UZ8A 4KHXL 2X4NA 4U33A 3DBXA 5GRUL 2NY5H 4OI9A 2EKSB 3MJ9H 1M7IB 3MGOA 4GRMB 2YPLE 1LO5B 2OXGA 1ZT7A 3RWHB 1NC2A 4M8QB 4LSSL 5I6XB 4G8FA 2KDGA 4HGWB 1FSKC 5EBWA 5I73B 4PJ5E 1JGUH 4G6JH 2QSVA 1WV7T 1T6VN 2DQUH 3UTOA 2H6GB 3W0WE 1MCIA 4MQSB 4IHOA 2J8UB 3MLSL 4QOKA 5JW4R 4X98A 4OFVA 5TE6L 1H9VA 2BY2A 3H9SE 3N1FC 5JA8B 2LU3A 4A2LA 2CLRA 4XVJH 4NM8L 3NZHL 5TFSH 4KPHH 1BQLH 3VGAC 2ZUTA 1CFNA 2A9NH 5I1LA 3V4VH 1NFDE 1CFQA 1KTRL 5DUPL 4GRLB 5CAYB 4YGVA 4DVBB 3VRLF 3O3BB 3BSZH 1TJGH 2Q7NA 4YDIH 2V5TA 3PNWB 5ESQB 1K8IB 4X6CA 1Z2KA 2V7HA 4EUPA 3MFGB 4OV5B 4XNYL 1RAMA 2APWA 2RB8A 3U30B 4P9HC 1H3AA 4Z7QF 3D3VA 4AG4H 1UB5B 1G7HB 1GC1H 4E41A 4ZXBC 4EVNB 2D0FA 1EXUB 3CFBB 4WHYG 3KGRA 1H15A 1FFQA 4TVPH 1BM3H 2YK1H 4JFDA 2J8UE 5DK2B 4GG6A 3OHXA 3VXMA 3F5WB 2J4WH 1S9WA 5HYFA 4R97C 3VWJB 3NABH 2IPTL 1L7IH 3AM8C 4U1GC 4OQTH 4PJCA 4D4AA 4DTGH 1KEMH 2HG5A 2ED7A 4XCCL 3T1FB 4LCWA 1H8NA 2C26A 1W72H 4HS6A 3RNQB 3RVVC 4R0LA 4G6FB 4NZTL 1NEUA 4OZHF 1RZ8B 3S9DB 5EIIA 1MQKH 1CLZL 2AXGA 1BD2D 3ES6A 4YNYA 4NUGH 2WQRA 4YBHA 5IVZA 4PBVC 4WO4D 3DI3B 2W0KA 1VEOA 4OBSA 1N2RA 2HH0H 4YLQT 2V3NA 5BVPH 5DMIL 5TQ2L 4UAOC 1IAIM 4G5ZH 3I3BA 3VGFA 1RZIB 5JQ6L 3G6AB 4HWZA 1HXYB 1E4WL 5DJ2B 3V6FA 1BBDL 4MLSA 1T20B 3LOWA 4NOFA 4DN3H 4NN7C 1OW0A 1LO3L 3QUML 5D1ZD 1DSFH 2OP4L 4YIQA 2HJLB 2X1OA 1ZGLP 4HW6A 5IGXH 1IILE 3QDAA 2LABA 3QO0B 3B5TA 1I7ZB 2O5YH 1CT8B 5EU5B 4AENA 3VFUA 1QZ1A 1VFMA 2WP3O 2W0PA 5KVDH 4RX4D 4M7JL 1OGAE 1CQYA 5B3JE 3RIAF 3ZKMD 1U8NB 1JNNH 4N1HB 3K80A 1C12A 3LEXA 2HTLC 5C0IB 5GRJH 2MQ0A 5KBNC 5BJTA 3QDGB 4MQXC 4ZDHA 3U7YL 5E7FA 3OGCB 1J18A 1CF8L 1NKRA 3RWJA 5TF1H 3PL6A 2OI9B 4OCYL 2Q7YA 1R24B 5I66A 1DQQB 4EDXB 1MVFA 3NZ8B 5A40E 2YXFA 5T33H 1BAFH 4PBXA 3S98A 2VDOL 3RX7A 3EHBD 3CZJA 4NHCL 5ESAA 3DPYB 2DM2A 3CFCH 2GI7A 3OB0K 4UUJA 5C0FA 1K2DB 3K0WA 4FXGB 4MMXC 1ZMYA 3OV6A 4LSTH 1XF3A 1CXHA 1QUNA 2IMMA 3QFDA 4M00A 3U9PH 5JHLL 4YDLC 3C5SB 4P4KC 5L2KA 1ZT4A 1IQDB 4D9QD 2AJ3B 2X4UB 1EEUA 1NUNB 1BF2A 3ARGB 1S7UB 2QSCL 1ZAGA 2EH8L 3Q5TA 4Y8DC 3WSQL 3AVEA 2HFEB 4F7EA 3QDGE 3GSXA 3MV7B 2VWEE 3BGFB 3IDIB 4G42B 4LLUB 1H3PL 4UBDC 3SOBL 3STZB 2F74A 5E1HB 1TVBA 5F3BA 1QHPA 3W81A 4U0QB 1CDGA 2AVGA 4X9HA 3OXRB 1SVZA 5L88H 3RVXC 1PZ5A 3W11D 1FFOA 5IMOA 2V2TA 4UILH 4NDMA 2RAMA 5C7XH 1RZJL 4I0KA 1FO0A 5C92A 1U6AL 2EE6A 5I15H 1OD7A 4JB9L 1OAKH 4JAMB 3PZ4B 3TCXA 1YJDL 2HFGH 1BIHA 4TPRL 2VXUH 3WJLC 4HUWB 1LE5A 4KTDH 2Q1EA 4MVBC 1FLRH 4XX1E 