4FXKC

Human complement c4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
290
structure length
290
Chain Sequence
b'APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 Beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxkC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxkC01
1BR9A 3V96A 3G6JB 2WINB 1UAPA 3T4AC 5JPMC 1PXUA 3CKIB 4LNVA 3HS0C 4D94A 1BUVT 1GXDC 5FO8B 2PN5A 2A74C 2TMPA 3FRPB 3I70A 5FOBB 5FO7B 5JPNC 3HRZC 3MA2B 1EDYA 3L3OC 2ICEC 3KLSA 4ILWA 4FXKC 4FXGC 2B39A 5FO9B 2XWJB 1OO9B 2XWBB 3OHXC 1XWEA 1D2BA 1BQQT 1BV8A 1UEAB 2WIIB 1AYOA 3CU7A 2A73B 2I07B 2J0TD 1JC7A 1JB3A 2QKIC 2E2DC
chains in the Genus database with same CATH superfamily
3VXQB 1GGIH 1CDHA 4K23L 1QLFA 2A6JA 2CXGA 4G1MA 3G4SA 4MMZB 1P84J 4NZUL 4N2KA 4RFEB 4P5SA 4X0KA 3NK9A 4YLCA 4GW5B 4M62H 3O9WB 5JXEA 5ECGA 5KSAA 4LVOC 1PYWD 1K0RA 1F4WH 5IEKA 3MBEA 2XIWA 1VADB 1GXDC 4TNVF 1G9HA 4RGMC 4FFZA 1DEDA 1TEGA 1RUPL 2AEIT 3AB0B 5C4ZA 2K6YA 2XQYA 3RWDB 1I8MB 1V43A 1BVZA 3DVNA 3MV9B 1LTLA 1JDCA 2XCMC 4UV7H 3RY6A 4F7TA 1A21A 4DNTB 4GP4B 5I75C 3ERQA 1XMQQ 2DQCH 2O72A 4U0RC 3X3FH 4AIEA 3ZZSA 3WE6A 1VCBC 3CC7A 4WI3A 3ILPB 1Y1WB 4OGXL 3T4AA 1XSIA 1JV2B 3BW9B 4K9EL 3UG3A 2FBRA 2B63G 5B1CA 4KKPA 4HJUA 1YQ2A 1TT2A 1MCBA 3ARGD 4OIBA 4F2MB 5JOFA 3L2NA 5JNYA 3OKKB 1BZEA 2LU4A 2WLKA 4XTCS 1A6AA 1CT1D 5JIKA 3ECBB 4JRYB 2RH0A 4N22A 5DJ0B 5CCHE 1OP4A 5I18L 1ILUA 1GR7A 4JFHD 3QHFL 5IG7B 2FH8A 1SHMA 3G48A 4HCEA 5FHAL 5SX5H 1LEGB 1LK3H 3I91A 5C09B 4GNXB 3P0VH 2A4EA 3QXVA 1UXMA 3A8KE 4PBDA 3MRLA 3C5ZB 3QNZB 1UWGH 4O1NA 3P9LB 1UGKA 4FQQB 4JFZL 2BCKB 2AWNA 4G6ML 3WS6C 5JVH3 3OF6A 1Q0YH 5J1AA 3KNBA 1WOCA 3RL1A 1LE9A 4HAKA 4GQ9L 4HWZB 4H5SB 4AYFA 1CR9H 3ARZA 2YQ3A 4KDVA 5AAPA 1L5GA 1G9MC 4FF4A 4KKAD 1F86A 4MJ5B 4HFUH 5D7KD 3DROB 3EYOB 4U3SA 2VB5A 4XXEA 1EA9C 5BZZA 1ET5A 2EDFA 4U6HA 