4FXKC

Human complement c4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
290
structure length
290
Chain Sequence
b'APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 Beta chain
molecule tags Immune system
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
total genus 47
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxkC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxkC01
2A74C 5JPNC 2WINB 2PN5A 2A73B 1BUVT 5FOBB 2J0TD 2ICEC 4FXGC 5FO7B 1XWEA 5JPMC 2QKIC 3KLSA 1UEAB 3CU7A 3OHXC 2I07B 2XWBB 4LNVA 2E2DC 1GXDC 3V96A 2B39A 1UAPA 2TMPA 3T4AC 4ILWA 1BV8A 4FXKC 3MA2B 3HS0C 1JB3A 1BQQT 3CKIB 5FO8B 3HRZC 1JC7A 5FO9B 3L3OC 1PXUA 3FRPB 3G6JB 3I70A 1D2BA 1AYOA 1OO9B 1BR9A 1EDYA 2XWJB 2WIIB 4D94A
chains in the Genus database with same CATH superfamily
4N8PA 1E5CA 4R4TA 2DLEA 3OZ9H 4N2LA 3W3AA 2IHEA 1Y0LA 1BZEA 3ZZQA 2WUBL 3FBKA 1CDJA 4H5SB 4F3FA 3SE0A 5KEEA 3QE5A 2AJSL 4TNVF 4EI5D 2XWTB 1L0PA 2CO6A 4BQBA 1IGCH 4JW0A 3UAJD 4B3MQ 3BXNB 4P3WA 1UURA 2HVKA 3PF2A 3B2MA 3HW7A 3P0VH 3TZUA 2RQXA 4JVPA 2H2PD 4U6XB 2R2EA 2JKXA 5KNDA 1E22A 3T3PE 2W80C 4NOBA 5ISZE 1PXUA 1PD0A 4Z7VE 3U9UB 1MWAA 5C0ND 4UAOC 4WW1A 3QCTL 5TK2A 1RFDL 2XWZA 4RMRA 3AU7A 3WN6A 3CUPA 1LYQA 4IBTA 4A7VA 3S35X 3ZGIA 4GQQA 1U8HB 4HIPA 2YD3A 3PP4L 4I0PC 3HOUH 4JG0L 4M6AA 5E7BA 3PLYA 1BIHA 4C1NK 2EO9A 4JFFE 1KLGD 3V52L 4TQUS 5J12B 3EYUL 3KPSD 4Z7UF 2NUTB 1KWGA 4ZFOL 3ILEA 4DAPA 3JWNE 1DTUA 4G8IB 4RQQB 2R9HD 4Z3TA 2VDLB 1I7RB 3FQ2A 3MXVH 1IBYA 1Q9LB 2BVYA 5E5MA 5IMLA 2PR9A 4Z3EA 4Q9QL 4UTAH 3BHBB 4B6ZA 2X0UA 1BFOB 3HOWB 4JFFB 4P07A 4I7AA 2RA4A 1H9VA 1L5GA 1R3IL 2YJQA 4DERA 5C5LA 4KHXH 1MLBB 3GUTA 5FLVA 5LBGA 3VI4F 4YS4A 1F5WA 5BN5A 1XL6A 4M7KL 3MRDB 4N0UB 4NIYE 3ZQXA 2CKZB 1G9NL 2C4XA 2YD2A 3TU6A 1RK1B 3HKZE 3DVGB 1F4HA 3K4DA 2OT2A 5DQDL 1VKXB 4P2AA 2ARJQ 1BXAA 2LHAA 5IVXA 4MXQC 5JHMA 2Z91B 1PZUB 4KUCF 2P42B 1JQYD 1KLFB 2E7HA 2XKNB 4U1KB 3ZDYE 1PNCA 3BD5A 4GIPD 3GTQB 1NINA 4Z7NF 3QQ3B 2JJTA 2J8HA 4N85A 3BP5A 4Y2DC 4F7MB 5BMFH 3HG0A 3WNLA 5ADPH 1GAFL 3ECVA 3HOGA 4UYPA 2HT2D 1OXTA 4DR2L 5C0AA 4GUPA 3HOXH 5IGXL 5AEAA 3O3AB 3GM8A 2EDGA 3WIFB 4X5LA 2RDHA 1I8IA 4TOYL 5DTFA 1KUMA 1T1YA 2Y1ZA 5E9DE 5E6RB 1KDJA 3TWCH 1YJWA 2BOCB 4PTUA 2YAHA 1KV7A 2GJRA 3HR6A 2VABA 1NPNA 1N36Q 4KY6A 1RIVH 3MRCA 4EKXA 1QFUH 3OKLB 4A7UA 4H88L 1IFRA 3NZUA 4XHQA 4H26B 1YEKH 5E08H 4AIMA 1PRTD 3LEYH 2FE0A 3N44F 3PFQA 4D9RD 2AWOA 1N12A 4LPXA 1BA9A 5H37H 3ZE1B 5DEGB 1BD2A 2H3KA 4Q2ZB 1C7TA 4KTDH 4ZUIA 4GS3A 4FHJA 4HK3N 3CRKC 1ZHKB 3IWUA 1S9VA 1F8TH 3I9PA 2CLZB 2NVXH 2X4UB 4FA8A 3NENA 4X62Q 2EY1A 2VL5B 4P9HC 2ENBA 5DHVB 5HJBA 3DWPA 2WC7A 1LEGA 1QQDB 2VN7A 4G7RB 4QO1A 5ESQB 1M7DB 4KKPA 2BNQA 4CN6A 5I71B 2NY4D 2NB0A 5IQOA 2XNAB 5IFJA 1RZ7H 2PI2A 1Q72L 2YEQA 4XCCH 4FP8H 2BNRD 3NGBC 3ES6A 2X70B 3QUXC 2V3EA 1NFDF 5DD5H 4D9LH 2ZX6A 1EY7A 1GMEA 4MRBA 2VAJA 1GKHA 3GGWB 4M43L 5D7SL 3BYYB 1ZANH 2D0PA 5TDPB 3GHBH 2VW7A 3WTWA 5M3FH 4QB4A 3ME0A 2K28A 4RZCA 3UC0H 4WO4C 2XSKA 4XPAL 3Q8CA 1TQTA 5JHLH 3KPMA 5KVGL 1QFWL 2LQRA 3DOIA 2V5SA 3BDCA 5ELBA 4CUCA 4OV5B 4L3CA 5CGYD 2FWUA 5FLXE 4K7PY 2R2HB 1G7MB 3FO2A 5DD5L 4Y1TA 2DH2A 4N2GA 4PCSA 3MUY1 4YDMA 3BDLA 3G6EA 3MLVL 1NPUA 5BS0E 3LS4L 3QUZC 5FLMG 4JHBA 1NH6A 4BCZA 4DPRA 1NAPA 3T04D 1DCLA 3HR5B 5DU7A 1GC1C 3NG5A 3MV01 4TULH 3PL6D 1J8HD 3W1GA 2RTTA 5IWLA 3QGVA 1AIFB 3TWYA 1JDAA 1R9TH 4RA0C 3ZKND 1A14H 4JI4L 4OX9Q 3ZDZF 1KDIA 2EIFA 3J80i 4GO6B 4KROC 2P8PA 4LEXH 5HHXH 4TQEH 1OXUA 4DA2A 4DR4Q 1RVFH 2VITA 3I74A 2FNWA 5HHMB 2IWHA 1BEYL 4EOWH 1N5AA 3C08H 4NKDA 5C09D 1P7HL 3G5XA 4EIUA 3MROB 4BY7B 5I5MA 3PUCA 5ALCL 5E6ZA 5HDBF 4XYOA 3U4AA 3WDHA 1COBA 3TREA 5IB5B 3UYRH 5KYUB 3ULUD 3QR2A 4APQA 2K45A 3SDAB 2WUCL 1T3FB 2IANE 5C0FB 1EEQA 3P9WB 2DDQL 3HS9A 1TYJA 4N0YH 4WWOA 3UZQB 5EZIH 2OMWB 1U42A 4NLHA 2HN7B 2BNRB 1QNKA 1MFBH 3H9SA 4S1RL 3GI8H 4R8WL 3X1FA 1NWPA 1LDPL 1UZ6E 2EDWA 3FK3A 5A7EA 3VXPB 1FVDB 1OCWL 4PJ7E 5FYJE 4AT6B 5DEGA 4J15A 4BQ6A 3Q8EA 3VDYA 2VDLL 3M8OH 4P49A 1ZV9A 2NSQA 4BFFA 1FYTD 4ZUVB 5J3BA 3C6LB 1I94L 3CF5A 2AEQH 1HU8A 1PF3A 2K4AA 5CZVH 5HDWA 4I3RL 4IEFB 1IV8A 5JQ6L 2IQAB 4LP5A 2I9LB 5D1QE 5KYUA 4L5FH 4X9HA 1K2DB 4OCXL 4K94L 4O4YL 4PJDE 3VXMD 1C16A 4AV5A 4KAQL 4FQHA 5HP5A 3MLSL 2XIDA 4QMGA 3JTTB 4YPGB 1BMWA 2Q2EB 4P72A 3I2ZA 1PTOH 2B3RA 2DICA 4L5FE 5TF1L 1FIGL 2C7FA 4NAQA 2K04A 2CPCA 2FFKB 5B1JA 4PS4H 1G43A 4UTCA 1HL4A 3I9IA 5K9OA 2X40A 1NFDB 1JTTA 1YN7A 4PJGB 5IFAL 3O9WA 5HURA 3W3BA 2RSOA 3DSFH 2VN6A 3B56A 5H4ZA 5C0DA 2R0ZL 4IIZA 4A66A 3GRBA 5AW3B 1VQDA 2P43B 5E5LA 3BAXA 4Z7WA 4WWKA 2N88A 2UUCL 4RCOA 1QLFA 3BUQA 3NEXA 3PWLB 1AGBA 1P5VA 1INQA 5LL6X 4FHBD 3HPLB 4K3HA 1IM9D 1G4MA 1EHLH 1EY6A 1NUNB 5EO1A 4KRMB 4TL5A 1SROA 1WBZA 4NQSB 2B63B 3LNHA 4DNLA 1NFDE 3TH4T 4GRMB 1OAZL 1WOCA 1Z47A 4NJ9L 4JE0A 5KEZA 1XH0A 3PPSA 3BZ4A 1XMOL 4ZW5A 1I4FA 4L5TA 1XYIA 1ASQA 1NSNS 2FECI 1U6AL 3PXJA 1K3ZA 4CVWA 5F0JB 5COYA 2N01B 4O58H 1BAFL 2FATL 4PTTB 2Z6BA 4U1SA 1PYSB 1LO3L 3D25A 1QEWB 2VUMB 5L7XH 3GK8L 5LCVH 5ESVB 2EKSB 1RZJH 3PP3H 4EO5A 5F9OH 3GDEA 4JI0L 2ADIB 