4FXKC

Human complement c4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4 Beta chain
total genus 47
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxkC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxkC01
3I70A 1EDYA 2ICEC 1PXUA 3CKIB 1BR9A 2WINB 2J0TD 3L3OC 3HRZC 2WIIB 3V96A 1BUVT 1AYOA 1BV8A 5FO8B 4ILWA 1OO9B 3CU7A 3MA2B 1GXDC 2TMPA 5JPMC 4LNVA 3T4AC 2QKIC 1D2BA 2XWJB 5JPNC 2A74C 1JC7A 2XWBB 2PN5A 5FOBB 3HS0C 1XWEA 4D94A 1UEAB 3OHXC 3FRPB 2I07B 3G6JB 1JB3A 2B39A 4FXKC 4FXGC 1UAPA 5FO7B 2A73B 1BQQT 5FO9B 3KLSA 2E2DC
chains in the Genus database with same CATH superfamily
3P11L 1T1WB 4KKLD 1RK1A 1TUPA 2EPBA 3TBSA 2FMCA 5K69A 3NJLA 5C4ZA 1R46A 3EBHA 1O7LA 3RNQB 3O13A 4XZUA 3FONB 1JIBA 1OGSA 2EINB 4MNHA 5IF0A 1E4XI 1HNXL 1IC7L 2ICES 4KRMB 4M43H 4H0HB 4MD4B 4ZDHB 4G8GA 1QVOB 5DHYA 1MVFA 3K2MC 1H8NA 4Q2ZA 5T1DL 4BCYA 1RMFH 2ZWNA 3O2VL 2H9GA 5GS0D 3BPCB 1IXRA 1HH9A 2IG2H 3VFGH 2CXGA 2LV4A 2I07B 2TSAA 1JDDA 2F7OA 3FT4A 2WXNA 3CVHH 1QNUA 2VC2L 2BNUA 4YHLH 1Z1WA 3Q7JA 5H37G 3HZYB 5INCA 4J12A 5IVNA 1VFOA 4NQQA 1U8MB 2YJQA 4AWJC 1PLBA 4Q6KA 5MEPA 4DP6X 3S5LG 3WIIH 1JUFB 4I4WA 1RUPH 2Y9RT 3EYOA 5T3ZL 4NO3A 3LWEA 5JORA 3FH8A 4MZIA 2Q5BA 1OALA 4GAGH 4MAZA 2WKLA 4RGNB 3KE0A 3PF5A 1XEDA 1DVQA 3B6SA 1IEBA 1TJIH 3DSNA 1A1NA 3LB6D 2HVBA 4HIPA 3BKCL 3KBHE 4MDIB 4OLVL 5IGDA 2VOTA 3B34A 1HTLD 4YSRA 3TA3A 5KSAB 1CGTA 4OWXB 3DSFH 1KGXA 1RURH 3LH9A 4GP5B 1EXGA 4L8SC 3UBXG 3VSVA 4DK0A 5JXEC 4EGVA 5HVFB 1FYTB 3NIGE 1T6WA 3ZYJA 2D4DA 2ICEC 4L1BA 4DF9A 2DY8A 2COVD 5E4EB 1U5KA 3HZKA 3V4PA 1AIFB 1BYNA 3PO2H 1D5ZB 4Q0FA 4FQXB 3FO2B 3BSHA 3PF4A 5DVOA 3ZMRA 4F1ZA 4PZ8A 4FEMA 2L7UA 3NELA 2NY0D 4NO0A 5K9KA 4X3TA 3D85D 5MEQA 2IHEA 3MRMB 1ZGLA 1R75A 2P28B 4EQ3A 5I16A 1I94Q 2DQDL 3UYRL 1JB3A 1LTTD 5HYJB 3TREA 2P3YA 1G9MH 4W9KC 5FKAA 3S0PA 1DD2A 3S17B 1KCUL 3I50L 4WKZA 1ETJA 4DOHB 4I1PA 3GUFA 4N2CA 4PRBA 4JQXA 4ZX4A 4XTRC 2P5WA 3MJWA 4PV1C 1LGVA 1YMMB 4IKNA 4JANA 1KFGA 3MXWH 1DN0B 3QS3A 1WH0A 2B3IA 1AGEA 1NGPL 4ZS7H 5IQ7H 5MEOB 5LBSL 2LLLA 3O45A 4J8RB 4ZPVA 3OD3A 1SFHA 4X6CB 3UJIL 3VU1A 5AB0A 1OTTD 2QMKA 3WFDH 2H47C 1JERA 1FCCA 3PNRB 4NP9A 4FQIL 5CV6A 3L95A 1CU4L 2OLDA 4JRYD 3QDMB 2OMUA 3BN3B 4AKQA 4ZW6A 4Z23A 2K5WA 1MI5B 4CAGA 4FJYA 2EDRA 3PUZA 4HXAH 4LSVH 4RFBA 4ICWA 3VXQA 1XZWA 2NZIA 2JIXB 3TBYB 1IV8A 5AW4B 3ZPDA 1SJEA 5F71A 3U7AA 2EY5A 4X9FA 4YHNB 4Y5YC 2JQMA 1PTOH 3N1MC 1AD9A 1OAQH 1QBAA 4FG6D 3QEUA 2K33A 3ME0B 4K4KA 2G2NA 4Y19B 5C8JA 1XCWA 2HLAA 4XBPA 3IXTA 3IFOA 3OAYH 1NPUA 4Q56A 4YBQD 3M1BB 1QEXA 2HKAA 3FFOA 4DV0L 1P7HL 3BEVA 3R18A 2F4IA 3DM3A 3CG8A 3E0GA 5FUCC 4FNFA 2J5WA 4A6YB 5F8QC 1A6AB 1KNEA 2X0WA 3X12A 1WI5A 3V4UH 5KYYA 1QZHA 4I9XA 2JELH 4D3CH 1KG0A 4WEEA 5M3FB 2B8GA 3SEBA 2AXJA 4JI3Q 4MJIE 4MFHA 5CV9A 3HOVB 4FZ8H 5E9DD 5JR1L 4CVXB 5I1CH 3RLNA 5DHVB 4FL4B 2GIYA 2F7RA 4F2FA 2SDFA 3F6IA 5CS7A 3TM6A 4JM4H 3MOAH 1ZT1B 5JPNA 4IOIA 3CMAA 4ZOCA 1KXHA 4GLXA 4BFIA 1SFDA 4FXDA 1DBBL 4HXBL 4G6KH 3M3YB 3QIUA 2JQAA 3QRGH 4UUJA 3DPBB 4DEPC 1E9OA 1EHLL 1U8QB 4LCYB 1XNQL 3HNSH 3H2QA 2Y7NA 3T65B 4MHHI 2OJ1A 1F56A 2HVKB 4Y5XB 1I1CA 5A6LA 2N0MA 2DI8A 2OJZH 4KVCL 4MRCA 5HVHB 4PMBA 5J06A 2MGSA 1FNSL 1MRDL 4WWKA 3HN3A 2HKFL 4EOWH 1P7QA 4HCRH 4Y5VC 1V3MA 1T9HA 3ZKXC 3D4CA 1V7NH 4XB3A 5ETUA 5G55A 5LL6X 5IGXL 1NAKH 1KC8C 1O5PA 4OFYD 1NMCB 2FZ3B 4PP1C 2E3VA 5K36G 2NXYB 2YA2A 4JUTA 4NKDB 1WBYB 4HF5H 4P46B 4R0LA 4Y2DC 5C07D 1E5CA 1T1XA 4Y2OB 3KLDA 1IC1A 1IIKA 3IMVA 5FYKE 1EY7A 4UDTA 5AOMA 3PO2B 2R4RL 5D2NB 5BW7A 2GUOA 5CCGE 1JWUB 4NRYB 1UEBA 4K0KL 2ZYHA 5D9SA 3EBAA 1C12B 4UDUA 1YQ2A 1E4XH 4HLZH 3S3BB 4K3GA 3WELA 4S2SA 1NUCA 3OSOA 2AKRB 4KV5E 3LAFA 3WY2A 1ET6A 3D06A 2OZ4L 3GXFA 4S2SB 5EN2A 1QFPA 1SYSB 1N7MH 5FKAB 1ZKOA 5DQJA 4X6CF 2CLVA 5IFHH 4BZ1L 4BA1I 4P5MA 2QKSA 3LS4H 1TEFA 5C0BD 3OG6B 3FO1A 4YGVB 2X2IA 1W72H 4XP6H 1XGUB 3FH5A 2EUXA 5ISZA 2WUCH 1PZSA 3ULUL 3X1GA 2WXLA 3QK0A 1N34L 2Z1CA 2NSMA 1CLYL 4P46A 5FYLH 4UB0L 5J3BA 4ZPVB 3WNPA 1KNAA 5JIDA 3VD0A 4FNRA 4QXUL 1PS3A 1UXLA 2NY6D 3HZKB 1WC7A 2AITA 4RQQA 2ZXOA 5IE8A 1BECA 2NXZD 4DR5Q 1WFTA 5E4XA 3TPKA 3R4DA 3S1QH 1IM9B 1Q1JL 3EO9H 4O58H 1CIUA 1BQHG 2OMTB 4RDQG 3RLSA 5LGYA 4U7KA 1R47A 2R9HD 2NZ9D 4BBRH 3T3PF 3K5NA 3KWWB 2VMJA 4PRNB 4A93G 5FHAH 2EH8L 4LPXA 3KL3A 4U1SB 5GGSY 4AK1A 3PIO3 2ARJQ 2NVXB 1F4YH 5T5FL 4MNQE 3DXAB 4DEPB 3F8UB 3M4OB 3RZCB 4JO8A 2VUMB 3F05A 5I9QC 4Q52A 4FA6A 4H7BA 1EEZA 3K5MA 2ZJQA 2D9QB 3BVTA 4LGRB 5EZLB 1U8JA 3UG3A 2CFMA 3S2DH 2DW5A 5I9PA 1ORQA 3V6OA 5L0QC 3S96A 2BPBA 2D9CA 4UTCA 4CA4A 5D2LF 1FNSH 1KIQB 1PYWB 2G9HA 1H15A 1HNXQ 4PJHA 2Z0SA 2G9HB 4AL8H 4FF2A 4BUGA 5GGTH 3HC0B 4JFHE 4LUZA 3O9WB 4A7SA 4M61A 3MUGA 2X69A 1EFXD 4R4OA 2ATPB 3AS0A 4NPYB 3CHRA 4XMLL 1MFVA 5EBMA 4RZCB 4XN5A 1JZIA 3BG3A 1TJMA 2R92G 2P8MB 4TL4A 1FE8H 4ZX6A 4HHWA 4AC2A 4IK7A 3LHAA 4IPCA 2XY1A 4U1SA 4LSPL 3OKLA 4F8MA 5DC2A 1OM9A 5C09E 3SO3B 3LQAL 5A1AA 3T51B 4WW2C 1VFAB 5F0LB 3CU7A 4IZ8A 2R4SL 1H9DA 3MXNA 1AD9B 4HFUH 5AVSB 4CDCC 2GTWB 5C0CB 4M93B 2JKLA 4TLSA 4ETQB 2DBLH 3BD5A 3L2NA 