1FBIL 5ALCL 4DZ8B 3UPRB 1KFAL 3FOMA 3U4EB 4YK4C 4D0DA 2FGWH 3MV7E 2IADA 3CMOH 5LG1A 5L2JA 2BC4B 1CE1H 3E6FA 4EI5C 5FYKL 4LEOB 2WP3T 3RNKB 3MUZ1 3QSKB 4PP1C 3RTQD 1U8QB 3D9AL 2B0SH 4KMTL 3VI4F 1EK3A 5I75B 2WBJC 2DQEH 3QXUA 3Q78B 3DTXB 2DDQL 4GKNB 2DIJA 1IC7L 1A6UL 3QDJD 1YNKH 2L7JA 5B21A 1HOCA 2AV1A 1T0PB 3DUSA 3Q7AB 2DN7A 1V3MA 2H32B 1XR8B 2HLFD 4XI5D 3BI9X 1KJ2L 3FHAA 4OAWB 4BFIB 1NGWA 4LGRB 3S6CA 1O1SB 3RWIB 1I3UA 1ZHNA 3O41B 1N3NA 2ENSA 3RBSA 1FFNA 2DB8A 4HDIA 5E95B 2EYSB 1IT9H 1YN7A 4G6MH 4XPFH 3FQNB 1KCRL 1N64H 4E42B 1N6QL 2VMFA 4ZPTB 1JYNA 4JZJB 5SWZD 2MOVA 2HFFA 4P39A 3LEVH 1GGYA 4LLDB 4OZGF 3BE1L 5HHOA 5F9JA 3SDCC 5MI0B 3R06A 5J57B 4I3RH 4OF6A 5CIPB 2FWOA 15C8H 2DM7A 5DHVA 4MB3A 4G8IA 1J12A 2AXJA 5HHXH 1HYSD 2FX7L 4JCLA 4ZPVB 5H35B 2YA0A 4LPVA 4GTRB 1CXIA 4NZDA 2Z31C 3QUZC 5BXFA 3JWNC 3U4BL 3S88L 5I19L 3TNMB 3O3UN 5FKPA 2VLRB 1YYML 5D7KE 4NRYB 2IFGA 1O0VA 3KHOA 2F54A 5HHPB 1OQXA 3O4LB 1MJJB 1T2XA 3UJJH 3KVQA 2IH3B 1D5IL 2EO9A 2I24N 2OJZL 3UTTD 4K71C 1DZBA 3DSFH 2XXMB 1CU4L 1UXSA 3RVWD 3KPQB 1V3JA 4DEPC 4DOHB 1TPXC 5E4EC 4WHDA 1S5IL 1LD8B 5HYJD 1F11A 3ARDA 4LQFH 2X9WA 3SQBA 3FQRB 2ADIA 4X6DF 4EN3D 5J11B 1T5XB 3D0LB 5K93A 4S0SD 2VLRE 3DXAD 4FZ8L 4NM4L 2UUDH 4XGZA 5AYQA 2WLZA 1XGQA 1H0DB 2PO6B 4MJ6A 1RIHL 5DZNA 1P69B 2RCSL 2BRQA 1FVDB 1HWHB 1DDHB 3Q5YA 5FYLL 1AGCA 3CFKA 3TNNA 5BVJA 4W6YB 3ZTJH 1KB5L 5I1KH 3K1DA 2F8XC 4KJPD 4KKBD 5D6DA 1JPSL 1A6ZA 3C5ZC 3CJJA 4P59L 1Z5LB 3QEQD 4XPBH 5M94B 5ETUA 3RJDA 2OQJA 1MLCA 2XNAB 4WHYH 4DOHE 4BZ2L 4PJIB 3I3EA 5DA4A 5ENWA 4MLIA 1K5NA 2WUCL 4XPTL 3DETD 3KQ4A 4LCIL 5HDBE 1O6HA 3CDGA 4UT7L 2R23A 2AK4A 4YXLH 1YECL 4QHKI 1OWWA 1JZ3A 4HXBL 1DQJA 1F6FB 5DRXA 4CW1B 1T7WA 3TWCH 1FZOA 4NRXA 3VXSB 3T2OA 3HUJF 4MAUL 3E8UH 1JI2A 4RISH 5E8NB 1U8IA 2FZ3A 5IMLA 3JTSB 1MFEL 3TT1H 5E6IB 4FQCL 5I16A 4E9LA 5IW3A 3EO0A 1NI1B 1RJYB 2BSRB 4AEFA 2B1HL 5L7XL 1PBYA 5IW6B 3QUXA 3L3IA 4NRZA 5FM5M 1VGKA 3T1WA 3A0OA 1QRKA 2K7PA 1R5VB 4IDJL 5F44A 3G5XA 4G3YL 4PJIE 2LQRA 5MEQB 3TBYA 5GS0L 4UB0L 3CCHB 4GRWB 3MLZL 5TQ0H 1NSNL 4Y19A 2G2RA 5KS9A 1HKLL 4IMKC 4PY7B 3TA3A 1JP5A 4PGDB 5DUML 3C6SA 4LCYB 1CI5A 1OCWH 1XGRB 5C0RL 5IHUH 5JNYB 1DQLH 4XB7A 3SJVA 1S9VA 4XBPA 2JF1A 1HXMB 3ISWA 4WDIA 3QHZH 4QF1B 1MH5A 1TJHH 4HZAA 4Z7OE 2R0WH 3VFGL 2AABL 3NH7H 1UGNA 4MAYC 2X4QB 4OFKA 4YHKL 3U46B 1ZEAL 5C2BH 1WCBA 2J88L 3GJFA 1UVQB 1AXTH 1UJ3B 3DX6A 1R3KB 5FGRA 2EDBA 4U1HB 3WHE0 2E27H 1M71B 1QLEL 