2Y24A 4D0CB 4TSAL 1SE2A 1I4GA 2X2HA 2ZXRA 3K5NA 2O5YH 4NSKB 4AL8L 3BZEA 3AJ7A 4LPWA 4PP2B 2ZJSH 1T7XA 3ARVA 5SX5H 2VR7A 3FNKA 4KKNA 2DRUA 5FFOA 5AW4B 2WJ5A 3WD5H 3BW9B 1IFHH 3US9A 1U4EA 5F21B 2XTJC 2YRBA 2CDGA 2PABA 5E2UH 2NPLX 1CFVL 3BDBA 4Q6KA 3V9EA 4Y2DB 4DK3A 2GHWB 2H3NA 2EACA 2WIIB 3J80c 5HI3D 3P40A 4HCRH 1DVFD 1ZTXE 4PJXA 1KXTB 3FB5B 4RLDA 1YMHB 3PGZA 5T1KA 5LGYA 4F80A 3FT2A 4XNUH 2QPEB 4PVNA 4POYA 1OTCA 4ZMNA 2Y0SA 1RHFA 3E80A 4XVTH 1SEBB 5FB8B 1UC6A 1EZVX 4JG9A 1G7HB 1NC4B 1AD0A 3U9PH 3TJPA 3W39B 4O2CB 4E9TA 3S14B 5AW8B 4FLHA 4HALA 4DTGL 5ABZA 1VZHA 4HCRL 4M29A 1KC5H 1OSZB 5IQLA 3TYGL 3CK0L 1PH6A 2OR9L 3TJEH 1MIML 3SVMA 3LSOB 1MDAA 4I18B 2FHBA 3PP4H 1AZZC 1E43A 5JHLA 4XVTL 3DJSA 4EZLA 3SBPA 1RIUH 4UQAA 2R29H 5DFAA 3PWUA 4JI3Q 1USZA 5L6YL 4Y2LA 3T2OA 1U5KA 1UHVA 3KLAA 5B7FA 4JI8L 3TN0A 4A3CG 3PNRB 4LF6Q 3RL2A 1QWHA 5FF6B 2V7HB 5CIPH 3DX1A 3WENA 2VR3A 5IYCG 4X83A 4ZNEE 2WQVA 2DEXX 3ML9A 1XSIA 5DR5L 1NFKA 2BJMH 1JPSH 2CNYA 2MKLC 1HTPA 1TJHH 1DSFL 3CVCA 4KFMA 4L9LB 3WO4B 4DGIH 3P30H 4HAEA 1IT9H 4RMSA 5J13B 1AOZA 4O2DA 1H5BC 3KDMB 1CLYH 2AEWA 1KRSA 4IFDH 1G6RA 1KYUA 4GW1A 4R0LC 5C3TA 1ZCRA 4HAGA 4HOXA 3NZ8A 2DKSA 1DQIA 3QRGH 2IOOA 3R2TA 1T2JA 4WNQB 1LTBD 1I8KA 1AW7A 5BN4A 4TLTA 5L37A 1CD1A 4F8QA 3CDZB 3QZWA 5F7EL 3DROB 4RQQA 4JY6A 4NKIL 4HC1L 3QCUH 1GXDC 3F2CA 1FORL 3T1YL 1CFNA 3CZNA 5KSVA 2NUTA 1OK0A 2YN3A 5F71A 3CU1A 2PO6B 3PJLA 5EUOA 2QHRL 2AEIT 1L9OA 4XMKH 1D5MC 3DMMD 1ASZA 3MLZH 5IP7H 1NCJA 1OF2B 2CCLA 2EDRA 4C4KO 1BF8A 5BRZE 4F33B 4EQ5A 2ZCHL 1V3LA 3P11H 1MCJA 1QI3A 4MMXB 2G3ZA 2J55A 4TULL 1FBIH 2L4NA 4OZFA 4Y4KB 5TFSL 2YEZA 4CKVX 3JZ7A 3BX7C 4JO4L 5BJTA 2ATAA 2YC1A 4N26A 1AS8A 4KX8A 4E41B 3TPUB 2R7ZB 3SGEH 1PTOF 1J5EL 4JFQA 1ETZB 1JUFB 3L3IB 4KJPD 5GSRB 5BOJA 1FWXA 5C2BH 2R0KL 2XN9E 4IUPA 3WJJC 1VQ6A 1RVFL 4BZ1H 5D7JA 1O7ZA 4L5SA 2K3TA 4ALAL 3DGGB 3OPZH 3BXNA 4ZYKA 1IGML 3MRNA 5E4OA 5I9OA 4K73A 4FABL 3WFDH 3CDFA 1DQKA 4IKKA 5CBAA 3VB8A 3KYAA 1D5RA 1U3HB 1G9MH 2BRRH 2WWNA 3LIZH 4X99B 5D7JD 3X14A 3SY0A 2O61B 1B7YB 5CGBA 1A5FL 2MO0A 4XN5A 4ZMVA 2K5WA 1CGXA 1MVUB 2DH3A 5HD8D 2H2SC 2JXMA 2JK5A 2V5TA 4GFXA 2KDYA 3BDYH 4ZKCB 1QEXA 3ZHKA 2FYVA 1IO4C 4GG6B 3W0WA 2VQEQ 4JDEA 4X6DB 4HJSA 4KDVA 1CFQB 3MLWH 4D3CH 1G2TA 4OGZA 2VN4A 5SWZA 1GCYA 1OW0C 1D6EC 4K8RD 4M6MH 3SPVA 2YK1L 4PR5B 5LLIC 5IGCA 3E5SA 4U0QB 1BVZA 2F4VQ 1G6RL 1HHKB 2WLLA 1ZYRD 2KC0A 1W0WA 3S0PA 2AQ3B 1RU9L 4RKBA 3CX5K 4BA2I 2BDNL 2A2QT 1HINL 1CZ8L 3BVDB 4HXBH 1OZUA 3ILPB 2G75B 4FQIH 5D1ZB 4R90H 3OVUB 4WKXA 3VA2C 2VDPH 1WWWX 4J3OD 1AE2A 4DAGL 4GO8A 4NZUH 1MWOA 3GTKH 4EIBA 1T83C 4K2UH 4S2SA 4LSSH 1KIPB 1P1ZB 1T89A 1WFNA 1X5MA 3MCKA 4WJWA 3R1GL 4KXZH 4PVBA 3KPLB 3L2MA 4KKTA 4L8DA 2IDUA 1I75A 1DZBA 1PQZB 5GZOA 4FQIL 3P3SA 1ZT7B 1PMYA 2G2RA 1CLZH 2DQDL 2FJGB 4KTYA 1DO6A 2GTWA 4PAZA 4DGWC 3SKMB 5GZNC 5DJ8A 3L3GA 5EZLB 3NCJH 3ZE1F 1MI5D 2ATWA 1MFMA 2APWA 3E1F1 2IX3A 4LHJB 3RIFF 3S7GA 2ZWZA 5DMKB 4Z7OE 1NJ9A 4JREC 5EU6A 3QEHB 1MRCL 1YZ6A 1GZPA 4HHGA 2VZTA 4FTVA 2G5DA 3KJOA 3QORB 2H3XC 1AR1D 1OHQA 4NKOB 4OZGF 4L1TA 1B2YA 2B59B 5DZJA 2ZUVA 2CLVB 3CXFA 1VZIA 1S3RA 3DMMB 3DTXB 3KDPB 3KYKH 5IP7G 4JFQB 4ZUWB 4AGLA 1N5YL 3MMEB 5IBUG 4PRPD 4JLRA 3QNYB 1IBLL 5EBMA 4Z23A 2P5WD 4IPHA 2WCSA 3BEVB 4EEEA 3L4WA 2PQAA 5FOJA 3PP3K 4EZJA 1CL7I 1F00I 1KXLA 1SBBA 2OX5B 5H2BA 1OZTG 4MMXA 5D7KE 4HX1B 1HQRD 4P3CH 2Y36H 1A3LL 4JN2A 1ZGLP 1E3XA 5T5FL 2UXGA 4TUKL 4BUQA 4M8AA 5A16A 1Q94B 1RZFL 4XP5H 1DJHA 4XX5A 1RUKL 1CPUA 4PRPE 2L8AA 3QDJA 2UY6B 1KTDB 1NLBH 2VLJA 2HVJB 1YUKB 1SJHA 2W0PA 3CQPA 3MCLH 2VLME 5CBEE 3GYRA 4L2YA 2B2TC 3TP5A 4U7MA 5CIPB 4JI2Q 3BAEH 3AB9A 2XXCB 4IBQA 1C8QA 7PCYA 4U6HA 1ITBB 4JDVB 4PJCB 2MEJB 1NLBL 2MCAA 1BHGA 1HNXQ 4RIRA 5I1GL 5SV4A 2GAZB 3U9PL 4ZUSB 2ZSWA 4OLXH 4HK0A 1ASOA 5CEZH 4KD3A 1D7DA 1D5IH 3KJ4B 1MI5B 1M6OB 2MCPL 1HILB 1EWCA 5DT1H 2DIAA 4OCRL 4R2GC 2DL9A 4NI3A 4POFA 2F8VA 4IBSA 5D7EA 5C0BD 2R92B 15C8L 4R96B 3S88L 2AJZB 3HG9A 2ITCA 5GSVA 5JORA 1IEBA 4DR3Q 1DVTA 3S1RB 1CDYA 2FH6A 1CFSA 4KZEH 4YZFE 5HDBE 2R39A 1XSJA 1TEYA 1X9LA 1IILE 3QPXL 1E40A 1YUHB 3UTSD 5ELFA 4FRWA 1IBBA 1UCTA 5TJWK 1VENA 3LX0A 1WTHA 2QTVA 4XXEA 3DRTB 1JRHH 3EH5B 3EO1A 5CP7A 2GHZA 5KYNA 3H0TB 4F88A 1VGKA 2CR3A 2Q76B 1WTOA 5EOTB 1CF1A 1IM9A 3I85A 1V1OA 1KPUB 4KKCD 5HHVH 2ICES 2DQTL 2BA1A 1RF2D 2PPEA 3BQUD 1PLBA 3JWOL 4FZEL 4GEIA 4N8VB 1QZNA 3OL2A 1JB3A 4WWKD 3U25A 4W68A 2BIIA 4H1LB 3V0VB 3PNWB 1OTTD 1AD0B 1RULL 2CXGA 2NXYB 1ICTA 3L4TA 1ONQB 3BZFB 3DX4A 4HF5L 3S5ZA 1U8IA 3BDXA 4AYBG 3FSOA 2TRYA 3EJZD 4MA7L 3I91A 2BINA 4GRLA 3WAJA 2CW0D 2V3DA 1WAAE 5I6KA 1OGTB 4HPOH 3IMBA 1GM5A 3GTLH 2R0LH 3D2UD 5E7FA 2GFBA 4LPVA 4B95C 4BY1G 3U4BH 5IBLC 1QG3A 2V17L 4ODSL 3QIUD 1VLXA 1VHPA 1E5ZA 4OKVB 2RCFA 4NWUL 4W9JC 3R0NA 1JWSB 4HUVB 2F0QA 3SK8A 4BEIA 2AEOA 2AW2A 4HJIA 2Z7UA 2Z9TA 2ZCHH 1XQ4A 5B8CA 1CZWA 5DUPL 4YHNB 1CFBA 2R7ZG 1VCAA 4FFYH 3RB7A 2XPZA 3AMUA 5T1GA 1VADA 2DQUH 2ICEB 5ILTL 5C0CE 4ELDA 4EMZA 2YPVH 1B9ZA 1MCHA 5KYYB 2F7IA 4F7XA 1F2LA 3QXAA 1OLZA 4K3DL 5TQ0H 3WFCH 5EIIA 5CP3H 1I8MA 1PTOC 