2ZF9A 1BBWA 1ZV9A 5JJZA 3KLQA 4GBXA 3L3GB 4PS3A 4AM0A 3KF8B 3UP6A 1VIWA 3L2PA 5ERWA 3HAEH 3CW2C 3GJEB 5GGRB 1EL0A 3ZT6A 5KYWB 1C9SA 4IBWA 2R23B 4G6MH 1UE6A 3W9EB 3K6FA 4YPGB 1QFWL 5ACZB 3G6DH 1WD0A 4KFZC 3UZEA 2PXYD 1VQFA 3F7PC 1CFMA 1WRFA 4F27A 2EDHA 3QA3B 2H26A 3CRKC 1DVUA 5KWYC 3PJNA 4G7VL 1AZRA 2XX0A 3S1QB 4XNXH 3MLPA 2WAQG 1XIWB 4FYTA 3MNWA 3J7AV 3IDXL 1H9MA 4RRPG 1PFNA 3IRCA 5D7JD 4PMCA 5C3XA 2OWOA 4XPGH 3C2SA 5CJ5A 1BCPD 3K2IA 4HAGA 3FDTA 2CUHA 2YXWA 2V2XA 2ROXA 3BP6A 1ODUA 4DAMA 3IDMA 3CIQA 1NM4A 4OCWH 4PTTA 2ADFH 4Y2DD 3QWRD 3WO3B 3SBPA 1MW3A 1ZLSL 2IQ9H 2SNSA 3E2HB 1LTLA 4W70A 1S7RB 4TSBH 2J8HA 2QVFB 5EJWA 4LASH 3NCWA 4LLQB 5HDWA 1SE3A 3V4PL 4PY8I 4DP5X 5T3XE 5IVXB 1I8KB 4LCWB 3QC5X 4ABNA 1OKEA 4OSUL 1VFAA 3CX2A 5E1FA 2GFBA 3FPUB 2XRAH 4RAVA 4XP4L 4A2LA 1JXFA 1QZNA 3APMA 3QG7L 5DQ9B 2A2QT 4Z7QB 1KT2A 1GA2A 4IN3A 3MRLB 3HJEA 4IBYA 4L3CA 3L9RB 2NNFA 2XN2A 1OF0A 3HG1E 4NQCD 2N88A 1ZKAA 2CMRH 2HPOA 4QRQB 1UYWL 4JPWL 1OGAD 2EYRA 5CJOH 5GGQL 1NGQH 2BVPA 1CA6A 3MROB 2H0JA 1TVHA 2F0DA 1AY1L 3MRFA 4MJ5A 4A3CG 4AYID 5JHLH 1FNHA 1CTMA 1F4AA 1OF2B 2N7SA 4E36A 2NSXA 2PP9A 4JFQB 1I9JL 4OLZH 4BFKA 5INDB 1MFDL 4JR9H 3ND9A 4XC1L 4OL7A 1NBZA 3RE0A 5SWQB 4GKZA 2CKBL 4LDOB 1Z47A 3RZCC 2JA5B 4WGVB 1X3PA 3WY4A 8CGTA 1FV1B 2MOGA 1T1YB 2YQ3A 3I56A 1QX1A 4HWEL 5IESH 1EQRA 5GRJH 1TY2A 2E27H 4FG2A 1C08A 1HINH 4YQXH 2BHYA 3QQXA 5DQDH 5FGCB 4HK0A 3S96B 1NCAH 4D9QD 4AMKL 5G5DB 3K2UH 1N8ZB 5JW5B 3TZDA 5IGGA 4ZAKC 5EO0B 1XX8A 1XH2A 4TSAL 2B2TC 3TN0A 1QHQA 1RL1A 4DUYL 2UY7B 5CN2A 1URLA 3MODH 1IAOB 3MLWH 4V1DB 5K5PA 5E94B 3KPLB 3V2AR 1GYCA 3BRFA 5C0AA 5BVPL 3RTQC 2ZOOA 1CQYA 3NA9H 1TWAB 5AW7B 4EZMA 4XVTH 2H0PA 1OTTC 2XVLA 3MXPA 1KB3A 4ETQA 3OYYA 2YOCA 3GT6A 3KAAA 3QDJA 3WE6B 2EY6A 2I24N 1OP5H 4PJEE 3ULSB 1LK2B 1ZA6B 1IC5H 3ECBA 3AS2A 1ILUA 1NCNA 3UBGA 3V5HA 1WCMH 1A6VH 1YEHH 2JJWA 2P5WD 3ABZA 3IYLW 5FK9A 1Z9FA 3LN5B 4DVRH 3U6XS 1AZBA 2AJ3A 4RAUC 2ZM6L 3PDOB 4N9GA 3UDGA 2GVYA 2ADGB 4N9GB 5LUMA 2AK4D 3LH8A 4IU2A 4X0NA 4M7ZC 5DEJA 5D1QE 4JZJB 1YJDC 3URYA 3FDWA 1TYRA 4HS3B 2EYFA 4IKJA 2ZX8A 3EYUL 2IBZX 2MCG1 4Q8BA 3SOBH 4G8EB 3CFMA 3FU3A 2E74C 1IKNA 2X2HA 3KD4A 5AAWC 5GGQH 5IEHA 5FFGA 4K5LA 2MCPL 3CZGA 1XB8A 2NY0C 2AJXL 2VABB 3A24A 1P2CA 5F0MB 3BD4A 1OXVA 1J9SA 1YHPA 5DK2A 3VGDA 1DANT 2RDGA 1VLXA 2O5ZL 4GLRH 2QPEB 2W65B 3VRLF 4XPTL 3WFCL 1MFDH 4JR9L 5CMAB 1NICA 3L3OB 2E8YA 1M9SA 5DFVD 5GRYA 1F41A 1IAOA 4HJSA 3S34L 1EEID 2RTTA 1A64A 2F1MA 1M3JA 1UUNA 4IBLT 1YNKH 4N0FB 4GUPB 4P07A 3FQXB 1KB5L 4YDIL 3MV8A 3PY9A 4FADA 1ECYA 4ZW3A 1WDAA 2I60L 4Z3FA 4YDKH 3S4SG 1X9QA 1U8LB 5C1MB 4GKNA 4XDXA 5C08D 3IAGC 3CFBA 1U8LA 4IFDH 4JOIA 3CXHK 3F7LA 3UG5A 4OD1H 4JBJA 3VXMA 2F5AH 4YHHL 1UADC 4HUWA 2CGRH 1WT5C 2VS1A 5C6PB 3P20A 1F2LA 1KELH 3SGDI 2QF7A 2DNEA 2BVTA 4G6AD 1BXXA 2C1OA 2F58L 2YPLD 1EDQA 2BDNA 4YXKL 3QFDB 1BZ7A 2WB1G 2CO7A 3ICEA 1KXVA 1ZLWH 1KIUA 4QCIB 3GTGH 2CO7B 4CSTA 1CK0L 4TVPD 3DHMA 4F9LC 2DLIA 2OULB 2CH4W 1PVOA 1RUAH 1VZHA 1VAHA 2DMGA 3H54A 2C3VA 2VLRE 5GS0C 3LN5A 1PLFA 3REVA 2B63G 1IGIH 2EYOA 2C34A 2WQSA 3FQRA 5DD1L 5KTEL 2JVUA 1DL7L 4WY7L 4UM9D 2PPAA 2OMZA 5IEKB 2A6JB 2Z92A 4M4RA 3VXUA 1TQSA 3UACA 4AV5A 5LBGA 1CGUA 3HLAA 1P9MC 1JZ6A 3A67L 1P5UB 4G5ZH 5JW4Q 1XSJA 2H8PA 3X1NA 4XZUB 4KKUA 4ZBJA 1MCOL 4OVVA 4FFZL 3NYKA 3VXUE 4YDLB 4Y19A 3BP5B 3LZOA 3ZDZE 5IJBC 2YAPA 3A8KE 3PP4H 4L1SA 3SK6A 2NYZD 2VDQL 5D7KE 5EU4B 5F6HI 4DV6L 2JA5G 1BLIA 2PPBC 3EJIA 2VN5A 2OBGA 3U6XA 4JFOA 2B2VC 3U6RB 4KJOA 2QCPX 4MNQD 4P5SA 1S9KC 3ZE0B 4A66A 1W91A 3QJTB 2FAUA 3B2DC 2OA9A 4J8QA 4I77H 5AW6B 5ADPH 4YN3A 1BBXC 2R0ZH 4ZO9A 1IGJA 1CCZA 3BISA 1YA5A 1M57B 3UYOD 4U2YA 1MREH 3VXNA 1GUNA 3AGVA 4TN9A 5C0NC 3FFCA 4J3UA 4XB8A 4EI5A 4U1HB 3QRBA 5KG9B 1F3JB 1FL3B 4OBSA 5GZOC 3BKJL 1HX0A 2WXQA 3E8UH 1P5UA 1L1OB 1OSEA 1V3LA 2A83B 2Q20A 4P4RA 4X4ME 3TYFB 4J3OC 4DV2Q 1SVZA 3V8OA 3BQUA 3RLFA 4FX5A 1E50A 3GKWL 3QFDA 3HMXH 2YK1L 3O3BB 5ALBH 1IFHL 5HVGB 2AV1B 1CLVA 2IH3B 4ODHL 1F90L 5TK2A 1R34A 3CE1A 5DJ6A 1IAIH 5D96C 5CBAE 1DE4A 1USQA 1LMKA 2DQUH 4PSRA 4U33A 3H3PH 2CDEA 5IBUG 4A3LG 4YSSA 5IHZB 3QXDB 4RBPH 4GOPB 1WWAX 1Z9MA 1O7YA 2A6ED 1FFOA 1DDHB 1CXKA 3OGOE 4P2QD 4IU3A 2K14A 4RGMA 2QJDA 3HFFA 5DJAA 1MCWW 3S48A 1L9NA 4H25A 4AUYA 5B4MD 5D71H 1U33A 1MCPH 4A3MH 2HH0L 3AFPA 2VMDA 4XNQB 2EVHA 1RUAL 4DKTA 4YHNA 4BFEA 1HJCA 1JL8A 2VQ1B 4XNZB 3EFXD 1M1KC 2ZSVB 3ESMA 5CEZL 5T1MB 2IPKA 2VDOL 2VQ1A 2YD9A 1NAML 1LM8V 2NW3A 3WSQL 3TO4A 3E7JA 4LF7Q 2Z4IA 2YMXL 2A7BA 3S35L 3V9FA 4OKVA 4QWWC 5JJKA 2DQ6A 2EKSB 3FT0A 3KPQB 5C3EH 4RMTA 5BO0D 1KCKA 3GM0A 4I2XB 1JDCA 4I4WB 2GJ6D 3BVNB 5FFOA 3STLB 2E2JB 4PREB 4L3ED 2OTJA 1YLBB 3RI5K 4F7XA 3FUIA 3O6FC 3FUDA 3FO1B 4YGVA 5BUPA 1NGWA 3L8QA 2HMIC 2ADJA 2EIKB 4PV9A 2YUZA 3VXTB 4JANB 5D7IF 5I76A 4G70B 3WIHL 1M7DA 2NYKA 3N1QC 4E9LA 3OC8A 1BWMA 1MFAL 1OXTA 4NZUH 2Q2TA 5EORH 3MREA 3WEAA 2JTDA 1OGAE 4K55A 1YEDB 5E8OB 1MCDA 4CJ0A 4I0PA 2ZG2A 5ADOL 2YPVH 2ED7A 1IM9A 3OPZL 4N8VB 2R69H 4B9KC 2P8PA 4ANXA 1UHVA 5LBSA 1AQKH 1YEWA 4X6DE 3FH7A 3PL6D 