2NY1D 1R3IL 5IJKA 2QHRL 4TUKH 3CD4A 5BZWB 4QRRE 5IF0A 4GRWE 3HPLB 3FFDA 4KUZL 5FYJD 2HMIC 2W9EL 1E6JL 3MLRL 5F1OB 4PGJA 2VNCA 4JM2D 4NWTL 4XNQA 3TV3L 3RVVD 1KZOB 4D8PA 3TFKD 2HJFB 3BMWA 3OL2A 1YY8A 3C60D 4OKDA 3G5VB 5H94A 1LE9A 3MV01 3LH2L 1OAUL 2R8SL 3L6FB 1GIGL 3K4ZA 2LFGA 2GSIA 1SMOA 4IOIB 5EU7C 3FT3A 3T0EB 3QR2A 1A6VH 3KPRD 4OM0L 1BVKA 3M45A 2CGRH 3MXVH 4H0IA 5FKAA 3BEVB 5HGDB 3FHQA 1DCLA 1O1TB 1HI6A 3O2DA 2ITDA 3X17A 4GS7B 1T2JA 2CKNA 3PF2A 4KKCC 3OG4B 4JFFD 5D93B 2P1YA 4JDTH 1F58H 3WIFA 5B3JF 4FQHB 4LLVB 2P8LA 4TUOB 4G43A 1SMAA 2QEJA 3OG6B 3OKNB 4JGUA 3ZDXF 1S7RB 3BKJL 5INCA 3HZVB 2ZZUT 2Z93A 2PYFA 4QHLA 3GSUB 3VFPA 3LV3B 5ID0B 1KPVA 2OSLB 3F7VB 3Q1SH 4UTBL 4XBEL 3T0EE 1JGVH 5DHVH 1DVFA 1EEYA 1J10A 4JZOB 4NQTA 5D70H 2HLAB 5D7SH 3IDXH 1E4KA 3QG6B 4HUUA 3UP1A 3DSNA 5DLML 3DECA 2R15A 3QQ3A 4GTSB 2FL5B 2ZG1A 3OKLA 4OB5L 1NGPL 4ZS6C 2GUOA 1S5HB 2W91A 3UX9B 2GYSA 4Z0XA 3KYKH 5D6CA 3ZKSD 4BQ9A 1BF8A 1OLLA 1B2WL 5EFIB 1A9BB 4FN0A 5DQDL 2FEEI 4WNQB 1J1PH 5JQHC 4FFZH 2AJXL 2Y7QB 1Z9SA 3U7WH 4YGAB 3RHWF 4OCLC 1AJ7L 1KTDA 2XXCB 4R4FH 3WO4B 1EHNA 1IGML 3MSPA 1P53A 3QIBC 4RZCA 2BDNH 3H7BB 1ZLSH 5JOFA 4OI8A 3EDDA 3H7LA 2RBLA 1R3JB 2OZ4A 1LDSA 3LKQB 3T09A 1GGCL 3ULUE 4JCMA 2QQLH 3Q3GB 2X6MA 1FL6B 2FBJL 2FYYA 5F97E 3DIFB 2ZOLB 3MR9A 1GGIL 3KPLA 1U8OA 2YPKB 1WEJL 4P5TB 4C1SA 5MP6H 1NBYA 1MCPL 4L9LB 3VFOB 4HG4J 1FNGB 2GEEA 2IPKA 3LRSB 3HZYB 4YH6A 3TO2B 1DEEA 1JPST 4B41A 1QR4A 1FT2B 5IFHL 1ZS8A 3QG7L 4KVNH 3HMXL 5HYIA 2QR0A 1CGTA 4PP2B 3LKRB 1QBQB 2EIZB 3PV7A 3SY0A 1HH9A 3BO8B 4H1LB 1ZLUK 2UWEB 3VD5A 1MFCH 1IGIH 1CBVL 1YUHB 4V2BA 1J05A 2F19L 4B0MM 3VW3H 4XTRD 2UZIL 5CLTA 4PP1D 3GMLB 3I6KA 2A83B 5MEOB 4XHQA 3BXNB 3G9AB 2CRMA 4JR9L 3QNZB 5JORB 3ARFC 3MYJA 5EPMB 25C8L 3NIDF 4Y4HB 1IC5L 5GGRY 4BSVB 1QYGL 5FF6B 1V7NH 1MUJB 1AFVH 1MRCL 4KUCF 4YXHH 5I17A 5GZOD 5CHNA 1MWAH 3CDYA 3CLFL 1FYTE 2IAMC 3HLAA 4PB9H 3MV8B 1IGJA 2C3WA 3LS4H 3W9EB 4GBXB 1RZ7H 4IRSC 4PUBL 5EUOA 3SDAA 5GGQL 2CJUH 3QIUB 4WIQA 3QPXL 3JWOL 2UWEE 4BM7A 1EGJA 1F3DJ 1XCQB 3MCLH 1K8DB 4JPIB 5I0ZA 1OAYH 1QRNB 4HEPG 2E7BA 5FM8A 3SDCD 3WNKA 3FONA 4K94C 4PRNA 3D0VA 4UDTB 5EWIH 3I9GH 2ICWI 2DQHL 2I07B 5F3HB 3T0XA 3BPNB 4QYOA 4L8SA 5LKNA 5CSGA 5IP4A 2X7LA 2PCPA 2X42A 3IJHB 2WUBH 3ZHDA 1QLRB 2DQDL 2Z31D 3WJJC 2F5BH 4RMUA 5BW7C 4PYGA 1FNSL 1G7LA 3CK0H 3GJFH 4HIXH 5L9DH 2I27N 3PWPD 1KC5H 1OAXH 2VLLB 3MV8E 1LO0L 1HQ4A 3GJEB 2A74A 2X4OA 2B1AL 2OTUB 5GISH 