4FXKC

Human complement c4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 Beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxkC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxkC01
5FOBB 1D2BA 1AYOA 1BV8A 2A74C 2PN5A 5FO9B 2ICEC 3I70A 2TMPA 1BQQT 2A73B 3V96A 2XWBB 2XWJB 1UEAB 1XWEA 2WIIB 3HS0C 5JPNC 2J0TD 3T4AC 3OHXC 1BR9A 1EDYA 5FO7B 1PXUA 3MA2B 1BUVT 5FO8B 2WINB 3HRZC 3KLSA 2QKIC 2E2DC 3CKIB 5JPMC 4FXGC 4LNVA 4FXKC 2B39A 3FRPB 1OO9B 1GXDC 2I07B 1UAPA 3L3OC 3G6JB 3CU7A 4ILWA 1JB3A 4D94A 1JC7A
chains in the Genus database with same CATH superfamily
4P2QB 2MP1A 2QGCA 4PRHA 5DK0B 2NUTA 2LY7A 3K2UL 1B4OA 1WK0A 1PX4A 1QR4A 2A3TA 2VDRH 3K8AA 1BZ7A 4MNGB 3M9BA 2E74C 4PCTA 2FAUA 1MSPA 5J12C 3ZYOA 1QLRA 2WY3B 3BGFC 4FKHA 4BFRA 4NM4H 4XHJD 4YPGA 2MTAA 1NCAL 4FI6A 4DGZA 1Q0YL 1ZANL 3SPJA 5E1HB 5F0LB 4AOFA 2L0DA 1YZZA 4RWHA 1FFTB 4YWKA 3LZFH 3MNWA 4NQCE 2EXDA 3K4ZA 5DVNA 3NJLA 1D3CA 5B1AB 4IALA 3MGTB 3GNMH 1Z9OA 1WSST 4Y4KA 1PGRB 2XTJC 4WK4B 1G1OA 2LOEA 1D6EB 1EY8A 3KBFA 4MAYB 4M93C 2IJ0C 1MLBA 1U3HD 2Y1VA 1RK1B 4NP4L 4LFBQ 4OCSH 4KY7A 2F7RA 5DHYB 1UD6A 3HZKB 1XCTA 1IRAY 2O61A 2BH0A 2Y5QA 4YNYB 5HDBB 1L4IA 3HB3D 3V5DB 4H7VA 1IIKA 3UZEA 1ZTXL 3PWPA 4MJID 2GK2A 2Y5TB 3CZFB 1CFQB 4G7RB 4K2UH 4L6TB 3IS0X 2NZOA 1V1PA 1T2XA 3NAAH 1HZKA 1VFMA 1CUKA 4PLOB 2QPUA 4XQQA 4QRPB 3RWEB 2VYRE 3IDGB 3C5JB 5L8JB 1Z2KA 4X4KA 1HL5A 2AQ3A 2K9UA 1TWFH 2E3VA 2X10A 4NPKA 4ONOA 4FFZL 5D93B 5HHPB 1B4JL 5CEYB 1J10A 2FX8H 5F7MC 3NFNA 5SV3A 3WTSA 1IM9D 1BQKA 5EB9A 3WLWC 3HNVL 5E03A 4XXWA 5AB1A 1KTKA 2F4IA 2WLYA 1QWUA 5G3LF 1F3JA 1DQQA 1HZCA 1A4KB 3QIWA 5HYJB 2K5NA 4LF7L 1E4KC 5GAHC 2F1AA 2XWCA 1A66A 1LVEA 5H2BA 4P2OA 4PRHE 2Y7SA 3DC0A 3W9DB 3PIP3 2XBTA 2ROYA 1I9IL 1AN8A 2EDXA 2Y0SA 1ND0B 2YEQA 2ZUWA 3QW9A 4TL5A 4A7QA 4JI0Q 4DN4L 2NZHA 1GL4B 4KXBA 4NQCB 4X7SL 1O7ZA 4JVZA 4JCWA 3HI6L 4HEDA 1ZVSB 3NK3A 3PGFH 4O9HH 4X7CC 5IOPB 1XSIA 2DQGL 4KTEL 5JPMB 5CMAA 4NN5C 4FCAA 1KLFA 5DMKB 3I72A 3OGOE 2ZYRA 4K5OA 4BEIA 5FDWA 2GYSA 5DD5H 2EUWA 3K6OA 2YEZB 4XODA 2P28B 4OV5B 5I1CH 4PJ6A 4JKMA 1VQ9A 4NB7A 2AJUL 1TZHB 1L9PA 3UL4A 2XWBB 2X2JA 1W8NA 3IXAA 2XJLA 1NOAA 4XBPA 4P2RD 1EDHA 4HPOH 4O1NA 4KHTL 4WNQA 4KKLC 3OHXC 4XVOA 4P4RB 5J1AB 3SOTA 4MLIA 3MOAL 3NCWA 4KUZL 4PMWA 2RSNA 1GMEA 1HWWA 1D8LA 1ETZB 1EMTH 5J3HC 2ZJSL 3LZNA 4K3GA 1STYA 1H9RA 3CXDH 3JWOL 1KCBA 4QXTB 4UT7L 3PWPE 4ODGA 4OX9Q 1DJGA 4UNTA 3TBVA 2WXRA 3MRMB 1VGEL 2FSDA 2YAMA 2B2XL 2E8YA 4P5TC 4DVBA 2I27N 1C8QA 2UXTA 4G71B 2PUQT 1H9KA 1PZ5A 2B2WA 1RUQL 2E7CA 5A2QE 4NBZB 3WIFA 4G59C 3WNIA 2WSDA 3DOSA 4FFVC 2MMXA 2O6DA 4O2EB 3UEZA 5HPOA 1SLJA 4KXCA 3A4EA 4F8LA 4JFDD 2EDOA 3K6NA 4N6RA 2ZF9A 3D0VA 4JL1A 5EBGA 3BZEB 2NUTB 4PRHB 1USZA 2QQKH 4JO1H 2E8ZA 4X65L 3I6LE 3KBPA 4KVNH 2ITCA 5DCCA 2EIKB 2XUWA 5AKRA 5DJYA 3II3A 1XCQA 1BZ7B 1LP9A 4FHKA 1WO2A 4GW1A 3EH2A 4MJ4A 3KFUA 1KYFA 2A9DA 2JKRM 1PZSA 3GSQA 4N9GA 2OR9H 4DUXA 1QLRB 4HHWA 2MIZA 3DECA 5C3WA 5C3TA 3UX9B 1JNNH 3B6SA 3QUYA 4YPGB 3MCLL 2L7UA 4X8XA 4N2HA 2Y0SE 2KYIA 2QZ5A 4H1LG 4Z7QF 4J15A 2Y6TE 1KGCD 4S1SH 3T3MF 1ENCA 1BBXC 3MNWB 2HKFH 5I4DA 5C7ZA 3KYHC 3FULA 3TJHC 4JRWA 4HF5H 4JQVA 1G1YA 1V05A 4MA1C 3DX2A 4MXWL 2K70A 3BG3A 4P9MH 1UZGA 4UU9A 4Y4KB 4BZ1H 4E9SA 1BECA 2HXAA 2OL3L 4GP4B 4HIXH 1MLBB 4YFLF 2ICIA 4GZYC 1NCNA 2BWQA 8CGTA 3HPLA 4LF9L 4RGTA 4OFKA 1XCTB 2O61B 2F3VA 1I7ZA 1UASA 3C87A 2CA4A 4M5ZH 4IHOA 2EVGA 5D7JC 1HS6A 1LLRD 5T5FA 1BR9A 3JAMc 2VQTA 1EY7A 3PWPB 4YDNA 5EBMA 2XVGA 4MJ5A 4WWKC 4EN2A 1JDCA 4QEGA 4E5XA 1TT2A 1Y69U 3ZKNC 2JJSC 1YAIA 4N8VG 3WKNA 4ANKA 5IFJA 1TPXC 4Y5YA 1V1PB 4TNVK 2JB6A 2R3ZA 1M7IA 2K5HA 2Q1EA 3T2PA 2C3VA 2XZCL 3CHQA 1OQXA 2AQ3B 2AEIT 3ULVH 4FG6D 4JZJC 3EYFA 1F9SA 4QLWA 2VR4A 2AEWA 2YD9A 1CB4A 4ENZA 1JNHA 5IJKC 4HCRH 3NFNB 3X1NA 1MCBA 2IV8A 3P2DA 4O4YL 5AKVA 3H3PL 5ELNA 1N6VA 1F3JB 3RR5A 1DQQB 3Q9QA 1UFUA 3QIWB 4DR6L 2HMIC 3QWOA 1BAFL 2ADJA 5DZ9A 3HE7A 2EXYC 4B9KC 3UTOA 1DXMA 5H2BB 3E3QC 2YUWA 4IUUA 1HQRA 4P2OB 2X6BA 3LTVA 5M5WH 4X50A 2R8SL 3S7GA 4XO4A 3CSFA 1DZBA 2MHAA 3FKIG 2ZWYA 4U1HB 3TCLA 5AOZA 2Y0SB 3NUKA 3V0WH 1MNUH 3BPNC 4DGYH 5ESVB 3LX9A 5I6XB 1NGZA 3VR4A 3RFZC 2JNZA 2OFQA 4JLRA 5JHAA 1U8CA 1KTCA 1QACA 1UM4H 1I7TA 1D5ZC 1HXMA 3ECUA 2ICCA 3QUXA 1WV7T 4M9OA 2AQTA 4KK7A 1P2CA 4Z3TA 4BXVA 5CMAB 4A2EA 3ZDZE 4FNRA 1KLFB 5FDWB 1Z6JT 4H1LH 3TP8A 15C8L 2V3FA 2J44A 3MBWA 4H2CA 5FA3A 5L7XL 4N26A 1KDCA 3I90A 1INEL 3TV3H 5HURA 2Y06L 5DUMH 3KYKH 5M3FG 3SO5A 1FAIL 3EF4A 5DMYA 1YO4A 2CIIA 4IRZL 1R3KA 3IXAB 3CMOL 4XBPB 4FA6A 4WNQB 4X7DC 2LGNA 4YHYC 4OJEH 1MIEH 3LWUA 2GIMA 3UZQA 1FNEA 3GTVA 1B0IA 4KY5A 2DQTL 3OTTA 2IDQA 4NQVA 1SR3A 5LNGA 5KTEH 1JXGA 5EV7A 1SRUA 2AJVH 3TBVB 2YK1L 3HHMA 5B3SB 4JREC 4IBWA 4YSEA 1U0QA 1VEPA 4TUKL 3POCA 4DVBB 4BBSB 4LL4A 5GGRY 1FYHB 3RU8L 1PZ5B 1RIUL 3RKDC 4BH8A 2ZTDA 3WIFB 5KS9A 4TTGA 3VH8A 2ZOKA 3DOSB 4POUB 1SFDA 3Q0AA 1WTHA 3W0WE 2CHWA 5FLMG 1NCJA 4MZ2A 4WTZG 1NDTA 4C1NK 5FWQA 2H1XA 4N6RB 1U8JA 4DSYA 4P99A 3D0VB 4KY1L 2Z6BA 2R7ZG 4K8RH 4M6NL 5FW7A 4IM8A 3UTSE 3MNZA 