4FXKB

Human complement c4
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 Beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
molecule tags Immune system
total genus 143
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 4fxkB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4fxkB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 4fxkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fxkB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fxkB04
4U1LB 4I18C 4MNHA 4D2NA 4OZFH 1JFQH 4OGAC 3TA3A 3WDJA 4YXHH 1DQJA 1GHFL 3KG5A 5SX5H 2E27L 4JPVH 2EC9U 3FOLB 5T33L 3VH8A 4GBXA 1FVDB 3OF6A 1AGFA 4LIQH 4LSTH 4X6CA 5D93C 4JY5H 3UBXI 4GW1A 3QRGL 1BJ1H 2JJTA 2BVQA 5LWYH 5F7EL 4HWJA 1F00I 3VFPB 5GZNC 5IB4B 1I8MA 4W68A 3DIFA 5EU7E 3HI6H 4PUBH 3TBWA 1CFBA 1RJZB 3S5LA 4QRQA 1Q9OB 4HKXB 3ULUD 3RQ3A 2OK0L 1UWEL 3MBEC 3WS3B 1ZS8A 2DQTH 2CMRL 1BFVL 3FRPG 2DIAA 4X6DF 2Q7NA 3BE1L 5KS9A 4ZOCA 2CDFA 2MHAB 1SJXA 5GXBB 4L4TA 1PW3A 2K7PA 3S36X 3H7BA 1Q0YL 4K3JH 3WN5A 5JUEH 4PJIE 1OY3B 3PWVA 5DTFB 1K4DA 2HP4A 5CFHA 5KVFL 3OWEA 4FXKB 2IPKB 2EYTB 4M1CC 3GSOA 3GNML 4KQ3L 1ETZA 1FO0H 2NY6D 1MAJA 5D1QC 4RDQG 4WWID 3MODL 4BSJA 3NACH 3RKPA 3MRPB 3FQXB 5IW6B 4G9FE 1L7IL 4ZPTA 1S7SA 3E0GA 3UPAA 5IT2H 2E6QA 2X4QB 5ESQA 3GI9H 4GG6A 1AY1H 2ZG3A 5I1IH 4WU7B 3MCG1 1DBMH 3DV4B 2Y5TA 4J1UA 5HHOD 4YLQT 1QOKA 3EYUL 4OCRH 1RSFA 2VISA 4G9FB 1R24B 2X2YA 1C08A 1OCWL 2BX5A 3ZL4H 3S8WA 3F5WB 1BBDL 5INDA 2VR4A 2DF3A 2JELL 3UZVB 3GK8H 4WTXA 5IW1B 1MCRA 4P2CG 4DTGH 4WV1A 5SX4H 4RFEB 5T1KB 2NY2D 3EYVA 1WWCA 1O6HA 4UV7H 2VZ3A 3BXNB 5GGSB 5KW9H 4PJAE 4M7JH 3K46A 4X9GA 5IGXH 2FYYA 4EXKA 2HTKC 3I3DA 5C0GA 5E8DH 3QIUD 2ICEB 2BB5A 1NANH 2AEPH 5D5MF 4B5EA 3TA3C 4KXZI 4HZAA 1W0YT 4LFHD 2WINA 1H15A 2QKIB 4UTAL 4OT1L 1ES0B 4P2RA 4P3AA 1CLYL 4PY7B 4HJ0D 4PJAB 1KXTB 4HT1L 5HHPB 3OEDA 3DSFH 1QFUL 2JJTC 4YC2C 5DUPL 1F4WL 3RVTD 4Z77A 2FBJH 4PV8A 4QTHB 2DRUA 5DUML 3Q6FB 2AGJL 3BH9B 4RNRB 2EKSB 4FN0A 4N0YL 4S1RH 4XAWL 4NKIL 4BQ9A 5IKCA 2UWEE 2BVOA 1Z0NA 4RISH 1MLBA 2H26A 3Q0HA 1RURL 4M48L 5DRXB 1XF4B 2X4UA 4PJEE 3FCTB 4HEPG 3C5SA 4HWBA 4ONFL 3S3PA 3A67H 3B9KD 4XMKL 2CK2A 2HMID 3HAEG 3P9LA 5C08E 3WN5C 3D2UD 4TULH 1BMGA 1JNHA 5CEXB 1A6ZA 4YQXL 3TFKC 2AI0L 1WISA 3VXUE 4N1HB 3JV4A 1ZANH 1HEZA 5CEZD 5D7JB 1DVFD 4IRSB 1A6TB 4WEBL 5EU3B 1ZA6A 1QSFE 4Y16A 1QSED 2QHRL 3OZ9L 2Q20A 4D9LH 4MJ5A 4UIMB 1A1OB 4HX1A 1MCBA 4UNVA 3E6HA 3VXUB 1T1XB 4HFWB 3SE3A 4RIRB 3ZTNL 4APQB 1C5CL 1NBVL 2G75B 3VGHA 3WNNA 4X6CF 4OB5L 1O79A 1KB5A 2QADC 1QSFB 1BFSA 3SY0B 5J1AA 1JTOA 2GJ6E 1JRHI 2B4CL 4GRLB 5FF6A 3B3IA 3ZKNC 4P2OA 2FLRT 5INCB 4PJDA 1R5WB 1LHZA 1CDCA 1IGMH 2Z35A 4I1NB 5SWZD 1DR9A 2DQEL 4X0KB 1G7PA 2BHYA 4WO4B 5BJTB 4I0PC 3EJYC 4C58B 1LILA 3FQUB 3I3BA 3QZWB 3V9FA 1SJEB 3WFHA 4ODXB 4U49A 1YEKL 2GUOA 5C9KA 5JR1H 2GJ6B 2NNAB 1G9NH 1Q9KB 2AJXH 1SJVA 2X4RA 5TGBA 1HHJB 2XV6B 4QRPD 4KK9C 4JPWL 4TSAL 3GMPA 4OQTA 4I13B 2W0FA 3QPXH 1I9IH 3SKUD 5DHXB 2ENSA 1OAUH 4XC1L 1YY9D 1RULH 1TNBB 3QEGH 5F9AC 4ZMAT 1EPFA 4PRBA 3X17A 4O51B 4ESKA 3QIBC 2GCYB 1T5XA 1NUFA 4NKQB 4XVJL 1UGNA 4PGDB 4F7TA 5BRZA 5DJ0A 1A7PL 1CBVL 5F8RC 1QPPA 4KK8C 3QG7L 3I6GB 1XR8B 1ZLVK 4GG6F 3E8UL 5HHOA 2A74A 5F7LB 4MNQE 2F0YB 1UB5A 5D7KD 4FABL 4NKMA 4RX4D 2V2WB 1NGPL 3TZVB 3TYFA 3V4UH 4R2GB 5I8KL 4Y2DB 4TRPH 1LEKB 2NY5L 1J9CT 3ECBA 1E4WL 1FPTL 3D85B 2LTQB 3L3OA 4HCRA 2ZZUT 2APBA 2GY5A 4KKCD 5I8EA 4ZXBD 5EIVA 3LOWA 1U6AH 4K7FB 5T5FH 5ERWB 1Q0XL 1JYXA 1LP9E 3G6DH 4FQXD 3U30C 3QIUA 4LVOC 2Q3AA 3G5ZB 3S9DB 3HE7D 1JN6A 3OGCA 3WUWG 4Y16C 5DRWB 5DHVA 5J9PB 4KVCH 5ANMA 1EAJA 3BO8B 1LP9B 1RZJL 4ZFFA 3C8HA 1IM3A 3KYKL 4LVNB 3RVWD 2GFBB 3NCMA 3SE3C 1BQHG 2X4NA 4MLSA 5FECA 4ZPVB 3MV9D 5LGKA 3IDMA 4NQEE 2Z31B 1M1SA 2IMNA 3KR3H 5FYKU 4LBEB 3RVVC 1DJSA 3HC4L 2V6HA 4IBLT 1G9MC 4YDJB 3ZKQD 4ZQKB 3ULUC 2BMKA 4KMQA 2JCCE 3K1KC 2FJFA 3F6IA 5L2JB 1DN0A 1MFCL 1E28A 3MRDB 1QFWH 4P2OC 1HI6B 4B53A 3RAJH 1LVEA 3OAYK 2LVCA 5GSVB 3LKOA 4KPHH 4NQEB 2DWEB 4N8VB 2LE9A 4W6WB 3B9KA 3MUY1 4XCNA 4HIEA 1NMBH 4Z78A 1OQOA 2R1YA 4JDTL 5DWUH 3BSZH 4FNLH 3MUZ1 1FL6B 3C5JA 5DD6A 2J4WH 4JREC 3GMRB 1EIBA 2FIRT 3BP5A 2BXYA 3OAUH 1UCBL 5JPMB 2ITCB 1A5FL 2NY6C 3MZTA 5D8JL 1ZXQA 1DVFA 4ELMB 1JBJA 3MNVA 3PIQA 4QXUH 3NFNB 5DK3A 1E6JH 5EOCL 3WLWD 1DCLA 5FUCC 1QSEA 2UY7A 1JI2A 1BIIB 5IMLB 5K9JL 1EHXA 4Q2ZA 2ADJA 3CDFA 1DQML 1HNFA 5DEGB 5MEQB 2AQ3A 2PN5A 2IQAA 1MCQA 1INEH 2VXUH 3V5HA 4XNUL 3S4SB 5CBEB 1X9QA 1QLEL 4J3UA 3CVHL 2C1OA 4U1MB 4WHDA 5GPRA 2H6GB 5F1SA 2FO4A 3DPYB 1NGWA 1N5AA 4BUGA 3P77A 5SWZA 2NY2C 2QHLA 3SGDH 5JHLL 5CEYB 1IZKA 3FB5B 2KL6A 5EBWB 3ZDXE 5ALCH 2APTA 4XNMA 3ABZA 2OP4H 3OR6A 5FAAA 1EFXB 2D7NA 4ZO9A 2DM2A 4LKXA 1VDGA 3HMWL 4OCSL 4MD0B 1CDHA 4JFFE 1LEGB 4LF3A 5I66B 4NT6A 4QRPA 1N26A 3MRKB 2G5RA 4WWKD 2RAMA 4YR6A 4LHUB 1X7QB 3VXME 1CE6B 3V95A 4BH7A 3LQAL 3W9EA 4TUKH 1JHLL 2UZYB 5E2TL 2YS4A 1KPUA 2VIRB 4FMKA 1I7RA 4MA3B 3TWCL 3RVTC 3VWJD 1NCTA 4NC0B 4HG4K 1AGDB 5FA4B 5I74C 3SN6N 3F6LA 1A7QL 3IKCA 1RIHL 5GHWL 2BOBB 4OD3H 3S35L 3L6FA 4WTZG 1A4KB 1NJ9A 4QHNB 