4L4TB 2P4AB 2H41A 4KRMB 3FQTB 2RFXA 5DWUL 1KGCD 3E6HB 3QCUH 2A77L 3RQ3A 1WIOA 4GTQB 2XACC 1H3XA 1AO7A 1QRNE 3HA0A 5GS1C 4JO3H 3HN3A 1QVOA 4JQVA 1EAJA 3S34L 1U93B 1CE6B 5GSVB 2R4SH 3MBEA 3WL9B 5IWLC 1CGWA 1MAJA 2HA1A 4XMLL 1VGEH 2EH7L 5DJXB 4ONFL 1VFAA 5E2VL 4ZUTA 2HVJA 2PMVA 2DQGL 2XN9D 4ODUB 2IQ9L 1DLFL 4M61A 3PHOB 5IEHB 1H3CA 1KNOA 1MI5B 4L4TE 2BVQA 4YPGB 3DV4B 1T7YA 4JO2H 5FHBH 4O51A 5EN2A 5EC2B 2V8KA 4MZ2A 3HXBB 1D9KB 3GBMH 3N85L 1NBVH 5GIRA 4ZOAA 1I8IA 1AGDB 1VB9A 3I02B 3UBXB 3QQ4A 1QR1A 2HVKB 3F7PC 2JJSC 4PJXA 1KXQE 5DHXB 5B8CA 1E27A 2Z91A 3NGBC 3O6FB 3P9MB 4J3WA 4RNRA 1I7RB 5EU6A 1OAZH 3P0VH 5FA4A 1EA9C 4WGVB 3ARBC 3TJHC 4X5XB 2R4RL 1MLBA 3KYMA 4I5BA 3X13A 3HPJB 1R5WA 1JPTH 3EYQC 4ZO7A 4QT5B 3KR3L 1PKQB 1TQCB 1NL0L 1P2CB 3AY4C 3FMGH 3WLWC 2YD8A 4NGHH 1QKZL 3ESUF 2CUMA 1TDQA 4AZ8A 3LDBC 1BWMA 5KW9H 3PWUA 1I7UB 5F9DC 5EZLA 5T3XL 5I6XC 1HSAB 4WW1A 3QCTL 2NY0D 4HXAL 2VABB 5I73C 1MI5E 4XCNA 4K9EL 3O9WB 4HPOH 4Z7NE 1LO4H 3FO2B 3BKMH 4P46A 4JFHD 2MCPL 4YO0A 2QSQA 3EJJX 1JMZA 3KPMB 4F15B 3H9HA 4OLXH 1JZ2A 3T77B 3SGKA 4ZOCA 2NY7L 4YXKH 2HWZL 4IM8A 5CS7A 2KL6A 3BUYA 4IRJB 5EOTA 1HIMH 2BSSB 2MMXA 4O9HH 32C2B 4X83A 4GRLC 1EJ6A 1AR1C 4ZTPL 5C0GA 1JHTB 5BV7L 3I6GB 4XPGH 1PKQE 3E32B 1EFXA 3U30C 4XWGL 1ZHBB 3TIEB 3O2WH 4XXCC 1NH6A 5FV1L 2OZ4H 3MUGB 3SE8L 4AH2B 4Z7OF 3B8YA 5T1LB 4PGCB 4NO3A 1BJ1J 4BH7A 5DQJA 2XWBB 1YEKL 2BXYA 4NNYA 4Z7VF 1QEWB 2DF3A 1OTTC 3DGGA 2EDXA 3DROB 3QDHA 5IESL 3MLXH 3QZWG 3QUYA 3H0TA 4DWHA 3QAZC 3C9NA 1DN0A 3HAEG 3UTSD 3MOAL 2R1WB 3HC0A 3BKCL 1ACZA 1NFIA 4WWKD 1N4QB 4I2XB 4BQCA 3HNSH 3IFOA 1F4AA 2VR9A 2I9LA 4H88L 5SX5H 3MRGA 5EO9A 1CS6A 2H45A 3NABL 3G04A 1AP2A 5F70A 1RJCA 1MPAH 5LVEA 4DTGL 3UO1L 4D9RE 3HXDB 3FCTA 4EZMA 5H37G 2YUWA 4P2RA 1UWGH 3L3JB 4HS3A 4OF0A 4P3DB 3WS6C 2PW2B 1WCQA 4FFVD 3T4AB 3QA3B 2G60H 4Z7UA 3GB7A 1U3ZA 3I75A 5FB8B 5LAXB 3WIHA 4UNVA 4KTYA 5AZEL 2XA8H 4YAQB 2CXKA 3CZFA 1LILA 3O3DA 4I2XE 2OM5A 4KKCD 1CGXA 4NQCD 2FLBT 4YDOB 1F4YH 4XT1C 4HT1H 3S3JA 3L5XL 5DD5H 3KS0H 2P5WA 2GT9A 4Q9QL 3OKMB 3C8HA 2O5YL 3Q75B 4PJEA 3DRTA 1CFVL 1MVUB 5DJCB 2BK8A 5C9JA 2D31A 3T3PE 2V5YA 3FN0H 3WXWH 2VWEC 3QDMB 4L3ED 5KZCB 4DFIA 3QZWA 1ZHKA 1XIWA 2V9RA 4HWBA 4TYUA 4QCIA 5JPNA 1QSFA 2OI9C 3OKDB 4ZSOA 1S7TB 5GGTA 3I3DA 3MMEA 2CDEB 1Z0MA 1G9NL 1A4KA 5ACLA 4OGXH 2ZCKL 5LGHH 5BS0B 3RP1A 3NBNA 4RAVB 1NCDH 4LLMB 1HHGB 1S7SB 1N4XH 3U7AA 1OB1B 4ZS6D 4LRNH 1GAFL 2L0DA 2AEPL 5SWQA 