2VDKB 2ITCB 4YPJA 4ZX3A 5DJYB 1XCQB 3I4MB 2XRAH 1C5BL 1LP9B 3IS1X 3K5SA 3NACL 1U6AH 4GW1B 4XHJC 1JZ2A 2DM4A 3GS4A 3ERXA 1MPAL 1C1EL 3IPEA 5GRZA 5ISZE 1GCYA 3GSQB 1S7RA 3IGUA 4N9GB 1F5WA 1FGUA 3EJIA 4MNQA 5DLMH 3UJTL 1GGUA 3CD4A 3B6SB 1B0WA 3ARZA 3QUYB 1WTWA 3OG6B 2AXHA 3FKIH 4FFZA 3AJ7A 1NJ9A 3ZDZB 1U21A 2QT6A 3HZ3A 3BLPX 4F8PA 1IBKQ 3X3NA 1GGIL 5KSUA 1KBKA 1J8HA 1U3HC 3QZBA 3KUPA 3QR1A 3HZXA 2J57A 2XVBA 1PDQA 4FQLL 3SDAA 4R7LA 4UU9B 2Y07L 3LPFA 2ZUVA 2ERJB 2ODHA 3CKIB 1P1ZA 4LL9A 3MXPA 2CBMA 1E28A 4HIDA 1B8AA 5BV7H 5D70H 3MLYH 3HPLB 3WDNA 4J5VA 5TK4A 4Y4FC 2OK0L 3BLBA 4KQ4H 1I7ZB 5FHAL 1PEWA 3FH8A 3P4NA 3Q43A 4IHOB 2CGYA 2X89A 2BDOA 1T83A 3N1FC 4ORZC 5IFAH 2VDNH 4K71B 4M1DL 4XE5B 5EBMB 1FCCA 5E6ZA 4MJ5B 4K8IA 4XAWL 3E3XA 2EDFA 1PFSA 4E5XB 5IFJB 1OD9A 3DLLA 1Q3LA 1P4IH 2YR3A 1JE5A 2X69A 2V9TA 3BUTA 3QUZC 4Y5YB 4A7VA 4J2XA 3CMGA 4GIPD 4JO8A 4NGHL 2JB6B 4DV6Q 2BH2A 3KPNA 3KBHE 4Z95L 1YNJD 4MZ9A 1M7IB 2C3VB 1VZHA 4GW5A 5TE6H 1GUNA 2YARA 3JT2A 3EYFB 3SGKC 5HVHB 1OLZA 4GOPC 3BWAA 5FS5A 1W72H 1D9KC 4TQPA 5IFHL 3F05A 1JNHB 1DQMH 4H44C 3ECVA 5HJ3A 4N2KA 4P5SA 3TWCL 5KS9E 2JP1A 2QKIA 4WO4D 4Y1AE 1QNKA 3Q8FA 2A1WL 3ZKMD 3KM2A 4B7IA 1S72A 2MHVA 4YZFE 5F44A 3U0WH 3QWOB 2ADJB 4AYID 3EH5B 4C2MH 4K0KQ 3HE7B 2V9QA 4GQQA 1J1PH 1DN2A 5FLMH 4XVTL 3VRIA 4KTDL 1HQRB 3BQUA 3HW7A 5T1GA 1EX0A 4MMZA 2VDQB 1RMFL 1OCWH 2FT7A 2MHAB 4P48A 3TCLB 1SJHA 2EUZA 3ZGIA 3AM8A 4CMHC 1ZXKA 2NXZD 4BH7A 4W9JC 4JGUA 4PJ5A 1NGZB 4L4JA 4MNQE 3IYLW 2MEJB 1ROWA 2VLRE 2NVTB 4JLRB 1U8CB 1XIWD 3QUXB 4OM1H 1I7TB 1HXMB 2K3TA 1DFXA 1P2CB 1PLGH 2J88L 1DJYA 5D1QC 5F0JB 2MPMA 3MJ9L 3JWDC 3GHEL 3V0HA 4MAUH 2O5XH 4AI7A 3MBWB 2HH0L 3T8XA 4O2CA 3JAMi 3VWKD 1P7KA 1J8HE 5FA3B 4GRMA 5T3XD 4Q9CA 3FU6A 5E8NA 5EA0L 5EQ0A 4IRSA 2BOSA 1NY4A 4DP7X 3HAEG 5AVSB 3WY2A 2CIIB 1R3KB 4NM8L 5JIHA 2NQCA 2V5RA 4BBWA 1SXBA 4FKKA 2Z91A 5H1SE 3MLTA 3NMEA 3UZQB 3SGJA 1XNQQ 1FNEB 1G51A 1RZQA 2N3JA 3ZE0F 3ZUCA 2J1XA 3WNNA 5GZOD 4APQD 4NQVB 3F7KA 4CC1A 3NP8A 2BNQA 4TVPD 1RDPD 2NZ1A 4JFED 3L9AX 4GO9A 5F1NA 3UG3A 1RZKL 1ZHKA 1NM4A 3EYVA 2QFPA 3ARBC 2W60B 3MA7A 5C0DA 2VDMH 3VM7A 4EJ1C 4I2XE 1KMGA 4YWLA 1A7NL 3J81j 1DVZA 2OL3A 3C75A 3LZQA 5EKKA 2ZOKB 4KI1A 3VH8B 4AYSA 3QR0A 5A2JH 4X80L 1G43A 2G3MA 4A3BB 1WDAA 1SVZA 2QTEA 1B44D 2AANA 3OR7A 4UINL 5DHMC 5ANME 1Y8PB 3EZJB 4OCXH 1H3GA 5KYLA 1U8JB 4WAFA 3M86A 3R8QA 4XNXH 4L5FH 5KWYC 4DEWA 3MNZB 4XT1C 1HE7A 1X9UA 4MJIA 5F7BA 1UCBL 1MFDL 4O42A 3L4VA 3QORD 4XMZA 4G3YL 3VI3F 2C9AA 1AO7E 1OF2A 1ODUA 2PPBC 5A2BA 5J0BA 1STAA 1S7RB 4PGDA 1I31A 4KV5F 1ICTA 3SQOH 1SEQH 4MNQB 5AB2A 4Q6KA 4ALAC 3C5ZC 4XRCA 1CBJA 3ILQC 1KYOJ 1HX0A 1SQMA 4QDGA 4QTFA 4X5PA 5KYWA 1NJ9B 3H3BC 2KCCA 2G4GA 2R0LL 3MXVH 4XPTH 4FVMA 5KSUB 4PJ5E 1MD2D 1J8HB 1P4LA 1CDHA 4RAUC 3OKDA 4KVCH 4JFFA 4JS7A 4LASL 3L5XH 4LVHB 3GTKH 1WFTA 4XOCA 4YGVA 3R7RA 3SDAB 1MW2A 5BW7C 1GGBH 3TPUA 2WWNA 1DQDH 4LF5L 3NSYA 3K81A 3MNDA 2YA0A 1U4RA 1P1ZB 2OTPA 3DRTA 3G6AA 1E28B 3Q2VA 4M62L 3S37H 2R92H 3SY0B 5GJSL 4DGIH 2NY3B 4Y5XA 5AKSA 4LLUA 5KG9A 2LSSA 2QCPX 1I1AD 3SE3A 4YH6A 2IH9A 3P4NB 2WC7A 1HSAA 4CKEA 1QFWM 3K46A 2H32H 5F21B 2VLJA 2B8FA 5JHLH 1CC3A 5LCVL 4PJ7A 2YD7A 5ABAA 2BP0A 2WLJA 2W5PA 2NXYB 3ARED 3IJ9A 4ZFGH 3KPNB 2BNQE 3S5LG 1AH9A 1QP1A 1XMQL 4EPSA 4GW5B 3TFBA 1A0QH 2Q76A 2AXFA 1INQA 4JO3H 4N1EA 3BWAB 2V7NA 3J27A 2GQHA 4N90E 3VXRD 2A6IA 5HTSA 1L7IH 4P23C 3UJIH 4HCGA 3O3AA 4O58L 5HJ3B 4IRZA 2EH8H 4NW2A 2IT1A 2QKIB 5FK9C 4PB9H 3LDBB 1VQCA 5G2NA 5GRYA 1OK8A 3CFIC 1FVCA 4GKKQ 4TVAB 4N9OB 3VRIB 4KN7C 4XMLL 3BP6A 1IC7H 3BQUB 2VW7A 2WYHA 4MMZB 4QJ4B 1X3EA 5HI3D 2YFNA 1RL2A 1JORA 4XB7A 2N01B 1SJHB 1J6QA 2Y1AA 3BEVA 3KW8A 1JHLL 2R39A 3VGEA 4BH7B 1IQDA 3RVVC 3CXHK 4IK6A 4PJ5B 2DQJL 5C6TH 43CAB 5L2JA 3BSZA 3QXVA 1TVDA 1CZ8H 2Z35A 4L1TA 4TRPH 1XGQA 3OTOL 1JFHA 3ILPA 2NR6A 4H8WL 4JFDA 3VR2A 4U6TA 4XNUH 3T8XB 4O2CB 3L4WA 1P7KB 5AAWC 2XWDA 4GRMB 3HN8A 1IBDA 1TY0A 5I1IH 5IR1A 2G3NA 4JFFE 5E8NB 3S17H 5IK3A 3Q06A 2WN2A 4IRSB 4NZDA 2CW0C 4J27A 2BHYA 3ZL4H 4DTGL 3S48A 1U3YA 3A23A 3C09B 3KPOA 2AK1H 2Z91B 3O8XC 1RIVL 3MLTB 4HG4K 3GV3A 3GO1H 4J3BA 1TZ8A 3UTTA 3W9EA 3VI4F 3RA7L 5FOJA 1BFTA 2DQEH 4KAQL 2A6HC 3V2AR 2BNQB 3DKHA 1DQIA 2VLJE 4D8OA 2E9JA 5JVG3 3BOVA 5F1NB 3O45A 4ZD3L 4BQ8A 1WWCA 1ZHKB 4JRFA 2PCPA 3EYVB 4X8JA 2KBNA 3MA7B 2WP3T 3WFDL 1V7ML 4X83A 5C0DB 4N0YH 3MEFA 1PX3A 2OL3B 4POYA 3D08A 1TQTA 2Q5BA 3RLFA 2LVEA 3ZSSA 5TPWL 5I15H 3BZ4A 4AVKA 1CDIA 3OR7B 2C7UA 3MRIA 3QNYA 4P05A 4YXHH 2JI1A 3OB0H 2BHUA 4CGTA 3RDTC 5GZNC 3KDMA 4OELB 2UZIL 3RP1A 5HD8C 5I1HL 4XX1E 4H7BA 1QPKA 1KJMA 3NJNA 5IESL 4MJIB 3BAKA 1DSFL 4YMPA 1OF2B 1VQAA 2EECA 3A55A 1P7BA 5HDQH 3LB6D 4B9JA 3BDCA 5AOIA 4JV5Q 4PGDB 3PU7A 1F4YH 5B8CA 2Z8VC 3L5WA 4K9JA 1UWGH 4KH9A 4GNXC 2CG9X 4PJGF 4MXVF 1FUNA 4XRCB 5EZJA 2ZXAA 5SX5H 2NPLX 3T71A 3WFBH 4LMQD 1DO6A 3MLPA 2A1AA 5KYWB 4PS3A 3D33A 3SDXF 1LWHA 1UT1A 1P4LB 1VZIA 1ESFA 3OKDB 1A1MA 3OKNA 3LRHA 4I18A 2FB4L 4JFFB 4MRBA 1F4WH 4R7VA 4YGVB 3UZVA 5CEZD 3HC3L 2OMUA 4H0LC 1LL1A 2J7LA 3K74B 3TPUB 4XN7A 