4MDJB 3V9FA 4K4KA 2Z31D 1GJXA 1GZHC 4TNWK 2A77H 5IOKA 1LO4L 1NCBH 3RFZA 1WTGT 4HJ0D 3EJYC 1F42A 1XAUA 2CRYA 3ARGD 1B4LA 1A4KB 1ZEAL 3QJSB 4CHTB 1KACB 1OO2A 1I4FB 4Z0XA 1A6PA 1PJ9A 4J3OG 2JTYA 5I74B 4P2QD 1Y6MR 2PW7A 1YC8A 2K32A 4PZ6A 1QO3B 2VDMB 3GXUB 1LM8V 2DI9A 3L81A 5IEKB 2IAAC 1JS4A 4HLZG 3ARXA 4FOMA 2GSGB 3GXTA 5LUMA 4R4OA 5EEWA 1AGDB 4UTAA 3BMVA 5ERWA 4AIZB 2P28B 2O5IC 4F8NA 1MKFA 5LN4A 3E7JA 5I1IL 3OHMB 5TH2B 4XN7A 3TLRA 4M1GH 2ZXWB 2VUOA 3CN1A 3FN0H 4M62H 3IT8D 2XIIA 3QEUA 5GRXG 4HU8A 3GTMH 4DEWA 4TRDA 3C09C 3K6NA 1JOQA 1X54A 3MKKA 1EVTC 1T1WB 4P4KD 3DARA 2EIZB 1J11A 4GIOA 3S1MH 5LXGH 4LMQI 2A6HC 3MA9L 2DWSA 3CMEA 1ACXA 3MREB 4UBDC 4UINH 1JVLA 3ZDYF 4XXCC 4ISVB 4BZ1A 3LPGA 4R7LA 4W9DC 3N91A 2BWIA 5JVH3 1IBDA 3HG1D 1CFSB 1H6UA 1TYRA 5L2KD 1WZMA 2Z65C 4EKJA 1KGYE 4DN4H 4KVNL 1E7ZA 1YEFL 1G1YA 2K52A 2Z4TA 4R96A 1F1AA 2I9TA 2X3BA 3SDYL 2A69D 4A3JG 2AGJL 4L8BA 5EIVA 3OC8A 3SKUD 3FRUA 5B3JF 2MFNA 1NR4A 1NIEA 5EOCL 5B21A 2BH8A 2TSBA 2WKOA 1HUMA 2BP8B 4LK4A 4NQCA 5AKTA 2EDHA 4PJ8C 3CPFA 3UE1A 2V5YA 3CG8A 3FOMA 3RI5F 1MQKL 3CC5A 3IRPX 5AQ0A 3R4RA 4Y4HA 3M1OA 3VDAA 1JZGA 2OP4L 1IB5A 3SDYH 2BSSA 3BGMB 3BQUA 4IGBB 4LIQH 2A74A 5C2BL 1WWAX 3FH5A 1XWEA 3N40P 3BC9A 4NKDB 2CDFB 3FTGA 3Q2VA 2GIYA 3RZOH 3T6ZA 3VJ6A 2X89A 2L1BA 4K71C 3SPVB 2FX8H 2P8MA 1ZT4A 1FNEB 1DVFB 2DM3A 3ZTEA 3MV9B 4UQ3A 3C87A 3L16A 1CK0H 4FQ2L 3HN3A 1V1QA 1E0BA 1M2OA 2X41A 1V1PB 3DOHA 1BAGA 4A37A 3FJTA 4UTBL 2JJSA 4MQTB 3VSUA 5ICZA 3GSQA 4WTZG 2Q2HA 2UXDL 1JPTH 1S7TB 2I25N 3I7FA 4GG8B 2YQ3A 4TLSA 5D4IA 3Q22A 4F93B 5JJKA 3P4OA 5DJ6B 2ICWJ 2MPAL 1ZVSB 3S8FB 1B2TA 1TT2A 1FVIA 1J1XL 2K0RA 3VSQA 1K8GA 5JZ7C 3UG5A 2YGVA 1OAYH 2JELL 3D4YA 3WYRA 2Z7ZA 4ZUWA 4JKPL 1BZQK 3H55A 2X5PA 3FFDA 4A75A 1F2XK 1KCVH 2PNHA 5DLMH 1JYVA 1OSPH 1HZCA 2NY5C 1X5JA 4QIRA 5ABDE 4NMZA 3OXSB 3UYPA 3CDGB 2E4TA 3BEWB 3EGXA 5DD6B 4X4ZA 1NJ9B 4R90L 2PXYB 4O02H 4RVBA 5CAYB 1A7RH 5JOPE 5AKSA 1EYCA 3LZFL 3MRKA 1QUQB 3DO7B 3G7LA 3UBFA 4AYEC 5GJSL 3VFNA 1PFNA 1WYJA 2J4XA 1I7TA 4WEUD 5D1QB 3FB6B 1M7DA 2KLSA 1HL5A 1LO2L 2A83B 1T7WA 3T2NL 1CTNA 5EBGA 4GBXB 5EUOB 3DHUA 1V3JA 1RJZA 3DMMC 3GI9L 4P3DA 2WQRA 1IGJB 3M07A 2WAQE 4PV9A 2N4IA 4M00A 4JFVA 3WXWL 4UU9B 1RDPD 4O58L 1LWJA 1CYGA 2X87A 4B0MB 3T1FA 1JHKH 4FQJH 4DPAX 3IJ9A 3SDXF 3A8JE 4FNLL 1KTKA 4Y7NB 3A5UA 4FXGA 4RETB 4NQDB 1SHMA 5E99H 1VF7A 3RZCA 5EU6D 1ZK5A 5E4EB 3EBAA 2C3XA 1KY6A 1X6OA 1WSST 1HCYA 3FFCD 4B5EA 2X6GA 2VDML 3WIFA 3TCLA 4KHVA 3N85L 2C3WA 2PLTA 5BW7A 4OF7A 4N2NA 1H3UA 4HF5H 1VQPA 3APNA 4MJ5A 1VZGA 4AKOA 4R9WA 4Q9RL 4AJVA 1HXYA 2WNXA 3V6BR 2QR0A 2BVEA 3IGLA 1JCKA 2BSTA 4YDNA 1GOGA 1IFGA 4GSXA 3MQIA 3TC9A 4JRYB 1EXUB 2FCBA 3QQ4B 1HNGA 2VQ4A 3K1KC 1MJ8H 3B37A 3UTTE 1FG2B 4K5PA 2HFEA 4MNHA 2VUYA 4Y4HD 4LFCQ 1C7YA 1CE6B 3KW7A 4Z7UA 4EF3A 1M05B 4P46A 4ZTOH 1L0XA 1L7IL 1MDTA 1DBJL 5JYLA 2BNQE 2VLJD 2CWPA 2EYSB 4QHLA 3ARBC 1MLBA 3EO9H 5CNHA 3GUTB 1KBPA 3QUHA 2VZ3A 1JD9A 2CRMA 4NWTH 3WL9B 1G8ZD 4Z18A 2AEPH 4G6FB 1K3IA 3UTTB 5C4ZA 3T0EE 3GSRA 4LVHC 1ZSDA 1OY3B 3F05A 5ILTH 1TVHA 4EUPA 1KJ2L 1SYBA 5IMLB 1HN1A 2GBVA 3AC0A 3PU7A 4MHHG 5D72H 4GW5B 1FNVA 4TN9A 3WIIL 1H9SA 4ORGA 2MHAA 3CCJA 3M85A 5T5NG 2VKXA 1YPZF 4LE8A 4OZFG 3QNFA 5DURB 4M1CC 2ARJA 2QGDA 3KPRD 1JF5A 3EJJX 3QC5X 3T0ED 2JA6B 4GN5A 1DN0B 3SDCA 3SOBH 1Q8MA 3CZJA 3U36A 2CR6A 4IZ8A 5CGTA 3B6YA 3A67L 1EAPB 1MCPL 4PREA 4NXML 5C0GB 1FRGH 4HIXH 2P5ED 1D5XC 1TZAA 4KTDL 5C2UB 2FD6H 1B2WH 3C75A 3QFJD 1MW2A 4U1NB 2IBZY 1WS7A 1ZHBA 2QSVA 3ROOA 4YLCA 3EW3B 3QZWG 4Y4KC 5E4XA 3KDMA 3QCUL 5C44G 4QRBA 1EHAA 1M2VB 2EE2A 1G0DA 1II3A 1A8ZA 1FCGA 4PGEA 1PFOA 5B8CB 4MQXD 5K9JH 1H3XA 1RLWA 2V7NB 4AMKL 3UTQB 5JIQA 4QXTA 1KN2L 1JGUH 5BOZG 3DIVA 2OMXB 4DW2L 3D48R 3RVXD 1RTNA 3U4BL 1CKOA 5GRVK 4N2BA 1BREA 3EBEA 1TJIL 2C7UB 5B1KA 1GGTA 3VXOB 3HOVH 5JUEH 2GBUA 2HWZL 4JHWH 2IH1B 1MJCA 2P7TB 4YHKH 4DPCX 1AR1B 3M3YB 1VQOA 4OBRA 5D9SB 5F96H 5C0AD 5D96C 3QULB 4PJAE 3O3EB 1F3DJ 3SZ6A 2WBKA 4OL7A 3CVHA 2EUZA 3AY2A 1SYSA 1T9HA 1SVCP 1H3PL 4HCEA 5HYSA 3E2HC 4ZSOA 2VC2H 3RGVB 3TIEB 3P4LA 3T1HL 5KJRL 4C3JB 3EGSA 1SQMA 2B4CL 3L5JA 3NJFA 2AQ1B 4L0YA 1MCCA 3A7AB 2ZWYA 2QKIB 4MS8D 1WT5C 4GLAC 3U1QA 1KCWA 4PJFF 1S7UA 4ME5A 1LD9A 2QPDB 1QWUA 1LO5D 1XIWB 3QO0A 4YHPB 5F1IA 1K2DA 4N6QA 1MCFA 1C8PA 4YDVA 3VXTB 2FRGP 2WWMD 1TNMA 3PIQA 3TTYA 1A3RL 1YQ2A 1KC8C 4F5CA 2E7DA 1D5BA 4TQPA 4ELMB 4WI2A 5DCCA 5D2NB 1TWAH 3QHFH 3ARYA 1DLFL 1ZLSL 4JYAL 2B3GA 2CDGB 1YNJD 2QVIA 5CSZB 5ICYA 3SE9L 1HOCB 4FO2A 1QZGA 3QO1B 4AYSA 1F1DA 4P23A 4MAYA 2ZKYA 3R8BA 1UXWB 2FR4A 1DBML 2GEEA 2XZCH 2YN5A 4PJBA 4WFFE 1PZDA 1V10A 4W9IC 4PJXE 3QHFL 5ITFA 1TCMA 4RH4A 2Q2LA 2B2WC 3H3PL 1WD8A 3T0AA 3NSFA 2WP8J 1YNLH 4HH8A 1YY8A 2K7VA 4QHNA 1ED3A 4MLSA 1IL2A 3VXQA 1NJIC 2YAMA 1OOAA 2B2UA 4CSZA 4L1BA 4OONA 3J81c 1HX0A 2BZ7A 1AG0A 1DJIA 3BKJL 1GJWA 1ODUA 4PJ5E 1FHGA 3B9KB 4AW4A 3FHWA 4A7SA 2OR8A 1KPRB 4G9FB 1Y8NB 4Y19A 4HG4J 4NXNQ 1CLYL 3RWGB 4HJJH 3S2DH 5IYBG 2EVBA 1A1NA 1P5UA 3RE0A 4JI6L 1XCTA 4F37K 5HPMB 4W4OA 4CVXA 5H35A 1H3WM 1M8AA 3OV6A 3BZ5A 5DEFB 1WFMA 