1A7RH 3O11A 2DYPA 5AG8A 3PXHA 4XPHL 4G9FB 4RGMB 1NCBH 5INDA 3MYZA 4NFCA 1VACB 3QDME 2D0GA 3A6BH 4J3OC 2ADJB 1I1YA 4EDWH 3RGVB 4J8RB 4YHYB 5JHDA 4M5YL 1NAMH 1FNEB 3QJHA 4U1LB 3QIBD 2JELL 2P5EA 4ZG1A 5HYQB 5IFAL 4QTHB 1CDYA 4J3SA 3ULUF 2Y07L 3WXVL 3IDMB 3O8XC 2ZNWA 2EDEA 1TN6B 4PGEB 1MHHB 2QQNH 1HQRB 2G75B 5F88B 5SV3A 3LCYA 4CN1A 5BS0E 2K1MA 4JDZA 3MZGB 2P24B 3LIZH 1RULH 1CXKA 3C6LA 4KZDH 2IH1B 1I7TB 2AEQL 5HHMB 3C09B 1F42A 2AJZA 2SEBA 1ADQL 1KZPB 3MUHL 4OLZH 3RBGA 2YRPA 3HFML 4G9FE 4TSCH 4KRPC 2AQ3A 4GXVH 4K3DL 2C3HA 1CICB 5EIVA 1U2HA 2XRAH 3EZ8A 3UAJC 4R7DA 4NQDA 2R2EA 2HN7B 4J1UB 3GHBH 4HIEA 5DC0A 5C0AB 4LNBB 3WKML 3TZVC 1FLRL 3D85A 4L29A 1KIUA 1XF2A 1OAQL 4HZLA 2DIAA 5I75C 4IRZH 2J1KA 4APQB 5DQ9A 1A22B 5EZIH 4QEGA 1BOGA 4XVTH 4U7KA 1RU9H 4NN6B 1CFSA 3QJFA 2BERA 3UJIH 5ERWB 4M7KH 5HHME 1JGDA 3WN5B 4KZEH 3B9KA 5CWSB 1ZGLA 4RMVA 5FGBA 4MNGA 3ESVF 1K85A 3GMNA 5D8JH 1LD9B 2FB4H 43C9B 5I18L 3BZFB 1EDQA 2UY6A 2CKBA 1T1ZA 1T1XA 4AMKH 3MRQA 5FEBA 3LN5B 2IAMD 3S37H 3BWUC 4LP5A 3GSWA 3FKUS 4KHTH 4ZYKA 2PXYD 2VDMH 3RX8A 4C59B 3F7YA 2VR5A 4Y5XB 3SE3A 3T65A 5C0AE 4JZJC 5ACZA 3W9DB 1C1EL 4GUPB 1IBGH 5MI0C 1WFNA 3MRJB 1CXEA 3V4UL 2D7OA 3HRZB 1IT9L 3TBWA 4WU7B 4U1NB 4HIIA 1D5XB 1N64L 4MDJB 3ALXA 2CO6B 5F21B 3WFBL 5C0BD 2KZWA 2YWYA 2Y72A 3REVA 4L4JA 1ZLWK 2VQ1A 3PV6B 3BZ4A 3P4NA 4MNQE 4DUWA 4CN4A 1JWUA 1FGVL 1NDMA 3CSPA 5HVHB 1MIEL 3WUZA 1U3HB 3HMWL 5IK3A 1SJVA 1KLUA 1VADB 4Y16A 4Y4KA 4DGVH 2H8PA 5KVMC 1FL5A 1RK0A 2QADB 3QPQD 5C08D 2IALB 1DBJH 3STLA 1SJEB 4HK3J 4Q9RH 5FOBA 2GK2A 4KDTA 5D72H 3VD9A 2XFXA 1FFRA 2BHYA 3GK8L 1VERA 1I9IH 4OSUL 4B5EA 4HD9A 1DBBH 4LKXA 2D9CA 4JGMA 2KH2B 4HK3N 3PE9A 4AIXA 1KXTB 4NO2A 5CBAB 3GZKA 5C0CB 1NMAH 1HILA 1MREH 3G6DL 4MXQD 5ANMB 4LHQB 3PDOA 3VG9B 3DO3A 1A6TB 3HRPA 4PJ9A 3QIWB 1BQUA 4LHUB 5H2BB 3FFCB 4PJ7B 1FH5H 4AEEA 2PO6C 3LQAH 4NWUL 3MJ8A 3KYOA 5I1CH 4EQ3A 3D5OF 3RL1A 4KKNA 2YPLD 3BHBB 3QEHB 1RUMH 5KN5B 1U8HB 4PTTB 3BN9C 1JCKA 4PJ5D 4XNZC 2AS5M 4YWGL 1Y6NR 4OZ4A 5J3HD 3IDYB 3W0WD 2MQCA 4TUJA 4HJ0C 1F4WH 1KIRA 3E0GA 1Q9LA 2GITA 2GK0B 4PPTA 4KK6D 3H9SD 4CDHA 1W0YT 3GSRA 2OL3A 1SY6A 1NEZG 3JZ7A 1H5BA 1HZHH 5ANME 3GRWA 2BVTA 4LASH 4L3AA 3ARBD 4XPBL 1AE6H 4WV1B 2K3TA 3HQBA 3S36L 4JPVH 4G6KL 3FFCE 4PJ7E 3HAEH 1JNHB 1FV1A 4HBCH 5GGSB 1R0AH 3VG0L 4Z7NF 3O3EA 5FO7A 3VCLA 3LEYL 2NY4B 4YDEB 4OD3L 2F15A 3DX7A 4HWNA 1P6AB 5J06A 2NNAA 4P5MB 5D1XA 3I85A 3B2VL 4L4VA 4ZH1A 1D6VL 4JKKA 