3VXMB 1CFSB 4D4BA 5IHZA 2D4DA 4RX4A 1I1AD 3MRIA 2Y9RT 4OGXH 4TNVF 1TIUA 4KZEH 1IAOB 2HMIC 3LRGA 2H8PA 3MROB 4ZXBA 1A0QL 3MV7D 4S1QH 4L3CB 2DI7A 5GS0L 3QUYB 4PJ8A 4LNVA 4XB7A 3QXAB 5FB8A 1IQDA 4FQXA 3HZYB 1ORSB 1HNGA 1W8OA 3L3DA 3H9SD 3FHAA 1FBIH 3DROB 3PWUB 5D7LD 1D5MA 3H42L 3HE7A 3VGEA 2A38A 1U3JA 4PRHB 2UWEF 4R3SA 4P2QE 3V6OC 5GS1B 3VU2A 1YYMH 1PYWB 1NMCB 4CU8A 1F4XH 1S9YB 4YPGB 4PJEF 2BK8A 2VXVL 4R7DA 3SDAB 5CJ5A 4NN5B 3MV9A 4O58L 2HJLA 3C8KA 2OS7A 1KLUA 4RCAA 2HWZL 1NC4B 3BPLB 4P2QB 3LS5H 5JO5B 1ZGLB 4UILL 1I1YB 1JV5A 1LD7B 5B8CC 1EEYB 1IQWH 1JNLH 2BSED 2R56L 4XNQA 2Y7QA 4OI8A 4MMXC 4NHCH 3BGMA 3MXWL 3MLYH 4BSVA 5E08H 4V1DD 3E33B 5ILTH 5DO2D 1PQZB 4U33A 2OM5A 4Z7NE 3STLB 3SDCB 3T3PE 2P8MB 4PJXB 3EYSL 3TO2B 3TESA 3D25A 1BM3H 1MIEL 3GI8H 1CDJA 5TE6L 2F8VA 1CXIA 3H6JA 1JK8B 3VGGA 3O6KH 3MA9H 3F7PC 4JFQB 3QDJE 5GGVY 4WFFD 1OAZH 1YY9C 4PJ5A 5M7QA 4Y2OA 5T1MA 5D96C 3Q6GH 1FVCB 1QFOA 3GJEB 4LMQI 3TNMB 5J1SC 1Y18A 4MXVF 5IHBA 4RGOH 1YEEH 2VDOL 1FNFA 2MMXA 3NZHH 4NQDD 1HK6A 3HXFB 4Z8FH 3E6FB 1NPUA 1YEGH 1N7ML 4YDIL 5MENE 1JWUB 4HGWA 1FFOB 1UB6B 1K5NA 3SDXB 3VXSD 5HHVH 4X6EA 3OX8A 1U92B 1Z9OA 1SHMA 5FYLD 4GKOA 5JNYA 1IVLA 2Z91B 4ODVL 5GISH 3KPRE 4KKCC 1NCUA 2VH5H 3HMXL 4Q9BA 1DBJH 4PJ8C 3WKML 1OPGH 1EO5A 3MGOB 4FQXC 3KPSD 4XXCC 1F42A 1P84K 4WJ5A 1FLRH 1IFHL 15C8H 3LPGA 3KPRB 3HE7C 2F53E 1BX2A 1XCTB 3CX5K 4U05A 4C83B 4WWKA 1GZPA 4PRAA 1O7SA 3BPOB 3IU4H 4BUHA 4Y89A 1HINL 1VADB 4U1SA 1TTUA 3ROLA 1P4IL 1FZOB 3AY4A 4XBEH 2XI9A 3VWJA 5J11B 3I9GL 3GJFH 3T2NH 2Q8BH 4DGVL 3PZ3B 1B0WA 4ODSL 3DVNA 3MYZA 2F53B 2PYEE 5EU4A 2J6EA 2WUCH 4PJFA 3R1GH 2ZCKL 4HUVA 1L0QA 4UTBH 2CLVB 1T7VA 3CVHA 2HVJB 3TPUA 2MFNA 1INQA 2NZ9D 3F12A 4RMUA 1I1AA 4O02L 1AC6A 3MLWL 3KYNB 2YOCA 4FA8A 1BEYH 2YN5A 5AAWA 1UCTA 1MHCA 2PYEB 4IS6A 3HB3D 3W11D 2V5RA 4MCYA 3PP4L 3FQTB 1X5IA 4OLWH 1JTTA 3SOBH 5HYQA 1S7XA 3FOMA 5I1CL 3MNWA 4HKJB 4UMGA 1T22B 1MRCL 3FONB 4CVZB 3NA4A 3OHXA 3GSVB 1NEZA 4DK3A 4WNQA 5EFIB 5KJRL 4F2MA 5TDOB 4EBQH 4U0RB 3S37H 1NBZA 5AEAA 3BZDA 5E5RB 4KV5F 4JFED 5JZ7C 3H9SA 5TDPA 4MCZA 5DURD 5D7LA 1CI5A 2JCCF 2WUBH 3WLWC 1RZJC 1DLHB 3HR5B 5MI0C 2GOXA 4LL9A 4EN3B 2IADB 2BZDA 4XCFL 1BBJB 3QHFH 4H20L 4XP6H 5DD0L 5KTEH 4M02A 1BWMA 4M7KL 2YPVL 2FX7L 4P0DA 1O6RA 1V3KA 4HKBB 4N90D 5KSBA 4D9QE 3PQYA 2FSEB 5GJTH 4MQSB 5JW5B 4S0TD 2UZXB 3PF2A 2GSIB 4MQ7A 4PRID 5AUMA 3S88L 1IEBB 3GIZH 4KZDH 3LN5A 1I3RB 4V1DA 4C57C 1QR1B 4U1GC 1ONQB 4ELKA 4XNYL 1N0XL 2OTWA 5JXEA 5CP3H 4NM4L 2G60H 3H9HB 4OM1L 4OIIL 3DGGB 1YUHA 2R2HA 3TBSB 4XB8A 5CP7B 2VLLA 4WWKC 4CW1A 3WIHL 4OCLC 3OJMB 3KGRA 3GKWL 3RBSA 1AP2A 5EUOB 2VDKH 3T4YA 2DL9A 2IFGA 1P4BL 3VWJC 1UJ3C 3MR9A 3SDDC 35C8H 3CC5A 1HZHH 4J3XA 1CFTB 5HD8D 4IHOB 1IAIL 2NW3B 5D1XD 3HLAA 4NQDA 3V0WH 5FYKH 5EU5B 5JORB 1GHFH 5T33H 1R3LB 1JF6A 4F7EB 5I1LB 3VXSA 2ZWLT 4HWUA 1I1AC 1KJVA 4DEPC 4YHPA 1BVKB 1F6FB 4RMVA 1AKJD 4LQFL 3QRGH 3N85L 3IJHA 1U9KA 3EAKA 1O5MB 5BXFA 4JFXA 5HHQA 3PJSB 3VXRD 3IAQA 3T0DA 4L4VE 1IKNA 3HAEH 1A7RH 3KWWA 4R90H 5K9QI 4FOMA 1XGRB 4J6RL 1M7XA 3CFEB 1A6VL 2M1KA 2A6DB 5I6XC 5EBLB 5IWLA 4LSQH 3MO1A 3IETA 3LDBB 4ZTPL 4V2BA 4H1LB 2BNQE 1JGDA 4XI5D 4ZUUA 1Q0YH 1MY5A 4WU5A 5EZJA 5I9QB 4L4VB 1TQBB 4ZUWA 1P2CB 4GW4A 5KVFH 2D31A 3SO5A 3P9WB 3OKEA 2H9GB 3L3KB 1ZLWK 5CZKA 4KQ3H 5ICYA 4PG9B 3BI9X 4LSUL 5I16A 1LE9B 1ZVHA 2XZZA 2ZSWA 2B1HH 3MCKA 5C1MB 1BZ9B 5TQ0L 4N9GA 2X1PA 4C1SA 1F6AB 1IGJB 3NN8B 2N1KA 2EDOA 5FK9A 3K8KA 1F3JA 5KS9F 5C9JA 3UCRA 4MQTB 1MRDL 1PG7W 1TTGA 4LPTA 4MJIE 3E30B 2VITB 1X5GA 4ODBD 3MOBL 5D2NA 5F7KC 4GXUM 2WQ8A 5JXEC 1OCWH 5DC4B 5TQ2L 2UYLB 1BBDH 1TZHA 3BP4A 4OF0A 5EO0B 5CSBA 2R2BB 4Z76A 4DCQA 1GSZA 4MJIB 1YEJL 2IGFL 1HOCB 1XF5B 4JFEA 2O26U 4JDZA 4MU9A 2VXSL 1JZ4A 1AJ7H 3PP3H 4WFGD 3TPKA 3P11L 4U1IA 1RK1B 3O3UN 4RSVA 2Z4QB 4WB2A 2YD6A 5F88B 1QFPA 3H0TB 4X4YB 4JFPA 5ITBL 2NXYD 1M71A 5DZOA 5E5MB 4BH8B 3ARZA 3FT3B 5DJ6B 3GMNB 2HFEB 3S96A 4OT1H 4Z7NF 4MSWA 2XTJD 5DLMH 4XPFL 3T3PF 1CLYH 4NZDA 3PWLB 4KTEL 4LLWB 4R8WL 1AD9A 2XTLA 5SX5K 2FJGB 3KXFB 4K3EH 3D69A 4LDEB 1UQSB 1JGEB 1RZFL 4AEFA 5DUPH 1F4WH 1UC6A 3PXHA 4CL7A 4OJFL 3VDAA 3LZFL 2XKSA 4PRIA 5BS0D 2AV7A 5DUMH 4U6HB 2AGJH 1UWXH 1P7KB 1IKNC 32C2B 4N0YH 5CD3B 1MCHA 1KENL 4NKIH 1V3JA 3KYMA 4ZRPA 3HI5H 4R7NB 1RURH 1NI1B 3VFUA 5IWLC 3K4AA 4TYUA 4WY7L 4ONFH 3MREB 1MFEL 4HS3A 3GUTB 1Z5LA 4MJ6A 4XMKH 4EUPA 5KANI 1VFMA 1N6QL 1V5JA 2D0HA 1D6VL 3TGXA 3D87B 4WUUB 1EJ6A 1MFDH 4G43B 5DUBA 1OAQL 4NRYA 4ZAKB 2CPCA 4Y88A 4KWUA 1S9WA 3SKNB 4RMTA 5GGTH 3HZKB 2ZUSA 1JZ7A 5E00B 4ZYKA 3G5YB 1T2JA 3QCTH 1I8IB 2NR6D 5D1XA 3TLRA 5F7FA 3QR2A 4WEBH 2QTEA 3VFOA 5IMOA 2Q7YA 3UDWA 3P0GB 3OZ9H 3F62A 5EORL 2CKNA 4WHTA 5FCUH 1H3AA 2E9IA 4U6VL 3EO1B 5JPNB 2X7LA 5EH1A 4GTRB 2ITDA 5EU6E 2CK0L 2QL1A 3I50H 2ZUTA 3VMOA 1V7ML 1C5CH 3W11C 1P53A 1NBVH 4M6OH 5D2NC 2NY4D 4OB5H 4M1DH 3M1BB 2XKNA 3N06B 1A2YB 3VXRA 4NO5B 3VH8G 1XGTA 3OKLA 2CRZA 2P5WE 1EHLL 2ESVE 2W1NA 4FQCH 2B4CH 2XQYG 3RPIA 1A6AA 4P5TB 4MDJB 3T0EB 1X4XA 4NM8H 3QT2A 2VXQL 5JW4Q 5SWQA 4HUMB 1MCKA 2VRAA 3BFOA 3SQOH 3BP7B 