The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
290
|
structure length |
290
|
Chain Sequence |
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb |
| molecule tags |
Immune system
|
| molecule keywords |
Complement C4 Beta chain
|
| total genus |
47
|
| structure length |
290
|
| sequence length |
290
|
| ec nomenclature | |
| pdb deposition date | 2012-07-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF01759 | NTR | UNC-6/NTR/C345C module |
| C | PF07677 | A2M_recep | A-macroglobulin receptor binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Alpha-macroglobulin, receptor-binding domain |