1FE8L 1FZMA 5E8DH 4JRYD 3UJTL 3IVKB 4WCYL 1J1OL 2VLKD 4HCRA 4F7MB 2AK1H 2VQUA 1BFTA 4PB0L 2VERN 1SJXA 5CEXB 4NZUH 4JY4B 4ENED 5E2JA 5IMKB 1U58A 2I25N 3P4OB 3RWEB 2O93L 4JQXA 1T4KA 1YYLH 2EDJA 1NCWL 4M48L 4GG8A 3QISA 1W0WA 3VFTB 4YR6A 3BZEB 3THML 1J0HA 3NFPA 2XZAL 2Y9RT 1ZKAA 5IHUL 5GQBA 5EO1A 5LXGH 4WUKL 1UJ3C 5E2TL 1BFVL 2P46B 5I1JL 5DJ0A 4LCUB 1NEZA 5FHAH 2EDHA 3RUGB 4EBQH 2GJZA 3SDXA 1ZANH 4RMSA 5L0QC 2VZSA 1HH6A 2EEAA 1CL7I 3VWJD 1FO0L 2XZCH 1C5CH 4PREA 3DJ9A 1I8LC 2ATPA 4XAKE 3GHEL 1IEBA 2CPCA 2WY8A 1KT2B 1U95B 1BEYL 3CFJA 2FX9L 4LMQE 3U9UA 2GJ6D 4K7PX 1MFAH 1GHFL 1GVIA 1S64B 1E0OB 1W0VA 2ILLA 1U91A 3U1SL 5HHNB 4U2YA 2EDNA 5DJDB 2E8ZA 3NFNA 3V5KB 5CD3B 3FQXB 2CDGB 3L3DA 3PGCB 5I8EA 2XWJA 5DRWB 3T0EC 1INDH 2FR4A 3P4MA 4ZXBA 2FO4B 4PRDA 1DANU 1CN4A 4M1CC 3SKJH 3QFJA 3IFPB 3TO4B 1UACH 3INUH 1UM6H 1SBBA 3GIZL 3IETA 1J7VR 2CIKA 1G9MH 1IGFL 3RUGE 3ZDYE 4MSWA 4XC3H 2BVEA 1T21B 2WMPA 1T1WA 4YX2L 4PRHD 5D93C 3RZCD 1UQSA 3AM8A 3PIQA 3ROLB 1P4LA 1MJUL 1B4JH 5FCUH 1WAAE 5T3XE 1JPGB 2BMKA 5GSRA 2AGJH 3KPNA 5EZOH 3SGJC 3T3PF 1BBJA 4N8VB 5IQ9B 4JVWA 3IYLW 1NC4A 5D7JB 3QUKA 1GOFA 4GMSL 4LVNB 2EDKA 5CD5C 2A6KB 1SYVA 3MRLA 3QDGD 1RUQH 2NY2B 3BDYL 5I1EH 1ED3A 4O02L 2NOJA 4HFWA 4FQQB 1B6UA 4NO5A 1TCRA 2GIYA 1YY9C 3BT2H 3OKEA 5K9KA 3ULUC 5E8OB 3B4NA 5IT2L 1HHKA 3RVTC 1N7MH 2P7TA 5CJBA 3MV9D 1JGVL 5D70L 1SJHB 2YA2A 3EYSH 2ZCHL 2EIEA 2FEEL 2H26A 1YEEL 2X40A 3L9RB 3PWVB 4ZFOA 3VI3F 1X4XA 5IBUG 5C0DB 2XQWA 3GSVA 4M9PA 3OJDA 1XR9B 4IJ3B 4LLWB 2V2WA 1TCMA 3ARGD 2W0FA 1CDCA 2YPVH 1PX4A 3WO4C 3MLVH 1RZKL 3S3PA 2AEIT 1Q1JL 1T80A 1RURL 5JO5A 3V8CA 2Z8WC 2NXYD 4X4YA 4TVPE 1FPTH 3ZYZA 4NZRL 4YHNB 2R0KH 4FFZL 3EOYG 3MRMB 3U7WL 2IPUK 4JFQB 3B43A 3WLBA 2AI0H 4P5TC 4R8WL 2ADGA 4PRPB 4L9LC 1LGVA 1SQ2N 4M43L 5DJZA 2FD6L 4I18B 1P1ZB 2I5YL 4LVOB 4JHAL 3SCMB 4GKSA 1WWAX 1KUMA 4P4KA 1EMTL 2AJSL 4NQSA 5DJ6A 4N0RA 4ZO9A 4D4DA 4AIZB 5ICYB 1KCUH 1SY6H 1A9EA 3VWKD 4GMTH 4WB2A 5AD0B 4LEXH 4XP9L 1B6DA 4CMHB 4NC2B 1IGYA 3EOBA 3MRBB 5JDJA 1A64A 3WD5H 5CBEB 3JV6B 3NACL 3DRQA 3WS3B 2JJVA 2DIBA 3S35H 3GKWL 4K07A 5T5NG 3O6KL 4KRNA 4Z7WA 3WIIH 3GGWB 4PRPE 4UTAL 5IB1A 4N9GA 1BD2B 4Y4HC 2V6HA 4UQ3A 3H8NA 1NCAL 2AXFB 4NKQB 4WO4B 1DANT 2ZSVB 4QHNB 4WEMB 3WJLA 4XZUB 4XP1L 4A2MA 1IEAA 3GMPA 3R0NA 2Q87A 2P47B 2BZDA 4PY8J 5CGYD 3RWGB 5CCKH 5D7KD 3QEUA 3BIBX 4GBXC 3W39B 1YEFL 3OAUL 5M7QA 2G5BA 4P23D 2FHBA 2GCYB 3FT4A 3OXSA 5F1IB 3QIUC 4PLKC 2VDKH 