3S5LG 2P5WB 1YEKH 5D70L 4JY6B 3QXDA 2A0LD 1A3RH 2K1MA 3GM0A 3DUSA 3IXTB 1IKFL 5C07D 3GSNB 4JPWH 4MMZC 1A1MA 1O5DT 3EO0A 5DJDA 4ZUVA 4P46D 5H37G 2E9JA 4HLJA 5AD0B 1F5WA 5H35B 4YFEA 4B7LA 1OLZA 1MELA 3QUZD 5SV4A 3O3EB 5DSCA 1TNUB 4LLDA 3SHSA 5DJAA 4QRRD 2CRYA 4KAQL 4OCYH 5DD1L 4OSUL 1RVFH 4TNWK 4Y4HB 1B2WL 1YQ2A 4P5MA 4X6FB 3UJTL 1A7PH 2GW5A 4OZFB 1NCWL 2NXZD 1AIFA 1T2QL 1A3LL 3GIVB 3QG7H 1NCCH 4M61B 4XBGA 3E8UH 2BFVH 5C6WH 4LGSB 3DRQA 4PGEB 1MCDA 3FRUB 1T1YA 3QUML 5I8KH 1WFTA 2NY5H 3VA6A 1E4WH 1FPTH 3DSWB 2GK0A 1CTNA 1B6DA 3VDCA 3LQMA 2DQHL 4CVUA 1JUFB 1YN7B 4DK6A 1JGVH 2WY7A 1J87A 3HNTL 4IOIA 1YEHL 1F97A 1TVHB 2ZG2A 1TVDA 1MEXL 4L29B 2VDPL 5DJCA 2ICCA 4BJLA 4PRNA 5C0DB 4P3BA 3RJ3A 2XXCB 4MB3A 4X98A 5I71C 1I1FA 4ZD3H 1CXFA 4LLUA 1QRNE 3UDWC 3BESR 1ADQL 5IHUL 2GJZB 3Q5YA 1UVQA 3H3PH 12E8H 2GHWB 1FGNL 4X8XA 5F9WB 4N8CL 1GJIA 1JWSB 3MZGB 1E27B 5EO9B 2H6PA 3QQ9D 4CU7A 3RWDB 2IALB 5FFLA 2QQLL 5BS0A 4HIHA 3QP3A 4DZBA 1VA9A 5FO9B 2ARJB 1QRNB 2GSGA 1EGJL 4YE4H 4GAGH 4XH2B 2NY7L 4WEMB 4YHNB 3RZCC 2VL4A 2Y06L 3IJSB 1C5BH 4QYOA 2IPUK 1OD9A 4K7PY 5SWSB 3IGAA 2V2XA 2H6HB 3MRQB 3ZKXB 5IEKB 3W82A 4JDTH 3HZMB 4OZHE 5HY9B 4P9HL 4K3HA 4KTDL 3TP4A 3Q3GA 6FABL 3RWIB 3FO0L 3DO7A 1T20B 3QSKB 3DSXB 2OXGA 3GRWL 3KHOA 1UCBH 5FGSA 5T1KD 5D8JH 1Z6JT 4NQTA 2CRIA 1G6RA 2CIIA 1MCOL 3P4MA 3GHEL 1NAMA 1NDGB 2WMPA 1RUQL 4UT9H 5EOCH 1KULA 4GKSA 5BZWA 1S3KL 1T0NB 2IC2A 1ZVSA 1DQMH 4TVPE 5IK3B 4YNYA 2EDEA 2R8SL 1DUYB 4ERSL 4JHWL 4XNUH 1XF1A 4Q6IA 1YYLH 3X14A 2DM3A 1IEAA 2B7DT 4Y19D 3UBXA 4KKBD 1GAFL 4KVNH 4XVUD 4RAHA 4FFVD 1OB1B 5KN5A 4FFZH 3NAAL 3OXRB 3KLDA 4G7YH 5IF0A 1NC2B 3HRZA 5DJXA 1N3NB 2A1WL 2GEEA 3SE4A 4P4KB 1YMHB 3CLEL 3VFVA 1S7QB 4YUEL 2XQBL 1BIHA 3MQIA 4DN4L 5I0ZA 4JR9L 4OCSH 1KSRA 2DLEA 1CR9L 4HF5L 4HD9A 1YPZE 1OAKH 2CJUL 1IM9B 5C07A 5SX4I 5CJQL 3O4LE 1QBLL 2V5SA 1MAKA 4XRCA 1XIWB 5H94A 4P46A 3QCUL 1DP0A 4CUCA 4HDIB 3LQAH 4HWEL 1MVUB 3UJJL 4YAQA 3QUZA 4JKMA 4LNRA 1NANI 1U95A 5A2IH 4NQSB 3DLQR 4M3JA 3WNMA 4U1LA 4QRRA 3EJZD 4JQXA 2EE2A 2BSSB 4IRSD 3VD4A 1A7QH 3NBNA 1UZ6E 3O4LB 3FOLA 1FVDA 3S35H 4X80L 5DXWA 2JE8A 2XOTA 3FB6B 4IJ3C 4GMSH 3IF1B 1TQCB 4JRYB 4PJ7E 1T89C 1UM4L 4APQD 3VFPA 4MAUL 4G8IB 3D9AL 1OQXA 1Q9WB 1RJZA 1Q9OA 4HKXA 5F7YC 2J12B 3MV8E 5T1DL 3QNYA 5GS0H 2ZJSL 2ZOLB 1X5AA 3WS3A 1R3HB 5GGVH 4Y1AB 5CLTA 1N64H 4PJ7B 5EN2B 5LQBH 2MHAA 4WO4D 4X7FC 2NR6C 1U8LB 3HC0B 1KGCD 3H42H 4ONHB 4Y5VB 3BKJL 1BVLA 2BHUA 3DJ9A 2Q76B 4O2FB 2YC1B 5CSZA 1OD7A 4MXWL 4FXKA 3QA3B 2IPKA 2EYTA 3BGAA 5KSAC 5TH2A 4Q6YA 4MB4A 4FQIL 4EI5D 3VFTA 2KKQA 2NY4C 1FL3B 5JQ6H 3AS0A 4LFHG 3FZUC 4MA7L 4OLZH 3MRPA 5IW6A 3ES6B 5IIEB 3GSWB 4HUXA 4OCNC 1O6QA 2X4QA 4K71C 2EIZB 4L5FL 4G80A 3MXWH 4WU7A 1A47A 1ZEAL 4IEFB 1HCFX 3U7YL 1G84A 1RUPL 3DV4A 3SE4C 1RIUL 2OL3L 1U3HC 2ZKHL 4LSRL 5GSRB 4R2GD 4KK5D 4Y2DD 1OP5H 2A0LC 4L9LB 2G5BB 1W0VB 1F90L 1MIEH 1PY9A 2VXTH 5TE6H 4R96B 3STBA 2BNRB 4Q58C 3QCVH 5T1KA 4P46C 3BXNA 4R9HA 1CGYA 4NFBA 2PW2B 1G0XA 4AL8H 4B50A 1JYVA 3U79A 2H6IB 2VZOA 3QUZC 3P3YA 1ADQA 5GS2D 1KV3A 2HN7B 5DR5H 5DRNB 2W0PA 5ALBH 1S7TB 3JUZA 4L1HA 5HHXL 4TUOB 1UENA 2QKIA 3U2SB 2H32H 4N0UE 1N7MH 4QRUB 4PY7A 2WIIB 5JHDE 1C8PA 1MHPH 1QYGL 1EGJA 1MJUH 1IAIM 2FL5B 2DMBA 3GMMB 1P69B 4QTHA 1KFAH 4ODVH 2OR9L 4RFOL 4X5XB 3Q6FA 3BH9A 1JGLL 2EKSA 5D2LE 5IOPB 3T2PA 4H5SB 4P4RA 5JHDB 3PGFH 3MLTB 4KKJA 4FP8H 5DRXA 1XF4A 1M7IA 3FCTA 3MRLB 1IAKB 1YMMD 5EU7C 3D0LA 3BD3A 2BNUB 2OI9C 4XPHL 5HYJD 2W07A 1PAMA 4JDVA 4KI5E 2DQJH 1CVSC 3VFNB 5CEXA 4IIQB 1U58B 3F7RA 2DQGH 3C09B 2AAVA 1HINH 1DQQB 3QFJB 5IVZB 4DZ8B 3PWPE 3PV6B 1OM3H 3I9GH 4C56D 1GZQB 4DGVH 3ZE1F 2R4SL 3RIFK 4ODSH 4IRSA 4K8RH 1A6TA 2DQDL 5EU3A 5CZVL 4UIMA 1A1OA 2AKRB 1QKZL 5HYSG 3HXEB 1T1XA 4HFWA 4JFOB 3IDGB 3PWPB 3RY5A 3O2DA 4G8GD 4O02H 4APQA 4OV5A 3MLWH 1XGPB 2G75A 4F33B 3NH7L 2G9HB 3LVEA 1RZ7L 1PSKL 2AJUL 3SY0A 1T4KB 3R4DA 5I1CH 1MHHB 1QFWI 3ILPA 1MRCH 3UTSB 1MFBH 1R5WA 5KJRH 3SGJA 1T1ZA 4X0KA 4DUXA 4PGJA 1S5HB 4WO4A 5BJTA 3OJDB 5L9DL 3FQUA 3QZWA 1EFXD 4ODXA 2YA1A 3OXSB 3JVGA 4XCCL 9CGTA 1S9VB 2CR3A 3BKMH 2VDQL 1Q9KA 4ZOBA 4KMTH 5DD0H 2M26A 2YPLE 1N4XL 2HFFB 4MNGA 2AK1L 3DXAE 5HI5D 1CK0H 2FX7H 1M05B 5E2WH 1RJLB 4O51A 1KYOJ 2DLFL 2GCYA 3SCMC 2P24B 4KKBC 4P49A 3H8NA 1ZA3B 4XVUC 1YA5A 3FFCD 5C86A 2P49B 3T0BA 3L3JB 1LD9B 2WZPD 2B2XL 4PGDA 4MAYB 1DBAL 3HPLB 5FM5O 5IBUG 1RZIB 3RZWA 5DVMA 3S88H 1KPVB 1I75A 3MJ6A 3I6GA 3BZFB 1XR8A 3O6LH 2B0SL 4XVSH 5BVPH 3MPCA 1UMPA 4XNYH 1I9RH 2V2WA 4E41B 4U6XB 4Y2DA 3D85A 2A73B 4U6YB 4R4FL 1H8SA 1T21B 1WWWX 1KEMH 4OM1H 5DRZB 3RWEB 2R0LH 5ERWA 3SGDI 3I2CL 5HGAB 5ADPL 4BOJA 3R06A 3QUYD 3N9GH 4OI7A 3GKWH 2IAMB 3R0NA 1G7IA 4H0GA 1P4BH 2V17L 2A6JB 2WBKA 5D7JC 4BKLB 5J57B 1K3ZA 1A64A 5DT1L 3EJZC 4IRSC 4QHLA 1IAIH 1AQKH 1KJMA 4PRHD 3HG1E 3QIWB 5J9PA 4MWFB 3GJFK 4Y5YB 5E1AB 4LLVB 3KLHD 2AJVL 3O9WB 2GFBA 3QHZL 1V7NL 4DGYH 3X11B 4PYHA 5TDNB 4P59H 1FZJA 2VLRE 3SDAD 4RAVA 4AIXA 4APQC 3TC9A 4ZPVA 1QACA 1AQDB 2Z31A 2DAVA 3PUCA 4LBEA 5EWIH 2O5XH 4Q7DA 4PLOB 2EDWA 4NUGH 1FFPB 2P8LB 3TIEB 4YDJA 5IJVB 4ZQKA 