3L3GA 4J4PD 1QHPA 4AM0B 5IROD 1UM5H 2UVEA 5AZUA 1A5FH 3EUUA 4Z3IA 3E8UL 3DUHA 3D87B 1FGVH 1OSZB 4C47A 2QHRH 4LKXA 1OM3L 1BNZA 2L9HA 3ISYA 3K8KA 1CDYA 1IW7C 3MJ9H 3RVWD 1I7RA 1NFDA 3E3QE 5FOJA 3MNZB 2DKMA 1Q8MA 3BP5A 1PTOF 3PWLB 1XAKA 3HN8A 4P23C 3LHPL 4LFCL 3IPBA 3WD5L 3FUFA 2BM3A 3LEVL 2AXGA 2AMCB 2F08A 4J3OG 4DKFH 3BEWB 2NY5H 4X99B 3UO8B 4EQNA 5C44H 1IGMH 4X7DC 1PD0A 2AK1L 5E4IA 1Q46A 1PH5A 3FQRB 2QGQA 4JY5L 4ADGA 3UZEC 3UPRA 3QIBB 1SXAA 4O51A 4JI4Q 4QQBX 4APXB 3S37H 2ADJB 4OY9A 4M4RB 1Y7VA 3VXUB 2ZXWB 3ZHDA 1RV6X 2XKNB 4MA8L 4GKKL 1G4MA 1CUOA 2BC4B 3C5ZC 4P73A 3RHWK 4QJ3B 1LE5A 1DVSA 2Y2WA 1FNVA 2RSNA 3M9BA 1BQUA 4YSDA 3R06A 4POZC 4KFMA 1PMYA 1FZMB 5IJDC 4HU2A 2RSOA 3K5LA 1TVXA 1FYCA 2G3NA 5CHNA 5TE4L 3VXTA 3DMUA 1OPOA 2YAMA 3H4FA 2AQ2A 5D1ZI 1FL0A 4O02A 4XP9L 5F9WC 2R2HA 1FH2A 1PH4A 2CNZA 3VFSB 5J1SC 1V3KA 3ARRA 4WNSA 5HJ3A 3O6KL 4QRQA 4J1MA 1ZE3C 1MFMA 4ECNA 2WIIB 2P5WE 2E4FA 1EZVY 1H5BB 1YAZA 5CJXC 3P9LA 1SDDB 1WC7B 4RQQB 4WO4C 1TZ8A 1D5XA 5IMLA 3SDZA 4B3RQ 1WA2X 1DO6A 2JI1A 2AHIA 2W8CA 6TAAA 2ZKYA 4AQAB 2FGWH 2K9FB 1OAKH 3C8HA 1LTSD 1LEGB 5KVFL 2KS0A 3H56A 3U4VA 3JT0A 1EO7A 3WNLA 1HYSD 2ALYB 3N85L 4ODVL 1BFVH 4AEHL 1UAPA 2AXGB 4RSVA 1CUKA 1N5YH 1YEIL 2W9DH 4LCIH 2JJUA 4XMXA 3RNKB 1AZNA 4JO2H 1K3RA 2OM5A 1PNDA 4AEEA 4R7XA 1V8QA 3H0GB 3R06B 4HUUB 4L29A 4P3CH 5CNHA 3ZE2E 1A62A 4HKBB 2NY4D 4O1NA 2QQLH 1HHHB 4EN3D 3KPNB 1GZQA 2IJ0C 3TT3L 5ELFA 4Y1AE 1VQBA 1EGJL 1NFAA 2Z93A 3N42B 5LQBL 1UUSA 5FXCH 4GQRA 5KVDH 3TVMB 4X7TB 4I87A 4K3HA 3ERXA 1Y6MR 3UTSD 1KL9A 4RKLA 3UFIA 5HYSA 3HG3A 4RMVA 3BVVA 3CC7A 1HOCA 2A6DB 4WKXA 3VNYA 4RBPK 3WKQA 1QA9A 2QHLA 3D39D 4AEFA 3I9AA 2KCNA 1VQJA 1NLBL 5AD0A 1YG9A 3WJLA 4V1DE 3ABGA 1P4BH 2AK1H 4JKKA 3F7QA 5HDOA 5CBAA 4R4QA 2D7TL 3M8OH 3NEEA 2WB1E 2GTWA 1U8HA 3QUZA 1XYIA 3BT2L 2ZX7A 3NCEB 5BXFA 3CPWA 4V190 1W6KA 3MV8D 3QQ9D 4ZPTB 3ER0A 3AG2B 3S3JA 1N0LA 2OR8A 4AVJA 2VDNL 5FYKH 3HBZA 2HT2D 4EF3A 1HQRA 2XPZA 1WIOA 4HALA 1BXTA 5EQ0A 4AQEB 2F74B 3P77B 1M9WA 4FVMA 2YD2A 1S3KH 3C5JA 4LVHB 4XC3H 3TN0D 4ADIA 3CVHL 2WZ6A 3PWLA 2E7LC 4U3SA 1W6WA 4A3CH 3F1ZA 5BV7C 1J1OL 3SO3C 5HYSB 5J7CC 4LHUD 4HK0B 4OIBA 1TWHB 5IUSA 1CL7L 1LO4L 4YSEA 3K6SB 2CBPA 1UA3A 4C59B 3QWOA 1G94A 3QUMH 4DIXA 1GMIA 5J9PB 3KGSA 3KNBB 5DUMH 3MLVL 3HR5A 1U95A 3EJRA 4QB4A 2QR0B 3HG1D 1QG7A 1F18A 4IEFB 4WHTA 3MUGB 1ZJAA 2N4IA 1SYVB 4OVUA 2NDGA 1PRTB 4RHSA 1YMME 3PFUA 5ES4B 1TYJA 4IK6A 2EABA 2HB0A 3VFUA 3N85H 4A75A 3DOHA 1WBZA 4E9YA 5L0QB 3ERSX 3S98A 2YC1A 3LRHA 2NN6I 2R8SL 2CM5A 2I26N 2YWYA 4MA7L 2YSSA 1COBA 2PYEA 4ZTPL 1EYCA 4Z7QE 4JKLA 3VXPB 3EJPA 4OD2B 5A40E 4YAQB 1BBJB 1BXVA 1DEEB 2YGNA 2L15A 4A4IA 2KZBA 2AEOA 2BCKA 5ICUA 3X1EA 4F7MB 3OR6A 4CVZB 1JGVH 1SSOA 4HG4K 4HPHA 1H3WM 3EGXB 4YK4B 1I8MA 5FUZH 1J88A 4XNMB 1FVEB 2XN9C 4RWHA 2NZOA 1EDYA 1M1SA 2EDOA 4FP5D 3O2DA 4H0GA 3CQFA 4LSQL 1FYTD 5CLTA 2LE9A 1V9PA 2VW9A 3A4FA 2FTAA 3L3OC 3FU6A 1W2BA 1CKOA 1GC1C 2K0RA 2DLEA 5KZCB 5EIIG 1S7WB 1KCSH 1IL2A 1PLGH 4PZ7A 3HI1A 1SYSA 2NY0B 1VQOA 4GRLA 2IL8A 3DA0A 5IEHB 4HPYH 5GZNC 2KHSA 1ITCA 4LLQA 2YKLL 3TMEA 3QO0A 1YNJD 3Q8CA 3QJZA 4BWTA 2F0IA 1JFQL 4BBSB 1WZLA 2J56A 3KGTA 3MRQB 4NXNQ 3OJ2C 4IO9A 1J8HD 2JKIS 4JS7A 2AEQL 2W0FB 2DBJA 3CZSA 4X8XA 5KVGH 4LLMB 2AQ3A 4ZMWA 4XMKL 2BP0B 1VQLA 5DUBB 4PJCA 4HXAL 4ZX5A 3HOYG 3OXRB 3IJ9A 5C0XJ 2BA0A 1LTID 1C5BL 4P4KC 1OARH 3EVQA 3SD2A 4UT9L 1CFSB 1JPSL 1YMMD 4YPGA 4QY8A 3IJHA 4TTDD 4DR1L 3AAZA 4IPHA 5T1KA 3LNNA 5KN5B 1GY2A 1HHKA 1NAMB 1ZGLP 2G3ZA 1Y1WH 2QA4A 4HKXB 4NQVA 3RL2A 2BHUA 1NKRA 1QI4A 3EOBA 3WUZA 4LAJH 2Y07L 3LD8B 4XIGS 3EDDA 4FA7B 4I65A 3CMOL 1IGJB 4XNXL 1VQMA 2XQYK 5JIIA 2CIKB 4Z95H 3V05A 1Q1EA 5E2TL 4XPHH 3VJ6A 2A9MH 1P7KA 5FLUA 5IFJB 1GIGL 1NMAL 1WZKA 2JMRA 1VFMA 3C1EA 3C2AH 2RA1A 3LD8C 3HZ3A 3MUY1 2FJFB 5EO9B 4UNTA 5ITBL 1WSST 1NFDF 5CWSA 4Y19D 1DJSA 4AL8C 3OKEB 3D6CA 2OL3A 1FO0L 3M17A 3POCA 4D9LH 5FW7A 3B8SA 3ZTEA 1TZOA 3WEXA 4K5NA 1A4AA 3MLYL 2VXTL 4PD4K 3UCRA 4ILDA 2O2LD 4APQB 1WOCA 2EKJA 4XODA 3LRLA 4LCCB 4QL5A 1KCBA 2H8PB 1PX8A 3KR3H 4AYGA 2NZ1A 4LPTA 4AW4A 4CGUB 1WAAF 1TT2A 3IN2A 1HUMA 2W07B 4LF3B 4MJJA 5FGSA 3UI2A 1W9XA 3HR5B 4Q74A 5DJDB 3TS8A 3MEHA 2YARA 2N55A 1GRWA 2J1KA 4GXUM 2H45A 4M48L 5M3MG 1XSKA 2WVTA 4CILA 3WKML 2H7WA 1S7VB 1TNNA 1BQLH 5TF1H 2CM6A 1YPZF 2ROYA 1BHGA 1IHZA 2OW7A 1VESA 3EROA 2OR9H 1U8NB 2O5XL 3L7FB 3BFWA 3SCMA 2DM4A 4HPYL 3VR4A 4M6ML 2HRHA 3SEPA 1PFCA 5IK3B 5T1IA 1F4WL 3FQXA 5L2KE 4ZMAT 3ATEA 5HYJE 4AGPA 3CFTA 4QHLB 2CHDA 1AXSA 2ENJA 5HHVL 4F2EA 2VDPH 3LMJH 4J3SA 2B1HH 5E8DH 5DMIL 3GPEA 1NC4D 4OJAA 4AQYQ 4JM2D 1JF1A 1JC7A 4NCC1 1A3TA 3SJVB 3QXVA 5D1XA 4UNUA 1KEGL 4P71A 1JZ5A 3TTSA 1UQSB 5I71B 3VJ6B 1W72B 2CDFA 5EIVA 1UTDA 3DBSA 1JSYA 4NN6B 1Z3RA 1E7VA 1YEEL 3N0AA 4ALAC 4F9PA 1YCSA 4XMUA 4MJ2A 4QF4A 2NX5D 4FKKA 1WAEA 4POFA 3FHQA 1DCLA 2ZUSA 3SY0B 1VQPA 2EO1A 2F52A 2RBLA 3ESNA 2Y07H 3PWNA 4ZFZA 3ULUH 3SE4C 4WVRA 1O9ZA 5F2FA 4P4KD 4OGAC 2P5PA 2QQNL 4Y9FA 2VABA 3P0GB 4IDJL 2G9DA 5HGDB 1RULH 5BZZA 4MXVE 5LGHH 4XN9A 3K58A 1CLZH 2RALA 3QCUL 