2ESVA 4XNMA 1BFOA 1V7NL 1IC4H 5F7EL 1KG0A 1AFVL 5ILTH 4OGAC 3KYNB 4EI5A 1CVRA 2ZKHH 1UCTA 1J0IA 1A2YA 1JGLH 3OSKA 4FQXB 4S1DD 2B4CH 3SO3B 4MBGB 3OB0H 2Q8AL 2WBJA 4MA7L 4U6VL 3AREB 3OKKA 3G5ZB 3PWNA 4W6WB 4DK3A 1BD2E 3P2TA 1I4FB 2R1YA 5DMGD 1BOYA 2QTEA 2JTDA 3EFFA 3AS1A 4PV8A 5F7DB 4X6EA 4RA0C 2E7CA 4NCDA 1I9JH 1SM3H 2VLRD 1EEZB 4OUUB 3QWOB 2EYTA 2NR6C 5TDPA 4I4WA 2DS4A 3O4LD 3DUUA 5I1IH 3C5JB 2WUBL 2DQFA 3L3KB 2IJ0C 4HFUL 1Y0LA 4W70A 2Y6SC 4X4XA 4OZFB 4Q0XH 1WIPA 4U1KA 1S78D 4FNLH 4HJGB 3E2HB 3IFLH 3F12B 4FQPA 4LSRL 2AJVL 1IZJA 4K8RL 2CDFA 4G7YL 3GFUA 4PD4J 1EO5A 2FNBA 1KPUA 4M7LL 4MD4A 3GMOA 3MGOB 5K33A 1NC2B 4G8FB 2FJFB 2YD1A 2A6IA 2VXTL 2Z31A 4FG6C 3QUZA 4Y4FD 4JO3L 3AFLA 5DGQA 4LOUC 3C8KB 3D2UD 3PWPA 5IKCB 1MNUL 4YDVA 2PW1A 4X98B 3GSNH 1IL1A 4C56A 1RFDL 2R4SL 2V9TA 1U8JA 3CFEB 4EKXA 3D6GA 3HE6D 4CBPA 2V2XB 2Z8VC 3LVEA 5KANG 3KHQA 1D9KC 4R3SB 1A7OH 1CFNB 5CIPH 4HKZB 1BGXL 1A0QH 1CFQB 3FO1B 2P49B 3QB7C 4KTEH 2ZUYA 3BQUB 2W9DH 2VZUA 3KDMB 3O2DL 3O6FC 4NPYA 2UVFA 1OP3K 3ULVF 4XP5H 4EUPB 5F7HA 3EDFA 4GSDH 1HSBA 5FHBL 5CINH 2NZIA 3D3VB 5I8CA 4D3CH 4D9QE 1UH3A 1NBVL 2YBRB 4Q97A 1EHLH 4EIGB 5J9PA 1M05A 1TQCC 3K81A 3MRFB 4L9DA 4WW2F 4XHJD 5EA0L 4GXUM 2OK0H 2WW8A 3T2NL 2XA3A 2DLFH 3VXQA 3MRKA 5GS2D 1MY7A 1MFDH 3VXSD 1NBZA 4RFNB 3OHXB 3VXMB 1S9WB 5KVEH 4W6XB 3ROOB 3RTQB 1CXLA 2EIBA 1CIUA 5E6ID 5FUZH 4X5WB 1PG7H 1Y6MR 1JCSB 1TZGL 5JW3H 1X9QA 1IAKB 1KLFA 4NNPL 3FRUA 4R0LB 5IOPA 5DR5L 1P7QB 2K7QA 3TYFB 1I9RH 3C5ZA 5DJAB 4CU8A 1J8HA 4IRJC 1X44A 3DOSA 5FOJA 3ES6B 3QDJB 5DTFA 4YNYB 5KTEH 4ISVB 5DEGB 1INQA 4XCYB 3PWJA 5C2UB 1N2RB 5D9SA 3BKML 3D3VE 1AGEA 1WWWX 2W65B 4X7FC 4ETQA 1DBAH 1JL8A 3TPUB 3I2CL 2D03L 1WFTA 5FO8B 2BVPA 3WUWG 3H3PL 3V0AC 4OKVB 7CGTA 1J8KA 1QLFA 3D39A 4HF5H 2X4RA 5B22A 3VXPA 2VLJA 2QLVB 4MJ5B 4QHMB 4RWYH 5TPWL 3VXME 4HHAA 5IV2B 4M1DL 4ORZC 2VDNL 5A3IC 2ICCA 5ADPL 4ZTOL 2JKXA 3VFUB 1G1CA 1CFTB 3KLSA 1QSVA 5EU3B 1GXNA 1KN2L 2OZ4L 2PUQT 1NUDA 3QDJE 5SX4H 4H20H 1PSKL 5IB2A 3DHJA 3LZFL 5F7LB 1ZWIB 1N6UA 5FAAA 3BDXA 3ZT6A 4QY8B 3VFNB 3L1OL 5BJTB 5GS2H 5ITFB 1CK0H 4X0KB 5F7YC 4ZDHB 5IM7A 1IQWH 1Y18B 2AERT 2AJYH 4D2NA 3DNKA 1QFUH 4MD0A 3V7AG 4OZHA 3RWJB 5EBMA 3MRDA 4POZC 3PL6B 4NYLA 4MMZC 4HX1A 1MCSA 2GW5A 1EVUA 5I66B 5K9JL 2NW3B 3EDKA 1UWEH 4X9IA 3WNPA 3UTTB 1T0MA 4UV7L 1MY5A 1OSZB 3ZE1E 4LNVA 3RA7L 5ESAB 5JUEH 1AKJD 4M1CD 4MAYA 5C0FB 5DEZA 3ZDYF 1YN6A 5B3NA 4E0RB 4DKAA 1QSEB 5ID1A 1MPAL 