3G6AB 3DRTB 3CHRA 2CO3A 4CHTB 3BAIA 4DNLA 1LDPL 5DHVH 3ZHKA 4R4FH 2VIRA 1R5IA 3KEDA 4Y5XB 3W56A 3V05A 4RGOS 3AG3B 4LLUB 5FYJU 2Z4HA 4OI9A 5KG9B 2AQPA 4WFFE 4X2UA 3CCLA 1HSAB 2I5MX 1O7VA 1X7TA 2VLJB 4R5VA 2VE6A 4XX5A 3MLXH 3V79C 2DBLL 4PJ7B 2X3BA 4WSGA 1QTSA 1TFHA 3L1FA 1SDYA 4CBVA 2BP0B 3TCXA 1I53A 3UTTE 3QYNA 5E08L 4OLYL 1IKFL 1JGUL 4NDXA 1LEKA 5DJDA 2OT2A 3MJ9A 4P46D 5E2TH 3S4SA 5K9JH 2Q76B 3KPTA 3GI8L 2AXFB 2EDMA 3O6ML 1INQB 2EE1A 1I4RA 2V7NB 1YIJA 5D7KD 1WFIA 2A6IB 5ICYA 5BZWB 2IHFA 3O3AB 3V0FA 5T3ZH 4N25A 1FE8L 4DESA 4JO4L 4ZX5A 3ENEA 2IMMA 1XX8A 3ZPDA 3EO1A 4DO5A 1MRFL 2K32A 4POZD 5IJCC 3KPLA 1I1FB 3ETSA 1NIFA 2DWXA 7CGTA 3A8IE 1FVCB 2YWYA 2AQRA 2XOTA 4CDCC 4XWOD 5KANG 2NNXA 3BP6B 3IFTA 4WFEE 1PJWA 3M45A 3NIDF 5TE7L 3WN5C 4G8FA 1MH5A 4R8WL 1KJ2H 5K1NA 3B9AA 3BEVB 5T1IA 3ARFD 2WB1B 4IJ3B 3RJOA 3EIVA 2E4TA 4XTRD 1IQDB 4QIWE 1A6AA 1W80A 3CLFH 1GC1L 3QJVB 5C09A 5IMKA 1WEJH 5L2JB 2D7QA 1WZMA 2Z35B 3WY1A 1XGQB 1XDTT 2AI0H 1E9QA 3ILPB 2J6WA 2P5PA 1YZ6A 1OTTD 2YUXA 1WC7A 3QQNA 4JFDB 2A68C 1TSHA 4IMLA 4PMFA 3RRQA 4GEJA 5IR1B 2QSQA 1WT5C 5IK3B 1SYBA 2XN9A 1CDUA 4LSPL 4LOVA 2WD0A 3TLRA 3RDJA 3TJEH 4AITA 3F7VA 2K8MA 5MI0C 3KPOB 3WOEA 3MRLA 3UH8A 4AC2A 1YNTA 5BRZD 3H94A 3M4QA 1HNYA 1RJTA 1O0VA 1EZLA 2HUHA 3ZDYE 1B90A 5CCHE 1A02N 3UTTB 3W9EB 3HI5L 1FBIH 3GYRA 3H91A 3REWA 3APMA 4U6VH 1H0DA 4KROD 2F0KA 1J0IA 1WWWX 3B9KC 3O4LE 3ZZ1A 3QIAA 2X12A 3L1GA 3O45B 4WJWA 1HKLL 4TLUA 2PCPB 4X8JB 2RDHA 2Z93A 4PCKA 4UBDC 4L5RC 3PO2G 3ULUL 4HJ9A 4PWIA 5C3LD 4JB9L 3ARSA 4KMQA 2XA3A 5E2JA 1YECH 4TOYL 3ZHLA 1M1SA 1SAPA 3BZ4B 4XOEA 5IT2L 3QCVH 2C7UB 3CZSA 3MRIB 2HT2D 3QNYB 4MHHI 3GIZH 4QLRA 3EYSL 3EBGA 5CP3A 2BRRH 3ZHNA 2FDBP 1TYRA 3KDMB 1E40A 1UD2A 3GP7A 2QFRA 2BNUA 1KJMB 4MYWB 3SEPA 3TYGL 4CL7A 5LCVA 3CCJA 4N2LA 4PJHA 4G8AC 4Z8FL 2MJWA 1EWIA 4ZJ9A 5JPNA 1PZ3A 5B8CB 2XPZA 1N3NA 2VM3A 4F24A 1URZA 2MQ0A 3L5WB 4CU8A 3GXPA 5EZJB 2KL6A 2QQLH 3ATFA 2NY1C 1KGYE 4LAQL 1RURH 4PGEA 5C09E 4UIMA 2J1ZA 2V4LA 1EY0A 5M5XB 3C2SA 4FYQA 1A1MB 1EQTA 3OKNB 4I18B 3UZVB 2E56A 2KECA 1W6JA 3GBNH 4M1UB 5ERWA 2OMUB 1M7UA 4JHWL 5CEZL 2BINA 5FGCB 2HG5A 4YSUA 2UWEF 4U1KA 3GHBL 2Y22A 4KI0A 5JMRA 2HPOA 4XPBH 4KKRA 1ZCRA 2B15A 3HNTL 5F0PB 3ULUF 3MX0A 2VIRB 1R5IB 4HEMA 1MKHA 1OSYA 4V1DD 2XN9E 1FLRL 1SJEA 4GXFA 3IK2A 3DARA 3JYBA 3MC0A 1IC4L 5IB1A 1P7QD 3JWNG 5LNEA 2VE6B 4ZX6A 3ZYJA 3EYQD 5FHBL 3MLUL 3I50L 1OCCB 4AW4A 4FXLA 1B50A 4PLKD 4GSDL 1LEKB 5DJDB 2IBBA 4B0MB 4JBKA 1XT5A 3S4SB 4PJDE 1A3RH 4DP5X 4HOMA 5I1JH 1Z9SA 5GRJL 4BBRG 2Z31D 4X66L 2F74A 2IAND 3EO0A 4RQQA 2VB2X 2HT3C 4UMSA 4HUVA 4MB5A 2HUEA 2DLFH 2BOBA 5IGFA 4HKJA 5GGTH 2B63G 5ICYB 1JZ6A 1FIGL 4CN4A 3PO2H 2WYIA 3TO4C 2DQDH 4AEHL 3IDNA 3HRZA 4NWTL 4BFEA 5IB5A 1AZVA 3EO1B 2JQAA 3KPLB 3LEYL 2O93L 4IFDJ 1AS7A 3WMSA 1UXMA 2GG1A 1WZAA 3OW7A 4OCRH 1Q1BA 1M4KA 3UE1A 4QUCA 2KZ1B 1KN4L 4PGZA 4MD5A 2IIJA 4AQOA 1AZBA 1EAJA 4JFEA 3J80L 3V8CA 1JGDA 3J7AV 2YAPA 1MH5B 4G8FB 4YVNA 3RY6C 4YHML 5ACLA 1DM0B 1W2BA 3MLWH 5I0VA 1NINA 2AUJD 3U2SA 1NIEA 4KHPQ 3CZJA 1A6AB 2VXQH 4XWGH 5C09B 4DPRA 1VHPA 4DW2H 5IMKB 1CGSL 2H7WA 5FUOH 3B5HA 2AJYL 4EBQL 3I3DA 4FNPA 4KGLA 1E9QB 2X6UA 4MZ3A 3HOZB 4NUGL 1D1IA 1B7YB 2CJUL 4L3FA 3X11A 2VR7A 3NCEB 1WC7B 1FVIA 4XNYL 4IMLB 3ZE2B 2GFBA 4HJTA 4EIGB 1LO2L 2DJ4A 2XN9B 5FYKU 5I6KA 4M7KH 2A7BA 3CRLC 2I32A 2EJFC 3F7VB 3QG6A 4KNQA 3CCSA 1AC6A 3K91A 2MPAH 3MRLB 1GKOA 1V3MA 3GTJH 4DV0Q 1GUOA 1YNTB 3TF4A 2KDYA 1JZEA 1X5JA 2RHEA 4KMTH 5F7LB 4HALA 1UFGA 1N6QH 3FT2A 1MAML 1YNKL 2X2UA 2XPGA 4JUTA 3REWB 2V17H 1ZMYA 3DBSA 3A6BL 4A2GA 1QI4A 3W3AA 1HHKA 2I60H 1H0DB 3SDDA 3CDCA 1IHZA 5DJ6A 3JWNH 1ZHNA 4UZUA 2VR8A 1E5YA 3OB8A 3IE4A 2R2CA 1OIOA 3EZ8A 2Z93B 3ETBJ 2FGWL 2IWGA 3VFSA 4AQYQ 3L3DA 4J23A 4IMKC 5EJWA 1ZGLP 2QEJC 4IOSA 5LMNQ 3QT2A 2BVUA 4BBRH 4DXFA 1WA2X 2X0VA 2J2ZA 1IAIM 4KJNA 1J9OA 3N06B 4Y16A 5CJOH 2KH2B 1I1AA 3PPSA 5J3BA 5KBMA 2B63H 5A2FA 4AIOA 4DVRL 1FIEA 4FXGA 1FNHA 2BNUB 3KPSD 3T0AA 4X6DF 1SROA 1ZV5A 4Z7UE 3ZHFA 5L8LB 1OE1A 1TWHB 2LV4A 5H37A 4DP1X 3FT4A 4PJHB 4Q14A 3US0A 4GS3A 3HMXH 5BR8Q 4A63A 5JPNB 4AUJA 2Q2LA 5M5YH 2CAKA 1BCPD 5KSAC 2XC8A 4KGJA 1A8VA 1N3NB 1QSZA 4G6AC 3ECBA 1V3JA 5ALBL 4DP9X 3COOA 4IEFA 4Z9KB 5CLZA 5I76A 1QFWH 2JKXA 1CVSC 3L2PA 2Z8RA 5J1SC 3DROA 2GBVA 2ZP0T 4AEFA 3VM5A 4PGEB 1I9EA 3IFNL 3FU3A 2O72A 4UIMB 1QLEL 5EBCA 4FQJH 4E9XA 1M1XA 2FHCA 4U4BA 4U1LA 4B97A 4M7JL 3R2TA 2UXFA 4FD0A 5ERWB 3DXJC 1I1CA 2HG5B 3U83A 2QGDA 4U1KB 3TREA 3Q1EA 2W92A 2F0SA 4ZXBA 2DQIH 3MX0B 3W1GA 3BE1H 3MODL 1CCZA 4PU2A 1JSYA 4WI2A 3DLQR 3NBIA 1DONA 5TFSL 1SJEB 3NIFF 3MC0B 4J3OF 1UM5H 5IB1B 2R93B 4G8IA 2NXZB 3WY3A 2J12B 1UTDA 1QSEA 2J8HA 2OI9B 3EW3B 2VW4A 1AFVH 5C4JH 1WLHA 5CCKL 1CL7I 4PWHA 4QGYA 4HN7A 1MWAL 5KW9L 4ERSL 1C48A 1BQUA 3V5HA 4RGOL 4QHNA 1Z9SB 2FQDA 4GO6B 2AMCB 1KV7A 1I3RA 2F74B 3EO0B 2HRHA 4RQQB 4E41D 3ATAA 4E9LA 4HUVB 2F5BH 1KNAA 4ZMLA 1SNRA 2BOBB 2VAJA 4HKJB 1T6VN 4P3WA 3HOYG 4K07A 3C2AL 3QEUA 4AMWA 4XWOC 1OAUH 2YD6A 3HRZB 3IDNB 4CJ1A 5CKGA 5FA4A 2C3GA 4ZSOA 5IB5B 3MBXL 4U05A 