2Z92A 3RX5A 3CDCA 3KSLB 4XNZB 4GRLC 1KB9J 5K59E 1L7TH 3MRDA 3QBTB 1HI6A 3SGJC 5GSVA 1K8IB 3VCLA 5JW4M 5HDOA 4J6RH 3WHE0 4WO4C 1GXEA 4N8VA 5D7IB 3Q75B 1EO7A 1YMMA 3QWRD 3RWJB 5HYJA 4ZTPH 1DE4B 2VLJB 2P47B 2YUXA 4MB5A 3AXLB 2C3GA 2X41A 3JVGC 1DQLH 3SDCD 4HG4J 1FRGH 3WSQH 1FL6A 3O3DB 5DHYA 3DECA 4NBZB 4H25B 4U1KA 1TCRB 2R0ZL 2ITCA 1H3VA 2PNDA 4C56A 2G0DA 4ELMA 3C87A 2YEZB 4LSUH 4LCWB 4WHCA 4Z7OE 3NFNA 1SM3L 4F58L 4MXQC 4P3CH 1IEHA 2CKBA 5JXAL 3O2VL 1QQDB 2GQHA 3QPQC 2BDNL 1K4CB 5DEGA 5MEQA 4KGLA 2YD2A 3TBYB 4G8GA 3ZE2F 4WI7A 3ARUA 1U91B 5CBEA 3GO1L 2XXMB 3T3ME 3NZ8B 3TZVC 3VFWB 3DTXB 4R2GC 4U1MA 4KK5C 4Y2DC 4P2YA 3T4AB 3C72B 1CDYA 2LTQC 4PD4K 5TQ2H 4YXLL 4BZ1H 4GRWF 5E8NB 4YX2L 4GLRH 3EJJX 5C0EA 1T04B 5F3HA 1HH9B 1H5BB 4M5YL 1YEJH 2IGFH 3FB5A 4JKPL 5EBWA 4I8DA 1EFXA 2DKSA 3P11H 1R5IB 2AV1A 3WFDL 3L5WB 4POZD 4KKNA 4CMMA 1K3IA 1UZ8B 4WW1A 1WT5A 4KRPB 1F2XK 2EO1A 2HYMA 3PDDA 3ZE0E 3RTQD 1J7VR 3Q1SL 5IFJB 3MRKA 2XN9D 4JO2L 4LHUA 1X7QA 1YJDL 4X7DC 3LHPL 4LVNC 5FUZL 3QAZB 4R8WH 2VIRA 1PBYA 1OL0A 4MA3A 5E4EB 4X4XB 2Z31C 4OJFH 1AGDA 5FA4A 4HH9B 2XZQL 3D39B 3LZFH 3GJFB 4GFTB 4XWGL 2V2TB 2BOBA 3MV01 1A4KA 4QHNA 1CFSA 1KENH 2YD4A 1UKSA 1MI5D 4EI6B 3K3QA 3KS0H 4A2LA 1JWMB 4UB0L 2DM7A 1W72L 4F9LA 4EDXB 1GCFA 4NQVB 5C6TL 2R0KH 4WY7H 3F7VB 2BC4B 2W0KA 5EUKB 3O8XB 3MROA 5LGJA 1P6FA 4G42B 4U7KA 3EYOB 4WI4A 3G6JB 1NLBL 2D9QB 3QUYA 1KC5H 3QXAA 2LVEA 1V05A 5GIRA 5LBSH 1YDPB 3HZYA 1DCEB 3LEVH 2VQ1B 3Q48A 4OCWL 1FGVL 4POYA 1W0WB 1J05B 2YRPA 3DROA 3PWUA 3C6SB 1WZKA 2B20A 1TN8B 1IGTB 1K6QL 5F6HI 4OBSA 4PRHA 5GS1A 5DDHB 4L1DA 1HWHB 1PYWA 4EN3D 3VGFA 3TIDB 5EORH 1S9YA 3LRSA 4U6VH 1VESA 3AB0B 3HUJE 1ZLSL 3C5ZB 3SDAA 2DDQL 2CK0H 4HH8A 1FJ1B 4PJBE 1IRAY 1QHOA 3RL1B 3RI5K 1P84J 4P2QA 4RAUA 1JNNL 1EHLH 1I1YA 4IDJH 3P0YL 4PY8I 1AH1A 2IPTL 3CX5J 1OTTD 3JTSB 1JZ2A 3HUJB 4NWTL 3AC0A 4NN6B 3DUHA 4LSSL 3QWRA 1PQZA 8CGTA 3EOTL 5L6YL 4HWBH 4LPCA 1XH3B 4Z7VF 4MD5A 5CINL 3STLA 3VFMB 3SDCA 3ZSTA 2Y23A 1KN4L 4PJXA 1GXOA 5D70H 1U0QA 1WT5C 4HS6A 4M76A 4MHHG 3AU1B 1JK8A 1UXWB 3V4VL 1UACH 4JFQA 4JO4H 4U1JB 1AD0B 1JZ5A 2ZISB 3UTPE 5B39G 5FYKE 1CTOA 2WWKO 3QJHB 3BISA 1B0GB 3V6FA 1A1NA 3R8BB 1CXEA 4D0BA 1FVCA 1I9EA 3IFPB 1A9EB 3GJEA 5I73B 5C0AB 1A4JB 4AH2B 4MX7B 3WO4B 3P4NA 1T7ZA 4RBPH 5DD1H 2FGZA 4PGBB 1GXNA 1LO0L 3LSOA 3E6FA 4X4MA 4EXPX 5E8EB 3ZSSA 3JTTB 1T2QH 1A3LH 5DJ2A 1R5VA 3QNXB 1FFOA 1JVKA 1UM6L 1UB6A 2UVFA 3SDXA 1TNYB 4OF8A 1U92A 1KJSA 2BY3A 1KZPB 4F9LC 4K7PH 4QKXB 1KB5H 2B1AH 1MJJB 3I02B 3BH8B 1IT9L 1P1ZB 1OTSC 1Q1JL 2Z91A 3DMMD 2E7LA 3UYRL 1KN2L 2Q3ZA 1FVEB 3LIZH 3ISWA 3L1OL 3QUYC 4YJZL 4QWWC 3HAEB 1D5IL 2NY1B 1MEXH 3V4PL 5C2BL 3SE9L 4YGVA 4WB3A 1HDMB 2H2PD 1EA9C 2DQIH 2VDPH 1XCTA 4M5ZH 3RTQA 5GS1C 4MA8L 1T7YA 3ARFB 2CDEB 1NMCC 2XN9A 5I1HL 5IHUH 4OQTH 5EA0L 3EGSB 1VADA 5C2UB 1BAFL 3SDAC 1FGNH 2AABL 4NN5C 1FZOA 1P5UA 1OGAD 3VG9B 2QQLH 3BPNB 4WI8A 3BPLC 1DQDH 5DEZA 4XMLL 5I1KH 3K4DA 4MZ3A 4Z6AT 4A6YA 1EVUA 1O0VA 1XGYL 2CLVA 3MJ8B 1MI5A 2HVJA 4D0DB 3OG6B 3MJ9L 5CMAB 5JDSB 3CFBB 4L3EE 5DQDL 3O6FB 1NAKH 4G6JL 4NQUA 1WBYB 3D3VD 5IFHH 4PREB 3SDCC 4HCRH 4HKJA 1JPSL 1UH3A 1YEFL 3FONA 4P9HH 4KRLB 4CVZA 1IC4H 3FO1B 3GSVA 6FABH 1T7XA 3FO0H 5TDOA 3Q73B 1D5XB 1MCJA 4TPRH 2FGWL 3GBNL 1KBGL 4EVNB 4EUPG 3GHEH 5T5NF 1NCBL 3OJVC 4NKOB 1FYTE 1F11B 1DLHA 3HR5A 2DTML 3G9VA 4EN3A 2IADA 4RFNB 3PHQB 5DHVH 3CAFA 1J1OH 5J89A 3F7YB 2N7BA 1G7QB 2NPLX 3C9NB 4HKBA 3BHBB 2R8SH 3WLBB 4ERSH 1C12B 1YC8A 4HC1L 4JHWH 2FSEA 1FCGA 1HH6B 3KXFD 5JW5A 2W92A 5TFSH 1VERA 4PJCF 3VFRA 4JN2A 2E7LC 2DD8L 3IAGC 4AYFA 1GAFH 2GSIA 2EC9T 1CE1L 3CLFH 5B4MD 3TH2T 3WV0A 1IEBA 4J2XA 1P7HL 5FDWA 2WP3O 1AR1C 3W39B 5DVKA 1I3RA 2A1WH 1QR1A 3L7EB 3CLEH 5EOTB 4YUEH 3KPPA 1VSCA 1AE6H 2E6JA 2XQBH 4WTWA 2AJSL 5K9KB 4DN4H 4JR9H 4UV4L 1BREA 2PTTB 4UQ3B 5E0QA 1CCZA 2CJUH 3RUGB 4PJXF 5CP7A 3CX2A 2P8PB 1V3MA 3BPOC 4WUUD 5E03A 3HNVL 5CEZH 4ZAKD 5EUOA 1ND0B 5J11C 3GSNL 4XXDA 2NY3B 4LAQL 5JOFB 3MLXH 1HKLL 4OFIA 4NJ9H 4IHOA 2NW3A 5CSGA 3RDTB 5JMRA 5JORA 1BQHB 3L95B 3SPVB 1N8ZB 4BK4A 4X80H 4M7LT 4OZIE 5IP4A 3L3HB 4F7EA 5I1LA 4GRMB 3OPZL 4NO0B 1Z0MA 1J8KA 1GXMA 1JFQL 5TJWK 4CVXA 1UM4H 1I4FB 3ZHLA 4Y8AA 4MAUH 3D9AH 4DFHA 3LKNB 4JLRB 4X99B 4LSTL 3HCVB 3F58H 4OZIB 4JY5L 1S7UB 4R0LB 5T1DH 2YWZA 2ZJSH 4G5ZL 3UJIH 3HQBA 5LWYL 4U0RC 1XGRA 3T0ED 2A6DA 1JCQB 5EBLA 2ENYA 3HI6L 4PUBL 1RD6A 1F4HA 2V5YA 1BVZA 4H1LA 1MWAL 4JGMA 2HRPH 4PTUA 1UKQA 3MRGB 2P1YA 1QPXA 4EN3C 1YJDC 5C0BE 4L4VA 2H41A 5FYJD 1P2CA 5J4MA 3OR7B 4MXWH 4BFEA 1Z9MA 2H9GA 4P23B 2NLJB 2I60L 1OGAA 4URTB 5DQ9B 1LE9A 4J12A 3VFSB 5KG9B 1BZ9A 1K8DB 3TBTB 5FDYA 2OCFD 4S10A 5C0BB 3QFDB 1F6AA 1OTTC 1IGJA 2IF7A 1U95B 3NN8A 4P57A 5E9DD 4AEHH 1FO0L 2WBJB 1CS6A 1J8HE 1CGTA 4MBGB 3A0OA 1JF5A 3MUHL 1ZEAH 2VITA 1CGSL 1OLLA 1RUPH 2OL3H 5T3XD 5IT2L 1D7FA 3D3VA 5C0RH 1H35A 1G7LB 3C2AH 3NIDE 2IEPA 4LSRH 3VXOB 3GI9L 1AY1L 4KMLB 1Q8MA 4G9DB 2X05A 1LK2B 1F90H 5EO0A 4PJBF 1J8HB 4XT1C 1ZGLM 4O2CB 3DPBA 2ARJQ 5I18L 2ZOKA 1XF5A 4OCRL 5EIIB 1GGYA 4RGND 3C60D 3ZL4L 4CGTA 5C09E 1RK1A 3RP1A 