3VACA 5EGTA 3NDYE 2WQVA 1ML0D 5ITBH 3M1OA 1OWRM 4YFDB 5E9DA 5EKIA 2V17H 1JGLL 2QMJA 1F13A 1V05A 5C9JB 1FC1A 1FO0H 1JV5B 1Y1DA 2N7AA 1I3QB 3SJVA 2BDOA 1E4KC 1XF1A 2EC9U 2R7EB 1JNLL 1I31A 4APQC 2NN6H 4FI7A 2X6AA 3LVTA 1F6LL 1KLGD 4JV5L 3FN0H 1A02N 1JK8A 2AJSL 4LVHC 3D0VB 3U9PH 4NWUL 3NJJA 1DQLH 1JK9A 1LO5D 2PO4A 2ZXCA 3UAJC 1X44A 1CPUA 3CVIL 2P42B 3UX9B 3DURB 3KXFB 4M48H 4QHLA 3N41B 1Z7TA 4YGAB 1M05A 5FA3A 3TO2A 2E47A 1JRHH 2DRUA 1S9VB 4FNQA 5I6NA 4Y1AD 3O0RH 1RTOA 6FABL 4J1UB 2HT3C 2JEBI 1M7UA 4XGZB 1VQDA 3CN2A 3LKPA 3WUWA 5JNYA 3DXAD 3O9WC 5KANG 1T5KA 2CIIA 2JKXA 2X2UA 2Q87A 1FNGA 4LBEA 5BR8L 2CBOA 3TBVA 4ZMYA 1OSYA 5CGTA 2RHEA 1PV4A 3GTLB 2R2HB 1DQIA 4JFZH 1GS7A 2B15A 2C3XA 4JFEB 1A6AA 1XB6A 3Q1SH 3VA7A 1GYAA 1KV7A 3L54A 5E5MB 4IOCA 4KK7A 4R9HA 2VJXA 4K7PY 2DBLL 2IT1A 2NTSA 1QBMH 5C0DA 1WAAE 4BKTC 3GIZH 3NJMA 2X87A 1KCVL 4ZK9B 3EH4B 3BE1L 3H09A 3WS3B 1EPFA 4JMXA 4JFSA 3JUZA 4LOUC 3TBTA 4TUOA 3GI8L 4POGA 1PFMA 2A4CA 2CJUH 2E5LL 5DT1L 3CFEA 1RJLB 3KYKH 1RUKH 2NW2B 3DJ9A 2BNQD 3GMMB 3KLLA 1J9TA 4JFOB 5D8JL 3WJMB 1ZVNA 4DQOH 2C1PA 1PX4A 5T5NF 1JK9B 1QWHA 2NQCA 1OD9A 3C60D 3MTRA 3P9WB 1TZGH 4NYLB 5FK9B 3IU3A 3WFHB 4DK5A 5C0JB 1K4DB 1CICC 2KHAA 2VZVA 4FA8A 1I8IA 1Q9LA 3OKEA 2H32B 5TK4A 1ZLVH 2WB1B 4R97C 4ALAH 1C16B 4LEXH 4D9RE 3N0PB 1E27A 5ABZA 4N8UA 5EH1A 1FD7D 1DE4B 4JG0L 1IAMA 5F7LB 1A1MB 5FYLD 4TPRH 4BINA 2LTQC 1JZ3A 1E40A 4XAKD 4NQSA 3SKMB 1ETZB 3MLUH 2L0DA 1YJDH 4GKSB 3RRQA 3W2DL 4DZBA 1XGRA 3OKNA 1M2OA 1IL8A 4MXQD 1HHVA 1PCSA 5E9DE 1DDTA 4GMTL 2Q9OA 4G9DA 1Z5LB 3FUJA 3KPOB 3MA7B 5IOKA 1LO3H 2DI9A 5I6LA 3NABH 3HS0A 5C2BL 1IKNC 5AAWA 2WNKA 3QG7H 1ZEQX 1GKOA 1BQHA 4KTEH 3VFMB 5IY0A 3MUHL 2OMWB 4ZZKA 2EIEA 3V8CA 2PYKA 2XFGB 4IOSD 1SUJA 5EOQL 1L7TL 4FXKB 4I2XE 4N5EC 3T56B 2AQTA 5F9AC 1J9RA 4AYFB 1PDKB 4GY4A 4IPGA 4BWUA 2ZE0A 1ZTMA 4KC3B 4IKIA 3ZE1E 4CBVA 3RNKA 5JW3L 1Q9WB 4KRPB 1TZHA 4E0RA 4LLUB 4FQIH 4LCWD 4A3LH 2YQGA 2ZSVA 3H0TB 3WJLC 4YUEH 4DGIH 4GKKQ 2X6CA 2L12A 4OLUH 5HI3C 1I9EA 3OKDA 1LTAD 1MZZA 4HJJL 4JJ5B 4LCYA 2GG1A 5CEYA 3NCJL 4A04A 1HYSC 1AGDA 4NQCB 4MA1C 4YDMA 7FABL 5BUAA 1DVYA 3FB5B 2HJKB 3EDEA 4FF9A 1J5OH 3MHZA 3VXRE 4E41D 1LT5D 1PFSA 1I9RL 4MMZA 2CGYA 5C9KA 5I1IL 3QXDA 3L5WA 1CQFA 4GZYC 1EVUA 4MDIA 4WO4D 3BHBB 1NCAL 3L5IA 3HBQA 4BRVA 4FQJH 4AQAA 5AZ2L 1QVCA 3FUKA 4L4VE 1HT6A 2WKOF 3G5YA 3H3PL 4H25B 2JA7G 2XPYA 4WEBL 3L4WA 1F2ZA 4RGMB 2X2JA 5M5YH 5EOTB 3KPPA 5EA0H 4UY8C 2G3MA 3D9AL 2BHFA 2ZOLA 1I94L 4DUVA 2CLZA 2P7TB 1MCJA 5I73C 4WDIA 4PUBH 2OK0L 4LQ1A 3RZCA 3OHMB 4K8RH 5J13C 4L8DA 1SYFA 2NQDA 5CHNB 4N0UE 1O7VA 4MNGB 2ITDB 4JM4L 4ATWA 2NY5C 1NIEA 4OH2A 2JKWA 2FB4H 1MGSA 1EUJA 1OHQA 3VD7A 1I1RA 4QYOA 3PMFA 5D1XD 4BKSC 4B3EA 3BVGA 4X7FC 2P26A 1RUML 5E2JA 5ANME 4CKCA 3X1BA 4YVNA 2R93B 4X3UA 3T71A 2JCCA 3DRQA 4X9YA 1SQ2N 1U6AL 2Z7UA 4WI5A 3AM8A 2IFGA 5AVXB 5TDOA 3TA4D 4KVNH 4BJLA 3VXNB 2XXMB 1AN8A 3G3LA 5E00A 3BEWA 5E00B 4MCZA 3NVQA 4RESB 3U82B 1SJEB 4Y7OC 5IQLA 2NUCA 5KVEL 3UE0A 2FL5B 3HI5H 3F5WB 5AAMC 3RVWC 4QAWA 1NDMB 2I5LX 1IW7D 5AL8A 3ZKND 5C44B 3WNIA 2YV5A 1ASYA 1ADQA 2CDGA 5ECGA 3UJJL 4JY4A 1RZJC 3CZNA 3SQBA 2FH8A 5F97E 2BP8B 3PUXA 2VLME 4UQEA 5IROC 4OHJA 1KLFB 4XXCA 2NR6D 2G0KA 3PREA 3SE4A 1INDL 1YBYA 4F80A 5C09D 4FLHA 4JDEB 4YHZH 1CD0A 1UGKA 3CHSA 1CVRA 3LZNA 5DWUH 3KH4A 4XXWA 3OGCB 1TTBA 1TOXA 2E6PA 3PGFH 2Y69B 3KLAB 1DBJL 5BZXA 5IJKC 3H6MA 2H26B 2VN4A 4TNVF 2OZ4H 3GZOA 3MV9A 3UBXB 4NKDA 3P1HA 4R5VA 4AGQA 2ZJSH 1AKJD 5H4ZA 1PKQE 2LQRA 2PXYA 3C5ZB 1MKHA 4ODSH 3F2CA 3DGCR 4EKJA 2FEDC 1Z9SB 2N59A 4POYA 2R39A 1J8HA 1SMDA 2GYSA 3GFUA 4LVEA 2O6CA 4XP6L 3DGGA 3HNVL 5DMKB 4YO0B 4C2MB 2LMCB 3M88A 3TO4B 4NLHA 4PJAF 2E2HH 1BJ1H 1SYVA 1HPCA 1BD2D 4OV5B 1Q12A 4OLYH 5BOJA 2ENQA 3KYNA 3QPXH 4ATTA 5T8IA 1A7BA 5IQMA 4DV7Q 4XCNB 1UVQA 4YZFF 1S7SA 5I19H 3N40P 5GAEC 1A6UL 1DJHA 4RRPM 4LE8A 5DJ0A 5J3HD 4M1CD 3D4DA 2IY5B 4L1DA 4ZUUB 3V0AC 3EO9L 4O58L 4AH2A 4ZUUA 2XBDA 4RGNC 4KMLB 2QEJA 2BS9A 2DWYA 1YY8B 3SYOA 4YAQA 1C1EH 3CLFH 4NBXB 1EIFA 4O02B 5CUSH 4Y2NA 2MCAA 3VWJB 4TOYL 5I75C 1H3VA 1S6NA 1J5IA 1HI6A 4X64Q 5HJ3B 3QJYA 3BAWA 2E76C 1SGKA 4NC2B 2Z8RA 4XP1L 4L3AA 3BUBA 2K6WA 3ARYA 2FR4A 1U21A 1RPQA 2X4NB 2YPLB 3CUPB 3H7BB 1BVSA 3V10A 1WTWA 4D0BB 1JXDA 5GJSL 2PYEE 4DH2A 1RJYB 2C26A 2FHFA 4M7JL 1DDHA 4ZNEA 4O0AA 3NACL 2BP5M 2FXQA 3LN4B 1R3IH 1RUPL 1SNMA 4JNXA 2VLKD 1UOWA 1W0VB 3SB3A 3ZYZA 2R29H 2ZXBA 5BR8Q 1JZ7A 4H8WL 3INOA 1ZA3B 3Q01A 1KYAA 5KVFH 3S8GB 2CLVB 3A22A 3HKZE 1YDPB 5JYLA 3EJUA 1RURL 4ODVH 4ULLA 1WD8A 3K5OA 4KROC 3CD6A 5ECJE 3OIQA 1MJ7H 4FFVC 3X3GH 4XN7A 4BH7A 3T3PB 3NJNA 1GL4B 4OM1L 2FJFA 3OZKA 1ED3B 1LUZA 2M8XA 3O8XA 3CH1B 3GINA 1AH9A 1UT2A 2WXMA 1EEYB 3RDTA 2Z93B 3AGWA 3SKJL 2AGJH 4Q6IC 5LWYH 2BRQA 3VH8G 1KB9J 4G9FB 1C8CA 4NGHL 3FTZA 4P8QA 2UUAL 4Y9GA 3BAJA 3V55A 3HMWL 2Y36H 2DQDH 4DR1Q 5T5FA 3N06B 4QOKD 4G8GE 2YOAA 4BHUI 2CO3A 3VVWA 3QOLA 3TFBA 1D5BB 3ITPA 1MJUH 3D33A 3SGDH 2J2ZB 1FSKC 4PW4A 3CHQA 2C4FU 1KFAH 5HHPA 5SWSD 4BWGB 1DSYA 1E8WA 2E7MA 3QCTH 4JPIB 3OWRA 5HGBA 1TQWA 3TGXA 5I19L 