3UBXG 2WQRA 1ULVA 3AADB 5J6GA 1YYMH 1V1OA 1WIPA 4AGPA 3DOIA 2Z34A 3ZX1A 5EORL 2XYBA 3BJ91 4XR8C 5EF0A 5I1KL 3KPRD 1S40A 2R23A 4Z78A 2PXYD 4WHDA 4WDIA 2ZKYA 3FN3A 4MD5B 4WRDA 4IO9A 1W3SA 4UAOC 4JFEB 4JN2A 5C0RL 5D7SL 1JGDB 3NK4A 3BI9X 2YTYA 1F1DA 2QGEA 2XZAL 3CQQA 3PUCA 2DY8A 2W9DH 3RI5K 3U2SB 2ZYSA 4NKIL 5FYLD 1HEZA 4U49A 5J8OA 4B50A 2XV3A 1XMEB 3B1TA 3F58H 4U2YA 4MJHA 5F7YC 1FI8C 2EJMA 1EO7A 5GGQH 1S7QA 1K0RA 2VDPL 4KXZI 4LF8Q 4LPTA 4NCDA 5IBLD 1BDYA 3X11B 3HOWH 2Y36L 5DFTA 1BVZA 2VABA 1SFOH 4YY3Q 1K2DA 2GFBB 3HFFA 5F6HI 1N2RA 4LIQH 3WJLA 1IEBA 3UG5A 1WZKA 5B1BB 3DWPA 2WACA 4IOFD 2IOOA 1DQLH 3QG6B 43C9A 1VQLA 5IG7A 1BNZA 1EO8H 1NEZG 1PFOA 1GYAA 3H6MA 1YQVL 1XWVA 2FWLB 2Q3AA 2F0JA 5A43C 1OPGL 1P16A 1QRNA 1X32A 3KJOA 3FT2B 5C4XB 2XPGB 2MCPL 1GPOH 2HQEA 2GIXA 2ZXBA 1PMYA 1HHKB 1NCCH 1YEKL 3SDDB 1OY3B 1CICC 2IO5A 5DJ6B 1UVQA 1QSEE 1ZHNB 2NY7L 5EZPA 4GRWH 4JK0D 1SN8A 3QIBC 5B39G 1H5BA 3U9PH 1S5IL 1R17A 4YHPA 3VFSB 4A66A 4MB1A 3RVUC 1AS8A 2XVLA 2CQOA 1UJ3A 3L3DB 4LQ1A 2JTDA 4C3IG 2UX7A 1D2OA 3X1EA 4H8QA 2CLZA 4JO2L 2J2ZB 2NLJA 2WLZA 4IU3A 4Y16B 5DT1H 2KQ3A 4GSQA 1R33A 2BS71 3BWUF 3VGAC 1I1AB 2F1BA 5E6YA 3FUEA 4AL8L 3HOYH 3P73A 1ET6A 4NXKA 4P4KD 2CHNA 3M7FB 1K3RA 4FXGB 1MCPH 3WDHA 5IVXF 1CFTA 2J4WL 4IRJA 5EF1A 2XTLA 4CA4A 1KULA 3H2PA 4HLZG 3FT4B 3T4YA 1FF5A 2XTSA 1CLZL 3RUGF 2WXMA 2HCCA 4ALPA 4NO5A 4C4UA 2CBQA 4PBWD 3RBGA 3VDBA 3U4ZA 1N8RC 2L9HA 3T53B 4RNRA 1Z66A 5LGHL 3SSGA 2D9CA 1TTAA 3ECBB 3GXNA 4PY8I 4RWSC 4IEFB 4ONFH 5I76B 4Y7NB 3OXRA 4I1RA 1CU4H 5F7DA 1OWWA 2EYMA 1KC5L 2HT4C 3DROB 4GBXC 3I4OA 2VR3A 3DGGA 5H35A 4LSDA 4BXSV 1CF1A 1KB3A 1JUFA 4NEHB 1PLBA 1UATA 1M1XB 5BRPA 4U1LB 2HPTA 4G7SB 4EXKA 3OAUL 4K94H 1OAKH 4KMLB 4ZXBB 1LO0L 4DAGH 1L9SA 2CE6A 3A3YB 4PSRA 1KFAH 2WXHA 3O6KL 1PRTD 5FWRA 1JPFA 4KK9C 2BLFA 1U8HA 1MIUA 3BDBA 3HG4A 4RGMC 1X3QA 3UTPD 4HUWA 4LNQA 2PPEA 1SDAB 1K73C 4G8IB 4M5YH 4LF7Q 2EXSA 3CSTA 5KOMC 4OSUH 3V4UL 3BFWA 1LYLA 1MDTA 1QSEB 25C8H 3MXWL 3CSYA 4B9CA 1JDDA 3UADA 2KDGA 4H0IA 4XXEA 2ZXRA 2EZ0D 3W1ZA 1QRNE 2Z31C 1KJ3H 3RURA 3N44F 2K01A 1UE6A 5FLXL 3H15A 5B22A 4G83A 3V5HB 2D62A 3FUMA 4RZKA 2RHQB 4QHNB 4PW4A 2IL8A 2QVKA 1FCGA 4BKLA 3T0ED 4UQAA 3B9VA 1OGPA 1I3RB 5C08D 5F71A 2N0KA 3KS0J 2ZKHL 1NCWH 3UC2A 5HI4D 4TNVF 1WTPA 1OT2A 3QEUB 5LJYH 3FONA 3S6CA 4CJ1B 5FJ8G 2JA8B 5FA4B 1PNCA 2X6GA 2Y6SD 4ZSOB 1MCKA 5J6GB 3ZBMA 4OF6A 4K8RD 1KCSL 4UAHA 4P71A 5BRZA 3VFOA 4B9FA 4TPRL 2GTQA 3SB3A 3V0DA 2IW3A 1OAZL 1TZIA 3N04A 4RCOA 3L9YA 2R23B 4MS8D 1R75A 4WDIB 4GRLD 1UC6A 4FGMA 1BBJA 1IBBA 4JN2B 2AQNA 1SHMA 3UPCA 2B9AA 4PJCA 4P5RA 3V4VH 1QQDA 4QRSA 4F58H 1VENA 3FN0L 5EUOE 1HEZB 1T7VA 1TQUA 2ADFH 4KRPD 5FYLL 3ZDXF 2FHTA 5C44G 1RHHA 4YLBA 5DGQA 3TBWA 4B9ZA 2OULB 5GS0D 2F58L 1D7BA 1KBWA 5I6WA 1S7QB 2VXSL 3IFLL 5I9OA 3HOVG 4Z7OF 1SHSA 3BT2L 1KELL 5EU6E 4FQIH 1ZYRD 1EOTA 2VABB 4UTBH 4NBXB 1K2DB 1JMXA 2DPKA 1VFAA 4U68A 2RQXA 1N2RB 1L7TL 4CKVX 1BQRA 3HJ0A 1TOXA 1IEBB 1MJ8H 3QQ9D 4K3EL 1DVFA 3PIPA 4Z7VF 1CPUA 3E6HA 3IDXH 4A3GG 3ULJA 2I0QA 2ZOOA 4E9QA 1WITA 2CCLA 4KJPD 3V10A 4GXUM 5IG7B 4ZCKA 2R0ZH 1J48A 3UABA 3EJTA 1N32L 1MQKL 3HKFA 2VUMH 2ENPA 4HC1H 4OIIH 1QRNB 4QWWC 1CL7L 4J2QA 4X65Q 4JFTA 2DQFA 4LPYA 4P3CH 1GR7A 1AKJD 4UT9H 2FEEI 4YE4H 1UVQB 3ZR5A 3SGDI 3NWSA 2WNXA 2DI7A 1XF3A 1H5BB 1WI5A 2JA5G 3ARRA 2DWDA 1MFBH 4YHPB 3RZCC 3A4FA 1UJ3B 1TMCB 3DMMC 4CC4C 3ILEA 4PJBE 2JA6B 3NCMA 2GI0A 4NENA 3CQFA 3H42L 3V0VA 3ZQXA 3VR6A 1HJPA 2CLZB 2H3NA 2NLJB 4IU3B 3HG1D 4X5XA 5E9DD 4C3JG 2B3GA 3P4OA 2ARWA 1WD9A 2DTML 1X3PA 2R4SL 3P73B 2D03L 4GNKB 3T2LA 3BP5A 4J3SA 5FJ8H 3TBIB 1BCPC 3WIHL 3WDJA 2OXPA 1CFTB 3SDYL 4IRJB 4JOIA 1T66D 4AQ1C 1YEHH 4HU8A 2ZX8A 1AE6L 3T4YB 1IQWL 1BEYH 4NO5B 2Y7LA 1MWAA 4LF9Q 2RCSH 4NT6A 4YAQA 2N3SA 3BAXA 3U1QA 2L3BA 5IWLC 4RWYH 1MOEA 3DI2B 4RNRB 2P24A 2KS0A 2FO8A 4RMVA 5EC2A 4M8AA 1ZHBA 2EDEA 2A74C 4AYBG 1A7PH 4HEPA 4PJCE 4JFXA 1HINH 4Y9EA 3OXRB 2EINB 2OTJA 2AABL 3NTCL 2DQUL 3QJHA 5F7DB 2VXUL 5CU5A 1M71A 3DGGB 1AW7A 5H35B 5I30H 2IDSA 2G5DA 1GYVA 4C8XA 1JUFB 1NSNH 2Q8AL 3NH7L 5JHMA 5C44H 4A7SA 4LF3A 1IJ9A 3HC0A 1NM9A 2E27H 4ABVA 2BJML 4LU5L 3HOVH 2VLMD 1VQ6A 4GLRI 1TS2A 2OPCA 4HJ0D 2Y4SA 2NVXB 4IIQC 5M94B 4QNPF 3MLZH 4HOWA 2EDBA 3SGEH 2OSXA 1GYUA 1DBMH 1ZEAL 3ZY7A 1JPFB 1U8HB 1U42A 1E8WA 4HUWB 4DR6Q 1KG0A 4A3GH 3VTTA 4J3OG 5LGYA 3FF7A 1BIHA 2VMCA 4PJXA 3CSYB 4GPVA 4CVUA 3ELAT 1GHFH 3MJGX 5C4ZA 1D7DA 3GZQA 4MYPA 2CBTA 5SWQA 1TXKA 3BRDA 3WKML 3TURA 2OSYA 1UUPA 2JLPA 5J89A 4J3VA 4BKLB 3Q2WA 3N42B 5MP6L 2XBDA 2IJ0A 5AVTB 5KYIA 2DIAA 1TEGA 2P1YA 1JF6A 4GB9A 4W68A 3ZT6A 4E9RA 1J5DA 2PABA 3VXMD 1Q38A 2I5YL 2H4EA 4HG4J 2JA5H 2WAQG 4RRPM 3FONB 3BZFA 5CN1A 5C0BD 1KD1C 1CD8A 9CGTA 4FF1A 3B7YA 3SJVD 2XGTA 2E2IH 3S16H 2E7HA 4R83A 1OXTA 4PV1C 1DBKL 1ZV9A 4NKOA 5GISL 3WXWH 5BRZB 3O4OC 2OMVA 3B37A 1UE7A 4C3JH 5G3LD 1TZIB 3ERQA 5EIIG 5JW3H 1DOKA 5J6HA 1QPPA 5TQ2L 4GQRA 2JK5A 5FKAC 3LEXA 1BBJB 2DDQH 4FKEA 3M6DA 4U6YA 3S35X 5CLWA 1XO8A 5ECGA 3ZTCC 1QTPA 2JLLA 2CDEA 4MFHA 4PJCB 3AYHB 4YSPA 1F77A 4A76A 