1L9PA 4NHUA 4K2KA 3A5ZB 4N2KA 1MGSA 1LO0L 4O02L 2Y4SA 2VQ1B 3GMRA 4YY3Q 3MLSH 2OKMA 3KS0J 3QZNA 3UAFA 1UJTA 4MRCA 1Z9SB 4RRPM 2F3WA 5FAAA 4MSWA 4N8FA 4WWKC 4A63A 3OR7A 3ECQA 4FP8L 4BXXH 4BHUA 1EQRA 4J6IA 5M94B 2PCPA 1IAIH 3FUMA 4GOSA 5MEPA 2HRGA 1FBIL 1ZVNA 5ACLA 3IJYA 3UBXB 2D3NA 1MAMH 3LQAC 4G7SB 1LTID 3D4WA 3QEQB 2HH0L 1VQIA 3QEHA 4M8QA 1MCNA 1YNKL 5LCVA 3AW5A 4G6KH 1HQRA 4EN3C 5GAGC 1I85C 4OZHA 4ODBD 1JPGA 2X1XR 4Y1AA 3U1SH 2NSMA 3VI4E 2NZHA 2I9LA 4K8RL 5C0XH 1XHHA 2RSNA 4ZZKA 2Z3FA 4W6XB 1YHQA 1ZDQA 3TH3T 3LEVL 5FJ8G 4BUHA 1A3QA 2LW3A 3ZKXB 3IKJA 4QIWE 4KQ3L 2EUVA 1WTLA 1EQQA 5I1AA 4FTVD 2D7OA 3D3VD 5CSZA 3NIFF 4B9JA 3BPNC 2NT0A 3G9VA 2MPAH 5C0EB 4PJDA 2F0EA 1D9KC 4YWMA 4XT1B 1T2QL 1UM5L 4BFKA 4ZFGH 1OAXL 3A6OA 1QFWH 4DK3C 1J18A 2IAND 3PGDA 4L3ED 5EUKB 3KL5A 2V3FA 4HUWA 1SJEB 1N4XH 4KKLD 4DGZA 3GLEA 5JPMC 1YYCA 4PRAB 2Y06L 2DWDB 2P80D 2AJUH 5E6YA 5EKKA 4WGVB 4FF2A 2VZAA 1LK3L 2QKIA 3EKCA 3DWQA 4KRLB 4KY1H 1S5IH 2HCIA 1A7OL 4UIMA 2Z8VC 3TFKC 2PPDA 4OCRH 3ZDXE 4KK5D 3BUDA 3UTSB 3B7TA 1JZJA 2CO7A 4RCAA 4NM4H 3KPPB 2FEDC 1S9WB 1SLXA 2YKLH 3C6EA 4OLUL 3ZE0B 1P84J 1V54B 1SGKA 4BA8A 4MBOA 2VE6B 4X9IA 1GC1L 3HNTH 3V6ZB 3QDGB 3V7AE 3R1GH 4LEXL 2ZNWA 4X99A 4RISL 3DJRA 5FW8A 2H1EA 1QFPA 3REVB 2K7QA 1R9FA 3VMNA 4DZ8B 4XR8C 3AREC 1QASA 3ZIMA 1G7JA 3Q5TA 1SRDA 2F1AA 1BBUA 3ZUNC 1C5CH 5FM8A 3FCSB 5CUSH 4K5VA 1S7QA 4WENB 5F7DB 4BFRA 1O7VA 5F9JB 5HYJE 4OV5A 5AW2B 5BPPA 5IOPA 3M9BA 2AVGA 4FQLH 4Q7DA 4JR9L 1PFSA 3Q05A 3F58H 3K91A 4N0RA 3S2HB 5EPJA 5IESH 1B44D 3HMXA 1YVLA 2E56A 3L1FA 2Q3ZA 3ABKB 3TO2A 4HA1A 4OT1H 1SXNA 1KPRA 2YUZA 1JI1A 4JO8A 4KI5D 4KUZL 5I82A 3WNNA 2FQDA 3E0EA 3F7VA 2DMGA 4MJIA 2GCYA 3UZVA 1MCLA 3N3EA 1RPKA 5JEAG 1JPSL 2FEEL 5HYJB 3KEHA 3SSGA 1GZQA 5FPIA 4QXGH 4WFHD 4D2NA 2NUPA 1OVZA 1R4QB 4IBUA 5EDSA 2UWEF 3FO1B 3MBEA 5IROD 2X6VA 2K5DA 2QQKL 4R4BB 1GUGA 4QGYA 4GAJH 5IMOA 2O6EA 3OLEA 4OZIE 3ND9A 1K83B 1DFBL 2ILLA 1P4IL 2CE6A 1RZFH 3G6JB 2LE9A 2P52A 3NPPA 3OHXB 4H8HA 3SGIA 1BR9A 2B8GA 2NY4B 1XCQB 2WUBH 3UBXG 4QRQA 1FFOA 1ZLVK 2JA9A 2IDSA 5KAQF 4ZUUA 1BAFH 2FATH 2X4NB 1HKFA 2BIQA 4F7TA 1OE2A 5J6GB 3EDEA 1XB6A 3CHXA 3DJZA 1WCMG 4GW1B 2JIXD 4BK5C 4YHLL 1YVCA 1ZS2A 2BVOA 2WBJD 3IVKB 2F0SA 3HB3D 2UX7A 4UY8C 1N8ZB 4H8UA 3WN5C 4IN3A 3VA7A 1L6PA 2WOBA 3SDXB 3D8MA 2BSEA 4IMKC 5IYDG 3GIZH 4LBAA 3BIAX 3GMQA 4QRPE 3PWNA 4PRIB 4XBEH 5F1NA 2A5HA 4GUPB 5FDWB 3STBA 4Y16A 1F6FB 3CSGA 1CSQA 1OT2A 1T0PB 5JMOC 1TVDA 3ARDC 4OLXL 2F54E 2R2BA 4G83A 2QDVA 4OAWA 4M61A 2WGXA 5FEBA 4IFDG 2DQIH 2QVKA 3DRQB 1QWNA 4MYPA 1GOHA 5J1ZA 2X2UA 3BSZA 5J1AB 2Z91A 4X6EA 1U3HC 4OCSH 1AO7E 2J1WA 3MGOA 3NOIA 4PI0A 2BHUA 2WLKA 4QJ3B 3NTKA 4JMXA 2JCCA 2D5DA 3BVNB 3IDMB 4XN9A 3MRIA 1AYRA 3U7WL 4LOUC 3K7UC 3C60B 5HGDB 4AVJA 5J57B 4PLKC 4DKAA 4PJEF 1EBAA 4LSDA 3P77A 1A6TA 4ONFH 2WAQA 4OW6A 4IQZA 1Z6HA 1KPVA 3HI5H 4XX1G 1J8HA 1KCLA 1NBYB 3BDYL 4R6UA 4PWEA 3WEXB 4EI6B 4LLQA 1IVTA 1XGYH 1NC2A 1WDAA 5KYWA 3AQQA 2WIIA 4LKCB 1RJCA 5JXAL 3ARDB 3E9HA 2YFNA 1BECA 1SYVB 3VFUB 5M5WB 4CNIB 1T0MA 3VFOB 1WZLA 2W0LA 5I8CA 2OZNA 1Q1JL 2DUDA 2H1PL 3ASNB 3CIQA 2G60L 1D8LA 3DYOA 2HWZH 2HT4C 4APXB 3HAEH 3D2TA 4K3EH 3V0WH 3VGDA 4AQ8A 4NSKA 2UUAL 3BVMA 4DV1L 3ZYYX 1CGUA 3EGDB 4PW3A 5GGTH 1Q8IA 1KC5L 4K2UL 2E9IA 4M9PA 1GJIA 2WO3B 1NE3A 3S9WA 5M5XB 2W0FA 3IFPB 3SKNA 2ROYA 2HKFL 3RA7H 3SGJA 3CZFA 2HDLA 5G5DB 1VFMA 3H9SE 3S9DB 4K3GA 2KPNA 3THMH 4I3SH 5GRWA 4IBVA 5DJ2B 3IPEA 3B7UX 5BO1L 4PRID 4LGPB 1NBQA 2YFOA 4JRXE 3VWKB 4OJFH 2ZG1A 3PO3H 3B1TA 4UDUB 4LSRH 2ZP9A 4LBEA 7FABH 4X5XB 3CHQA 2RHSB 5DRZA 5EO1B 2E74C 1CICC 1I9JL 2ZYIA 3IFPA 4ZXBD 3J80E 1HSAA 4OH2A 1XGQA 2BE5C 1M1XA 3ENEA 3OKMA 5BV7H 1XR9A 4MNGB 3MVVA 4HJGA 3DRQA 4RSYA 1SXCA 4N5ED 3AAZB 1QFUL 2PMZB 5MERB 4HMJA 3L48A 3P73B 1EJ6A 5DJAB 2NDGA 4ODXA 5KANG 4W9LC 1OTTC 2BY2A 3WIAA 4BY7G 5FDWA 2F19L 1CCZA 4NERA 5I1EH 3K71A 2XN9C 1F6LL 1AKPA 5J6SA 1AOHA 5BNXD 4L0PB 2FGZA 3VYUA 4QRSA 4HC1H 5A6MA 1A3VA 3IVKA 3OMCA 1LTXA 2BXYA 3QZBA 1T03H 3SGKC 3L3DB 3H0GG 3TA3A 3U83A 2VLKD 5KW9H 4L1HA 2PMZE 5C0XJ 3L4UA 1J1OH 3L1OL 4H40A 2C9OA 3VYSA 4WWNA 2F3IA 1GA2A 4A3MB 1F3JA 1O7LA 4GSUA 3EH2A 5F7HA 3L45A 3WUWB 5EPMB 2YGQA 1GR7A 3HEJA 4YBHA 3FQWB 4YUEH 5DD1L 2Q7NA 2IAMC 5HGQA 4LESA 4F2MA 1WHPA 4JGNA 4U3XA 3FN3A 2XG4A 3F62A 5EPLA 1SOQA 3L4VA 3SJVD 5JQHC 3O0RL 3FU9A 4HDIB 2EYTA 4L8SA 1DANT 2AJXL 4UHVA 4LT7A 1EZUA 1K28A 1F4XL 3IMWA 2FBRA 4RMUA 4AQOA 2EJFC 4AENB 2EZVA 2BOBB 3JBG7 5D65A 4UAHA 1FYTA 3S14H 2XX0A 3NSXA 3Q43A 1UXMA 5IWAL 1PY0A 4FP5D 3TBYA 4D8PA 4ODHL 5GGQH 5TE4H 4IK7A 3UTZA 2VXVL 5DGQA 1CT8A 1UD5A 4JI5Q 2JKRM 3DSNA 4JFHD 4Q0XL 2AQQA 1UD2A 5AG8A 5IIFA 1B6DA 3GC3A 2GYSA 1PEWA 5L88H 3PHAA 3VTAA 1TU2B 1SVZA 4PRHB 3DBSA 4MSWB 2JLLA 1RJYB 3LKSA 4HJTA 3GO1L 5T1MA 3ARGC 4HEPA 2VLLA 1KJ3L 1N2RA 1UACH 2YPLD 1KDCA 3ESMA 4KMQA 2JCWA 2X6MA 5HJ3B 5DO2C 4RAUA 5C3WA 1FYHB 4WFGE 4AIXA 4S3SA 4EVOA 5EBLB 4L63B 1PY9A 3H2WA 3NJIA 4LHUD 5K59E 3KPPA 3RY5A 4OIKA 4YNYA 2CUMA 2YGOA 3BAIA 2C8NA 4K5OA 2R7DA 4EE2A 1ZKAA 2FWOA 3KF6A 2F2HA 3K4ZA 1CXKA 2BNUB 5ELDA 3JWNC 