1GHFH 4BRJA 2NZHA 4F93B 3ARGB 4BEIA 3KGRA 2QTEA 1WV7T 3HZVB 5LCVH 3EH2A 3E1ZA 2V7NA 1KBWA 2CK0H 4J15A 1AO7B 2VDRH 4HS8H 4M7ZB 4AG4L 2IOMA 1VGEL 5FYKL 3FQYA 4DKEL 1JORA 4ACPA 2DLFH 3QFGA 4QMEA 2HXAA 3NCYS 4DZ8A 2A74B 2E2DC 4DV5Q 1LO2L 2LT9A 2XKSA 4M6NH 7PCYA 1OGPA 5F7UA 1KXTA 4UOW0 4ANUA 4E42B 4HEME 3U46A 1T0MA 1UCBL 3EFOA 2J7LA 1S9VA 4YWGH 4ZSOE 3I4NG 4K9EC 2X09A 2RH0A 1KY6A 3Q6GH 3QDAA 5I2YA 5M5WB 2ZAGA 5DHMC 4UTAH 2IWFA 2LVEA 3IETB 5AW2B 3C6LA 5M3MB 3RWDA 4PLOB 1UXSB 1URZA 4XCNA 1NDGA 2MHVA 2FT8A 3WIHH 3TP8A 3KL0A 1KTDB 4UT6A 4M62H 3W38A 4P2AA 2VJ8A 3NP4A 4OXPA 3W3BA 5E8PA 2VUKA 4L0PB 4BK5C 5E1IA 3T4YB 3MBED 4Z7WA 2J4XA 2GFBB 4PJ9B 2VN7A 1WYDA 3AREC 5AENA 1M56B 2MTAA 3D7PA 4G8AC 4NHUA 3X14A 3PAZA 1BXUA 2XICA 4XX1G 4AQ8C 1WIPA 4HIJA 4IKKA 4JFDE 2EEDA 4AQ1B 1XXFC 4DKAC 1SXZA 1XTCD 2WXHA 2AXFA 5CN1A 3BQUD 2QHRL 1TYEB 2WQXA 5DU7A 3HS0C 1VQIA 4IURA 2X4QA 4H1LB 3IFTA 2SEBA 4JE0A 3WCYA 3JTTB 3QA3A 2W9LA 1ENCA 4ZMTA 3HGBA 3EW3B 1JGUL 1U58A 3UC0L 1KQSA 3A74A 4NKMB 3WTXA 4L5FL 1MJUL 3U4ZA 1AP2A 4FOMA 4CN6A 3TJEH 4FI6A 2EE2A 4BELD 1EH9A 2B2YA 1SUHA 4GNXA 3QUKB 3HJ0A 5FHBL 1T21A 4LF5L 5CILH 2APVA 2Y7QA 3SJVE 3IGAA 1FH5H 1D5MA 3QFJA 5ID0A 3D18A 5IZ7A 3NPSC 4JI1L 3VFWA 3U1SH 1AQDB 5TDNA 1BM3H 4CC4A 3MLZH 1G6PA 2Z31B 2HVKA 1CE1H 3O8XD 5I1DA 2Z31A 3ZRFC 4DVBB 2CVRA 1Q94A 2CK0L 3RGVA 5F3FA 5FYJD 4OLEA 5EU4A 2XG4A 4XMKH 3RDTD 2CE6A 3BUDA 3D0LA 3FU7A 1HS6A 3MJ7A 3IFNH 2YLKA 4NQXA 5C0BA 1TQCB 2F15A 1TSHA 3V4LA 4AZ8A 5D14A 2GBVA 3TA3D 4JLRB 5KN5A 1R9TH 2Q8RE 1TWFB 3IEAA 2QELA 3RVTC 1A6WH 3FEWX 5G4MA 3LQAC 4XP9H 3NDZE 2FIKA 3GV6A 3CDYA 4ZAKD 4HIJB 3QIBD 4U3CA 4LQFL 5C0GA 2IJ0A 4WW2B 1NCGA 4WCYL 1SNPA 5D2NA 1I6VC 2XWTA 3GC3A 2K6AA 4NQEE 5TFSL 4ZO7A 3KBPA 1EBAA 4D7PA 5D7LB 4IALA 2PI2A 4AYEC 3IPEA 4HJ1A 2CQVA 4Y7NB 1DFXA 1TTGA 2ALAA 3F7RA 4MYPA 1GIGH 1NMAH 3DSFL 4MTNA 5EU7C 3K3QA 4B9JA 3C87A 3KWVA 5H94B 1X5ZA 1XR9A 5CYUA 3RN5A 1BEXA 3X13B 3WDIA 1HTYA 1N32Q 3EYVB 4GW5B 1UZ8A 4ZRGA 1CMOA 5I8KH 1U92A 4IDLA 4D9QE 3S14B 3QDME 3MQIA 1B0IA 4B41A 5DSCB 4HJ0D 4YWMA 1KBPA 4BS9A 3VX1A 4KZDH 1Y6KR 1EGJH 1X32A 1EHKB 2GIMA 1SOXA 1I4PA 1XF2B 1U3HB 5JXAL 4DR4L 3IDGA 1VS0A 2W65A 5HI4C 4PJFB 1U9RA 5TDNB 3WWVA 4BFJA 3GJFB 1UWYA 2Y25A 2XIIA 4XXEA 4P2QA 2B63B 1VQ5A 1GS6X 1ZDQA 2XWEA 3JV4B 1B53A 4DEWA 5IWLC 5GS3A 4TNEA 1BQLL 3WHXA 4P3DB 5C5MA 2O5XH 4K3EL 1HKLL 2XV6B 1ZGLM 1ZV2A 1HHGB 3E8VA 3OLGA 4BY1G 3LH2H 1MEXH 4G6FB 5B39A 5J11C 5KS9A 5L8KB 5C6TL 4JZJA 2I32A 4L9LB 3CXDH 5L2JA 3EOAA 3ET9F 4U68A 1BM3L 1FZJB 1QJOA 3SN6N 5FO7B 3UDFA 3ARDD 2ARJB 2FWLB 5KSBB 4WY7H 5C9JA 1GUGA 1I4XA 3W1GA 1LP9B 2EUZA 1OOAA 1BYOA 1BCPC 4Z76A 3TV3L 4LSVL 4X4XB 5EO1B 1WGOA 1CLOL 5F9JA 3QEGH 3RWGB 3WI9A 4HVBA 4P0DA 4AI7A 3T4AC 1OGTB 1J05A 3STZB 2WV3A 1WG3A 2E7BA 1XCTA 2PN5A 2H3XC 5HGAB 4OFDA 32C2B 4LHUA 3BXNA 2LU4A 4XWOC 4NUMA 4ENZA 3EBIA 2VDQH 3K57A 1Y0LB 4XMWA 1TIID 3LCYA 4X9HA 2IDFA 2APSA 4IUVA 2DJMA 2BIHA 3MYZA 4PJGA 4NX0A 1TJXA 1ZWIA 2KC0A 3BO8B 2IPUK 4PJCE 5A3IC 1EQTA 1S46A 1AQDA 5EU6B 1J18A 5EPLA 2AERT 2EYHA 2F53A 4U49A 4FQCL 1M7XA 4NUGL 4HUWB 4J4PA 1MFUA 4A3BG 1WHPA 4UAIA 3OV6A 3UDIA 1X6LA 5E8EB 2F0EA 4ERSH 3ZKXB 1GHJA 3TBTB 1KN2H 4MAUH 4AV0A 5INCB 1BGXL 3WNJA 5JIQA 1FN4B 2OMNA 4YDNA 1QWYA 3NRPA 3K4AA 1WF5A 2CKZB 2ADFL 4U0RC 5H2BB 3T1HQ 4ZMOA 5FO8A 4WV1B 3GTJB 1QABA 3BN9C 5L4IA 3JV6B 4QO1A 1X9LA 3MFYA 3KM2A 1VQCA 3JTTA 5M5YB 2V9TA 2V0AA 5EEVA 1VMCA 2NXYD 3WLBA 1U8OA 3FB7B 4DP9X 3HMXL 3R2IA 2WWKT 2QTVA 1ZK9A 4EXPX 5FUZL 3F7YB 3EOYG 1FV1A 4LF9Q 3LKSA 3X11A 2VT0A 3G5ZB 3LN9A 3X11B 1TWGH 4M7KH 2R6GA 5IVXF 4IQHA 4WK4B 5JO5B 1NZRA 2AMUA 2Q86A 3ZZSA 1OAXH 3CU1A 5I1EH 1PAMA 5C09A 5AVYB 4J1UA 3GP7A 1T03L 3IJ8A 4LOEA 4EDXB 2CJ3A 2WD0A 1B2YA 1KCSL 1PLGL 5C86A 4U31A 1SMOA 1DLHA 1G6RA 2O4XA 3DHUA 4G1MA 4HIQA 1V27A 4ONHA 2AZAA 4ZUVA 2YN3A 3V0DA 7TAAA 2SOBA 4NOBA 3EADA 1AGDB 2QGBA 4ZCKA 3EA6A 3CQZB 1U93A 3O3DA 5C0BB 4RAHA 2NZ9C 5HI5C 4HA1A 1IL1B 2HUEA 3VGGA 3KDFB 4RHRA 1TMQA 2RCSL 3QJOA 1ZSDB 5KAQG 2DWSA 2NXZC 2X6MA 3TTYA 4BH8A 1JPGA 2NY6C 1FFOB 1FZKA 2DQFA 2FDBP 1BLNA 2UZYA 3AC0A 4LF6L 3RWIA 3CHBD 1JS4A 3ZSSA 4RG1A 5ICXA 1PDKA 4G42B 3HA0A 2KJXA 2NXZB 4XO4A 1ZT4A 4A3BB 1F45A 4AQOA 3GJFH 1SJHD 1W6LA 2YBRA 1HILA 4GAJL 5H4YA 1VGKA 5DT1H 5F89B 4LSTH 1O78A 4RCOA 3UC2A 3K80C 4OCLC 4PS8A 3DECA 3TF4A 2CRZA 1KTJA 3AZUA 1MFBH 1TCMA 3HPJA 5EZJA 1WFMA 5FYLL 3SQBB 3S16B 2KBGA 1AI1L 2E59A 2FWOB 3ALXA 5H1SE 4FE9A 3Q1EA 4U1HA 2VLJA 3VDYA 3GK8L 2WLKA 5FO7A 2HJLB 5D1QA 4G5AA 4KXAA 1MXGA 2X0VA 5FYJL 4ALAL 5CZXC 2NY3D 1GW0A 1E24A 5HHNB 2EYSB 5ISZE 5K59E 5I1GL 1IBYA 2X41A 1UM5L 3ZTJG 4TKOB 2EXSA 4TUJA 4TPRL 1RERA 2F7IA 2R2EB 4KK5D 4L18A 3UABA 1HEJC 5GAGC 4U6VL 1L3WA 2DTMH 3B2MA 2E2HB 4G9FE 5EU7E 4Z7OE 4OZHE 3FCTB 3H53A 1BBDH 1FRGH 1NEZB 2X9YA 3GRGA 3ILDA 2OQ0A 2W81C 4K8RC 4GG6E 4L8CA 2ZT9C 4UQ2A 3GTKH 3KPLA 3QHZL 4ILWA 2DQEL 3MRGA 1G7LB 3NIFF 2RHSB 4TRPL 5DS8B 3B2VH 3QZWA 3DKHA 3FULA 5E0FA 2DIAA 4OD3H 3WMQA 4A3JH 3GSOB 1T2XA 5CLWA 2VXQL 1LVEA 1Z32X 2PWFA 1B3AA 5K5YA 3EDJA 1QVFA 3UE1A 