4KNTA 1JV5A 1PZ5A 3O41B 1EIBA 5F8RC 4NX0A 1U3NA 2FHTA 4Z23A 4F1ZA 2A74B 3DXAA 4M6ML 4PJEF 2WSPA 3J81E 5TK4A 1PXUA 4X8CA 2GHZA 2XWBA 4UMSA 2CUHA 4GH7B 1SYVA 1HEZB 2YGOA 2NZOA 1E2WA 1WC7A 1ZJAA 4XO8A 4DR6L 1UJ3B 4CDCC 5DWUL 2QVFB 2YD0A 1VEOA 2PPEA 5C0XG 4HC1A 2CA4A 3RIAK 4PRDA 4X4YB 3FB5B 4G2AA 3O3EA 4GMSH 4KVNL 4PWHA 1F90H 2VGLM 3Q6FB 4GW1A 3THMH 2XN9B 5EZIH 2UZPA 4ZZKA 3KE0A 4C3HH 4GAFB 1Y1VH 3C5JA 1EFQA 2ZUXA 2IT1A 1ZOXA 3ZX1A 4AIMA 2HTLC 4PMCA 4BKLB 2OTWB 5FO9A 1IBMQ 3IJYA 2IV9A 3HNVH 4ODSL 5E4AA 4M8QA 4XN1A 1INQA 1U0LA 2IBZY 1BUVT 1PVHA 2UV3A 3RUGB 5L8KB 2B2WC 3QIWC 3QUZD 4FLQA 1RUKH 4GKNA 1UM5L 4OQTL 5EORH 4AQ1C 3MRNA 1UWFA 3R4RA 4CGUB 3TEYA 1G7MA 4G8AC 1F2QA 5G4MA 2W81C 5T1IA 4NKIH 1L9OA 1YNTA 3EYFB 2PNHA 1MNUL 3FTGB 4GP5B 4W4OA 2P8PB 3CVHL 4YDMA 5AWNL 3ZU8A 1EO8H 2ZUUA 3GSUA 4QJ5B 1AH1A 4YDNA 3A23A 3D2TA 5IGCA 1TO5A 3VFWA 3MLSL 4XP5L 1TS3A 1A0QL 3CPLA 3E8UL 4GXUN 1P53A 3UZVA 3QJZA 1WBXA 1NQBA 2C7UA 2IH9A 3OZKA 1QE6A 1CE1L 4KU1A 1MKFA 3IF1A 3PAVA 2I7OA 3QQ3A 4P2RB 4AGOA 5BW7C 5JZ7C 3LN4A 1BEXA 3UYRL 3TS8A 2B4CL 4BK4A 4H8QA 2VDQH 4KVCH 5C3EB 2CO7B 1USZA 5CXPA 5ELNA 2QVMA 3RYMA 3TESA 3L4ZA 3O4OC 4M43L 4N2GA 2K45A 1A9VA 4MFHA 2Z4QA 3BGMA 5HTSA 1OE2A 3NK3A 4K7PH 3FJTA 4MA7H 5EBLB 3RNQB 1KCUH 3RZDH 1KT2A 3NTCL 1HNWL 5IWLA 2GIMA 3AXLA 5F3HA 3QPXL 3ZVVA 4I0PC 5GGRY 3FMCA 2RCSL 1F41A 3QZWA 1IBDA 1CD1A 4KKZA 1W16A 3MLRH 3WJJC 5CV4A 2E7DA 1W6JA 2PCFA 2LAAA 1X9NA 1DVFC 1JN6A 3PO2G 5C0ND 3UJIL 2XKNB 5JDSA 2HQEA 3KVDD 4JBKA 3TNMA 3H4FA 2CALA 5GS2H 3IFNL 2QDLA 1Q9KB 4MAUL 5F9OL 3ND8A 3ZR6A 4D9RD 1MQKH 4N2AA 2L11A 2FSDA 1CZGA 3WDNA 2WPGA 4ONHB 3ET9F 4G8GE 5FR3A 2K4AA 2OXGA 4HKBB 3MFGB 5DRZA 2K5QA 1BWWA 5IIFA 2ESVD 2HH0H 5C0EA 4HJJL 1DL7H 2WZPD 1Y8OB 4Q56A 5F1NA 1NC2A 1H0DB 4C56B 3W1BA 1L0WA 4QEGA 1N33L 1PFNA 1LQSR 3SE0A 5EBDA 1QW9A 1T66C 1BA9A 