4PRHE 4OD3L 1A6VL 1OOWA 4QRRB 3CX2A 5GRVL 1OP9A 3RTQB 2CDFA 5EF1A 5I6NA 4FDBA 1BO0A 4I5BB 1EIHA 1JNNH 1OSPL 3KPSB 3RGHA 3LCYA 2YRLA 4HKBA 3F6JA 3PGDB 1LVEA 3JV6B 4AY0A 4F9LC 1TSHA 1E4WL 1IC7H 3B5TA 3Q5YA 2HJKA 3BWAB 4MQXC 2PUQT 1ZHNA 3GIZL 4XCNA 1IGFL 1IKNC 3A7LA 1MJEA 5DYOA 5F1KC 1UXWA 1ILUA 3VAEA 2XG5A 5DI8A 2VLMD 2X4UA 4M7ZC 5HDOA 5I1AB 4HZLB 3QAZB 5TF1H 4Y9CA 4BV1A 2WBXA 4LVNC 4R5XA 3EO0A 3D31A 5MEND 2P8LB 2X4QB 3P4MB 1GUOA 3QZPA 4W6YB 4OGXH 1PYBA 4EAEA 5LBSL 1AY1H 5INCB 4DR5L 2AV1B 2GITA 4RA8A 1PA6A 2WTRA 4XZ4A 4DV0Q 2PWHA 4PB0H 5J9PA 3VMOA 4DR1L 1KV3A 3ULUH 5I5RA 1JAEA 4CADB 1G9MC 4FCHA 1CLCA 4JFDD 4KXZI 1BQHB 3FU3A 5FO9A 3BPLB 2IAMB 3OMGA 1JSYA 4PCYA 3MNVB 1MLCA 4LCIH 1RFDH 3GZQA 5C0AB 2R0WH 3OWEA 4H8VA 2VMEA 2FJHA 5I0XA 4H2CA 5AVRB 2HLAA 2DMHA 3CVHB 1RK0B 2L4OA 1N0XL 3HUJA 3WGUB 4GQ9L 1ML0A 3MO1B 3W11D 5HD8C 2WTRB 4I87A 5CGYC 3D2UB 3Q5OA 4JFDE 2A1AA 1Z9SA 2F08A 2LGNA 1GYAA 3PWPD 4YHMH 3L3KA 3TH2T 2WKGA 2JQZA 4F9PA 3I6GA 4R7NA 3JWDH 3L4YA 3N2JA 3ZYJA 1NLDH 3SBWC 2KHAA 1A9EA 1WAPA 3LEXA 2WWMC 4ILDA 3ZQ9A 1NOAA 4LRIA 4BELD 3WNJA 1IGTB 1XCTB 5JOEA 3RB5A 3HE6B 4PD4J 1BBJA 5IKCA 1M2VA 2K9UA 2G2NA 4PM1A 4YHLH 5HGTA 4ANWA 2OCCB 5KVFL 1PU0A 4FNFA 3EHBB 4JPKL 1AXSB 1YMMB 3NXWA 3AWGA 1I1FA 1OSEA 3FONA 3PV7A 3T13A 1EDHA 1I7UA 3U7YH 3MUGA 3C1FA 4BA1I 1ZVYA 3IYLW 3MXWH 5LWYH 2A19A 3VRLF 1NSNL 2J6EA 5J06A 4UDUC 1TQBB 1Z9LA 5DUPH 4I0PA 2VH5L 1DQVA 3DHQA 1ETJA 1RD9D 1GGCH 5LBSA 5IWLC 3CGTA 3LY6A 2D0HA 2PTVA 2WYZA 2XTJB 5F7BA 3BISA 5EMYA 2PQEA 5TK4A 1IAOA 3NEEA 3B2UD 5TDNB 1PKQA 3PSIA 2DTMH 3NTIA 2O1AA 4BM7A 2IGFL 3EJYD 2H32B 3OKKB 4RAUB 3EHBD 1G1OA 2NR6C 1GD7A 1AJ7L 5I26A 2VY3A 2ADGB 1X3FA 5JJIA 2WN3A 3I50H 1S5CD 2HZHA 4LCUB 3KLKA 4M7LL 5D7LE 4X65L 4L1SA 5KN5B 1QJOA 1S7UB 3CFTA 2Y23A 3CFKA 4QXUH 1DDTA 3RD4A 4FXDA 3QJRB 4RGNE 4YIQB 2LAAA 4BBSB 2GK0A 2X3AA 3D69B 4FMKA 4ELME 2OTLA 2ITDA 4IOSD 1WJ3A 4X6BB 3RWHA 1B0WA 2KZWA 3SYAA 2J6EH 5E1AA 3U6XA 3RGVA 5FA3B 2NY3B 3LZQA 3OB8A 4J4PC 5DUML 1XV8A 4JM2A 4LF9Q 1U8LB 4JBSA 1HNWL 5EC1B 1CKNB 3IETB 2K6YA 4BDVA 5B39A 1XPOA 5KNBA 1VA9A 2HJFA 1I8AA 3FPYA 5IUSA 4O1NA 3RIFK 2F5AL 2EYTB 1CGYA 3U50C 1E28A 3GMLA 1KBWA 1LEIB 1SLVA 1I3QH 1CU4L 4QHKJ 1U3YA 5K1JA 4BXVA 2X2YA 43CAB 5T3ZD 3APCA 2WZ5A 4P2YA 5FA4A 5SWZE 2A6KA 3QIUC 3SD5A 1WICA 2OMBA 3D85A 1KB9J 3WUWG 3BH9A 2HKFH 2QGCA 2IPTH 4LL4A 3PGFL 4CSSA 2XN0A 4OIBA 2OW6A 3HOUB 1HIMH 2RDFA 5C0RH 4H88H 5E08L 2K3HA 2R83A 5JPNA 4JZJA 3UOAB 5CD3A 1VQCA 2XX1A 3PIPA 4K3JL 4PVMA 1G7QB 4PJEB 2C1OA 3ZPDA 3LKNB 1NIFA 4CAGA 3SGEI 3N1FC 4GS7C 5T3ZE 4U68A 1OE3A 3PCYA 3FKUS 3KD4A 3I9GL 1UXSA 3FPUB 4D0DA 1EX0A 4MJID 3WJMB 3MV7D 3HUJE 5DSCB 2FWOB 1G87A 3P9LB 3TEHB 1FGNH 1NCWH 5M3MB 2RR3A 1Q1EA 3C6SA 3CLFL 3F2LA 4HS6A 3MBXH 2Z7WA 4Z78A 2A83A 4KNSA 1QYGL 1T1XA 1QUPA 1MIEL 3LRSB 3I8ZA 2BOLA 1DJZA 3AGVA 4J28A 3NJMA 3ZKMD 1SN8A 5C07A 3EYSL 1ZGLB 4BQCA 1SHXA 3H3VI 1F6AB 3M8OL 4NQCE 4Y5VA 3M7OA 2XUWA 5GJTH 4LBEB 1PLAA 4Q9RH 4UILL 3HPJA 4R8IA 3RZDB 1JYXA 5I15L 1J5CA 1AE6H 3PWVB 2OPCA 4DV5L 3GHEL 2IBBA 2FWSA 1LUZA 4DV4L 3GBLA 4O2FA 4WO4A 5ISRA 1WFUA 4MAZA 4YAQB 1BCPF 3Q2NA 1IC4H 1GZPB 2DLFL 2L0DA 1QTSA 2VIRA 1N8RC 1WP6A 5FUZL 1O5PA 2FHCA 4B53A 3ZZ1A 2V2XB 4HSVA 1ZMYA 5IF0B 2LU7A 4C58B 4U6YA 5I6LA 1AE6L 1T04A 2WKCA 1KTJA 3KXFA 1FJGL 3MV9D 3CFCL 4IKLA 4DEUA 1NMFA 5SV3A 1S9KC 1BPLB 4KK9C 4G6JL 4LLMB 1HTLD 3GRWA 3T3PF 1C5CL 1E27A 1H95A 4QT5A 3TBSB 2BCKB 1T4WA 2Z0BA 5LMNL 5AVXB 2J6WA 4K5WA 1YQVL 4F8PA 5ELIA 4RGNA 1J8HE 1XXFC 5SWSB 2D31A 4UV4H 4LLWB 3MRRB 4YIJA 3L6FA 4X5QA 4PLKD 3QJUB 5DLLA 3WNKA 2NMSA 2PYFB 4QRAA 5JOPD 1H3GA 2GJPA 3IFLH 2TRHA 4HT1L 5I9QB 5GGRA 4RNRA 1I8KB 1D5XB 4G4KA 1O7SA 2ALYB 3L3DA 1CXEA 1D5XA 3O4OC 3SDZA 1J9SA 3L4ZA 3LQZA 5FKAC 4MKTA 4Y4HB 2D9CA 3L7FB 4LFHD 2VXVH 2WZAA 4WU5A 4QF1A 5AKVA 3MRJA 3RY6A 1KXHA 3PQYA 4D9QE 4M7LT 5A2QL 1ND0A 3ASOB 2QQKH 3Q2WA 5BS0A 1T6WA 3K71B 3RX7A 4HWZB 3GK8H 5LCVL 4YWKA 2CH4A 3ERQA 3HG1B 1R5IB 3HZKB 4HTHA 1T66D 5HGDA 2Y5TB 5BQ7B 1XF5A 1HA5A 1SR3A 4DR7Q 1IKFH 3E3XA 1IGIL 2EC9U 5EKIA 3FB6A 4DP2X 2OL3B 3ZMEA 4FJZA 3NCWA 2C3GA 2L0CA 1IC5L 3ZHLA 4KO7A 5FYJD 5KWYC 5HGGS 1OAJA 3OAYK 2VZOA 3S3PA 1FYTE 2R23B 2Y0SE 1JMZA 1N9WA 4O00A 4NRYB 3FU8A 5F9DC 5T5FH 2AANA 1E2VA 2EIMB 1KIQB 2FL5B 4TNWF 4WRLA 3UE0A 1A9BB 5D1XA 5A2IH 1WFQA 3WTVA 3N6RA 2Y0SG 3SDDA 4P5TD 1CWVA 2I60L 4LFBQ 5CJOH 4DVRH 4S10A 4ADJA 3IGAB 3QJFA 1ZLUK 4F58H 1U8NB 3RWDB 3G6AB 2X2IA 2K8QA 4PN6A 2R0ZH 4P8QA 4YFEA 3ULVL 3FT1A 3HHRB 4XP4L 3CFKB 1B3QA 3L5WA 4N2DA 3NA4A 4OZIB 2ZXEB 2F52A 2YD8A 4KZDH 4ZAKB 3P4OB 2YSSB 2VR4A 3LIUA 2HHHQ 3NUKA 3M4OH 2XNAC 1MOEA 2AXGA 2L12A 5I71C 1IBKQ 4A3DG 1WGOA 4RBPK 1ID2A 1CBJA 3FB7B 1FZMA 2V4DA 3FL7A 3OHXA 4LVHB 4PUBH 3KVDD 5ANHA 1EHXA 2QILA 3TBWA 3NELA 1EH9A 4K7FB 4BK8A 1VAHA 2XZZA 2XWEA 5KBNC 4M1DH 2ZZUT 4M5SA 1HZKA 5KSVB 5F7KC 1YITA 4LEOA 2ZWSA 2ISDA 3E6HB 4O2EA 4JN1H 3IKCA 1X5GA 2XV3A 2H5XA 3SBRA 3BGAA 3DROA 4M93C 1D2BA 1F77A 3CDZA 2C1OB 5F8QC 4QJFA 1OCOB 2CKBA 3HNSL 1QATA 3MAWA 3FTVA 3KBFA 5CV7A 2DOCA 4C8XA 1AEXA 1BWWA 1RUAL 3D0LA 3FUIA 