1XMWA 4B9YA 1NBQA 2MQ0A 2NUPA 2E9GA 1IX2A 4XBGB 2EOTA 5E5LA 3UTQB 4IUUA 1X9RA 2F5BL 4KJPD 1FFNB 4WDIB 4QXTA 3SCMD 4KHPL 3RY6A 5IMMA 1Z9PA 2AJUH 3BIAX 3MX0B 1ILPA 2FVNA 2UXBL 2VH5H 1YZ6A 1KACB 2YUVA 3D3RA 1YN6A 4G80A 4PRPB 2JA6G 4X6BB 1KJ2L 1KYFA 3SBWA 3K72A 1D9KC 2OTUA 3C08H 5F7EH 1R5IB 3VFGL 1P4LB 3KLSX 1QSFE 2IANB 2V8MA 3QZMA 3DK0A 5DZVA 3SSGA 1NWOA 5K93A 1FL5B 4KMQA 1BIHA 2NY7H 2QR0A 3STLA 4NENA 1Y1VH 2VIRA 4AEIH 2WVUA 3CSYA 4X4ZA 1JZGA 3L4XA 1UD8A 2F9BT 1GCYA 2Q1EA 4BUHA 2I9TB 5DVPA 3VFUB 1RI8A 1MHHB 3EYFB 2E9IA 2WWNA 4GSQA 4OTXH 4LU5H 3SKOB 4CRPA 5I2IB 3W5OA 1SXSA 5IR1A 1RJCA 3MLSL 5SV3A 3NBHA 1UT9A 3LDBB 3SGJA 2EZVA 2PR4L 3WGUB 1VQ6A 1J1PH 2KQMA 4FG6C 1SMXA 1XAUA 2QL1A 1NDMA 3PCYA 5L88L 1EU4A 3GHPA 3ZDYB 2WZAA 3L45A 2B2WA 1WK0A 2R2EA 4QRRE 4HHGA 5DS8A 5GXBB 2BS8A 1KBBA 4M8QB 1BZ8A 1QWNA 2FQGA 3IPFA 1FVDA 2IIJA 5F93C 3CBKB 4XQQA 3C8KA 3GIVA 3A0OA 1SPDA 2XJLA 3CQZH 5SX5K 5JEAJ 1MRFH 2ZYIA 1N68A 5C08B 1BFTA 3TZVA 2EE9A 1BPLB 2FB4L 4XCCL 3DGGB 2QQLL 3GXUB 3HNTH 2XTSA 3GSNB 4WIQA 3OWEB 1IBGH 1KTLA 1OAYH 4FNSA 5A2AA 1QW9A 1NOAA 5GGUA 3N1FC 1R5VA 5DLMH 3VMPA 3MA2B 4YHYB 4MSWA 3K59A 4O4YL 3TEZA 5IMOB 1OT2A 1S9YB 3HHMA 1DGSA 2YBRB 4N6QA 4KTAA 2IMMA 3F00A 3MRCB 1G7QA 4NWUH 5IG7A 5K9QG 4XCEA 5DRWA 5E8NB 1UEMA 4R7LA 4IRZL 3VI4B 3P73A 1TWCB 1M53A 5MEQB 1OY3B 1GZQB 2EC9T 4LSUH 3SYQA 3ZKQD 3CCEA 5B1BB 1S40A 3FOMA 3MXWL 3JBG7 4NAJA 3DV4A 4C3IB 5GROA 4S1QL 3DXAE 4JI8L 2F0PA 3HOXH 1P7QB 3FUHA 3P30L 5KRUA 2PNDA 5DJ2B 3BRGC 3ARXA 3ZHLA 3T4YA 3LEXB 3NPZB 3B7YA 4A3IH 1BX2A 5C08E 4OJCA 4RX4A 1H3PL 1QSED 4JYAL 2DV6A 1U41A 4Z0BL 1OGAA 1EHNA 4FXTA 2UU9Q 1TNMA 3VSTA 4HDIA 4W81A 1WIUA 3CJJA 1LTGD 3C6EA 1YITA 4BFIB 2L04A 1L7IL 2JKJA 2IPKB 2R51A 3P69A 4BQ9A 4CW1B 3NXWA 2V3EA 4ODSL 3WDJA 4XHQA 4JKNA 1ZHKA 4JZOB 1KSRA 1FA4A 1GVPA 3RWCA 4QYOB 3E9TA 5DO8A 4AYFA 4LAAA 4KTGA 2EC8A 2XX1A 2B2UC 3DV4B 3ZN6A 3CCSA 2HRPL 3G04B 5AW1B 1I4HA 1S7SB 4Y16A 3F7VB 1T0NB 3WNKA 3FKIB 2NLJA 1V10A 2AJYL 5JUEL 5JQHC 2E6QA 4JFED 4OUUB 4GMSH 1FFRA 4LUVA 2YTYA 2ZXGA 1K8MA 1R6VA 4EJ1C 1I4RA 5IHLB 3NWTA 2DB8A 2ATAA 1ML0A 4PN6A 1S8DB 2IADB 4LOVA 2PZWA 2ZP0T 2LLGA 1UWEL 3OLDA 1D6VH 3OBAA 3NE5B 4P74A 2G75B 2I5YH 3O11B 4EUPG 4ZW5A 3Q8EA 25C8L 4M5TA 4ZRZA 2A1WH 8FABA 1AE3A 3B7TA 3MROA 4K9EH 3B8YA 5KBMA 4DAGL 4KGLA 2OMTA 3PWPA 5LXVA 3L2LA 2BH8A 1FLRH 3S35H 4LFAQ 2ZUYA 3MKKA 4OCXL 3AMLA 2JK8A 5BV7B 3QP3A 3VXQB 4GUQA 4F8NA 1HZHL 3JTSB 4KKLC 1Q4NX 1ACZA 1LT4D 2JIXA 3DVGB 3S3PA 3QIWA 2DQTL 5EZIL 3MACH 4G2AA 2VB3X 4LL1A 4K23H 2HQLA 4WI3A 2NUTA 3KYHC 1GW6A 1UZGA 3FUMA 4LFHD 5AFWA 4GSDH 1ZANH 4JHWH 1OTUC 5DJZB 5FWQA 2ZG1A 3U4AA 5B3JF 4OZHB 5IGXH 4K94C 5IROA 5C92A 2LXKA 3RMHA 3O41B 2ZWYA 1TWFH 5DD3H 4F7PB 1WT5A 3AQZA 4M8VA 1MAMH 3LXCA 2HJFB 3SY6A 3QHFH 1TTCA 2K8MA 3HB3D 1U91A 2P24A 2WXIA 5EO1A 4FFYA 4XCYA 3KH3A 5KVGL 2OFQA 4NN7C 4JG1L 3TBCA 1TZAA 4OJYA 3CCVA 1DUYA 4A2DA 1G6RL 3O6LL 1JG9A 3FT1A 3AACA 1O5DT 3G6JE 3RKDC 3QG6B 4FABL 3ZLQC 1N64L 3ZDZF 1XH1A 2GA4B 5M9OA 3SHSA 5JLZA 4Y7NH 4B0MB 1D5ZC 3QO0B 4FQXC 4H8PA 1O9WA 4GQ9L 3EJTA 3CC2A 4KKPA 1F1AA 3MN8A 2TMPA 3B9KC 1I9RH 1TTRA 4R4BA 5I1IH 1X7SA 3OWFA 3KYAA 4BKLA 4OD1L 1HE8A 3O2DL 5BOZG 3WFEL 3KF8A 3RWJB 4W4NA 1BDYA 1WBXB 1EX0A 3PL6B 2D7MA 3JV4A 4TNWK 1CVSC 2EEFA 1ZGLB 2DY2A 4NWTH 1TCRA 2WGXA 4PV8A 1A8JH 2YA0A 5E6SB 5ELEA 1S5ED 2WXPA 3DK2A 2WM0A 4JFEE 1EJOL 4Z7OF 5HSFA 2A68D 4NZRL 1JPST 4WWKD 1NCDH 1JE4A 2OYMA 1PXUA 2A6KB 5DM73 5LGJA 2HCZX 1MFCH 4DOHE 3A5ZB 3FB6B 1OL0A 4Y8DC 5BRZB 1P6AB 2N3SA 4NDMB 25C8H 4Q4IA 4BZ2L 3IKCA 5CP3H 3HLKA 3MLXH 4JRLA 5DJYA 5MERA 1LTRD 4K9EL 1YEZA 1E2VA 3ZTNL 2X3BA 3DX8A 1PFOA 5DHDA 4I3SH 4J27A 1LO2H 1X5KA 3HUJE 2XWTB 3JVGA 3GQBA 4XXCC 5E70A 3SDDB 3WS6C 1FDLL 3ARBC 3ILQC 2BCOA 3GMLB 3MRNA 2CK2A 1JYNA 3AB0B 4UV7L 3HRPA 1YNTA 1P6WA 1AS7A 3QS2A 2IH8A 4GSRA 5T3XH 1WTVA 1QR1A 3WKMH 3RZWA 3S15H 3T2QA 1M1XA 4MAYC 4BIKA 4ZTOH 1JP5A 2HCCA 1M8AA 4X8CA 5L7XL 3QRFM 2XIBA 1RKRA 3ME0A 3WXVL 1X5YA 3ZYIA 1FCGA 2XWDA 1BFVL 5EU6A 1DZ1A 5I17B 1C8QA 4U7MA 2PP7A 2Z91A 1CFVH 1D5BA 3SHLA 1SBBA 2GK2A 3GS7A 2QKIB 3OAUH 4F15B 1J5CA 3U4EB 2K70A 1N34Q 2AJ3B 5ICXB 4A3KG 5HYQA 3D34A 4YHZL 2Q76B 5MENA 2JE6I 5IFJA 5E8DL 4KI5C 1DQQA 1T6BX 1SFOH 2FLBT 3D2TA 3EJZC 1ZLUK 1QNZL 3US0A 1UT1A 4PLKD 4PW9A 3FAWA 1OGTA 4M8AA 4P23A 4KQ4L 3K0XA 1OO9B 1RLWA 1IE4A 5FJ8H 3BC9A 5TE6L 4Z6AT 3LIZH 3UO1H 1B2WH 3QIWD 4EBQL 3V5KB 2VUMG 2Y6TE 4H8VA 2OI9B 4OF3A 4E5XA 3T0BA 1WUZA 1TQOA 2EXZA 1AMYA 2ZXEB 3KYOA 4QXGH 2WSKA 3VR3A 3UAFA 2DLTA 4R90L 5I30H 4CMHC 5KYLA 2HA1A 3IMUA 2RQXA 3GXTA 4KROB 4L5QA 3HLAB 3RY6C 4K73A 4DGVL 4F7EB 2A77H 3RFRA 3AXLA 3OF6A 5FYKU 5D3DA 2WTRB 3DO7B 1R3LA 1MNNA 2ILLA 1IAKA 1UASA 3FTXA 5GS2D 5EO0A 3GO1L 3QR1A 1IYJB 1D2PA 2R92B 5DJ8A 3PAUA 5IHBA 1EFXA 5HDBE 1KXQA 3UTSB 5IT9c 4LCCA 4X64L 3S1MB 3S9WA 1RHHB 5D72H 1UWGH 2Z4TA 5TPWL 4BSWB 3D12B 3GHEL 4XAKE 3MRJB 1KPVA 5KAQF 4NB3A 4P3DA 2TAAA 3D39B 2ZCHL 1K8AC 3F3HA 1BD2B 2YMXH 3L4UA 5L4FA 2H5UA 4X0KB 2H9GB 4NBZB 3AQQA 3VFTA 3OKYA 2K78A 3JWDC 4YHML 1FFTB 3BWSA 3VR5A 