3K5OA 3APNA 4R26H 2RD0A 1ET8A 3D25A 3BP5A 3EJYD 4G83A 1E4JA 1YC8A 5DFAA 4WV1C 4QHNA 1I8LC 3AW5A 5I6PA 5TQ0H 4EN3D 2DUDA 2ZOLA 3NA9L 2ENQA 4HCFA 2EPBA 4N2OA 5E8PB 5FAAA 3L2MA 1B4JH 4YHHQ 5A16B 4C3JH 4MCYB 1AS7A 1P6AB 2AK1L 2NQCA 5E6ZA 3PHOA 4XPBH 4DV5L 4OCRH 2A69D 3V96A 3VD3A 4I1PA 4FFVC 3PDOB 4WWKB 3AFQA 3MJ6A 4XAKD 4HJAA 3VI3B 2LSSA 43CAB 2EDBA 4WENB 4HIIB 3TVMB 3GKWL 4P9ML 3UH8A 4A2MA 5ACZB 4G8GA 1KJMB 3M86A 2FEEL 2W80C 4PBXA 1R5VB 4WEBH 2SNSA 4LHUG 3FP9A 2GKIA 4Z0XA 2F4IA 2ZCHH 3KXFD 2I85A 4WJ5B 4MMXB 1V3MA 1U93A 4WFHE 3EKCA 4X64L 4JFVA 2JI2A 3RAJH 2F8IA 3O6FB 4NDMB 1QBMH 3PL6B 5EOTB 1Y0LB 4M5ZH 3BDYH 1YLBB 5FKPA 1EGJH 4Q52A 5EOQL 4NJAL 2XIIA 1A9EB 3FTVA 3R3OA 4MB1A 1XF3A 2OZ4A 3DGCR 4OZHF 4A3GG 2IWGA 1M6OA 2B3GA 2H6UA 2CQVA 4FHJA 4KRPC 5EDXA 3UC0H 5KJ4A 3GBDA 1LWRA 3UEZA 3FXIC 4NNYB 5I30L 4OZ4A 4WJ3M 2NQ3A 1IFHH 4KUCD 3FQNB 3T2PA 1E1OA 2IOIA 3K80C 3R93A 4ME3A 3FC8A 2W07B 4Q6IA 4BBRB 2BFVL 4DGVL 3GMNB 3QGVA 4ZTPH 1IM3B 3E1ZA 1EZLA 4XX5A 4OJFL 4Y2DB 4G43A 3SPIA 3VD5A 2XSKA 1Q72H 4ZMNA 3V2TA 2OK0L 5C6TH 1I1FB 2QF7A 1QSEB 5K1NA 3PYCA 5HJDA 4N24A 1JOOA 5J9PA 4DO5A 2HVJB 4OB5H 1FHGA 4ZX4A 1QUNA 1WHPA 3S14H 2NCEA 4GKOA 4AENA 2VZOA 4LPWA 2R0LL 1WFMA 2F74A 5BQ7A 1ESRA 1BF4A 4IIQB 4LCVA 5FW6A 3CN4A 3KWVA 5I1HH 2G3XA 2K33A 1UASA 4OCYL 2XWZA 4OZGF 3GDCA 3VACA 1QBLL 1G291 1IC4H 5LXVA 2XQBL 3ETBJ 5IB5A 2VUKA 3WO4C 4TV3A 2HIVA 4JO2L 1DBJL 5MEQA 1VQMA 1Z2KA 2WXIA 3HNSH 4YY3Q 1DO6A 3OKNB 1D9KA 4TTDD 4XNZB 3VWJC 5C0CD 1U58A 5CGYD 4DP6X 1CU4L 1PZID 4RWHA 4Q97A 2HX8A 4AE0A 1A2YB 2ID5A 2RQEA 2OYPA 2WV3A 1DFBL 3HG5A 4FYTA 2IPUG 3U0TA 1QWYA 5HYSG 2F9BT 1OPGH 4R5XA 4Y5XA 2B1AL 3FB8A 4M00A 1FRGH 2NUTB 1E5YA 2MHVA 3FQYA 5FGSA 1F8TH 4CJ0A 2YD3A 5EO0A 5TD4A 4GAGH 2NYYD 3VX0A 2CH8A 4B9WA 5TDPB 4Y19B 1K4DB 1INEH 5FGBC 2OSXA 3K6SB 1KIPB 3DRTB 3E9TA 1NM9A 3JAML 