4OUUA 2LFGA 5L0QC 1NDTA 1ORQB 1FL0A 1RZKC 2QL1A 1B3AA 2R1WB 3OKDA 4TNVK 1T22B 5D5MF 3ZTJG 4AQEA 3BH9B 1AVAA 5IKCB 4ODVL 2KMWA 3GB7A 5IHUH 1D3CA 2NW3A 1MCBA 3EF4A 2X69A 4Z3JA 1X9RA 3I73A 1YNLL 4GAYA 1BV8A 2IV8A 4LZKA 3IDJA 3W9DB 5DUMH 2PPFA 1LO5A 4CDGC 3TFKD 5FGRA 4HHWA 3NP3A 1YHPA 3GSVB 3P3YA 1TKWA 3LH2H 4NZUL 3IXAB 5EORH 5D7HA 1WZAA 4E42B 1STNA 5AB1A 1FZOB 2EDOA 4Z77A 1NLDL 1TTGA 2LVEA 2VSMB 4XPHL 3MO1A 1KYFA 3SCMA 4C56C 3L2NA 3V55A 4WI4A 4LNRB 1N33Q 5FGBC 4HGMA 1U8JA 1FZJB 3BGFB 3QHZL 2VXSH 4HIHA 4NN7C 2WKDA 1MHCA 4BSJA 3NIFE 1MLCB 5DVLA 2APTA 4A3EG 5CHNA 4LRNL 5F1SA 3IDNA 4LLUA 2OMZB 1MZYA 3MJ8A 5IQ9A 1ZWIA 3UPRA 2RB8A 3JTSB 5L4MA 3D87B 1D5ZB 4FQHB 3TJHD 1A0IA 5D5ME 1NEUA 4GKJL 3WFCL 1BQLH 4ZAKD 1BFVL 4JZNB 4K3JH 2D7TH 1D6VL 4PHXA 1X5XA 2J43A 2UVEA 2FLBT 3BYTA 4J3VA 2H3NB 2CLRA 4GAAA 4JHZA 1A8VA 4LAJH 1B0IA 2PXYC 3FRPA 1FLTX 3HRZB 3QH3A 1AE3A 4G8FB 4KO9A 4NUJB 5BV7C 4GQZA 4NLAA 4E9QA 1A64A 1EBPA 1QSED 1E4KA 4P5TB 2NVQH 5IJKA 2FMCA 2X4OA 3FO1A 1MG3C 1QPXA 2FJSA 2VC2L 4QRTA 2CW0C 1E8WA 2LABA 3QWQB 1SDFA 2IG2H 3AY4A 4TUUA 2E8GA 1S3KH 2DKUA 5E6UB 4J1MA 1H5BA 1KN2H 3HZYB 5LJYH 1OTUD 1Y8PB 1EIGA 5EU3B 4YX2L 5LBVA 4KGJA 1ILPA 4WI5A 1N3NB 2LXJA 3K5OA 2KERA 3SEPA 2EY2A 1U8QB 5IG7A 3M7GA 2VUMH 4M8QB 3VR2A 4F1ZA 4IUTA 3BP7A 3WTXA 3LD8B 5KZCD 4YZWA 1CGSH 3KGTA 4PHZA 4U1GB 3BZ4B 3DKHA 4N20A 2F54A 4WDIA 3SE9H 4TSBH 3G71A 4FI6A 3GSWB 3GHEH 3LV3B 3NT0A 4YNYB 4A68A 4CVZA 2R4SL 4F8LA 3D51A 1B90A 4PG2A 2F5BH 3D9AH 1T80A 4E2OA 2AVFA 2XVKA 4L4VD 1AP0A 2MIZA 4IRJA 4DZ8A 5H37G 1AS7A 3ZSSA 2A1WL 4K8RC 4WO4D 4PZ8A 4RESB 4Z7VB 2I46A 1I1AC 2AKRB 4OKDA 1X9UA 5D4QA 1GHJA 2WYTA 5LAXB 5KBKA 3AT8A 4ELKA 4J39A 3N41F 3N55A 4GRLB 4XB8A 4XVJH 5CILH 3T3ME 1SJMA 1Z9NA 3V5HA 4IOAA 4AH6A 5C0NC 4X5RA 1MVFA 3MMEA 4I2XB 2GTQA 1YNTF 2OTUB 2UZIL 3CPLA 4PJ9C 3QA3B 5HY6A 4LB8A 4URKA 3MRQB 3N42F 4GP5B 4GQRA 1RUQL 1KBBA 2HT3C 4PS3A 2DWXA 4XMZA 5TDOA 5L88L 1CDIA 1AI1L 3WXVH 1SMAA 2DYSB 1JOKA 2EEFA 3BYYA 3CVBA 4HFUH 5HDBB 1OL0A 5LO7A 5T33H 3ZKXC 3CCRA 1G9NH 1WAAA 1PDKB 4JDTL 4KPHL 2RCSH 1MW0A 4JVUA 1EDQA 5EUKA 3INUL 4MB5A 1F3RB 5A6LA 1YJDH 5INCA 4IUUA 5IB1B 1E9PA 4UT7H 3AU1B 5BVPH 1DXMA 3CDCA 4FI8A 4I4WB 4J3SA 3ZYZA 3H3PH 3HC0B 2BX5A 4FQQB 2X0WA 2YXWA 3N06B 3TIDB 1N10A 2FBJL 2HX9A 3CQZB 5DRXA 3MCKB 3RWCA 5AZ2H 4PJIB 5CCKH 5MI0C 1ZHKA 4BY1B 4PJIA 3HS0C 1WG3A 1KN4H 2NXYD 5ICYB 4QRUA 5ACZB 4WGWB 3F8TA 1SY6H 2QDBA 4H0HB 2CHDA 5FYKD 3CVHH 3QDHA 2HT2C 2CU9A 1I82A 2A73A 1X6NA 5AZ2L 4LCYB 4MCZA 5I8OL 1XIWA 2VR9A 2EH7L 2LT9A 4R7DB 2IDCA 4YFLI 5DTFB 1KG0B 1QG7A 2ZOKB 2ZTBA 4YDIH 5FUZH 2APFA 3D18A 3PDOB 3DUZA 1MNNA 4YHYB 3K72A 3MOQA 2FEJA 4W93A 4C47A 4KKZA 4HYTB 5JQ6H 1ET7A 3JV4B 3IJYB 3UBXA 5HBBA 3GLDA 3D0VB 4QY8A 5EFIB 5FUOH 5CEZL 5GS0C 3ULVD 4MQ7A 4JC0A 4XBPA 1OAQH 4XMWA 3QJTB 1EGJA 1OAXH 2O30A 1A7RL 4KX7A 4PRHA 15C8H 3VXOA 3BI9X 3GSNH 4IRJB 4WK0B 3GSVA 1O9ZA 4JRWA 3WNMA 1RPQA 5JW4Q 2L5TA 3NCCB 4F7CA 3MV8D 2A9ML 2TMPA 2XPYA 5EN3A 2PP9A 2OLDA 3VE0A 4A6YA 4AGMA 1IL1B 2I26N 5C6TH 3S6CA 2QQLL 3KYMB 4MS6A 4UUJA 4Y19B 4LQFH 4P5RA 4RH6A 4B9WA 2JA8H 3LRHA 5GPRA 1QW8A 1J5IA 3T8XB 3CH1A 4FFZH 3FUKA 4PB9H 1PZ5A 2XQYK 2GTWB 3EJIA 4GNXB 1TUPA 2G2RB 1HA6A 2EDEA 4MMXC 2F0OA 4MXWL 2XZAL 3LKOB 2UUBQ 1A7PL 4LEBA 5JNYA 5ELNA 4PG3A 3HFML 4JCMA 4MCNA 4KJWD 4ZMLA 1OB0A 1IIKA 5FV2A 3GSNA 1JVKA 1XZ0B 1DYQA 3WSQH 4LF6L 5I1HL 1FR3A 3RZOB 4KI5E 3BWUF 2QQQA 4BK4A 3HZXA 3HRZA 4RFOL 5DQDH 1X7SA 3CD4A 3FPPA 1FZMB 2L15A 3MLTB 4XPTH 4AZUA 2VRQA 4PJ9D 4YDVB 3VXTA 1DD2A 2IJ0C 3LN4A 2VDKH 4NKQB 4TPRL 1PG7H 4FFYL 1OP3K 3WEXA 4EI6A 3V0JA 4JFDB 1D5IL 1EU3A 1I9RH 1JJUA 1SDYA 3VFGH 3PWPA 1OANA 4L9LA 4GN3B 4HIEA 1S5ED 5A2BA 1HSBB 2RF4A 1QSFE 5KSUA 1CFQA 1WE5A 2GI0A 5G3LD 5DS1A 3UMNA 4IO9A 4AH2A 3J7AF 2Z9HA 1AMXA 3T1YQ 5IVOA 2ADJB 3KLAB 1AGFB 2G3NA 1MVUA 1P9MA 4J23A 2AEPL 5D9SA 4I3SL 4WV1A 2N7SA 3HTLX 4XMPH 3QDGD 4WV1B 2CHNA 1C5DB 5BZZA 1DBAH 1IARB 4QEGA 1FAIH 1HXYB 4OJFL 4XBGB 1MJ7H 2X3CA 1JVOA 2VDRH 2X42A 5HYEA 1STHA 2OMXA 3KYNA 1MJJB 1W72H 4FZEH 3KM1A 4OWTB 3X11B 1OTUC 1DVXA 1NOLA 4NDMB 4WU7B 5A2FA 2EDBA 1AKJA 2DN8A 4LF4L 4Y52H 2QADD 4ZFFA 1TVXA 5D2LA 1NM9A 3T51B 3UCRA 3UEQA 1V5JA 3FAXA 3IJSA 5BJTB 2BVQA 5FGSA 2C5CA 4OF5A 3LOWA 1WF5A 2EEDA 1QLEB 3L4CA 2CKBB 1E4XL 3J81E 1EZLA 1Q9LA 5E5MB 5A2CA 1MNUH 2C1PA 5JJLA 3U1PA 1OGAA 3FQYA 4NZFA 3NABH 5JOFB 4EPSA 1KCUH 1AZVA 3MTXA 4PWHA 3GDBA 2WSKA 1OP5H 4CL7A 2R4RH 4GBXA 4RGNB 3IMVA 3QRGL 3VR4A 1BFTA 4E9YA 3VWJA 4Y5YC 2D3JA 2E9BA 1YA5A 4PQXA 3JAMi 1ZA3A 3FN0L 4M62L 5KYIA 3ZKSD 1UWXH 3VFWA 2A6DA 2EKSA 2OQ0A 4M7KH 2CHXA 2ZWNA 3BVXA 4L8SC 3W2DH 3ZTJH 2VZUA 3MX0A 5IF0A 1EHKB 3C3LA 2VNCA 4U1SB 4Q9BA 2BY3A 1ENCA 1ZEAH 5EUOE 1XPUA 1KPVB 4X66L 3LHPL 3OXSA 2DWEB 3RL1B 1Q90A 1MFDL 2BA0A 3MLUL 4G11A 1A21A 2ICCA 5LNGA 1NTDA 1STYA 3DWAA 3FHAA 3HLAB 4PMBA 4AC2A 2CQOA 4WHCA 1DVFC 2AJXH 1ADWA 4C4BA 4AITA 4POGA 5D1XB 1L0XB 1YEJL 1ETA1 3PUUA 3RURA 4KVNH 1T21B 5FFGA 3DURA 4G7YL 5I17A 3VXUE 1AGCA 1G4RA 1VQ8A 1O0VA 4AJ0A 4S1QL 1G6PA 1KGCD 5DEJA 3U9SA 1AGFA 2CJ3A 2H1XA 1JZ3A 1PG7X 5BUAA 