5L37A 2AK4E 3AITA 3BVDB 3CSGA 2JKNA 1TTAA 1IRAY 4I13B 3BIBX 4V0BA 1Q9KA 4KAQL 4LVOB 1GGTA 3I3BA 4R2GC 3F58H 5CM1A 4PJ7A 1CZ8L 1F00I 4S1RL 2HFEA 2YD0A 1B0RB 1Z66A 4YNYA 5CSBA 5J4MA 5I1KL 4WUUE 1F11B 3VUAA 2X44D 5DJ6B 4A3EH 2OTWA 4P49A 3HG9A 4G43B 32C2A 4LHUB 5AALA 1RD6A 3QCVL 3DVIA 4R1JA 1BO0A 3QARA 1VCBC 4HT1L 3KPSD 6PCYA 2EYSA 2CJTA 3S6CA 2HT1A 1R3LB 3JQOB 4W6XB 3MZ5A 2ZKWA 3CFNA 3CN3A 3V4VH 3G08A 3ARBB 1HIMH 2BVYA 3HG1A 3MUJA 4XYOA 1GGIL 1BAWA 1NCCL 4YIQA 4WLCA 3T1YL 3OKKA 4CNIA 1BFSA 1IAKB 3L5JA 1DFBL 2J6WA 1SEBD 4JBWA 2L8AA 3NTCL 3HKSA 5F89A 5AYUH 1UJ3A 3ENEA 1M4KA 3ZJAA 4JC0A 1RUKL 3SK5A 2VNUD 1CDUA 4G72B 4HCRL 4YVUA 2J8UE 5F0JB 1QO3A 4A3FG 5JJIA 3QIWC 1QKZL 2VSDA 3GEWB 1KJMB 4Q9QH 1I1AC 2W59A 4PJ5E 4MQXD 2JFCA 3L5XL 4LSSH 1T5XD 1IGTB 2DF3A 3H9HA 3EJZD 4XO9A 2CO2A 3GHBL 3U4EA 1B3IA 2X4PA 1I3RA 1RFDL 2ZXPA 4DQAA 3IDUA 3U2SB 2MJWA 4UIKL 4QOKB 3ZBMA 4FGMA 3HOUH 1FNEB 1AGEB 3HTLX 5KSUB 4C8XA 5IGBA 1X5XA 1HESA 4FNUA 4JI7L 3BLBA 4HJAA 3L3JB 5CINH 4MA1B 4L23A 4DV6Q 1RIUH 1KXVC 1XCTB 4KJQC 2D3VA 4NQCE 1STHA 2K5QA 2Y06H 4HGKC 3LQZB 3ZUCA 4AOFA 4IHOA 3GMOA 5J6HB 1X5GA 5I1AA 3RA7H 5LNDA 3O4LE 2OMZB 4QIWE 3J80L 2OKMA 3ARGD 4MXWH 2C9OA 4P04A 4EUPA 4DKAA 3VD3A 4JI0Q 1GUWA 1NGXA 1CGWA 2AEPL 1FZOA 4O5LL 5EF2A 1S7XA 4UM8B 3JWNG 3K5SA 5CF3A 4RMQA 3VYUA 4KK6D 5F88B 1AE2A 4RGMC 5HDQL 3MSPA 2ZKHL 3MYJA 3V6ZA 3C2AL 3SPGA 2K1MA 5JDSB 4KV5F 2H1LM 3IKKA 3VFNA 5DUJA 4TQUS 2CA4A 2NPLX 1A4BA 4OKVB 3L08A 2XTJC 4LPYA 4A76A 2ESVD 3JV6A 4ACTA 5FO8B 5H2BA 3CFBB 2BSCA 2W9EH 1J86A 5ITFB 1ZYRD 3PO3B 1UACH 4DF7A 2HKHL 4M5ZH 1HE7A 2OI9C 3HOUG 1MY5A 1D5MC 2XWJB 1DJGA 1YNLL 2F68X 4X8JB 3TWCL 3VM7A 5AB9A 2IWEA 3KCPA 5C0FB 5MI0C 1PPIA 1B44D 4WU7B 1IJNA 2FJHB 7FABH 5IKCA 5JHMA 5ESAB 4JFXB 5LQBH 2A68C 2K28A 4I5BB 2NTTA 4JI5L 3P75A 4NKOA 3IU4H 4I5BA 3GV3A 3D6WA 2UY6B 1HXYD 5BO1L 4HSQA 2H32H 5ICYB 3HE7C 1I3RB 3DROA 1YMHB 4BCZA 2AQQA 4L5FH 4ZUWB 2FYVA 2E7LA 3B9KD 3UTOA 4IBUA 5GGTL 1G6VK 4LF5Q 1U8KB 4PRPA 3NT0A 1AC6A 4X6BA 4ZD3H 5D7LE 4M1DH 5FK9C 4HIHA 3FOMB 2HWZL 2LKVA 2IBZY 5E6IB 2HG5A 4KY1H 1C8PA 1R4QB 1HSAB 5D65A 4G8EA 2XVSA 3OMGA 3VFMA 4EN3A 4MD4A 3QQ3A 3KPSA 3KLAA 5FKPB 2XFXB 3OOCA 1R9TB 2YYZA 1G9NH 1UM6L 5IP9G 1G43A 1A8ZA 2VDNH 3BESR 4ZFFA 2ICCA 3HG1B 4GP4B 1JNJA 2PO6D 2K01A 4MD0A 4PJBF 4CU7A 4Y2OA 1KBKA 1CN4A 3B3IA 4PJ8D 3U7WL 2HX7A 4A3EG 5DFTA 1N5AB 3TYGH 2AEWA 2HFGL 1KDBA 2FATH 3QUXA 1WUNT 2C9QA 3WAJA 2EDLA 3BGFC 3P0VH 3HC3L 4BZ2A 1L5GA 4DNIA 4NJ9H 4AGMA 2CO6A 3S35X 2P4AB 1GJUA 1K9TA 1X5MA 4PTUA 3O8XB 1GGYA 1TPXC 4MQ7A 3ZW3A 3N43F 3IL8A 5TSSA 2K5HA 5C08A 2K7QA 1IBHA 4YY3Q 3I6LD 3P3UA 5F7AA 1PH3A 1TIUA 4N8CL 4IOFD 1MJJB 1E0OB 2X4PB 4JM2B 4PGCB 3T0AA 1II3A 4GOPC 1LYQA 1U2YA 3KHOA 3SJVD 2Y24A 4F8LA 4WAFA 3TJHD 3PO3H 5EF3A 3WTTA 4M7LL 3PIQB 4PV9B 4JY6B 1JF6A 2A6DA 5BRZE 3MREB 2V4LA 2V3DA 2RIKA 1KCRH 5CJQH 2HG5B 2WBJB 2WUBH 1JNLH 2VIRB 2KCMA 4KJNA 1F8TL 2K03A 1NKOA 3VB9A 4D0BA 5D7LD 1U8KA 4AE1A 5K9OB 2M26A 2HYMA 1ADQH 5F7HA 2YK1H 2WMPA 4UQIM 1DSWA 1FLTX 3HRZA 3VQMA 4DTGL 3TJPA 2XI9A 2DQJH 4HMJA 3B2PA 4KY2A 2EJMA 4CGYB 2J8UA 5BMFL 6CGTA 1PZ2A 4HETA 4YE0A 5KIXA 1FBIL 2OSWA 3DXAA 2OP4H 4C56A 2ODHA 4N1CA 5DCCA 2HLFC 2XPGA 4QXTB 3ARWA 3PPEA 3ILEA 3CQQA 4XO3A 1U8JB 1MD2D 3O0RL 1NC4A 3EOTL 5KJRL 3GYRA 1KLGB 5JHLL 1WA0X 1PH9A 4XPBL 2EXYD 5DRXB 5E56A 2GHWB 2A9CA 1T4WA 1FVIA 3ZT5A 4R7NB 1U8CA 3BVXA 1L6XA 4LLYA 1U3HD 4U4IA 3LKNB 2K7PA 2PR9A 1EDHA 4NN6C 2H6PB 1IM3D 3L95B 1MSHA 2VDOH 3KHQA 5IB4A 1HNWQ 3KXFD 5I71C 2UUAQ 2VTFA 1UATA 3CHPA 3DJRA 5D7KD 4G59C 3I6LE 3GSNH 3KYNB 2XWBA 4U05A 1F77A 2Z35A 9CGTA 1QLEH 2QV4A 5E24E 5GRJL 2NWGA 1SVBA 1I6HH 2WXFA 3DNKA 3VG9B 3QSKB 2VRKA 3PV7A 5E4WC 4A3JG 4LU5L 2EP6A 4XCEB 4JDTL 3KS0H 4I0PB 1OEZW 1U8HB 5I17A 5F1OB 3ARDB 2M9VA 1HK6A 2KT6A 3MV9B 1HQMC 4PPTA 2R2CA 4NRZA 4IRZA 4RA3A 4DQOL 1CG9A 4I48A 6PAZA 3NSWA 2V2WA 1M7IB 3GZKA 3UPAA 1QTSA 2N01B 2V2WB 4HEPA 2PCFB 2G3XA 4ISVB 4M4PA 3VXOB 1F4XH 1KJ3H 1A3RL 1WEJL 4ZT1A 2QSQA 4H26A 4NUGH 2WANA 3HOXB 4JYAQ 4TUKH 3JUYA 4XCYB 2WACA 4NT6A 3PLYA 4ERSL 1CDJA 4RCAA 5CCKH 5KYXB 1KTLB 1EJ6A 5FUCE 5D7EA 5LB1A 3V0IA 2VCOA 4PGEA 1I4QA 1KHIA 1GYVA 3BFOA 2DI7A 3HI1B 1KD1C 3LEYL 3QJHA 4A3DH 4HKZA 3TPUA 3QNXA 1K0RA 2ZPKL 2A9NH 3I73A 3WEBA 1F8TH 3CC5B 2AQRA 2W1NA 3HMWH 3VQ2C 2ZTDA 1BF4A 3SDCC 2XN1A 3D07A 3G5VA 5L9DL 2YR3A 4Y9EA 3BZDA 1UXSA 2J73A 1XMOL 3APDA 2NBFA 3Q48A 1DR9A 5IVZB 5AW0B 2G0LA 1KULA 2WW8A 2CNYA 3FO9A 2QDLA 3B5GA 5I8CA 1RSFA 1T03H 3VXRA 3VFRB 1S7TB 3M85A 5EOQH 1YO4A 2OR9L 1GPOL 1R3JA 4DR4Q 4QF1B 1AXIB 4HV8B 5HHQA 3QZPA 2WVSA 2J55A 1QCBD 4NKIH 3V79C 1IC7H 2PW2B 4OZFB 3S2HH 1NTDA 2C3GA 4L1LA 2GI0A 1PSKL 2PW2A 1ORQB 1D9KD 3HE6A 3JVGC 3K80A 4OZFA 4P5KA 3OQ3B 5T1DH 2RAMA 1KB5B 4PJHB 3IMSA 2XRQD 3WKYA 1YYLL 2XQYA 1A22B 1AR1D 4B7IA 3E6HA 4XPFH 2F1EA 4HJJH 1H9KA 1X7QB 2BNUB 2WXRA 1MHPL 3LMJL 3KLKA 4FJ6A 5E2VH 4PSPA 3RUGF 1JYVA 5D7LA 4ODXB 2WBJC 3S3SA 3QIBA 4YHLL 4LDLB 1CDGA 2VUMH 1FNFA 3INUH 3MJGX 4Z7VE 2FX9L 5LL6S 1NM9A 1OO2A 1XTMA 1U91B 3IGLA 1ZTXL 4CVWA 1S5IH 4GAJH 2EDKA 