1YJNA 1QQDB 2HYMA 2AMUA 4IYKA 4QRSB 3H8NA 4LUOA 5IBLC 1JWMD 4G6FB 3ZW3A 1RHHB 1N4XH 1SMDA 3TBWB 1VADA 2QSCH 5CILH 1LGVA 1XCWA 4K2LA 1PKOA 1Y18A 3B8YA 4JFHE 1QZNA 3BVXA 4YSDA 3ICEA 1W0VA 4MKMA 2CGRH 1MREH 2DQCL 3FFOA 2O4EA 1VFAB 3F2BA 3ESNA 3L4TA 3CN0A 4KZEL 1DVFB 4B9WA 4KKUA 3LNIA 3SE9H 4F8NA 5EEVA 4L5QA 3VQ1C 3WAJA 3WV0A 3E6HB 4OF3A 2EJGC 3ARVA 1SXAA 1IAIH 4WV1A 2ZWNA 3P0VH 2V5YA 4JRYD 1OARH 4PVMA 2FQEA 2OMWA 2ZAGA 1K9MC 2DQFB 3ULVC 3K8KA 1I8MA 1IBFA 1OW0C 3CJJA 4N5ED 4JPKL 4NUPA 3J7YW 3I73A 2CR0A 2E46A 4QUOA 2EY2A 2BM3A 3B8SA 3JV4A 4J3OH 4QT5A 4PJXE 1QLEB 1I5FA 5D9SA 1ASQA 4YDVA 1JZ4A 1RZJH 1XF3B 1IJNA 2SDFA 3T4AC 2DD8L 2F61A 1HKFA 2DWDB 2WVTA 1GGTA 1EJ8A 3FQ2A 3LRSA 1T2QH 2XTJE 4W9KC 4GS7B 4M3HA 1BMWA 4NENB 1RUPH 1R9TB 4IFDG 2NT0A 3V0VB 5J1TC 1A2YA 1VDZA 2H3NB 4YBHA 4X5XB 3OHXA 2QHRH 3SGIA 3SE0A 3MJ8A 3P4OB 3WTVA 1OGTA 5EH1A 1N0XL 3OWRA 4PB0L 3GMMA 3BP5B 4O5LL 4JI6L 4FO2A 5GAEC 5AZ2H 5CR3A 1Q9KA 1A7QL 4RH6A 4J1UA 4AQ8A 3DV4A 1JPSL 2Y9RT 5CNHA 3RVTC 1MWAB 3G04A 3K3QA 2AEPH 2P7TA 4NT6B 4YAQB 4P5TA 3RWDA 4G8GD 4LVOC 4ZMYA 3K1KC 5LXGL 4FP5D 2R69H 2P24B 4HKXA 2A6ED 1Q0XL 3RVWD 2DGYA 2ZOTA 2Q3ZA 1ZHBB 4MCMA 2AKWB 4E41A 4JFXB 3Q24A 3U4BL 5C9KA 3QJHB 2WXLA 4G6JL 2Z4TA 3UFIA 3VGBA 1YY9D 1M71B 1LP9F 1NANI 4Y2LA 4NUJA 4UHVA 1A4JA 4N0UE 1UA7A 2CKNA 1PMRA 5DUPL 4MNHA 1R5VB 4HH9A 4LF3B 3GO5A 3HC0B 1MZYA 3MAWA 4XCCH 2WAHA 2AF2A 4MA3A 1AQKH 4XPAL 1IKNC 2EZVA 1EHLH 5ILTL 4DR3L 4IBVA 1XH1A 1MHPL 2LU3A 2CLRA 5J11C 2VN7A 4IBTA 5J12B 2A73A 3BGFB 1WZ1H 4HMJA 5DVOA 4LCIH 1KG0B 3H3KA 1TJIH 1N10A 1KZQA 3FAWA 3L08A 3NQIA 1GTFA 4PJXB 1CYXA 2ZXQA 2DN8A 2LU5A 2L0CA 2XXMB 4IGBC 5C4HA 1KEMH 4WUUE 1I8IA 4HPYL 3C5XA 1E4WH 1KB9K 4ICXA 5SWQB 3FCBA 1OCZB 3AG4B 2VDPB 5L2KD 1EEID 1KTLA 3BYTA 5I66A 1NUFA 3BYYA 1I8KA 4YOKA 3T1HL 2XTJB 1O9ZA 2X53A 1XF1A 2XWRA 4A3CG 1KIPA 1GMIA 1N8ZA 3GRGA 5GGVL 1F6FB 2BP8A 2CDFA 3IWUA 3CFMA 1NWOA 4D9LH 5GRXG 3PWJA 4HWEH 4XMWA 3FYEB 3I02A 4F37K 5I1GL 3BZFB 1TYEB 3GSWA 3CDFA 3CQZH 3RN2A 4E6IA 4V190 2AK4D 5C0CA 5D7JA 4PJ8D 1PY9A 4NKOB 4IFDH 1EH9A 2IG2L 2PQAA 4LUZA 1EDYA 2OMVB 4WWKA 2D5DA 3GTGB 2JJSA 3PHAA 5J6HB 1HWHB 1KB5L 2JK5B 4HR7B 3LEXB 3VXUD 3SKJH 4XVUD 4U6YB 1P6WA 4FDBA 5C5LA 2CDEB 3S8WA 1RZPA 3TSSA 4ALAL 3D30A 1NL0H 3CCHA 3SQBA 1YPZA 4NN6B 4PREA 5FLXE 1A4BA 5BNXD 1T03L 3KDFA 5C0AD 3DHPA 5IJKA 4Z7NE 1SYSA 1VADB 2VLKE 3W11D 3WOVA 5BV7C 2J8UE 3VQMA 4IOAA 4PIBA 4E2OA 3KYAA 3KCWA 1Y18B 3GBMH 4ZS6C 2OEOA 5CR1A 1W0VB 4Q7DA 4A3FB 3UMTA 4MCYA 1M6UA 3FUKA 2X3CA 3WIHA 4YX2H 3HTLX 4UV4L 5DJXA 2V9RA 1XGPA 5AZEL 2HVBA 1CHQD 1QRKA 3HN3A 4TM9A 5I19L 2IHEA 1MELA 4HS8L 4AKOA 2BSEA 4PLNC 3KXFE 1HCZA 5AWNL 4WV1B 2P3YA 1QHPA 4PRIA 3AMUA 2A4CA 4AQZA 4ZUUA 1QABA 2EVHA 3E0GA 1G1KA 2OMWB 2A69D 1N19A 2BWDA 2OW7A 2XQBL 2ZUXA 3E2HB 3RFZA 1I8MB 3VTAA 5CZVH 3GQBA 1D5ZA 3L2NA 4AIMA 3U82B 4F15C 4AMKL 3WIAA 1BQLL 3JV4B 4HIPA 1CFBA 2O30A 4NN5B 1ESOA 2QJDA 4QT5B 3OGCA 5D9SB 1JGVH 2F3IA 4YDVB 5JXAH 2D4FA 4AGMA 1U58A 2AZAA 2ED7A 3L4XA 2I07A 3BN3B 3C12A 4X9YA 1A9BA 1P6FA 2UZYA 2N8NA 1KY6A 3FMGL 4ZS7L 3ZYYX 4MVBD 3Q2CA 4GUOA 1XZWA 2Q2HA 5CINH 4RMBA 2XNAC 5LLIC 4A3CH 3MV8D 4JJHA 1A2YB 1K5NA 2JYOA 2VUYA 1VERA 4LRNL 3WSQH 3OHXB 5BQDA 3ZMNA 2KCNA 2WIIA 3MJ8B 3N1PC 2X2YA 4WRLA 4FQ1H 4X6BA 4X5LA 1OGTB 2FR4A 1KIUA 3FSOA 3GMMB 5C0CE 4MCNA 2D3JA 4LF5Q 1AGBA 1Q9KB 2RH0A 1R9FA 2GSMB 3EYUL 2GPZA 4J1UB 1FDLL 2ZNXA 4P75A 3DV4B 4NZJA 3QUKB 4TLKA 1BOSA 3G04B 2P7TB 1NGXA 4Z7WF 3WEOA 4P5TB 3RWDB 2ID0A 2X09A 4C83A 4TLTA 1OHZA 1UWFA 3U9SA 4HKXB 3VGDA 4YEEA 1OTSC 5AVZB 1A2UA 5C08A 3UAJD 4E41B 3GFUA 2L7QA 4L1DA 1Q7YC 1YPZE 2WWKO 3NFSL 3KLSA 2WN3A 3CFQA 4NUJB 4HFUH 1Y8NB 1A4JB 3AITA 2DJGC 5K5PA 3PL6C 2MNJB 4HJ0C 3N50A 2DICA 4JRXA 1IGIL 2YQ2A 1Q9LA 1T0NA 1HQMC 2IFGA 4MNHB 1MJ7L 4HH9B 1XMQQ 4OF8A 43C9B 1JQYD 1NTDA 4MA3B 3F00A 4V33A 3F2DA 3QISA 3FOLA 3F2LA 4U7KA 2VRKA 1LUZA 1WAAF 2MQHA 2CLRB 3E3QE 1QVGA 2ZCHL 3FEWX 3FXIC 2LS01 3B1UA 3QOJA 1FC2D 3ZE1E 3QWQB 4RLDA 5CC4A 1KCWA 4QRUA 4TSAH 5CFHA 4L8CA 1GJWA 1OAXH 3LXBA 1TR5A 4PRAA 1EY5A 4K9EC 4ZO6A 4EO5A 1E5BA 3FSWA 1IILE 3BZCA 3K71A 1M56B 4PRIE 3UOAB 5IP4A 2KEDA 1ZS8A 4NIKB 4Y1SA 2FYYA 1I8IB 4FNSA 4N3TA 5HI5D 4D7PA 2GA4B 3DDFA 5B7MA 5AEAA 1A63A 1KTLB 4DKFL 3BYTB 3FBKA 3OMIB 1INDH 6PCYA 2Z7WA 5DU7A 3BYYB 4MA1B 1I8KB 2XACC 3M8OL 5DEGA 5FGBC 1KIPB 1N8ZB 3BO8A 3KVPA 2BP8B 2CDFB 1HCFX 3L3OA 1Z5HA 3RB7A 4DGVH 2BZCA 1AC0A 3MYZA 3PWJB 2BOCA 3QI9D 1TYJA 4Y4FA 3I02B 2GJPA 3FTXA 3GSWB 3OTOQ 1JV5A 2WBJD 4G9FE 4S1QH 5I26A 3SPVA 1U8QA 1E8XA 3O3BA 4XMVA 5C0CB 5D7JB 1ML0A 1E0BA 3SDCD 2PQAB 1BBWA 2HFEA 4WWKB 2YPVL 1CQKA 4OFDA 3PYCA 4QRRD 3RZWA 1TPXB 5K5YA 2WXJA 3QUZA 3QJYA 4Y2DD 4MBOA 2AGJH 3F7QA 2UYLA 1ZY9A 2BDNH 2NDGA 5EWIH 1QKZL 3D8GA 3I3CA 1HHIA 1Q4NX 3CCHB 3SQBB 1YPZB 3SGKA 4PREB 1H9JA 1JPEA 4WUKL 5LKNA 3KDFB 3LEVL 1D9KA 1EBPA 1SM3L 1SYSB 1S3KL 4OLVL 3S14B 2B2TC 3GK8L 1PG7X 1BM3L 1L0YA 2G4EA 1CF8H 2Y1ZA 4XP1L 5D7IA 3H6AA 1MCWM 5HHVL 4QUFA 1HUNA 1AY1H 1HE8A 3RX7A 4ZPVA 2X3AA 1I9RH 4JRXE 4MCYB 5LQBH 3LRKA 2K9FB 4RRPG 