2VZSA 3QFGA 4XNZC 1DOKA 3C6LC 4FEMA 5BVPL 1N0LB 3OC5A 2Z4QB 2JN4A 1XX8A 1BBDH 5C97A 2YYZA 3VFPA 3CXHJ 3UZEC 3TGXA 1GGIH 1OAUH 1OCWH 3UTSA 2E86A 1FYCA 2Q8IB 1A7NH 3OW7A 2GABA 1CG9A 3C5SA 4S11A 5SX4I 1TQCC 3OKNB 4HUUA 5F72S 3CCEA 4PEEA 2J8UF 3GMOB 5DRNB 4FDWA 2H5UA 5EQ0A 3WV0A 3E9TA 1DR9A 3B9DA 4HUWB 1MSGA 1DQJB 4OLEA 5LGJA 1U9RA 5CU9A 2KQ3A 1PIFA 3BQUB 5JOBA 4IGBA 4KAQH 4NQUA 4X7CC 1URLA 1OM9A 2OMTA 3V0FA 4KXAA 5K9KB 2YAFA 1EUUA 2FSDA 1XDTT 4G8EB 3IFOB 5AL0A 4XMTA 1UTDA 1DVYA 2A6KB 4HWUA 4NQCB 4QYAA 5AW5B 4LJZC 2E5EA 2FJFB 2A6HD 1QI4A 3NN8A 4N25A 5J11C 3LH9A 3UDWA 4ODUB 2QFPA 4P73A 1KY7A 4V1DA 3KDFA 1TMCB 2YTXA 3RWCB 4MZIA 1IQDB 1RLBA 4LSQH 3QYCA 2EKJA 5D7SH 4JQVC 2WXLA 2B63G 3ABLB 2OP4H 3KYOA 3MN8A 3GMMB 1PD1A 3U30C 3HZVA 5F0MB 4A3BH 1CL7L 5SWSD 4NZRL 3MAQA 4KH2A 4YDKL 1X5HA 2IHFA 1KCVL 3B2DC 1SLUA 2UZXB 2MOGA 3MV11 2NTSA 4OWWB 1I3GH 4DV6Q 1U3JA 3S34H 3SDXA 1XD0A 5E2JA 4NOFA 3O6MH 2HTKD 4W6WB 1TTUA 4IUVA 5JW4N 4J3BA 4PWGA 1UH2A 2HMIC 5CV9A 1LMKA 4H0IA 4LASL 5BZWA 4X6BA 3D0FA 2XPGB 2YXMA 1V7NH 4Y8DC 3RWHB 3L1EA 2CGRH 2XQBH 3LZPA 3PWVA 2K6AA 1QBLH 3IK2A 2VLRD 5DVKA 2MP1A 5SWSE 1LT5D 2QHRH 2BP3A 1QVOA 4KMUC 4M6OL 2Z93A 3V6FB 4B3EA 1ZHLB 2PXYD 5CCJA 3IJ7A 2Q2UA 4G5AA 1AGBB 1P5VB 4OCLC 1PZCA 1GUWA 4YSRA 3I4NB 3KUPA 2Z35A 2VE6A 3WY2A 4G2AA 4IJ3C 1DQQB 3TO4C 3WMSA 4ME3A 2EE1A 1SZNA 2J2ZA 2E27H 4ZSOE 2LTQC 1NQBA 2XQYA 2GQHA 4OIIH 2N0KA 1I6VC 2Z6FA 5CGMA 2GJJA 1Z3GL 2YPVA 2AZUA 4NC1E 1IM3A 1ZT4B 4PJAA 1CFVH 2F53D 5T3XH 2HG0A 1DEEA 1FLRH 3QQNA 3LKNA 4Z7WE 1SYGA 4MDJA 3FU7B 4XP1L 3HOZH 4GLRI 3AWFA 4XOBA 2BH0A 5I6YA 3A4DA 3SQOL 4C83B 4DN3L 4C3JH 4K0OA 1G9ML 2BRRL 2JTDA 5HHNA 4AUUA 4JPIA 4OD1H 3ULUF 1X5IA 4QD2E 4MTKA 1SFOH 2JJTC 3VNYA 2E2DC 4TKOB 1SF5A 1XB8A 3PGCA 3JWNH 2CLZA 4NQEE 5T1LD 3UO1L 3H3VH 1HRJA 4E41E 1YECL 3GJFH 4JPKH 2JYOA 4H7BA 4LF7L 1L3WA 1E3ZA 4KHTL 2Y2TA 4PP1C 4YHIB 3V4VH 1FSKB 1MEXH 1Q9KA 4Q6IC 1O6VA 4AEHL 3QUZD 3BVZA 4A2LA 2W9DH 1KEGL 4NPSA 1CURA 3L3KB 4OU3A 1XEUA 2DKMA 2R29L 4ZMYA 1QR1B 4FYTA 5FK9A 1Z7TA 4GKKQ 4NCDA 4YC2B 1TOXA 4I65A 1U8MA 5I8KL 1FAIL 5FYKU 2E9WA 2HTKC 1HYRC 3OZKA 2JI3A 2DMCA 3CMGA 5IHUL 5EC1A 4K0KL 3DIDA 5CGKA 1MJUH 4HXBL 3ZVVA 1FRGL 4HIXL 2KUTA 5A35A 4XPBH 4JM4L 4WGKA 9CGTA 2VW9A 1GSKA 1OTSD 1TWCH 5GGSB 1KJ3H 4PMEA 2WNKA 4IDJH 2Y22A 2JE8A 4LSSL 2YO3A 1WBYB 3QWOB 3WTUA 4GG6E 2SNSA 2HRPH 1R4XA 4PY8I 3VI4A 4NBXB 1PJWA 5CP7B 3C46A 4ELKB 3V4VA 1S3OA 3KH3A 4PRNB 2G5UA 2AUKA 2X6BA 4D7PA 5MEQA 1TXKA 2CO2A 1V05A 2JA6H 3RX8A 1HJPA 1RODA 1KQSA 4OD3H 4HQQH 4X6CB 1A2TA 3FCGA 4XVSL 5J3HC 2D7MA 1YHBA 5M95B 1T0OA 4TF4A 3ULUL 3SHSA 3V10A 1PFCA 3M1BA 1LO3H 1PRTC 2ZTDA 3RLNA 5J56B 1JZHA 5I19H 4X62L 4CGTA 4ZOBA 1UD3A 2UZYA 5AOLA 3RQ3A 3VXSE 5IV2A 1HILA 4XC1L 4HOZA 3C9NB 4N1HB 2R2CA 4P2OA 3QJXA 2V5RA 2WN2A 4Z0XB 1OXXK 1HH6B 2X7LB 3LZLA 5I1DB 3ARBA 1Q38A 3QIUA 3G08A 4GLXA 2QGEA 2AJ3A 2RKSA 2VAAB 4HFWB 4BWUA 3TA4D 2EO7A 4GXUN 3B7RL 4NO0A 4U1NA 4B0MM 1MKHA 1YEGL 4XVUC 4DCQA 5HHQB 1JNHB 3RPIA 2KZBA 4WIQA 4DCQB 5HHQA 4G8GE 1M56B 2Z34A 4JZJC 5E2UL 2DJUA 3A74A 4B3RQ 5HDQH 5GS0L 3S8GB 5BR8Q 4C55A 2CCZA 2JA6G 3T0XA 4HGKC 3HE6A 4PMWA 2WJ7A 3L7EB 2BNUA 4IS6A 4PV8B 1D1KA 2CUHA 3K2UL 1KT2B 3KL0A 4MXQD 1AD9B 3VXRA 4K5XA 2MO1A 3ASWA 2XBZA 3EG9B 5C0JA 5IIEA 1Q94A 3NIFB 2DQIL 3ZDWA 3WDIA 2XBTA 3FRPB 2CJUH 1NC4D 4P9MH 4WJG3 3TZVC 3CZEA 1YEJH 1I1CA 4OVVA 1A6XA 1LP9B 4JZOA 5FC9A 5CMDA 3FHEA 4DEPC 2GB2A 2XVBA 3RKPA 3TM6A 1W72L 1Z9MA 2RJMA 1WGVA 4W9HC 1HKLL 1RCYA 1ANUA 5KYXA 4JBJA 1IXRA 1QHOA 4OCSL 3TO4D 5I1CH 3CZLA 4JI4Q 2AF2A 2OMVB 3JTSA 1NGQH 3GTGH 3S96B 4MTMA 4YN3A 1XBRA 5K36H 1EFWA 3VD0A 3R2IA 4PRBA 2VZVA 4WNJA 4D3CL 5KAQG 1KULA 5CHNB 4AL8C 1TS2A 3S15B 3TONA 1S7RA 4JFUA 4NKOA 2FVNA 4DGUA 4DW2H 3F84A 4LPUA 3QORA 4DJMA 4DSYA 2DS4A 4MD0A 3VXRE 4F7MA 4FQCH 1M7XA 1JJGA 2WSPA 1GGBH 3UGUA 3GSXB 3H8NA 3OJVC 1QLRA 4ZD3L 1JL8A 1EDYA 1JF6A 2XKNA 4U1KA 5D7LD 2CGZA 4WTXA 1MF2H 5HHOB 1JNJA 2F9BT 2BJML 4J3WA 5LGKA 1CUOA 2VMDA 2EVGA 2MUYA 3L3GB 3TZVB 4OI9A 2NNAB 5F6HJ 3I02B 1IEBB 2F7PA 3GTOB 5CORA 1H3PH 4UQCA 5AWNH 3VRJA 2FYYB 4U3CA 2NXYC 3STLB 5CJQL 3MRPA 2P8LA 1YLBB 5DMYA 5DDHB 3FH7A 1KLUA 2XWXA 1B9NA 2BIHA 1R5IA 3HZKA 4GAFB 5EO0A 1K8AC 2ZCLL 3KWUA 1K8DB 4U1HB 3DK2A 2ZCZA 5CWSB 3LDBC 2EH8L 3RIAF 3RVTC 3NMEA 3CMOL 4P46D 1M6UA 3IM1A 5HHOE 5IVXE 3HAEA 4MHEA 3MHZA 3F2DA 3W0WE 1WT5A 4JPIB 5IYCH 2O4XA 2VDRB 4KV6A 1LM0A 3LQZB 2ED6A 3W9EB 1ET5A 4JKKA 4JANA 3QG6A 5AAWA 1OARH 3TS0A 2CCVA 3SHLA 4A3CH 3ZE2B 2VM3A 2ZOUA 1VS0A 5CEZE 2P5WA 2IXQA 4DQOL 4PY7A 5BO1H 2UU9Q 3AS1A 3U2SB 1HH9B 4HN7A 1RIVL 2DQFB 4M43H 5KBMA 3BIKB 5E51A 3W11C 3T1WA 2FZ3A 4MDIB 4URTB 4UNIA 3RNQB 3W0WB 5GHWH 3ZTCC 4QNPE 2PTTA 4NQQA 4QRRD 5KANI 2QGQA 3VW3L 2VT0A 4M6NL 4KV5F 4KKSA 2H0FA 3U79A 1I8LC 1PSKL 3FSWA 5A2QE 1U36A 3HZMB 2P3YA 2VLLB 4HKZA 5CEYB 2IANB 1P7QD 4DNRB 4PW9A 1HR0L 2AXGB 1SN0A 3LKSB 1YC7A 4DZBB 1U95A 1WTWA 1UCBL 4QHMA 5GHWL 3FS9A 2QZ5A 3QDMD 2A6JA 4JV5Q 2BNRE 3KWWA 2EYRA 3HE7D 3QS2A 2OSLA 4JLRB 5GRJL 5L4IA 4DUVA 3CLEL 1CF8L 5EA0L 1XF2A 3VA5A 2QPFA 3S5LB 2WANA 2B63H 