2EE1A 4X65L 2Y6SD 2FT6A 4HCIA 1E9QB 3CC5A 3SYAA 1QFWH 1UZ8B 3IMRA 3QAQA 3RTQB 4CSSA 2NNRA 5C70A 4FF1A 1T1ZB 1TR5A 1A7OL 4HKZB 1SBSH 3TBBA 3UDWA 1Y69U 2VSMB 3RU8H 4X99A 1DVFC 4CDHA 4LFBQ 3WOFA 4ZXBC 2F7PA 3GK8H 2HHHL 3GSWB 4KK5C 2J5LB 1CXFA 4E41B 2A69D 5BRQA 5EBCA 1CLZL 4Q5VA 3BZFA 4AT6A 4QGUA 1JE6A 1NOFA 1DL7H 1IBDA 2QGDA 4PJ8A 5AWNL 3EXLA 2W80C 1WBXA 1QLFA 2B9AA 1R3KB 1JZDC 3X17A 4EUPH 2Y5QA 3LEYH 4QJ5B 1UCTA 1NL0L 4DN3L 1AYOA 1HOCB 2ICWB 3N3EA 4L8BB 4I3GA 4JFFE 4ANWA 2Z6KA 3CFCH 4QTIH 3OZ9L 2BA1A 1HYRC 1DTUA 4ELME 3N44F 3HAEB 3OMNB 4FFWC 3GEFA 4JI1Q 1A3VA 3KYOB 2VR9A 5BN3A 4JFDA 1LXMA 4QXVA 2GUOB 3PP4L 1FZJA 4WTWA 1J7VR 2NCEA 2WP3O 2X4UA 4L1HA 5T5NG 4HTHA 3M1CA 2QT6A 1QBBA 1WAAA 4AITA 2MPAH 5I1LB 2CDFB 2VW7A 2F5BH 1F9QA 1N36Q 4H8QA 1SEQL 2J4WL 2OXHA 4I77L 5DMGC 1ZHKB 5EEWA 3BT2H 4JRXA 3BPNC 3V52L 3X1FA 4HPOL 5A2QL 3IBOA 5HI5D 3ZL4L 1WCMG 4QNPF 4NIYE 3TONA 5ELDA 1SMYD 5M5WH 1OT1A 4OT1H 3BKML 3Q43A 5HD8D 2YIHA 4HEPG 1H3TA 5AVTB 1YYML 4M56A 3ZMNA 2A73B 1L3NA 3U79A 2N1TE 3BP7A 2KZ1B 1N10A 2ZJSL 5CMAA 1OT4A 4YIQB 3IMTA 3K8AA 4PY7A 4XR8C 5ALBL 5FW8A 2XDHA 3SDAD 3VWKD 3OW2A 3GTPB 3SCMB 2K5DA 5LDUA 2VZ3A 1JNNL 4DESA 3N9GH 4AQ1A 4KKAC 1DVTA 1S5IL 8FABB 4DUZL 1FJ1A 1MW2A 2F53E 1QRNA 2JKSA 5IJKA 4NWTL 1QRNB 1J1PL 3WJJC 3UTZB 2W0PA 1QTPA 3OG4B 4L3FA 2AHOB 3ZE1F 3QPXL 4WV1A 4Z7WB 1JBJA 4Y52H 2HVJA 4X5RA 2PTUA 1RHHA 4WI8A 4BSWA 1V3JA 5IMKB 3PXHA 1STEA 3SE0A 3MXGA 3DYMA 5SWQA 3BUPA 4FZ8L 2WCPA 3RWEA 1AKJB 5HYIA 3ZTCC 5J5EA 3RIFK 3KNBA 4OZIB 4C1NI 1T7YA 4UP7A 5JHAA 1MJ8H 5AKTA 1KJVA 3LGJA 3EJJX 3KXFE 3IFLL 3TO4D 1O7DE 3BP4A 2O61A 4BQBA 3KJ6L 3L17A 1EO8L 5EO9A 4JRXB 3ZDXE 3FKIG 1VQHA 3C9NA 3RB5A 4RISL 2AF2A 2A5UA 2ZTEA 5DEFA 4MX7B 4XO8A 4QRPA 5IVZA 4C54A 1UURA 2XG4B 3QBTB 3PWVA 4HUXA 4N9OB 3NACH 2IPUG 2DEWX 3H9ZA 2ZZUT 1T1WA 3IRPX 5JA9A 4ZUTA 1EUTA 2BW4A 3L81A 4XWOD 5E94A 3ASOB 5ISZB 1ZY9A 4DR6Q 2MH4A 4GRWH 3GTQH 4HKXA 4KITB 1MXDA 2Z0UA 5M5XB 2Y7LA 3TV8A 4C57C 1WTRA 2WLJA 1MQ8A 4Z8FL 4KK8D 4IYKA 4DR5L 5JIKA 2J21A 3I6KB 4W93A 2J44A 3GNML 1R24A 4TUOB 3AW5A 1CHPD 4LUOA 2AJVH 4WO4B 4MJ6B 3UL4A 1TZIA 5KSVA 1BZ9B 1JJ2A 4GAAA 3ARDC 2MNAA 4Z3GA 3AYHB 2K75A 2FEEI 3QAZB 5JOPE 2C3VB 1QNZH 1OP4A 3NFSL 2ADGA 4O2FA 4M9PA 3E38A 4MMXA 1W6JA 4A3MB 4QRAA 3NCJH 4N90E 3PP3K 4H20L 3I8ZA 1L9OA 1EJ8A 1MCNA 2YFOA 1B0GA 4WUUB 5EU3B 4JDZB 5CGYC 5D2LA 1L0YA 5SWSA 2N49A 1OHZA 4NZDA 4TNFA 3UTTD 3S8WA 1HQ4A 1K4CB 2IH1B 4OF0A 1HHHA 3ZE1B 1GZHC 1I8MB 1W15A 3M46A 3R93A 3P9MA 5SWSE 5KVMC 1HZAA 4PJ7F 5D1XB 1QSEB 3UJTH 1MVYA 3OQRA 4FAAB 1IMHC 4E41A 4XPHL 5T1GA 4CKEA 5DC9B 1JPTL 4RFNC 4AUUA 1D7CA 1N19A 5DO2C 3HBPA 2V4DA 2R0LL 3NIFE 3PP3H 4KZEH 2IPKD 3MRJA 4L4TA 4JI8Q 1G7LA 5ANHA 4BXXG 2JB6B 3MV11 3KPTA 3QUZD 2BERA 4OGQC 1HHJA 1UWGL 5DJDA 5TPWH 3C12A 4DHLA 3GDEA 1A7NL 4OQTH 5F7DB 1YEGH 1QFOA 3ONAB 5KS9F 3K7UC 4Q9BA 3P3YA 2D62A 4Y5YA 3ZHNA 4P2CB 4XWGH 3A8IE 1BCPF 5KYIA 3WOEA 1C08B 4HD5A 3RUGE 3ZIMA 4WI0A 3KF6B 2WO3B 1NCBH 5F88A 1IZJA 3MACL 1HA6A 4GRWB 2GK0B 2V7NB 5T1LD 3I72A 3OAZK 4IRSC 1UFGA 3QIBC 4PJ9C 5I5JA 1BVLB 1SN5A 2XN9E 1B88A 4GAGL 5HY6A 1ZHNA 4TSCL 3S8FB 1AEXA 1NCWL 2ES2A 5INDA 4RMUA 3L3JA 3EO0B 4OZ4A 4M03A 4L8SB 1NPJA 1ZANL 2R15A 3JAME 3L13A 4DK3C 4LHJB 2LW3A 3V5KA 1WD1A 4HCRA 1MJEA 4LFCQ 3GTGB 4ALPA 2XV3A 3TA3C 1JF5A 5J6HA 4TLTA 4G57A 1LNUA 1KXLA 1MAML 2MFIA 3RDTC 1HZLA 1W8OA 5AUMA 1G9MC 1KTBA 4OI9A 4JGJA 3G7TA 4N2BA 5CP7A 3KLHC 2D0HA 3JWOC 4WNQA 5CP7B 1E28A 5GRVK 4GI9A 2F53B 4JAMB 3ARSA 4JRYA 3EYSL 4HKJB 2F8XC 1LWRA 3ECQA 3LX0A 3BQVA 4OLWH 1ZXTA 2XYCA 3MRGB 3W11C 1NCCH 2CRIA 5DMYA 2CCVA 1GH7A 4HJEA 2DJFC 4ZYSA 1IQDA 2VDLB 1ZPLA 2EDYA 2EADA 4L05A 3VFPB 2BWIA 2UY7A 1J5HA 2D03H 4OZFG 1G9ML 1U93B 1JGUH 3O3DB 1UB5A 5I1JH 1ZHNB 2W91A 4RH4A 3I50H 2BOBA 3NPPA 2XQYG 3O2DH 2APFA 5FECA 4WKZB 3N5AA 1IARB 1PAZA 1JHKH 1KMGA 1JNHA 3SGEI 2EUWA 5IBTH 1MFBL 1JWSB 4KBPA 2F0WA 4OLYL 1EJOH 2VM4A 1G1OA 1CXIA 3C8DA 2X4QB 4H1LA 5F7YC 4Y16D 2A4ZA 4GG6A 1CS6A 2FSEA 5BW7C 3AROA 5D71L 4D8PA 1DJZA 1QEWB 3HC2A 1UWFA 4NW2A 1Y1UA 3ZE2F 4KH2A 1XXGA 1KPRB 1UOLA 3SY0A 2G4EA 2VO8A 4R4FL 1QAWA 5DVNA 2B2TA 1E9PB 3MBEC 3FTWA 1OXSC 2Q8BH 2FD6H 5E5RB 5C0CE 1X5LA 1FRGL 3WDHA 3EHBB 4X6AH 1VDGA 2XCMC 4P5TC 1MIEL 4RRPA 4XNZC 3FBKA 4WWKB 1ESRA 3H15A 3P4OB 4OSUH 2D2OA 4Q6IB 5CXPA 1ZS2A 2LVCA 4Q6IA 4XH2A 5MI0B 1JPGB 3J81c 3ZRCC 3MLRL 1CFQA 2VXQH 2IXQB 4PJIE 4ZQKA 4HH8A 1I85C 5C4JH 3QO1B 1J87A 4L1TA 1YHBA 5KOVC 3OAWA 1TVHB 3VR2A 1U9KA 2F19H 2WYZA 4L3EA 4LCVA 3TIEA 2FFKB 3PWPE 3DUUA 3UTPD 2WIIA 3VFNB 4BBRB 4AIZA 1I50B 1LT6D 1WCBB 2E8ZA 1Z3GH 2K32A 2F0OA 3HFZB 1EZLA 4N0YH 1FIGL 1AZUA 5I18H 2YGVA 1R0AL 1N9WA 1BIIA 3GS4A 1NINA 4LHUG 3X3GL 2MUYA 4UZUA 4HBCH 4ZTPH 3QEHB 4YDLC 1UE5A 4QHPA 3T2PA 3VYPA 4PJIA 5IFAH 5SWSB 5FLXc 1LILA 1MN4A 2X1XR 5D70L 2WN3A 2UVFA 2OCJA 1OCCB 4WU5B 2ZCKH 3HUJF 5AJ3Q 3QRGL 1CXHA 2GBTA 5AEAA 1XZ0A 3MXUA 5FCUH 3I9PA 4B9ZA 2AXHA 4C3JH 2W38A 4JEGB 2F3WA 4L2LA 2E2JH 1BF5A 3BE1H 5T1LA 1MCEA 3B9AA 1SN8A 2MO1A 3LHPH 5K1JA 3DIDA 3NPSB 3RGVD 3FUEA 2BSDA 4RWYL 3NJVA