3OF6A 3FZUD 2H0JA 1EXHA 3P69A 5DJXB 4OHJA 1URIA 1XGPB 4KK6C 4KRLB 2ORBL 3ZE1B 3MUUA 2R7EA 2YJQA 1KCVL 4XO9A 3D3VD 1H9DA 1BYPA 4ZUUB 2O4XA 3R19A 3KDPB 2PW1A 3RFZB 3R3OA 1WA0X 3QQDA 1BXTA 1D5ZB 2F7IA 3IJYA 3MA2B 3K80C 1NICA 1STEA 2GK0A 3HUJE 4FJZA 4A55A 3OGCB 1KSRA 4PJIA 1KYAA 1U58B 35C8L 4GI9A 4LFHD 2DIEA 2I07B 3KCPA 4CAGA 5JHDA 4Z7AA 2SEBD 1A9BB 4YXLH 2UZYB 2RJMA 3L16A 2DL2A 2IGFL 4Z0BH 1K3BC 2J6EL 3BT0A 1PSKH 3O3EA 5IGXL 1NUNB 1X3FA 4R96A 5I17A 1K8AC 4BXXH 1K5NB 3IETA 1NGPL 4JZOA 1CGXA 2WIIB 4X6BB 4HYTB 4OJCA 1H3PL 1MHHA 3MGAA 3DJ9A 2FR4B 1E22A 3KK7A 1KIUB 2EICA 2FJHA 5KVDL 4YHOL 3NCXA 4OJFH 1AGBB 3IRZA 3DUSA 3R1GH 5DURB 2JJTC 1BVNT 4WY7L 1MF2L 3AB0B 4GAAA 5I0YA 3VD9A 1IGMH 2M2DA 2IDCA 5AKTA 4I8DA 4EZMA 1MCJA 1SBSL 2JA7B 1NGXB 3WKPA 3GF8A 3ARBA 4JM4H 3GUFA 4Z5RA 4C83B 5DWPA 3BJUA 1YHPA 4RVBA 3RZOB 2JKSA 3IBEA 4HXBH 2RQ8A 3GTOB 4XBMA 5C08B 4G82A 5EPKA 2W0PA 1A6WH 2AUKA 4JCMA 2XTIA 1SYCA 5I1DA 1Q8IA 1AHKA 3LX0A 2UXGA 4A38A 4IUTA 2MQGA 4JRXB 4WI0A 3NJMA 3UDXA 4CBZA 5DVMA 7PCYA 1Q90A 1J1XH 1Q9LB 1T0NB 4U1GC 3EJUA 2VRAA 2V1CC 1F11A 3V8OA 3DXAD 3U6XS 5BZDA 2Q8BL 3O0LA 3H0GB 3FOLB 1Q9OA 3KLLA 4ZW7A 4NN7C 1KB5A 4JW0A 2Y24A 4ONGL 4XO8A 3BPLC 3QCUL 4EVNA 5C0XI 4ZODA 4QRUB 1J5CA 4L8CB 1YYLL 2ATPA 2G2NA 3AGWA 3DM1A 5ELDA 4JDTL 4PRAB 3S36H 3UIZA 1X5AA 3K71B 3HZYA 3RIAK 4LSRL 2PW7A 1QFUL 2HLFC 3CU1A 1ZS8B 2I9LA 2FLBT 2FYYB 1H8LA 1O7IA 1EL0A 2GC7C 3L4UA 1XMWA 3FRPG 1IFHH 1OHQA 4IPCA 4KK5C 2V7HA 4XMUA 1CQYA 4ZK9B 3M17A 3GTTA 1B3QA 3O0RL 5D1QE 2Z6KC 5DEGB 1E5CA 2WJ5A 1IVLA 3BO8B 3R4DA 4PJIE 4NJ9L 4X6FA 1RJZA 5JHDE 1NCDH 3QHFH 4LP5A 3L3OB 4Y8DC 4PJ7F 4YWMA 3J81c 2W9EH 3QJXA 3T2OA 2BOCB 2Y3AA 2K28A 4Y4FB 2YPLA 2Q2TA 4K5XA 1JV5B 3SPVB 1FL6A 2VDLL 1GAFH 4UQ2A 1U8QB 3O3BB 2D3LA 4RAVA 4ODVH 3H9SD 4XVUC 2HFEB 3FQNA 1BA9A 3NHHA 2FIRT 3EDFA 2G2PA 1XGYL 1WGVA 3AU0A 3FQTA 1CR9H 4ID6A 3I3EA 4JDEA 1UZ6E 4LLMA 4XI5C 3D85D 3OPOA 3EGXA 3QUZB 4JZNA 5I9PA 1JVLA 1NOFA 1CDCA 2BVEA 3C6EA 2UYLB 1YEZA 3O9WC 3Q8CA 4M5SA 5HDLA 4PUBL 4AZUA 4TF4A 1REIA 4KTAA 1HHIB 4H4NA 1CMOA 2YGVA 1D9KB 4R4ND 3TT3L 1U8PA 4J6RL 1EZVY 1A6ZA 2ZUYA 2VGLM 3T1YL 1L0YB 4R90L 2ID5A 5D7IB 3QZPA 5CGTA 3ND8A 1DN0A 2SODB 1I3VA 2BNRA 2VDKH 4PWGA 5DJAA 3GLAA 4ZPVB 3S3PA 4ABUA 3NSJA 3I4MH 1QNUA 4QOKE 1QBLH 2HVJA 4IHBA 3WYRA 3E8UL 3RPBA 1EJFA 3NPSC 4G70B 1KWKA 2A69C 1S46A 2R7EB 1NMGA 2HX9A 3QEHA 1IGCH 4B9XA 1RIHL 1ADQL 1YEGH 3A22A 4M8UA 4CMHB 5JOPD 1GOGA 4XNMA 4XNQA 4DZ8A 4CILA 1UA6L 4TQEH 4EE2A 3EJZC 2A9NH 2PW1B 3QQDB 1KPVA 2WKLA 3IJYB 2V6HA 2GK0B 4EQ2A 5JAVA 2PWGA 4J3UA 5JIQA 4NUQA 4MVBC 4PJFF 4DK3C 4RGNC 5ELCA 2AJXH 4PJIB 5JHDB 3K0WA 3KCPB 1JT8A 1KLGD 3HS9A 3KW7A 3KGUA 4ZO8A 3FTSA 4CKQA 4UP7A 5DR5H 1OVZA 3RIFK 3O3EB 5EUKA 1V43A 3L4CA 4R96B 5I17B 5KZCD 2YEVB 4NZTH 3O8XA 3IETB 1KOAA 3QG1A 4JZOB 5DHXB 1CFMA 1UE1A 4DV3L 4OJAA 5T5FH 3NCFB 1ZVYA 1CGWA 4PMCA 1MHHB 2XZZA 2YPLE 3O13A 5I2XA 2FJHB 2LKVA 4L9LC 3DETC 5B21A 2ZX6A 3DUSB 5ITBL 3BKYL 2VL5A 1A6VL 1XQ4A 3CK0L 2R0KL 1KAWA 1PU0A 1Q1PA 1CI3M 3VH8G 4KKZA 3QZWA 2F8IA 2YLKA 5I75C 2WYTA 3E9HA 5AL8A 5FFGA 1QOHA 4A3BG 4Z5RB 4Z6AT 2EE0A 2X42A 1J0ZA 2QHLA 1BZQK 2K5QA 1O7LA 2CRIA 3ESMA 1HZ9A 2ZJRA 3MUY1 3RPKA 5GS3A 1JJ2A 2N7SA 3P0YL 4FAAB 1DDTA 1T0MA 4OU3A 3JTBA 5I1DB 1KEGL 3TRZA 3ULPA 3N5AA 2OP4H 1PJ9A 5L88L 1RZFL 2EABA 1K8MA 4WI0B 5IGEA 1LK3L 4Y4HC 5L0QC 4B08A 5E8DL 1F11B 3G6DL 4LEXH 4DP4X 2UUBL 4XT1B 4EN3D 2QVIA 3LNDA 5BZDB 4X66Q 2YPVA 5CHNA 2VDQH 1Q9OB 2X38A 5I73B 2D2CC 2PW2A 1KB5B 4B0MM 1BZEA 4J12A 1J9RA 3L3GA 4EVNB 3DMUA 3INUH 4QHKI 4GNXA 1MLCA 3STBC 1NKGA 3EKCA 3DUHA 2ATPB 1EXGA 1LTGD 2JE8A 2P8PA 3TOPA 2NVTH 4BRJA 3HZYB 3PO3B 1MSHA 3HC4L 2I9LB 3HFMH 4YXKL 2RDGA 3H0TA 3UO1H 3WKQA 1MHWC 2ICEC 1AR1D 1PH3A 2FJ2A 5C0GA 1ONLA 4Z7IA 4NPJA 3FO2A 5AZUA 3K2UH 4RX4A 2V7HB 5JZ7D 2GEQA 3M17B 5D1XA 4R1JA 5PCYA 3MJ6A 1EU4A 1KLUD 3ELQA 3VXPA 5B3JF 4N2IA 4X6FB 1RJZB 3D9AL 3EJJX 1SLUA 3QZNA 1N26A 4PP2A 3UDIA 1FR3A 2YPLB 3AS1A 3TESA 2OSLA 1FL6B 4GEIA 2R2HA 4ODTL 4UQ2B 4S1RH 4AEIH 8PAZA 4RAVB 1NCAH 2IFFL 3ZN6A 1IAKA 1JJCB 1ZANH 1Q0YH 2HRGA 4ODSL 1XSJA 3FQNB 1T2JA 2ZCKL 4JDEB 4AG4L 3FQTB 5E4WC 2ZTEA 2JCCF 3KHOA 1VQGA 4LLMB 2F8VA 3TASA 3EGXB 4DCQA 4JZNB 4HSCX 2F53D 4L4VA 1OM3H 3P02A 1Z9MA 1J5EL 3BSGA 2B3IA 3DM3A 1E2WA 3NBHA 3T08A 4R4TA 2R29L 3NDZE 3IPFA 2PTTB 4NP4H 5GADC 2L7JA 4A3BH 2TRYA 5J22A 1ILSA 1U8PB 4JM2D 1A6ZB 5LBSH 1AYRA 3AY2A 2OSWA 3TIDA 5C2BL 1UENA 3VW3H 4LEBA 4IUPA 1DN0B 5E23A 1XFPA 1ZTXH 2BNRB 4B3TL 3RI5F 3ZKSD 5DJAB 3BW9A 5B7FA 3WFCL 5C86A 3H9ZA 3GJEA 4M48L 2QDLA 2HVJB 2A77L 4WJKB 1EPFA 1JGIA 3ABGA 1AIFA 1FGNL 3WN5A 2DQ6A 2XT1B 2GHZA 3UP6A 4PJ9D 3QEHB 4HKBA 1TS4A 1J87A 1QBML 4HZLA 4PD4K 5BO1L 3VFVA 1QZHA 3G5YA 4XNQB 2BERA 4XNMB 3ROOA 4DZ8B 4RDBA 1B4JH 3RGBA 2YKLH 3ZE2F 2XSCA 1GUWA 1QSFA 2Z92A 3J81i 2C4FT 1ZVHA 4GXVL 1KPVB 3HNVH 3Q5TA 5D6DC 4DEUA 4LSQL 4ABQA 5HYSA 2ZYHA 1AD9A 3MFGA 3CHPA 4NXSA 1RTNA 3QOLA 2H8PA 1S2EA 1SXNA 1YDPA 4AH6A 2CO2A 3H55A 5D55A 5DC4B 1A9EA 4R7NA 4NKQB 2QL1A 5DSCA 5F7UA 5D1XE 4WW2A 4KITB 4YCUA 3CVBA 