5CN3A 4HKXA 4NNYA 1PDQA 2YKKA 1X9NA 3TF4A 2LAGB 3AM8A 1JK9B 1GHKA 1M05A 2HFFA 4FGMA 5TE6L 1QE6A 2BOBA 2ENJA 4EOWL 4QUFA 5IREA 5JEAJ 3GBDA 4ENZA 1TTRA 3NFSL 4KJQD 2DIEA 3FUHA 4CGYB 3REWB 2QBWA 5ISZA 1BM7A 1XSOA 2OXHA 3KG5A 2OQJB 2NY7H 3BAKA 4UT9L 1QBML 2NCEA 4FF4A 5JMRA 3S1QB 1Z9OA 4MJ5B 2BE5D 1FNGB 3UDXA 3EA6A 1BQ5A 1HINH 4P2QB 1LK2B 5IEHA 5F3BA 2ZONA 2FJFA 4HJ1A 4D0DB 4MX7A 1HTYA 1M4VA 4WUKH 3RUGA 2J5WA 1RTOA 4JW3A 3IFOA 2WVVB 2BO0A 4G70B 2G75A 1ZS8B 4NJAH 2DV6A 2VISA 3ILQC 3PJSB 5I24A 5CC4A 1I8UA 4XCYB 3STZB 3LJ3A 4XT3B 1N26A 1TWAB 4WNQA 1KEGH 1E1OA 3UC0L 2VWEC 5FYJU 4Z5RB 4WI8A 5EULV 4XXWC 1YDPA 1E6OL 1UATA 3EHBC 3NSDA 5E8DL 3T3PB 1ACCA 3PABB 1TFPA 4LOEA 4YSUA 3WSQL 1CG9B 1MREH 4XRCB 3H0GB 1Q7YC 3J27A 2RCNA 2WTPA 3H2PA 4FXKA 4NEHB 4PJ9B 4J3OF 4H8WL 1SLJA 4HPYH 4FYSA 4AQ1B 3O6FA 5GGVL 3WS6A 1N32L 1PMRA 4OX9L 1JHLL 5AALA 2JK5B 3IFDA 1EO8H 4X80L 2UXCL 25C8H 2MOVA 3G5WA 4F87A 2WXHA 3COOA 3BT2H 4F2FA 3SDXE 4X4KA 3D12B 4IIQA 2D7NA 2VYRE 3HG4A 3I6LE 4FQLL 3P7JA 2I69A 3L3OB 3O11A 1C5BH 1T21A 2DQHL 2WXQA 4XNQB 5FYJH 4I18A 4AIOA 2OJEB 1UFGA 5JA9A 4MD0B 4M56A 2EDDA 4KITB 1QZHA 2W5PA 1PLGH 35C8L 3LH2L 4NPKA 2I5LX 4OUOA 3DETD 3HZ3A 3MCYA 1LNUB 1LDSA 1TZOA 3D69A 3CFNA 3H09A 1BDYA 1CYWA 2BY1A 2MWCA 3GMPA 4YH6A 2F8XC 3TV3L 2W1NA 1ERNA 2Y2WA 3KXFE 3I4MH 2HG5A 3Q1EA 3S98A 4DKTA 2K1BA 4P2OD 1BOSA 4OFYD 5IB3B 3BESR 5FW6A 3W1ZA 5CEYA 3QUYC 2A6DB 4WFHE 4AZ8A 4R4QA 2KQNA 3QUZB 4AEHH 4ETQA 2F74B 3NSWA 3AREA 2Y69B 3LNNA 3OX8B 2LXKA 4YLQT 4AJYV 1WPCA 3GT6A 1IGCL 4ODTH 1GTNA 3HKFA 4J7RA 1IBML 1C1EL 1RZGB 2JQMA 2W07A 4ZBJA 2XCMC 1GGUA 1AACA 2PPBC 4GKSA 4LMQE 5JZ7D 1U8CA 1FGUA 5HVHB 4PJEA 2GCYB 1KYOK 3UZVB 2WAQG 1XNQQ 1HKLH 1PVOA 4EIZC 1T1ZB 3FN9A 3MOBH 1BYOA 4HKJB 4UMSA 1BG9A 4X6FA 1RIHH 1CGVA 3Q8DA 3MRFB 2KZ1B 5DK3A 4N6RB 5DC0A 5C6TL 1UEAB 3T6WA 2XQYG 5J22A 3RVTD 5D2LB 5T1DL 4PBWD 1BBJB 4B9ZA 3VXUA 1A6UL 4J3TA 1NGQL 3VRLE 2OL3H 2UXVA 4GAJL 5FLMH 4JFPB 4N9TA 5G55A 3DO7A 1YEEH 5K1VA 3BKYL 3V52H 3MGAA 3K6FA 1QI5A 1S7QB 4N2FA 5F9JA 3UFIA 5DDHA 1WD1A 3FQ4A 1KCRL 3OGOE 2H8PB 2IEPA 5E4EC 1SUHA 1MIMH 3HPLA 5EUOF 2G4GA 4MD5B 3GTNA 3RX9A 2DY2A 4TS6A 1OSYA 2CQVA 3QPKA 3V4VB 5E2WL 2YU9H 1DQML 2CRZA 4CBPA 4LCWA 4P9HL 1O7DC 1X3PA 2FWLB 4Y5XB 1SYEA 2AZAA 3PNWA 1HNZQ 3MV7B 2PYKA 3MNVA 1G5AA 1JP5A 1WHOA 3C60C 3H91A 2CBTA 2B3IA 2BS8A 3P2TA 1HQ4B 2VDMH 4Q56A 4L18A 3GZOA 4PRBB 1MHWC 4YIQA 3UGXA 1P4BH 1WBXA 5I5JA 3WIHA 4C57C 4JAMA 4GKLA 1A25A 5CV5A 3O8XB 3S96A 1MIUA 3EFFA 4FVMA 1KTCA 2ZAIA 1RL1A 1L0YA 3VX0A 4XBMA 5IFHL 2VMCA 3RBGA 3TEUA 3HI6H 4PIBA 4Z8FL 1KTLA 1X5AA 2FH8A 4M5YL 4U1IA 4ZO9A 5B38G 5CLWA 5AD0A 2C34A 1OM3L 4ZQKB 2GVAA 1AI1H 5ELCA 4MLIA 1DVQA 2C9AA 5T33L 1HESA 2Y1AA 3GIVA 5I6MA 3N44B 3S16H 4JG1H 3GBNL 4KRPD 5JA8B 1BOGB 3QHTC 2R9HC 3EOAA 1ZTXH 4PV8A 1ZEQX 3TYFB 4J12A 1NCBL 2WLNA 3EFDL 3GP7A 5DYOB 5BVJB 2NY6C 1RHHA 5AUMA 2R51A 1F41A 1G9EA 5IYDH 3S1QH 2PYEE 2Z1PA 1OM3H 3RTQD 1ZVHA 1U8KA 4HKBB 3DIFB 4BGDA 1I7UB 3T2QA 5I1EL 1EA9C 5LN8A 5ESAA 1HCVA 2WB1G 1HEZA 1RI8A 3S97C 4JRXD 5E6SB 4KJYA 4MJ6A 3A55A 5A3IC 5I1DA 4A6YB 5CP3A 4JJ5B 4L9DA 1LTAD 3CVHL 3UEZA 3ICEA 1M90C 2X4SA 3CIAA 3FTUA 4NCC2 3K59A 3O9WC 1DP0A 2EDNA 3TEXA 1G7IA 3BVVA 2XETA 1PZ3A 4WHDA 1MCOH 1U21A 4LDOB 1C12A 3BP4B 1ROWA 1TQUA 1WC7A 4K7PH 2IBGA 3CCHA 3UCQA 1OGTA 4KNQA 1VGEL 1UVQA 2FO4A 4P2RA 4FF9A 1CT1D 3QNYA 5KRUA 1Q0YH 2D8KA 4XT1C 2EICA 5FECB 4JI7L 4P2CB 1JIBA 4I3GA 3AFQA 3OWEB 3L08A 4Y4FA 2JA8B 3V0VA 4K23H 1XBDA 2VR8A 2PWFA 4GP4B 2BWDA 3FB8B 4U33A 1R1CA 5K39B 1K5WA 1L2FA 1XF3B 4K5MA 2AFNA 5B1BB 5KVGH 2ZOKA 4LF5L 2L7UA 3N43B 4K8JA 2OTPA 4XNQA 1WCBB 1PV4A 3KLQA 1ADQH 1NGYB 3QUGA 1O9VA 4IIQB 2DEYX 5CINL 3SKMA 1FV1A 1JXJA 5FK9B 1WD0A 4F5CE 2YXVA 1EFID 4EGVA 1EHNA 1MQKH 2DQJH 2E27L 3KYOB 2Z64C 5D6DC 3WFDL 3V4PH 2HP4A 4PP1D 2YD9A 4V2BA 3NP8A 2AWNA 5JW4R 1G9NC 3NN8B 4KI1A 3U4EA 4WHTA 4DR3L 5AW1B 2DNCA 2XWCA 2WXMA 4PS7A 3HNVH 2ZSWB 5CM1A 2HKAA 4Y2DD 4FYDA 3O45A 1T3FA 1BEYH 1F9RA 1PH9A 3GTTA 2KCTA 4PJ8D 4B50A 5GS1A 4HVBA 2UXFA 3BQVA 5M5WH 1JWUA 2RCSL 3IGFA 2ZTEA 3BU2A 3CSYB 4M93B 3N1PC 4A2HA 3LXCA 1SNMA 3KYHC 4GOPA 2YGNA 3RUGB 3ZJYC 3U9WA 1LTTD 2AQ1A 1QSEB 3C5SB 3NCBB 4I0CC 3TXAA 4OI7A 3M7NA 5DS8A 1RZ8A 1MEXL 4UILH 3EOYG 2EXWC 4M7ZB 1PLGL 35C8H 4ZODA 4C1NI 5ICXA 1LT6D 3AXHA 3DLQR 5ITBL 1EANA 4AGOA 43C9B 3QK0A 2XZCL 5MEOA 3DHJA 4K94H 4O4YH 2OMYB 3VFGL 4P4KA 3SJVE 1HSAB 4WV1C 4QLRA 1YNJC 4IRZL 4O0AA 4GYBA 3VUAA 3BEVA 2ZCKL 5EEZA 1MI5E 4KPHH 1X3QA 5KS9A 3NZSA 2HT4D 4Z7QF 1NUCA 3GSWA 3LV3A 4OCNC 2VTFA 3RWJB 1OP4A 2ZOWA 5LQBL 1QLEH 4NQEB 1BVLB 2AXFA 3FTYA 4MB1A 3PXHA 1XH3B 3SE8H 3VFVB 3ECBB 3ZSTA 5LVEA 1GJUA 4P4RA 1BW8A 1UE7A 2ZYRA 4KV5E 5E2VH 3SJVB 1WV7T 1MG2C 1Q86C 5AYQA 4IALA 4QCIB 2UZXA 4QNPF 2WNGA 4J2XA 5I66B 4FS0A 2F4IA 1A4AA 4ZCKA 3QIWD 2GJZA 3N41B 1NIAA 3ARGA 1B3IA 2P26A 3PHQB 4OJAA 3WOVA 3VFMA 4F33A 3PO2H 3G9AB 2XG4B 2EUXA 4NHCL 3L2LA 2Q8AH 1HHGA 3BZDB 3OB0K 4IDLA 1NGWA 3IDXL 4QHUA 1T5XD 5HY9B 3FQWA 4HWEL 5E95B 2HFGH 5D55A 4S2SB 5DA0B 1EY8A 1HOCA 5EF3A 1NA8A 1X44A 3KEDA 4HEMA 1CTOA 1NAMB