2PR4L 2DQIH 3O6ML 3QFDB 4LL9A 4XMPH 4P3CL 4QRTA 3EGSA 4GOSA 5HYJB 3VFSA 1NUFA 2DQCL 3LHPH 4G6AD 1DQDH 1AIFA 1WAAF 3L3GB 3EJYC 3WUWA 1FIGH 4Z9KB 4EN3B 3VRJB 3BEWA 5ADOL 1S7QA 4F7EB 3DXAB 1U3YA 4KQ3H 2BNRB 1IAOB 4MX7A 5C0EB 1QFOA 1TVBB 1A3RH 2VXQL 3K4DA 4QRPD 1FP5A 2XA8L 3BIKA 4ELMB 4RGOH 5BQ7A 1ES0B 3UTTE 4D4BA 2V2TB 4HULB 1K6QH 3EFDL 3QEQB 1A3QA 4F9PC 1HEZB 3JV4A 4PJDF 4WEUD 1RZFH 3TPKA 1A6WH 1EGJL 1QSEE 4MA3A 4KHXH 5IQ7L 2M8XA 5GRUH 4CVXA 2BOCA 1YY9D 1GGBL 4ZFGL 5HYJE 3ULUD 1KLGB 4DN4L 1LE5B 3C72B 3KLAB 4LSSH 1FVCB 1KJMA 4HBQA 2BVUA 1P6FA 1ORQB 2FBOJ 1MCNA 2AJUL 2VR4A 4M6NL 3ZYIA 5IFJA 3DXAE 4IBLT 1NCCL 2BNRE 3BW9B 3FN3A 3MLSH 3VXUA 3PXJA 2E9BA 1E28A 1A1NA 4RGMC 1JTOA 2FEDC 5TE6H 4KGLA 4P9ML 4ZFZA 1GJIA 3EYUL 4OGXL 4ELME 3VRIA 4XAWL 3HNTL 1V7ML 3NZHH 4NM8H 4ODSL 1A14L 4JO4L 4L3EA 4OIAA 3RGVC 4KKAC 4YHYC 4N5ED 2BFVL 4UNUA 3QEQE 5DUPH 4J12A 1QO3A 4LDEB 4U6YB 1A7RL 3GM0A 1I3VA 1HOCB 3J8F7 2AV1B 4OD1L 3DUSB 4XNYH 3V5HA 1G0XA 3QNXB 2WBKA 2BB5A 3CVHA 2D0HA 1WBXB 3IDNB 1AXSA 1ZHNB 4ODWB 2HJKB 4P5TD 2Z4QB 3C09C 3BGMB 3CSGA 3GUTA 3D69B 5T5FL 5D96B 4OCMC 4OD2A 3Q2CA 2IPTH 1GGUA 4CNIB 1ZA6A 4XH2B 4HSQA 1KIQA 1KOAA 1CICC 3CDCA 3X14B 4XCCH 5D1QB 4FMFA 2OLDA 1JGEA 3PP3K 3R06B 2Z35A 2FWOB 5DHVB 4XNUL 4G8IB 5F93C 1CLZH 3MA7A 1DP0A 5DDHA 3OPZL 2NY1B 1FZJB 4H8WC 1YQVL 4ZUUA 5JDSA 1O6RA 1FG2A 5GXBB 4I48A 3KXFA 4P2YA 2OTWA 4JM2B 1MCBA 5DMIH 4MNHA 4NN6C 5JQ6H 1QP1A 1E4WH 3QCVL 5C09B 2HKFL 3TLRA 5KSBF 1BBDH 4P4RA 3C60B 5GRVL 4Y4HD 2HKHL 4YDJA 1FRGL 1I3RA 1LO3H 3BN3B 3QUMH 1WZMA 2OP4H 1LNUB 1F13A 1A6AA 1H8OA 3BPCA 5EZIL 4Z0BL 2BY3A 1WC7A 3OAYK 1T2QL 1MHCA 3M8OL 4JVUA 4JE4B 3KPRB 2XPGA 5I76A 5E08L 2JK5A 4GBXD 3V6ZA 4ZUWA 3IDJB 4HGMA 5HPMA 3SKNA 4KK5C 1CD9B 5EZJA 5JPMA 1DR9A 4AYFA 1WBZB 1F11B 3VMOA 4IDLA 2H1PL 1QRND 3AC0A 4OZGA 1CG9A 2FECI 4KHTL 1WT5C 2EDOA 3U7YH 5AZ2H 1XGQB 2IQAB 1CF8H 5ISZB 4MJ6B 1XGUA 5C09E 3SDDA 3B2UC 3S5LG 1EERB 4NSKA 1N8ZB 3DLQR 4GXUN 5I1DA 3ARFA 4TNVK 4HS8H 4OCYH 4ZAKC 4HV8B 1ZLVK 3JWDC 5HVHC 1UCBL 1U8MA 2VDOH 1U3HC 4LFHD 5FYKD 5E4IA 1SA4B 1XGTB 4NHCH 3HCVA 4PV9B 3ARZA 4D4CA 1M1SA 4JFZL 5ETUB 2QADC 3KPRE 2IAMA 2OQJB 2NR6D 3D18B 4IRSA 5FV2A 5KVFL 4L4TD 3QQ9C 1K5NB 1T5WA 4PR5B 1G6RA 3FOLB 5JHLH 1XF5A 5DVNA 2YHGA 5IBLD 1G0YR 3FB6B 1CFBA 5KANI 3DSTB 2ZISB 2Y6SD 2QSCH 4JPKL 4AQOA 2CLVA 4DGVL 3WSQH 1S7VA 3VFMA 4BUGA 3OR6B 3ULVC 4HJJH 5FK9B 1QBML 1H3PH 2EE3A 4NRXB 3SOBH 5ISZE 5C0BA 2SQCA 3VG9C