2Z4QA 4FTVB 5F70A 3GK8L 3M8OH 3T77A 1WCBB 4N9OB 4DTGL 4KTYA 4QHMB 3MRCA 4QHUB 1LE5B 5AZ2H 1NLDH 4JJ5A 4K94H 3V8OA 5E5MA 4BH8A 3FT3A 5HHXH 3DX7A 1ZT7B 5DJ6A 3GMNA 3FB8B 4MVBD 4M7JL 1KOAA 5L2KE 4JFZH 5C09B 3X13B 3PWLA 2AEPL 1QYGH 2FJGA 3KXFA 1JGEA 1S7RB 3IDNB 5AAMA 1C3DA 3QI9B 1NDMB 1T3FB 4U6HA 2V5MA 1FHGA 1EMTL 3FAWA 1KJ3L 3O3BA 5EG6C 2SEBB 3K0WA 5CD3A 3DSFL 3LY6A 4R26H 5L2KB 5CWSB 1TETH 1I85A 1TJGL 2C3VB 3FHQA 4TVPL 4R7NA 2H2PC 1OTUD 3LDBC 2W9EH 3MREA 2BSRB 5K33A 5SWSD 5B3JF 5GGRY 3GUTA 5EC1A 4WW2B 5CAYB 2R2CA 1MFNA 5DMKB 5I9QC 1G0YR 3VRIB 4RISL 1TQBC 4WUUA 3JWOH 4G43A 4ZAKA 4K23H 2DMKA 5ACLA 2AW2A 4BFBD 5EPMB 1WTLA 2XWBB 2F54E 3I6KB 4NQCE 2MNUA 5E00A 3RGVB 5CD5D 3B5HA 3G5YA 2LV4A 1I8IA 2BSTB 4TULL 1D5ZA 1VKXB 4QHKI 1HN1A 2AXFA 4JRXE 1FC1A 5CZVH 3JV6B 1ZANL 3EO1A 5JPNA 2NY0B 3T0WA 2DWDB 4LKCA 4PRPE 3REWB 5HYFA 4NQCB 2XFXB 1EK3A 5JQHC 3NH7H 4D9LL 1A2YA 1B4JH 4NO5A 4JRXB 2MTPA 4QXWA 1T03L 5SV3A 4U4BA 1GIGL 1XFPA 1RHFA 1B88A 2ZCLL 1QLRB 4KK6D 1IGCL 1ZTXL 4P5TA 4MDJA 2ZNWA 4E42B 1INDH 4PRPB 3T0EA 1NC2D 1OP5K 2HT3D 4Z7WF 4UAOB 5I8OH 4QCIB 4PPTA 5HGHB 4P4KD 4DFIA 3QG6A 3HFMH 1RZ8A 3T8XB 4Z18A 5DF0A 5C3LD 4JY6A 2RJMA 2VDQH 2X6MA 2D03H 2DJUA 2X9YA 5GRZA 3IXTA 4DVRH 2VERN 4GKNB 3NPZB 4KJWD 2CXGA 1BD2D 2AK1H 3N1GC 4AG4L 3V6BR 1XIWD 4NN7B 2V9TA 2BVTA 5JR1L 3NFSL 5AD0A 5H35A 5CLWA 5FHAL 2XZCH 1G9NL 4U1NA 1WLHA 2A6KB 4LDOB 4POUB 5E9DA 1XF3B 3LN9A 5B4MC 3QPXL 2B2XH 3VI4F 4Y4HA 1G1CA 4XX1G 2VABB 4X6FA 1OAUL 4JZNA 3UYPA 3GIVA 3PDOA 4QOKD 1RULL 2G2RB 4I2XB 2J8UE 1NCAH 3VXNA 2B0SH 3DVGA 4JKLA 2I5YH 4M62H 1I85C 4DKEL 3ARDB 4PGEA 4JRYD 3FRUA 3DHMA 4H26B 4R4FH 2DKMA 2HT4D 5C8JB 1GOFA 2DQCH 1WSST 4QY8B 4NNXB 5GQBA 1KJ2A 4HUWB 5EBGA 3I2CH 2FR4B 2J8UB 5ADPH 1YN7A 2BVEA 5AYUH 4ZAKC 3V4UL 3TYGH 1TVHA 4MQXD 4TRPL 4Y1AD 1CFNB 2J3SA 5DQJA 2V17H 4LPXA 4UUJB 2C7UB 5T5FL 1U6AL 2HA1A 3I85A 5C0DA 5E56A 5I1DB 1FNSL 2R1XB 4R4BB 4OIBA 3NCYS 1FAKT 1K2DB 1F4YH 3B2VH 3QHZH 1V7NH 1OP3K 3K2UL 1JWSA 3T65B 3Q78B 1E27A 3NIGE 1H3TA 2WV3A 3KPQA 3RWDA 2IALA 2BY0A 4GTOB 4KVCL 2ADIB 2UV3A 1LDSA 2J8OA 1J10A 2ARJA 4MLIA 5FO9A 1QRNA 5I75B 1G7MA 2OMBA 1C5DB 5E2UH 4OGZA 4P5TC 2KQMA 4YHNA 4E0RA 3VXTB 3T0EC 3KR3L 2CLRB 1MCLA 2OR8A 2EIEA 3IJSA 4L8BB 3JXAA 1TTFA 1W6KA 3BKYL 1V8HA 5SWSA 3BIAX 4JFDB 4OFVA 5KSVB 1H3CA 3NCFB 5IEKA 4CAGA 1QFWL 2DI8A 3RAJL 1M4KA 3HZMA 3CSPA 1KIQA 4MZ2A 1RJYA 3RWIA 4YDEB 4FFYH 4Z9KB 2IH3B 2R0ZH 2BNRD 1D9KB 3FQNB 3PHOB 3AAZB 5DD3H 1NMBL 3S36L 4GUPA 2XNAB 4ETYA 1CD0A 1U8IB 1NDGA 3BSZL 5DWUL 4FNLL 1SM3H 4NC2B 3W0WD 2J4WL 3BPCB 2H1PH 3ALWA 3EYQC 1TNOB 2X9XA 4Y4HC 1T0NA 4N0FB 5C0CB 4NHUB 1TJHL 1IGIH 5IK3A 2X1OA 4NPYB 3SJVE 1B6UA 4QXUL 4YDVB 1DUYA 2QSCH 3GMLB 1E6JL 5FYLH 4BYHA 2H32B 3GO1H 5E6IB 1OOAA 1X4ZA 4JZJB 1JHKL 3O3AB 1OB1A 5F1OB 3OXRA 2IH1A 4D4DA 2VXUL 4YX2H 3SJVB 1NC2A 4LLAA 1BECA 1LGVA 1F45A 4P4KA 2E9WA 4XMPH 1YMHA 4M4RA 1RJCA 1S7QA 3T1WA 1B0RB 1BOGA 5IFAH 3X12B 1B3JA 3GZKA 5CUSL 1IM9A 3K74B 3GMQB 1BD2A 3V7AG 2EZ0C 3OKKB 4JO2H 1XIWA 4Z95H 2VC2H 3QZWG 1VEMA 3NIDF 4W70A 5FUZH 1JCKA 1ZHBA 3QFJD 5F9WC 5F6IB 2AJZB 4NQSA 3CXDH 4GKZA 2BSSA 3RPKA 1KCVL 2EC8A 4LLMB 4XWGH 2A83B 4QOKA 3QJFB 1WZ1H 2J5LB 2AXGB 3FB6A 5DMGD 4HGMA 4JRYA 5BCAA 1N6VA 4UB0H 5F96H 1OTUC 1PEWA 1W72H 3KPMB 4QXGH 2Y6SD 4X6DE 4OGAD 5C6TH 4G8IA 5EZLA 4GG8B 3ZKXC 2P7TB 1Q9WA 3V5KB 2VDLH 1AGCB 5GJSH 1NLBH 4M1GL 1GOHA 2ZOLA 2ZUVA 4U3XA 3UTSD 3TVMB 4OGXL 5ITFA 1R3HA 4Y1AA 2OQJB 4JAMA 3QDME 4PJ7A 1SY6L 5EN2A 1J0ZA 1U93B 3V0VB 4X6DB 5CD5C 4JVPA 1QTYT 2AK4E 1ITBB 1U8LA 1RU9H 2DLHA 2P5EE 4GS7B 4S1QL 2ZCHH 3MJGX 4ONHA 5L88H 4Y5VA 3I75B 4KUZH 4RWHA 3U7AA 1N2RB 5F7UA 4O2FA 2YC1A 3MBED 1O1TB 2IQ9H 3QA3A 4XZUB 3QDMB 3SFYB 1FBIL 2DDQH 4I9WD 4FQQB 1VACB 3VE0B 1OF2B 1FL3A 1KPRA 4RA0C 1S78D 2ATPB 1N4RB 1YYML 3FN0L 1C16B 3ES6A 5IIEA 1CXKA 4KK6C 1JNNH 4CBPA 3ZMRA 2IPTH 2EIZA 4KUCF 1GSMA 4M1CD 5DMJB 1AO7E 3IDXH 3STZB 2DICA 4NWTH 2HT3C 4QGTA 5D1QD 5F89B 1DSFH 3ZYOA 1JZ6A 4P4KC 3QDGE 5K93A 3EOTH 1H0DA 5GSRA 4DOHE 4HMDA 4E41D 3IVKA 1FH5L 1JNLL 1KN4H 5ID0B 2G5BA 1W0VA 5D5ME 3MLYL 4NC1E 1AO7B 3KAAA 5E08L 1L0YA 4KJWC 1ZT4A 2BNRA 5ILTL 5F72S 1XIWC 5JOPE 4N8VG 1YEDA 3N0PB 4D9RD 2PF6A 3QDGB 2PW2A 2IAMD 5D1ZB 1Y6MR 3O11B 1ZE3C 3W0WA 1BM3L 3UTQB 3GI8L 4DOHB 5C7XL 2VQTA 2HN7A 5DRNA 3MYJB 3O6KL 1QQFA 3MA9L 2J1KA 5D5MB 1BLNB 2I26N 3EFFA 4F7CB 4TUOA 5DK2B 3QEQB 1U8KB 1PKQE 2W38A 3T04D 1LO0H 1U8JB 4HV8B 3U2SA 3Q6GL 4X9BA 3J7HA 4QRUA 2WIIA 3W5MA 1TQCC 1UM6H 2CDGA 3RWFB 5FCSH 2FL5A 3NA9L 5FXCH 4RGOL 2OTUB 1IT9H 3NZHL 3NIFF 2HT4C 2OX5A 4FXLA 4NOBA 4Z8FL 2C3XA 2FHFA 4IMLB 1PKQB 2OJZL 1YEGL 2F8XC 3HN3A 4EQ2A 1FE8H 3LKPB 3BOVA 3MGTB 4UZGA 3WKNA 5IOPA 4NCC1 4H5SA 5IJKC 4MQXC 3ELAT 3WBDA 4JQVA 1AGEB 4X9HA 4NWUL 2VLKE 5GISL 5ETUB 1P4LB 3V4PH 2CXKA 3SE9H 1DL7L 3WD5H 2VL5B 1LO3H 3MRLA 1IAKA 3JWNC 3VGBA 5IVXA 1W6JA 2N4IA 4JEGB 2BNUA 5HHME 2VLJD 3FT2B 4Y5VC 1AXIB 1DBJL 1UJTA 1OPGL 2BVPA 3VFNA 1QEWB 4IIQA 4HKZB 4I4WB 4CN6A 1G9NC 5BO1H 1DQQA 2QJDA 1BAFH 3QFJA 5DC0A 4DZ8A 2HRLA 1CU4H 25C8H 4YHYB 1VHPA 1IAII 4LCWD 1GH7A 1MREL 