5EUKB 3H3VH 2C4XA 3NIGE 1QLFA 3O8XB 2BSCA 5IVZA 4W93A 3FCUB 4ULLA 3VFWA 1K9TA 3BPOC 4DN4H 1G6ZA 1UOLA 2XG4A 4DXGA 1EERB 4X7SH 1F3DJ 1S5DD 2QVFB 2G9HD 2CO1A 1SF5A 3DX8A 3HI6H 1WBYA 3QAZB 1GGCL 2DQGH 1CKNA 2VL5B 4KTEH 4Y5VC 3SPHA 3ULSA 3B9KA 5CAYB 1S7WA 3QZWB 3WGVB 5F8RC 5CP7A 1WTQA 2DF3A 1XAUA 4AENA 4WI9A 1KUMA 4H88L 4XZUA 5A3IC 4L4VE 3CFJA 4H8HA 2A9ML 1IEHA 5ELEA 1UH3A 2AJUH 1O7SA 2KUTA 4FJYA 2OQKA 3GSOA 2M2LA 1T0MB 3NQKA 4PJHF 2XIIA 4KHTH 1RKRA 2QDVA 2WBJA 1UYWL 4HLEA 1QFHA 1F86A 3MOAH 4KUZH 1K6QL 2CKBL 4OQ1A 3CHXA 1HOEA 2B59A 4WENB 1X6LA 3P4LA 3R8BA 5CHNB 4U6HA 4UT7H 2VOTA 1FD7D 4UILL 3K5MA 2PW2B 1MJEA 2BH8A 2QLVB 1VGEH 3OQ3B 4QRRA 4Y2DA 3UP1A 1T6WA 5A1AA 2B2XH 5KVDE 1XBRA 3I4LA 1HJBC 2H9GA 1S5ED 1AIZA 1IGTA 2WHVA 3L3GB 4R0LC 3JWNC 3PDOA 5FYJD 5BUPA 1HNZL 4E36A 1MLCB 1RUQH 4M29A 1OWRM 3A21A 4HUKB 2P8PB 2MSPA 4KKAD 2M1KA 3FKUS 4XB8A 3SE8L 5I8KL 3RAJL 1XV8A 3H0TB 5FR3A 2DLTA 4JY4A 1S78D 1B9ZA 5C0GB 1QSFE 4DV4L 2DEXX 1G7MB 3UYPA 3FO2B 5DXWA 3DBXA 3JAML 2Q7AA 3NABL 5D1XB 4RFOL 1CXEA 4AIEA 2JELL 1PW3A 1NUDA 3QZOA 4ZUJA 3VXPB 4YSAA 3K8MA 5EU5A 1PZKD 3U7YL 3TEXA 4MJJA 5BOZG 4DR2L 1HIML 4PP2B 3S2HB 2VZTA 6FABH 4UTAL 1HL9A 2OSLB 1RCVD 5DVKA 2R2HB 2OCCB 1PAZA 3ASOB 5I71B 1IB5A 1MGSA 3K5NA 3D3VA 1ADQA 3MCLH 4ILDA 1IAKB 2FMCA 4FLRA 2VMDA 4W9GC 5AUMA 3ZIMA 3PHQA 4KD3A 2ATKA 4TVPE 1MCRA 4YHNA 3SE4C 1X5MA 2K6ZA 1U2HA 4DCQB 2KENA 1TO4A 3QIUD 3APNA 4L4VB 3NE5B 1S7VA 4GG6F 1RLBA 4Q5VA 4MD4A 4MXWH 1GS6X 2A19A 1PA6A 1TQCC 3F5WA 3OC8A 3NBHB 1E4HA 2J20A 1C8CA 2OL3H 4FI7A 1J5IA 2VTFA 4F7TA 5LB1A 1Q0EA 4ELMA 3CXFA 3I9GL 3RIKA 1OB0A 2MPVA 5D2LE 3TBTA 1LO5A 1K0SA 3TO4A 3DSFL 2YAHA 1AZUA 1FFPA 4TQIA 3TDQA 5AOMA 3TIDB 3X17A 2FINB 2WQXA 1EUUA 4ADIA 5FUZL 4W4OA 3BW9B 1RUKL 2UVEA 3S1NB 4AUUA 1U0LA 5I1EL 1ICFB 5E56A 2C3WA 3K7AB 4HU2A 2WB1G 3GJEB 3W3BA 4Q9QL 2K5DA 1AXTL 1XBDA 1AIFB 3WN5B 4JHBA 3BFQG 4QHLA 2XZCH 2Z6FA 4HKBB 1Q81C 3MXNA 4HZLB 3VFVB 5IJDC 5KSBF 4P07A 5JR1L 3G5YB 5E00A 4NNPL 3CLWA 1PH7A 3ROOB 3KYMA 5BQ7A 2EDWA 2RR3A 3E8VA 3FUFA 3PJNA 1PL3A 2VQUA 4X9GA 1AFPA 1QSFB 1CDBA 2IPKA 2Z92B 4KXDA 2AHIA 1E3XA 2RVLA 4O4YH 3VB8A 2EYOA 3UCQA 12E8L 5F88A 2C3HA 5HYSB 2EQDA 1FAKT 3MFGB 2WZ0A 2ZCLL 1BAFH 3B2VL 4HSAC 1F41A 4RMTA 2H8PB 1YDPB 4AK1A 4YDKL 2IH8A 3NZUA 3FT3A 1A9EB 5IHUL 4R7NB 5DSCB 1FYTE 2R8SH 4WW2B 3IAYA 4GN3B 3L4YA 3EDDA 1W6KA 2DUDA 1QLFB 3K4DA 3HEJA 5MI0B 2EP6A 4A2MA 1SNQA 4R5TA 3DTXA 5IVZB 3PJSA 2J1KA 3VFWB 2JIXA 3NG5A 4FTVD 5DD1L 2HD3A 3P77A 3MRCA 3ZTEA 2XG4B 2Z1PA 3DX8B 4FLHA 3RTLA 1WBYB 4NKDA 3ONAB 1CKNB 4JR9L 1EO5A 2K6AA 3ULSB 4EUPG 3B9KB 1S7WB 1F4HA 4WI5A 4X98A 1TXYA 1BYNA 15C8H 1CT8A 3BC9A 4X5RA 3LZFL 4HLJA 5CP7B 2H6UA 4AENB 5L7XH 4XZUB 4A3KG 3CFJB 2Y06H 3PCYA 2B1OA 4R4BA 1FAIH 4LCCA 1G91A 3IF1A 3DTUB 4L3EA 1X9LA 5GPRA 3GSOB 3CMOH 1J88A 4ELME 3EH3B 5FLXc 4NKMA 2KBGA 5SWSA 2VDLB 2MQCA 2WBJB 3BCDA 5FCSH 4D2NA 2DQTH 3FB8A 2YD4A 4HP5A 4IJLA 4M02A 2MGSA 4TULH 5HJGA 5HGBA 3SDCB 1SNPA 2B59B 4F2EA 2FEJA 1G7JA 3CP0A 3R8BB 4U6HB 1U8NA 2DB8A 3T2QA 1EBAA 1JBJA 2YK1H 4QRRB 3HA0A 4YFEA 4Y2DB 1OSZA 5KSAA 4TUKH 1MSGA 1IGTB 1PEZA 2CKZB 2H9GB 2N1TE 3NAAL 5FYJL 3PDOB 5C07D 1CURA 2X41A 5LDUA 4DEPB 1CKOA 1CGUA 3C9NA 3HE6D 4UQ9A 1AR1C 2BW4A 2R29A 3TS0A 4NHUA 2IALA 2NY1B 4PSPA 4A7UA 4LLDA 5IUSA 3S1QB 4LO9A 2BVYA 2ZXCA 1HYSC 4IDJL 3IGFA 3S96A 4JY4B 1XTMA 3P1VA 2A5UA 5T1DH 3UYPB 4KY1H 4M6NH 2IADA 2PYFA 5F6IC 3NTIA 3DBXB 3TA3D 1IL1A 2FEDD 4PS4L 1Z3GL 3NACH 4HIHA 4ZQTA 1PG7W 4D9RD 3O6FC 4U4IA 5EU5B 4ZW3A 1OL0A 1MPAH 1C1EH 3U58A 3W81A 1EHAA 1T7WA 2FYVA 5DO2D 5AW5B 4HULB 3GPSA 2PO6D 4AYEC 3UJTH 3GEWB 4FQQA 3D3VB 1H8OA 5AUMB 1VCAA 3PHQB 4OZHA 5CGYD 2ATKB 1S9KC 4YHNB 4UB0L 1CQFA 1GGIH 2JB5H 1PS3A 5FKPA 1ZT4A 3GWJA 2O5NA 3DO7A 4LP4A 4JG0L 3ATEA 3EN2A 1TJHL 4O9HL 4TKWA 1S7VB 5EBDA 2IGLA 4FQLH 3VWJC 4MD4B 1OAYL 1QUNA 3MOBL 5T1KA 2Y07H 3F5WB 1JPGA 4HBCL 3F2CA 4XCFL 3WD5L 4EUPH 1N32Q 1N0LA 4F7TB 2J5WA 3KOJA 4ELMB 2EC9T 1AGFA 5JXEC 3L7FA 1BQHG 4PM1A 1LO5B 3TBTB 5H4ZA 4K94C 3TO4B 1FFPB 2OK0H 5FHAH 1JG9A 4DPAX 4IBYA 1YY8A 3GDBA 3BQVA 1MRDL 2VZSA 3JV0A 4TMPA 4Y19D 4M1DH 3JYCA 4BK8A 2YZ1A 3T09A 1P4BL 3ER0A 4XAWH 1SXTA 3FSVA 5SWSE 3ZMEA 3CQPA 1NC2A 3BDYL 5KS9B 4R2GC 3NJHA 3QPQD 5CXPA 5FYKD 4BY7B 5CGKA 4QXVA 3AVEA 3CXDL 4Z95H 2AP2A 4QHLB 2I5LX 1KGXA 3UIYA 5JMOC 3MXNB 1PD1A 2WXIA 3D4WA 4BCZA 4PRPD 1Z9LA 3HOZG 5E00B 3RTQC 5BQ7B 3KYMB 1OGAA 1SOXA 2X88A 1WBZA 1IMHC 2WZPD 1B70B 4C55A 2IQ9L 1G4MA 4OZGF 2IPKB 3TWCH 1MVYA 1JJGA 5M5XH 1ES0A 5F88B 1E5ZA 2A1WH 4FQ2L 2M9VA 7PAZA 2K45A 3L7ZC 3U6RA 4WFGD 4XVTH 2CKBA 3HKZA 3DHJA 1WCMB 2SNMA 5COYA 3WELA 3V9CA 4Y9FA 1WFOA 4EN3A 4AE0A 3FT3B 4YZWA 4N0CD 3OMGA 5LMNW 1RMFH 1WBXA 3KJ6L 4J4PA 4RMQA 2VR6A 2V5MA 4N85A 1R4XA 2WANA 4KJQC 4PGCA 3DTXB 4L4TD 3PJSB 3MRRA 1ASPA 1UA3A 2JIXB 3RG1C 1J0HA 3P77B 3SE6A 3MRCB 3BH4A 3ABZA 3IMUA 5GHWL 3RN5A 2VXWA 3N0PB 1HZHL 1CXFA 3FUHA 3MZ5A 3ZLQC 4HHAA 4WEEA 4A3JB 3U6XA 2QR0A 3DWQA 3QHZL 4NKDB 4RISH 3HS0C 4IPDA 1CICA 1U8OA 2J88H 4LPWA 4OZHE 3ZR6A 4H20H 4X98B 3MJ9H 2FH6A 1UXLA 