4X6CE 3IU4L 3MXVH 1EDQA 1QO3B 4H8WH 4CRPA 5GRYA 3JV5A 4XBEL 1DQJB 4ZDHB 2AJ3A 1JF1A 4JFOA 3MJ9H 3IDGA 3PWPA 4GBXB 2XT1B 3VH8B 3WEXB 4I18A 1AGFB 1VGEL 5IB1B 1XGPA 2WUCL 4Z0XB 5DQDH 1D6EB 4G6JH 2G9HA 4X6CB 2H45A 4FQJH 5F6HJ 1NL0H 3R1GL 3WNLA 1DN2A 4LCUB 2IBGA 5KS9E 3DSVB 1T4KA 1SMAA 4KQ4H 4L9LC 4JQIL 3ZYIA 4L4TE 2YBRA 1CLCA 3UTSA 5DEFB 3CZFB 4QRQB 4LNBB 3HC3L 5GRJH 3RL2B 1S5HA 2QADD 3GBNH 4ZG1A 4OLWL 1ZS8B 3E2HB 1MRFL 1NCBH 4PGZA 4U3HA 3OXSA 2JIXB 2D0GA 2CDFB 3FO9B 3CPLA 4L4TB 4PBVC 1VB9A 3MBEA 3ZKND 1EAPA 3S37L 2ZUWA 3H7BB 1P7QB 5T5NG 3RWGB 2HFFA 2YHGA 4ZS6C 1O7VA 3PE9A 4I0PD 3QWQB 2WUBL 1K4DB 2KDGA 1HSBB 4RBPK 4GG6E 3BUTA 1RJLA 4U6TA 3QHFL 5LAXB 2HAZA 2P24A 1ZA3A 2DD8H 3VXQA 3L3JA 4ZS7L 3UROR 3D39D 3K1DA 4MAYA 5E8OB 3HPLA 5IROA 1CE1H 5KOVC 1RZIA 5FM5M 5D1QA 3KLSA 5T3ZE 3BEWB 5GJTL 3EDKA 3T0AA 1AFVL 3CSGA 4JQVC 2FRGP 2EEDA 2HJFA 3ARPA 5FGCE 3QIBD 4E41A 4N5EC 4U6XA 2V9RA 1CG9B 2IANB 3K8MA 2Y5TB 4J1UB 3ROOA 1T21A 3NMEA 4UV4H 3I6LD 4BZ2H 3KVQA 5CIPH 4GLRI 2VISB 3RWEA 4KK8D 4NQXA 2WK2A 1ZT1B 4WFEE 4IIQC 5HGAA 1N0LA 2F5AL 5INDB 4D8PA 1HHHA 3C09C 3E34B 3HNVH 4JM2B 2IAMA 4JANA 4DVBA 4OF7A 5FGCB 4WV1B 2G60L 1FNGB 4BKLA 1NAMH 3GKZA 4P2RE 2R15A 1HKLH 5BV7H 2EE3A 2F5BH 4KI5C 3REVB 4PD4J 3K7UA 4MWFA 4Y5YA 6CGTA 3UEZA 2WLZA 4LLVA 5C71A 2MCPH 3OPZH 1EVTC 3O9WA 3OTTA 1BPVA 35C8L 1HZHL 3X11A 3I3EA 2Y6SC 3ULVF 1JTPA 4P2RB 1AQDA 2JKXA 5FYKL 2YD3A 3V0WL 4Y16D 3TV3L 1FFPA 4FQ2H 3D0VA 3MCLH 4TNVK 1IE5A 3V5DB 4Z7UB 5CILL 4U31A 4Z77B 1F6LL 2I9TB 2EDJA 4G5ZH 3O2WL 1PX3A 3RVVD 3B9AA 4M6NH 5D7IA 4KH2A 3RWJA 4WDIA 1DE4A 2VLJA 1MLBB 4UOW1 3AXLA 1MWAH 1XGUA 2XY2A 4R97B 3GFUA 1T6WA 1NL4B 1A7RL 4WFHE 5IVXF 4R90L 3BQUB 3C5SB 4I3SL 4P2OD 3DV6A 3O3DA 1MCNA 4F8TA 4H25A 5D7SH 3LCYA 1PG7H 1TFHA 4NZRL 4LSQL 4P99A 2VSDA 3K7XA 3RVXC 1KCSH 3TBVB 2OI9B 2I60H 4LLQB 3MX0A 2AJYH 1S78C 1FAIH 1L6XA 4LCWA 4HIXH 1RHHB 1MJ8H 4LVEA 5C0AD 3HPJB 3TCLB 3DX9A 3H3BC 4G7VL 1ZGLP 4MAYC 4PLNC 5IROC 1ZA6B 5FA3A 3ULUE 3O4OB 2FB4H 2B1HL 2E7MA 1MY7A 5C70A 3D18B 3MUGB 1CGSH 2DLIA 2CGRH 4NCDA 4PJDE 3UAJC 4PJIB 1HHGB 3NZ8A 1OSPL 1Z9SA 3UTTD 5BRZD 3UTOA 1N95B 2VR9A 3QUMB 1T04A 2X4TB 5J1AB 3MLZL 1HH9A 1H5BA 4LQ1A 4EZMA 5I18H 5FF6B 1JCRB 3SKMA 2IAMC 1EERB 1R5IA 2Z35B 4QRTA 2QBWA 1JMZA 3FQWB 3DVIA 1G0DA 3CFDB 5I19H 1UZ8A 1I7ZB 3LPWA 2FEEL 1VFBB 1YNTB 3QIWC 4HQQH 2GUOB 4Y5YC 1AJ7L 4I0PA 5IFJA 3MNZB 4K55A 3VMNA 4EOWH 2X4RB 5TGBB 3O9WC 4OLYL 4PR5A 3MFGB 2VO5A 2EYSA 3U82B 4X4XA 4OF5A 2OZ4A 4LARH 5F9OL 2FEDC 5HHOE 1PX4A 3TT3H 4HH9A 1EHNA 3D39A 3N1QC 3GJFA 1JHTB 1H3GA 2V2TA 1EMTH 1H3WM 5DLML 2Y72A 1KJ3H 4XNZC 1T5XB 4JJHA 4LU5H 5CGTA 4K3EL 1RZKL 1M6OA 1H3XA 4GXUN 4EI6A 3LN4B 1MSPA 1JWMA 1TJGH 4JGUA 3QIBA 3SCMB 2VUYA 4TVPH 3ZDZF 3LB6D 4EDXA 3F7VA 3O6FD 2BC4A 1HHIB 2C26A 1XZ0B 3FRPA 5HHNB 3EYOA 3G6JA 4YEFA 1R3IL 4M8VA 3HI5L 4JFHD 5I8EB 3O6MH 1QVOA 4D4CA 3K8LA 4WEUD 1YDPA 5JIPA 3FMGH 2VQ1A 3NCBB 4GMTH 5K9QG 1JE6A 4GTMB 4HPYH 4OCMC 5ANME 1QFWM 1W0WA 2GAZA 4YHOH 1J05A 3MGAA 3C6SA 3IB4A 1IGTA 1N4SB 1BFTA 1MFDL 3FT4B 3QIUB 3MFFB 2UWEB 3TIDA 4AMKH 3B6SA 1JN6B 4PJEB 5GGTL 1LNUA 1X5FA 3C5ZA 1N59B 5DHVB 5L0QB 3QCTL 3CD4A 3GMOA 4ZFFB 3RL1A 1Y6KR 5C08B 1T83A 3B2UC 5HSFA 5FCUL 5I17B 1T03H 3IDMB 1GIGH 3U9UB 1SJHB 2RFXB 2XA8H 2ZCLH 1IGCH 1ZTXH 3I50L 2E8YA 3L9RB 4K9EL 1H5BC 4FQHA 4YFLF 4LRNH 4M6OL 4CNIA 1I9JH 2QQKH 4NO2B 3KNBB 4M1DL 1OWRM 2GY7B 1YC7A 3HNSL 4AQOA 1XH3A 5IESL 2NTSP 4FQCL 4HUUB 2CH8A 5CEZE 3VFMA 5HBBA 5D7IF 2VE6B 3B9KB 4KRPC 2PW1A 4MXVE 4NM8L 4HIEB 4XWOD 3AU1A 2ADFH 3D5OF 1UXWA 4Z78B 2R1YB 4U1JA 4N8PA 3PGCB 3D2UB 3DYMA 4YPJA 1QSEE 2A77L 4TSCH 1FDLH 4AG4H 3SQOL 2XKUA 3QJHA 1B0GA 3AFLA 3GSQB 1U8OB 3INUH 3QAZC 4H1LG 3BP5B 4JHAL 4ZFOL 1DANU 3ARGB 3NFSH 5E4EC 3IFPA 1A9EA 5FHAH 1WTGT 4U7MA 1A3RL 4CU6A 5C0AA 4LK4A 1DVFB 5HDQH 4AH2A 4YDLB 4MX7A 3K81A 1KIRB 2ED8A 3I84A 3RDTD 2EDLA 4PGBA 3T0XA 3A6BH 3JTTA 5KSUB 1TZIB 3QNXA 3O2DH 4NO0D 5FKAB 5IB2A 3TF7C 4DKEH 1QUNA 5SWZE 3UTTA 3Q7AB 4OCYL 3U4AA 1OVZA 3BH8A 1RVFL 3I02A 5IBTL 1JNJA 1P1ZA 2RB8A 4GRWH 3O8XC 3D48R 3M17A 3T1FB 3ALXA 2VKWA 2H6FB 1NCCL 4RQQB 4DKFL 2BFVL 2EXYD 4Q9RL 3SGEH 1N5AB 4QRPE 1ERNA 3HAEA 4CJ1A 3L3GB 1HDMA 3GSXB 4XNMB 4NFDA 3V52H 4LCCB 4TUJA 1JGVL 1FNSH 1BWWA 4KKLD 4PJ8D 3ARFA 2CDEA 2VSCA 5KANG 2R4RH 3CGTA 1J12A 1VCAA 4MNQB 5TF0A 4BELD 4LF3B 4ORZC 2WLYA 3EGSA 4FRWA 3AB0C 3C5ZC 5D72H 3K2UH 3WE6A 5B38G 4ZD3L 4BH7B 1T83C 3W9EB 1ZSDA 1KPUB 2BY2A 5HYSB 1I7RB 3GHBL 4OV6F 1T2XA 4NO3B 3H3PL 12E8L 1I1CA 1MH5B 3NFPB 1H37A 3FAXA 3MJ8A 4UINH 2WBJD 2GKIA 4NFCA 4X8JB 4D0DA 2VN4A 5IM7B 3L6FB 3CFBA 4NN6C 3BKYH 5MHSD 4KV5E 2C4FU 3O6FA 1WBYA 1PGRB 4YE4L 2R23A 4QHKJ 4GAGL 3UMTA 4XP5L 2OL3B 4MA1B 2HLAB 3IFLL 5JTWA 2SQCA 4NSKB 4LRIA 3FO1A 1C5BL 4ZXBB 4I0KA 5IEHB 1D5XA 4FQ1L 1WIPA 4W4NA 5FO8A 3S36H 2X44D 3MRMB 1IQDB 3TO4B 4EVNA 5GS2H 2JCCB 1U8MB 4FTVD 4JPKH 4NKOA 5I73C 1F11A 1UYWL 3DURB 2MQCA 3MV9E 3L3DB 2E7CA 3WO4C 3ZT6A 3W81A 5EC2A 1D5MB 2AS5M 2FATH 1NKOA 1TJHH 4PJ5D 5JZ7D 1G7QA 1MUJA 1MNUH 3BHBA 4UT9L 4F37F 2Y1VA 3V6OA 3BMWA 4R7DB 1HH6A 5IBUB 4PB9H 5DS8B 1ZAGA 2R39A 3MV9B 1T7WA 1X5KA 4L8CA 3C8KB 4XHJC 1UT9A 3QI9D 1JHKH 1GC1H 2HT2D 2XG5A 1T0MA 4GAJL 3LEXA 2Q87A 4OKDA 5J3HD 3W39A 4NDMA 1XT5A 1YYLL 2BRQA 2QV2A 1Z3GH 4ENEC 3L7EA 4XNQB 4MYWB 5IG7B 5EOTA 2NY1C 1FZKA 1UXSB 4KVNL 4XP4H 5C0IB 4FFZL 4PJ9B 5B8CA 4UQ2B 4O2EB 3EOBB 3ULUF 4G7YL 2PTTA 5CUSH 4UQ3A 1KT2B 3V6ZB 1LEIB 5IR1A 3RUGA 3ARFC 3T0VA 4PJDF 1KLFA 3D25B 5HGDB 5JMOC 3IXAB 3OSKA 1ND0A 4F80A 1H3UA 1MIML 5JOFA 3QYCA 3VG9C 1OAKL 1A14L 5CZXD 3RGVD 3BPNC 3IKKA 3RDTA 2CKBH 4J3WA 1KCVH 3L95A 3EYFB 1N8ZA 5FOJA 1CN4A 1JPTH 1GGCL 4GRMA 3VRJA 4NO0A 2NY0D 4ISVB 5IB5A 5I8CA 5FGRA 3RGHA 5ACZB 3LB6C 3SDDD 5DJYB 4JFFB 4NZUL 4HIJB 1I4FA 3O6FC 4UBDD 2YSSB 5M95B 4X6EB 1ZHLB 2W60B 4JLRA 1CFQB 4X99A 2FIKA 3W5NA 4NZTL 2YD9A 3MRBB 4MD4B 4GMSL 4G6KH 5GGUB 4ODWB 1C7SA 5C0FB 1JCSB 1S7UA 1B4RA 4R0LA 1EJOH 4LRIC 2YUZA 4M1GH 2L4OA 2EDRA 1KNOB 3G9AB 4ZNEA 1SY6H 4UU9B 1LO4L 2VUOA 4OF6A 3L5XH 5T1LB 1EZVX 1N5YL 4M43H 2DQFA 4OLUH 3FJTA 4KHXH 3IJYA 4RFNC 1HXMB 4HXBL 5GGVL 1N64L 1XR9B 4F7MA 3IAPA 4XXCA 3OR7A 5KZCD 1BX2B 4M7LH 5BVJA 5LQBL 1WIUA 4PJFE 5EZIL 2NLJA 1WBXB 1TNMA 5KG9A 4U1SB 3D1MC 3TBTA 4OTXL 3FN0H 2BCKB 4GJTB 1F4AA 5C0BA 3QFDA 5JW4R 2FJHA 4I3RL 3DVNB 2FO1A 1VPOH 1EHAA 2WBJA 1NFDA 1HXYB 3MRJB 4NBYB 3MV7E 3ZYJA 2W65A 4X9IA 5JQ6L 4YHZL 4NCC2 3PQYD 4C59B 4OLZL 3NTCL 4BA8A 1EO8H 1FIGH 2XWTB 4IOSD 3ARDD 2WANA 4OLXL 3HKFA 1FH5H 2YUWA 1IC1A 4G9DA 3H9SE 4N0CD 4MJ4A 4XWOC 5D7LE 3MLVH 3OAYH 1TMCB 2YXMA 1HSAB 1J88A 3MV7B 3HHRB 4CADA 5EIIA 2KH2B 4ZUSB 4ALAH 4F2MB 1U8NB 5GS0D 5JXED 4FTVA 2NY3C 2VXTL 5C7XH 4HEME 4MCZB 5KSBE 4XPAH 4QHMA 4Y7MA 1LE5A 1J1PH 1GPOL 3KLAA 3QCVL 3RDTC 4XBPB 1FN4B 4JM4H 1ZT7A 4S1DC 3FB8A 4AL8L 1QLFB 4YZFF 3BKCH 1PJ9A 1XEDA 3LEYH 5C09A 4HS8H 3X13A 5DR5L 1KCRL 5ALBL 4QTIH 1IC7L 2DBJA 5IQ9A 2I07B 3NA9H 1QSJA 4F8QA 4D0CB 4OZGA 2X40A 4V1DE 1S7RA 3IDNA 2EKJA 2F9BT 3QDJB 3QI9A 1WC7B 1WVZA 1RK0B 1T3FA 1NSNH 2OJZH 2EXYC 2XY1A 4R0LC 1MHPL 2SEBA 4AY0A 5L2KA 1MJUL 2WM0A 5E1HB 5CWSA 1IJ9A 3RJDA 2B4CC 3MMEB 2C3VA 3BEVA 4NWUH 4WFFE 1KFAL 1DL7H 4MDIB 3WFEH 3WFBL 4EKXA 2BSRA 4FS0A 4JFDD 2VJXA 1U41A 4ELKB 4KKLC 2OTWB 4NRZA 3CIQA 3TNNB 5MENB 2EDYA 3VRIA 5I1EL 4M7ZB 3PGFL 2QSQA 3NCJL 2Q86B 4FP8L 4ZFZB 4Q9QL 2W59A 4NQDE 4P23C 3HE6B 3LPFA 5EPMA 3CNKA 2XWBA 3QH3B 4OD1L 4E5XB 4Z0BL 3BW9B 3RGVA 2ARWA 1PFCA 3BYYA 2DQJL 2BSTA 5FYJU 3VXSE 1MREH 3JWDL 2DQGL 5FYLE 3RU8H 4AK1A 3MR9B 4K2UL 4OGYL 4QO1A 5IMKB 2VLMD 2WBJC 3IS0X 3B9VA 5J6HA 1OM3L 5C0CD 3ULVL 1UJ3A 1QBML 4W81A 3SDDA 3REWA 4OUUB 4K8RL 2XFXA 1VGEH 1J0HA 4HIIB 3VXSB 2D7TL 3KPSE 2APXA 2VDML 1Q9LB 4JQIH 1DUZA 3WHXB 3P30H 4H0IA 4JFXB 2NY5C 3VGAB 4PRPA 3VMPA 3TJEL 3HC3H 1CGUA 5HGHA 2WIMA 3KWWB 3KPSB 4ACPA 1MRFH 5LXGH 4LCYB 3T8XA 5B39B 1MFBL 3IETB 2IPUG 3BZEB 4J3SA 4LSVH 3E32B 2Y36H 4GKNA 3FQRA 4WU5B 5EZJB 3VDBA 1WBZA 2EECA 1RPQA 4OLVH 3AUVA 1MF2L 2R69H 3BKML 3PL6B 2LU7A 5ICYB 3H9YA 4KMTL 2MQ0A 5D6DC 4NRXA 3QI9C 2ZSWB 4LAJH 8FABB 1IC5H 3K4ZA 4ZS7H 3S3JA 5JOEA 3MCKB 1EV2E 2HT2C 3PDGA 1CK0L 4JHBA 2VABA 4A6YH 3LS4H 1S9XA 4WENB 5J3HC 4YWGH 1NGYB 2EYRB 4I2XA 3WNPA 5E2WL 4DGIH 2VZUA 3QQ3B 3MRFB 1NFDF 1FL5B 4HWNA 4CMHB 1AFVH 5A2JH 3ARDA 1JIBA 1WZMA 4GTSB 4JFEE 1G7HA 3U83A 4H26A 4NJAL 5CHNB 3ARBB 4WW2C 1W72B 5EBMB 5C8JA 3SQBA 3GSUB 4DW2H 5ISZD 2Z0BA 1RAMA 3O6LL 4QY8A 4XVSL 4HUWA 1R6VA 5H2BB 5BVPL 5TF1L 2FR4A 3EKCA 2F5AH 1IMHC 3BP4B 1RIVH 1I9RL 4ORGB 3TVMD 1I7TB 1CFNA 4DCQB 2DIJA 3HR6A 1KEML 1FG9C 5CZXC 3RGVC 4N90E 5DVLA 5DURB 2R0LL 1CFVL 5I1DA 2R1XA 2V8IA 3LAFA 4R4BA 5IBLC 3N9GL 1G7JB 4JFPB 3DETD 1S8DA 5A16B 1IZJA 2NY0C 4PRIE 5BQ7B 2IWGA 3SQCA 3EDDA 1HIML 4NUJB 3T65A 1CDUA 4UBDC 1WIOA 1AQKL 1MHEB 1YQVH 4XPGL 5GS3A 4RZCB 3RHWF 2ADIA 1AD9B 3NABL 3CK0L 3TV3H 3WNOA 4OZGF 1LO5B 1C5DA 5CILH 3L5IA 4DAGH 5I15L 4AM0B 4DGYL 4P59L 4PRIB 1F13A 2AV7B 2UY6A 3VXTA 2NW2A 2CLRA 4Y4FB 5EWIL 3O2WH 2O5XL 5ESVB 4BFGA 4UAOC 5J13B 4NUGL 5A3ID 4C4KT 3IU3B 4P9ML 4DQOH 3DSSB 4JFDA 5KSVA 2DN7A 3UC0H 1L7TL 2MWCA 2MQ3A 3VFUB 3QNZA 2A9NL 7FABH 4YEEA 2B5IB 4I3SH 4WI9A 1QP1A 4NZRH 3RZCD 4XPBH 2IBZX 2IH3A 3IS1X 1R0AH 3ARSA 1OHQA 3FQNA 2M2DA 3AAZA 4NN7C 5D9SB 2XNAA 5DUBB 3VFGL 4PJGA 3ZHDA 4J23A 1DQLL 3G04B 1U8IA 5D1ZD 3G5VA 3LKQA 3EZ8A 1FRGL 4ZUTA 3SE8H 3WSQL 1SYVB 4CDGC 3LQAC 1U42A 3BPCA 3DBXB 4ZYKB 1CVRA 4HFUH 2VN7A 4G7VH 4JE4B 5D1XB 3VI3E 3ARWA 3HA0A 4N0FA 3CDYA 5C0CA 4G3YH 3VXRE 3QEQD 2BNQB 4YDVA 3EIFA 5J1TC 2PETA 1L4IA 3OKOB 4P3CL 3ARDC 4ZODA 2H32A 2X7LB 3WFCL 1SVCP 1AKJB 1OSPH 2YPKA 1BHGA 3QXWA 4N0CC 5ID1B 4PJFF 4JZJA 4YHIB 3O3AA 1L9NA 1ZHKA 2X89A 4GAYA 4M93B 5JW4N 3VXRB 5J56B 3UPRB 3OKLB 3HMXA 3MLZH 1A3QA 3VW3H 1A6AB 2EDBA 1RUAH 4LVHB 5GS0C 2C3HA 1U8HA 1B0RA 2X10A 5DZNA 3X12A 4BZ1L 4H1LH 1FQ9C 1IL1B 2UUDH 3UTZB 1ZK9A 4LASH 4ODHL 4ETQB 4YO0B 3RWHB 4JO1H 5D71L 5GRVL 2DIBA 3GMQA 4YH6A 3LQZA 3MLRL 3OKKA 3QXDB 4P5KB 2I9LB 4OLYH 2D7QA 1WAAA 2DBLL 4OD2B 2V7NA 1A1MB 1I8LA 3EO0B 2AJZA 4J4PD 4LEOB 5F9OH 1OW0A 1SVZA 1UA6H 4QF1B 1CZ8L 4JY4B 5AZEH 2HH0L 5I75C 4L4JA 4M00A 3W9DA 3O41B 3QJFA 1RY7B 1A7BA 1CF8H 2AXGA 1OAYH 1HQRB 1RZKH 