3GHEH 1V5JA 1CT8B 1FHGA 3ISWA 4JO5A 3THML 2HH0H 2HKFL 4HF5L 2YYZA 4HWUA 4FEIA 1W8EA 4YBQD 5EA0H 5D7KE 4ZTOL 5D1ZC 4R4BB 3JBG7 4HT1L 4LCCB 4ZOEA 3IF1B 4L3EB 4CN6A 4XVJL 3EHBD 1J5HA 4QY7A 4NM8H 5I2IA 4P2QD 4NKMB 5CGMA 5D3DA 4UTAA 3FTUA 4I3GA 1XGRA 5SWSB 3MPCA 3LZPA 4YO0A 4PMEA 1YMMD 3GHPA 3FB8B 3D2TA 4LKCB 5HGBB 1ZXQA 3BUDA 3FQ1A 1H3VA 3JVFC 4XPGH 2Y2YA 1G7JB 3FMCA 1WTOA 2WSKA 3C5SA 1MCEA 1U8NB 2YAEA 3ULUC 2QMJA 4N2FA 1BCIA 1RZKH 3TN0C 4MLSA 1OSZB 4KKAC 2Q6WA 5KSAB 1R24A 3MTSA 5CIPA 5CD3A 4AM0A 4GMTL 2CGZA 1A7NH 2HLEB 5EC1A 4FQCH 1FNUA 4NHUB 2IALB 1PIGA 2BZ7A 3F83A 3GUTA 3CD6A 2B77A 4LLDB 4X80H 1RD6A 2WBXA 3LNFA 4GBXA 1E4XI 1P1VA 4I87A 3ESUF 4UINH 2VL6A 1OGAE 2YQGA 3HOZH 3S96B 4Z0XA 1DL7H 4WJ5A 4HCRL 3FFDA 4TNGA 4MAYD 2IADB 2PYFB 1EYDA 1IL1B 4R5XA 3S35L 2MO1A 1UCBH 5E5MA 1MFDH 4TUOA 5B1KA 3A5VA 4G3YH 4HIHB 4W9EC 3HKZE 5BS0D 1KNEA 1JI2A 4WCYL 4BFNA 3CMAA 1VPOL 5TE4L 1XF2A 3MN8A 1SY6H 4FQQB 4AQAA 1SN2A 5DD0L 1FN4A 4G11A 2E47A 1PLAA 3V0WL 1S7UA 3C8HA 4LDOB 4OZHB 4KLKA 2IAMC 2J73A 3P7JA 3M3YB 1Z32X 3GSRA 2R0LH 5D7LE 4UOZA 2AZUA 5FKPB 4QRPD 5EEXA 1ZT4B 3DO7B 3F04A 5AVQB 1ZK5A 4A93B 3FDTA 1PAMA 4X3KA 4NC2B 3FU0A 3U25A 3BUQA 2H1PL 4A7GA 1SF3A 1I8LC 2JQZA 1NWPA 1QUNB 2WCSA 4JPQA 5T1KB 1A1OA 1JPGB 1N0LB 4M62H 4L23A 2DMHA 5GJSH 1AGFB 3JAME 1O6SA 3L7FB 3NGBC 1ETB1 1NMBL 3EA6A 3L4ZA 5CP3H 4LQFL 1YY8B 1UWVA 2CJTA 3OM3B 3GRWL 3LD8C 2VAAA 3AW5A 1QI3A 1VQ5A 1TWHH 3T6WA 1NC2B 4LVNC 2KHIA 1PKQA 3LKRA 1JGEA 1WG3A 4Q6YA 2CH4A 4UAOB 3EFXD 3IMSA 1HRJA 4KO7A 3ZZLA 4QCIA 5KTEL 1HEJC 5EPMA 1WOCA 2B5IC 2F54A 4KJWD 2PETA 2B1AL 3ZKXC 3H09A 3CFBA 4NQCD 5F7AA 3BRFA 5CJBA 4BDVA 2CUIA 4L0ZA 1OGAB 2F5AL 1WBZB 2VSMB 3V6FA 4JI6Q 1MNNA 2E2HB 3CAFA 1WAEA 2ED9A 4O58H 3T3PB 1TITA 4MIUA 1ES0B 2Q10A 1MG3C 5DMGD 4FXDA 3U6RB 2C9OA 4C56C 3CVHL 5ECJE 4XH2A 2CKBB 3HKZB 1EJOL 3OLEA 2YMTA 2YRBA 2EKSA 4XMLH 4EN3B 4JPWL 1SXZA 4ME5A 1SMYD 4BCYA 1WBXB 4KKBD 4ZMXA 2ZUTA 3BAEL 4QXGL 5HHNA 2ITFA 5C4XG 4KNUA 4XCEA 1A64A 4PGCB 3DV6A 4UDUA 2E2JH 4APXA 1GXEA 1JHLH 2R93H 1MCQA 4UI2A 1M53A 3MRRB 3QC6X 1SYEA 3MJ7A 2DKUA 5AG9A 4DV1L 4CJ2C 3KGRA 2DQJH 1EGJH 3LVTA 2JK8A 4HHAB 5AB0A 2QR0B 4DR3Q 3MACH 1VFUA 1CICB 1U8OB 3MV11 4F1ZA 4H8WH 1QZ1A 5EU7C 1A22B 3D0LA 4UIKL 1BQQT 3ZSTA 4ELDA 3I56A 2W0LA 5T3XH 3RZCA 3MV9A 4JNXA 1WZLA 3C2PA 2NY4D 5E1GA 4C59B 5E4EB 3DMMA 4CC4A 3PQYA 5AW8B 4Z76A 1TQOA 1G9HA 1JVOA 3OKKA 1FH5L 4I4WA 2IDFA 2EYTA 2D0OA 3NA4A 4N4YB 3NESA 2IH3A 3A54A 4DTGH 5I2IB 1ACZA 4PRHD 3MLYL 2FD6L 1RIVH 2R15A 4WEBL 5H37G 1XGRB 3VFNA 1HJCA 2PZTA 4YO0B 3EYOA 3P0GB 3V6OC 1TENA 3T1HQ 4EQNA 3HG5A 4L5SA 4BK5C 2VDNL 4NNYA 3QULA 5IFAL 3C5SB 4U3XA 2RHSB 4XYQA 4J3WA 4YFLI 1AZQA 3TP7A 4ZD3H 1TG8A 2PWDA 1P5UC 5MHSE 3QIUA 4P2YA 1P4IL 1VSCA 3IDJA 1J86A 2Q6WB 4B9IA 4HGWA 5IWLA 1R24B 2R7DA 3WFDH 2OCJA 1IXRA 1V7MH 3FQ4A 4J3OC 4FL4C 5CIPB 5CD3B 4AM0B 2RCFA 3QNZA 3CFCL 2CHDA 2F54E 4PWEA 5EC1B 2A74A 5TE6L 1OQOA 2A9BA 2QADC 3GUTB 4K5LA 5TPWH 4GBXB 2OX5A 4K3DL 1M9SA 1RSYA 1W72L 4LRIA 2PKDA 3FN9A 3STLA 1U4FA 4Z0XB 4LBEA 4WJ5B 4Y4KD 1O5DT 3FFDB 3TF7C 1WTLA 1QEWA 1AS6A 2K0RA 1OXXK 2UZIH 5I1HH 2ZTCA 1A3QA 2JQOA 2NCEA 3CBKB 3FCGA 4KD4A 5IESH 2QLYA 5E5MB 2TSAA 4TUOB 2Y7OA 1AZZC 1DSFH 4HXAL 4PR5A 1J1PL 3DYMA 4OCYH 2DH2A 5KSVA 1G9NL 5HGQA 3OHMB 2EYLA 2D0GA 4KK8C 2H5UA 3R0NA 4M8RA 5AL0A 1JWUA 1XF2B 1VLXA 5IQ9A 5T1JA 3PWPD 2CCVA 1HESA 4Y9CA 4AQAB 4FF2A 1FN4B 4R3SA 5C4XH 1T21A 2WSPA 1ZJBA 1S7UB 1WUZA 3F84A 4G6ML 1D5MC 3GSRB 3UBFA 5BVPL 1II3A 4M03A 4XMPH 1ENAA 5F6HJ 2ZG1A 5E99L 4IUVA 2QILA 2FB4H 2A4ZA 3VMNA 3HC3H 5PAZA 1R4QB 1BVSA 1A1OB 1JICA 1X7SA 2JA8G 4X6CE 2KKQA 4H02A 4ENED 3RGVC 2APWA 4JW3A 1LDPH 2KHAA 2YMXL 3I6LD 1O6SB 3F8UB 5IF0A 3IDUA 1F9RA 4UV7L 4OONA 2GTWA 3QIWD 1HNFA 4LK4A 5FGRA 3QPQC 4LSUL 1T1WA 6CGTA 1FQ9C 2VAAB 3MHBA 4P2OD 4XVSL 3OW2A 4NS0A 1IKLA 2DMCA 1UWXK 4U1SA 2DKMA 5H37H 2EAEA 3LRMA 3OKLA 1PKQB 1WS8A 3LKRB 1JGEB 4BUHA 1ZLDA 4DV5L 1BJ1H 1Y0LA 4OLYH 5E08H 3SQRA 1IKFH 3UACA 5IROC 2Z0SA 1JGUH 3QK0A 5KVGL 4QCIB 4QPEA 5EPMB 3CDZA 2F54B 7TAAA 3CFBB 3U2IA 3GI8H 4MMYA 5JOEA 3O6MH 3ZK0A 4BDVB 4K9EL 4OZIE 4Y7NH 1E4XL 2L5TA 2A99A 4RFNB 4MCZA 4A3DB 1UEBA 2YN3A 3V6FB 4LHUA 1X44A 3VRLF 1FE8H 1ITCA 1NFDF 3ZT7A 4JO4H 2XWJA 1MRFH 1FGBD 2YXMA 3HNSL 1ET9A 4OFIA 4FNTA 2NVQB 3MWYW 4EQOA 1ZDQA 4XH2B 3GBDA 1G291 2WM0A 1FH2A 5D96C 3BLKA 2RBMA 2EKSB 1E2ZA 1BFOA 1OSPL 2O6EA 2X4OA 4XNXL 3MR9A 3QJUB 3ESPA 2WXFA 4PY8J 5TE7H 4WI3A 3A4DA 5HHNB 3FB5A 1TVXA 3D5OF 4FZEL 4R8WH 4XCEB 3DV6B 4UDUB 4APXB 3BWUC 2XDHA 4ZNEA 4ATTA 3L1OL 3MJ7B 1T80A 1GC1H 1CYGA 2JSOA 4DWHA 1F6LL 1OW0A 1QX1A 1IC1A 3VCLA 2DLIA 2I7SA 3IDIA 3MRGA 2EIMB 4HCRA 2JA6G 1YEFL 3D0LB 3CZEA 4WORA 3PWVA 5ACMA 3T4AA 4PWFA 4TSCL 3L5XL 3RZCB 2F68X 3MV9B 4LLVA 1GGBL 1A14L 2NX5E 4LSPH 3PQYB 2W0FA 4UOW0 4I4WB 3OKKB 2JA8H 2EYTB 2IH3B 3HGBA 4DGIL 1D5XC 4GQZA 4EF3A 4HK3J 3VFNB 4AW7A 4P9HC 1EEQA 3EYOB 5EOQH 2R27A 2CUHA 3VR5A 2CK0L 3EOYG 5LBGA 3HI5H 5CV9A 4G43A 1NPJA 3GMPA 4F7MA 4NNYB 3QULB 3K2IA 4BZYA 1U8MA 5KNBA 2IX3A 4AJ0A 2QPFA 3QIUB 1HKLH 2X6AA