5DFTA 2YKLH 2KBGA 2YMXL 1MFAH 5KSBF 3SGKA 1PZ5A 4Q97A 2BRRH 3KPMA 1I8KB 5HI3D 4WFGE 4GG8A 1MPAH 2P7TA 3DRQB 5ISZA 2JB6B 3KQ4A 2Z93B 4GH7B 1R3IH 3LV3B 3TVMA 3V0AC 2R0KL 1D9KC 3V0VA 4PJHA 1U93A 2A6IB 2HG5B 3BDYH 5T3ZL 2CSPA 3PXJA 2HFTA 4FG6C 4ZOAA 2XTJE 5FUOL 4IOIB 2YD8A 5E94A 3ZKMD 1XF2B 3O45A 2WNGA 1K9TA 4ONTA 3I75A 4QLRA 1Q72L 2JIXD 4L9PB 1KC5L 1N2RA 4HJGB 5LBSL 3QQ4A 2NXYB 5DJCB 5HYIA 3LEVL 4LNRB 5H8DA 4PRNB 4XAKD 3MLUH 5BS0E 1P7QD 4LLYB 4XZUA 3RRQA 3QDMA 4LLUB 4AQ1B 4U0QB 4XP9L 4ZH1A 1VACA 2XTJB 1CLZH 3VE0A 5F7MC 1OF2A 4YBQC 2XWJA 1R3KA 5E6IC 3FFDA 2X4PB 2ATPA 2D0FA 1C16A 1JMXA 3VD3A 4JZJC 4U3CA 3CFCH 2CR6A 2X4SA 4XCEB 1CD1B 5KSAD 4D4AA 3SDYH 3STZA 1FC2D 4K9EH 2CUIA 5F89A 4I3GA 1ORQB 5BOPA 3CH1B 3FZUD 4NP4L 5DMIL 5F1IA 3HNSH 4AZ8A 5KVDL 4IDJL 5F3BB 5IESH 4L8SB 3IDUA 3THML 1OGTB 1BZ7B 5ID0A 2IAND 2XRAL 3IGAB 5EU6B 3RZCA 4OFDA 3RIAF 4E9LA 3MRNA 5CIPB 2A77H 4HWBL 4LPVA 3DO7B 4JHAH 1U3HD 4JM2D 3WIHA 4AENB 5D1ZA 4ZTOL 2ESVB 5FV1L 4YBLB 3O11A 3NVQA 5DK0B 2Q6WB 5F6IC 1I8LC 3WIIL 5KVMC 5CCKH 1OW0C 3MYJA 4PJGF 1UACL 4JO4L 1O1RB 1ZLUH 1NAMB 4F7CA 3QEQA 1U8KA 4K8RC 5BV7B 5F9DC 2D7MA 4HV8A 2J5LC 4X9FA 5E99H 4JG1L 1T0PB 2WWMD 5FKPA 3SKJL 3NCYP 3SGKC 3RWFA 5KVGH 3DYOA 2W91A 5IBTH 4U2ZA 2Y07H 4O4YL 4Q6IB 2APVA 4IMLA 3BD5A 4DKFH 4F9PA 3LKPA 3WJJA 4Q9RH 2Z8WC 4IRJB 3CDGB 4K7PL 3TVMC 1KB5L 2B1AL 1AGEA 5C07E 5IHLB 2O5ZH 5ETUA 5IF0B 1P4LA 3ARYA 3ULUL 3MV11 1HYRC 2VL5A 3LIZL 3BGFB 4IM8A 4GS7C 3FT2A 3ZE1E 5E2VH 1HILB 2B8OT 3KPNA 3SKOA 1D8DB 5FYJH 3DETC 1QEWA 1MWAB 3BQUD 2QEJA 5MEPB 4PBXA 4QRRE 5CJXA 5F7DB 3AREB 5C07B 2DQIL 1CGVA 1MCPH 1KCUL 4J4PA 4M5ZL 1WAAF 4AIZB 4YAQB 4GO6B 3GHBH 4OQTL 1QO3A 4QRRB 3IDYB 5I1AA 4ZDHA 2K7QA 4OCXH 3WEXA 2NXZB 5A3IC 3KPTA 1FO0B 1WK0A 5T3XH 5F1NB 4HW5A 5IB1A 1DQDL 4J8RA 4Z0XA 1D6EA 1A7NL 5F44A 5I1KL 5JIKA 4XP5H 4LCUA 4F15B 3IFLH 4Q0XL 2L0DA 4FQLL 1KJ2H 1F58H 1A21A 1LTXB 3L7FA 3RWCB 5GGRB 5DEFA 3CZFA 1T89A 2BHZA 5C6PB 1NAKL 2EE6A 4FQ1H 4JKWA 4NKDB 3H7LA 4UDUB 3RL2A 1WFUA 3QNYB 4XPTH 2YR3A 5IFHL 4HCRL 4G9FD 5D1ZC 1OAXH 3KDMB 4PJHF 5ICXB 4XX1E 2CRMA 4QXTA 43C9B 3K80A 5I2IB 2JIXA 1IC4L 1UYWH 3FO9A 1KUMA 4NC1C 4P39A 4TPRL 1YN6B 1J1XH 1P7QA 4HK0B 1YZZA 1BVLB 4FFWC 3RWGA 2Y25A 3OMZA 4UT6L 5C0JB 5CSZB 1HSBA 1MCSA 3CFJB 4OZHB 3DX6B 2DLTA 4XCYB 5TH2B 3VA2C 5LAXA 1J1OL 4KHTL 3VFTB 3QWOA 2HTLC 3BVNB 1AGBA 1KELH 3ET9F 1RUMH 5E8OA 5KSAA 4KU1A 3B43A 3CSYB 2ZUUA 1CL7H 4HUXB 4GAJH 4F9PC 1CYGA 3WJJC 3BEWA 1NFIB 1LDPL 2W9DL 5L8JB 4HAGA 2QQNL 5TFSL 5DJ8B 2VDNL 4G80B 4L8DA 3SCMD 3OKDB 3VI3F 2DI9A 1CG9A 3E3QE 2IANA 4M4PA 3CLFL 4PLKD 3V79C 2DMCA 4I5BB 2YZ8A 4LCIL 1NEUA 3HQAA 1ZT1A 5ESAA 4D3CH 1P6AB 4ODUB 5CJXC 1NUGA 4RMSA 4JM2A 1U3HA 2JK5B 1IGYB 3MLSL 3WJLC 1KZOB 1AE6L 2X1QA 4Y4KB 5MEOB 1FNGA 4J4PC 1D8EB 1AI1H 1MIMH 2E3VA 1A14H 4YHYC 1CGWA 5DGRA 2H3NB 3REVA 1DEEA 1VGKB 5K9OB 5CEZL 1FNHA 4Y19E 1AXTH 3S34L 1GGCH 4YDOB 3MLXL 5D7JD 4GBXC 4NJ9L 3U4BH 3MOAH 1YPZB 4NZUH 5HI3C 2C9AA 5C08D 4ZO6A 4NZTH 3V5DA 4Z7UA 1QNZH 4Y19B 3P2TA 3VXUD 3BZ4B 3AMLA 2I9TA 1H3BA 5IB4A 2WY8A 1LO4H 1HWGB 1F3DJ 4P4RB 1QSFD 3E2HC 2RCSH 1N5YH 3ZKMC 3F58L 2HKHH 5KVEL 1M7IB 4GRLD 3MC0A 3BQUA 1YY8B 4LEXL 3UJIL 4EIZC 1N6UA 3QXVA 5AG8A 4HXBH 3D0LB 3H3KA 1H9VA 2KQNA 2Z8RA 3WS6A 3U7WL 5L8KB 3CCHB 2B39A 4JDVB 5EZIH 2AXHA 3TBVA 1TITA 5HPMB 3ZE2E 2HRPL 4LLQA 2J2ZA 3IRZA 1RHHA 2OSLB 4K3GA 3ARGD 3MV8B 4OTXH 3C08L 5DTFA 2GJ6D 3U9PL 2VR5A 3HPJA 2PYFB 3OQ3B 3TCLA 3DGCR 4I3RH 2CUMA 4GRWE 4LHJB 5GRUH 5JLZB 1L9MA 2HLFD 4YHZH 5DFWH 2V3NA 3D18A 3MUGA 3RVUC 3FQXA 3NTCH 4PJIA 1HHGA 3WMSA 5EDXA 4MXQD 4G6ML 4AEHL 5CGMA 4OLXH 5E5UB 3V7AE 4OV5B 3QPQD 3DSUB 1T5WB 3ZHKA 1KGCE 3QO0B 3QUMA 4UOW0 4GRWB 1DFBL 2X4TA 4JFYB 3ULSB 2EDTA 3ILPB 4JM2C 5C0RL 4G9FA 1R24A 3C2AL 4X4ZA 3TZVD 3F5WA 4WV1C 3G5XB 1T1ZB 3D85D 4MNGE 3IDJB 1A6PA 3FQWA 3CFDA 2FHBA 1A9BB 3BMVA 5IW1A 1I7ZA 1VFBA 1SYSB 1GPOH 3P9MB 4RFEA 1YNTA 5AWNL 3IRPX 5BOZG 3VD5A 4S1SL 5GGSA 5I0DA 3MNZA 1DQTA 3FB7B 2O5YH 4MNQD 1MVFA 3IDIB 2WWMC 1WICA 3PZ2B 3BT2H 2ICEA 4ONGL 4MNGB 1KCRH 3M8OL 1IC7H 1K85A 4JCMA 4EI5B 5AZ2L 1NLDL 1KIUA 1Z9LA 4K94L 1EXUB 3B9EA 5GZOD 1T66D 5TE7L 1ES0A 1JHTA 4N5UA 3MRRB 4JFZL 5HPOA 4PJAA 4HJJL 5HHPA 3TJHC 4S11A 4RA3A 1J0KA 2DS4A 3LN4A 3SCMA 2Z31D 1NCDH 4OKVB 4O00A 3WFBH 1TENA 4R97C 4RNRA 1HHIA 1YEIL 1XZ0A 4N0UB 3BQUC 4R26L 5HHNA 3PZ1B 1TETL 5I1EH 2PCPB 3SGEI 3WS6C 3NCJH 4Q9QH 2IBBA 3FKUS 4NQED 2W9EL 3WHE1 1FNLA 4HBQA 4OD1H 3R06B 4Z0BH 4U2YA 5B4PB 4JM2F 4LPWA 3GRWA 3ZKSD 1JGUH 1EUTA 3TO4D 3OKYA 1G7IB 5D2LB 3JWDH 3FT4A 4Z7QF 3JWOL 3MFFA 2UWEA 4K23L 2ATKB 2F8OA 4K2UH 4OGYH 1U36A 4S0SD 4QHLB 4PJEA 4JZOB 1QZ1A 1JP5A 1J11A 1KJMB 5D7JA 3ULVH 3O4OC 1N59A 1QBMH 1OP9A 1C1EL 3WXVH 5C08A 3G08B 2D2OA 3AGVA 2D7TH 4BFIB 2FD6L 2QQQA 1FZJB 2IFFH 4RAVB 4Z7VE 2JB5H 2VDMH 5I17A 3U9UA 1SJHA 3VXUA 2RFXA 1YMME 2CQVA 1AHWB 5HYJE 4RIRA 3L9RA 1HHKB 2Z92B 4Z7UF 1KIPB 3ME0A 1OARL 2IG2L 4NO2A 3TJEH 3KNBA 2IEJB 1CD8A 1QSFA 1B4JL 3DRTB 2FNBA 3VCLB 2JJVA 2PO6B 4QRSB 4HUUA 4Z7VB 5E95B 4GRLA 1KYOK 2VE6A 4C56E 5INCA 3CVIH 4PJ9D 3TN0B 4ELME