2V8MA 3WXWH 4I7ZC 3C12A 4O2EB 1RURH 1MI5B 3LSOA 1IAOA 3T6ZA 4FQJH 1Y6KR 3NN8A 4DNRB 4K6DA 1L9SA 1HZAA 2VR8A 3QZMA 4AL8H 2OMVA 4OD3L 4L6TB 3MXWH 4XNMB 4B7LA 5I23A 3T0DA 1BZ7A 4MCZB 3IK2A 5DD0H 1O7DC 2J4WH 2BSDA 1FFPB 5K9QG 4UQEA 5C0XJ 1PDQA 3T04D 3U9UB 1RAMA 2GIYA 2CDEB 4ZO8A 5DK0B 1G1CA 1FVDB 2HKHH 1AFVL 1KY6A 3CRLC 1CXLA 3RKDC 3SDCA 3A55A 4ODHL 4MYPA 3RWEB 4AG4H 1NY4A 1ROWA 2E8YA 2D7MA 4JRXE 3QUKB 3SHSA 3WD5H 1PFOA 2LVCA 2YC1A 1JIBA 1O80A 4R5TA 3E3XA 4S1RH 1AANA 1ILSA 4NRZA 5CKGA 4NFCA 3R2TA 4Y9EA 4Q74A 1VSCA 1XDTT 4LL1A 3DHUA 3BHBB 3QR0A 4I3SL 4MNGE 4M5TA 4MJ4A 4FQLH 3DWQA 4BFRA 3EOAA 5BVPL 4POZC 1BBDL 4Z3HA 2F0OA 3QHZL 3TBSA 1E42A 3QXDB 3HEJA 3VWKA 1SMYC 3BQUC 3GUTB 2MHAA 3AQYA 1NCHA 2BDNL 2P47B 2VLJD 3CVCA 1FNHA 2OYLA 1BXUA 4XCCH 3PGDB 1HZHL 4OGAD 4WFFD 3HRZA 4WJWA 1UH3A 4YDJA 3P1HA 1RV6X 4MJ6B 2PMZE 1ZVSB 1YEHL 2HFGH 4G80B 1E9PA 4ALAH 1Z7JA 1J8HB 3TS2A 2Z31B 4XN5A 5DURD 3V4UL 3A54A 4I77H 2M8XA 4MASA 1JVOA 2IAMB 2NN6H 2XZCH 1ADWA 1LEIA 3BP7B 4BA2I 3OB0K 2IBZX 4GSQA 2B8FA 3L8QA 4MZRA 3MRKB 3KHQA 4B3EA 1OHZA 4E0RA 1TKWB 4LHJB 4OM0H 3M17B 1G7QB 3ESPA 1P1VA 5GGQL 3P4LA 1XO8A 4JRXA 2B5IB 5EEWA 4AE1A 5AAWC 4AYBB 4JKWA 2Y1ZA 5C3TA 3H54A 1JCKA 3MFYA 1UUSA 4MNGA 2VDNH 3HCVA 3H7LA 1CBVH 2IH1B 1PY4A 4FI7A 4XBPA 1ML0D 1Z9SB 4H0IA 3H3PL 3L16A 2DTSA 4A2DA 3C3LA 1IGJA 4JFQA 4NLAA 3HOVB 4QHLA 2QQNH 2V2WB 4NCDA 4YHKH 1ZA6B 4JG2A 2J1ZA 1FG2A 2X4PA 4IOIA 4QYAA 1MCDA 4F58L 3BKML 2X9XA 3OWFA 2UX7A 4OONA 1Q9OA 2PMZA 5BUAA 5BS0B 5K69A 2RF4A 3IKCB 3MLWL 5AL8A 3KDMA 4HXBL 4RQQA 1E3XA 2RFXA 3MVSA 5M5WB 5EN2A 4ODUA 2XG5A 5AVXB 3RWCB 5M5XB 1E65A 5E6IC 4DVBB 2MKWA 2GUOA 3BWAA 3SDAA 2XWXA 3LKNB 2J43A 2E75C 2XTJC 2Z7ZA 4JW3A 4AEFA 5IHUL 4XPAH 1SE2A 2Y5TA 5FYKH 1K83H 2NNCA 4ZMZA 1K8OA 1A62A 2CRIA 3D06A 4EXKA 1HHKA 2O4EA 3JWDH 1A4CA 1EJ8A 1G6RB 2DL9A 1JNLL 4X9BA 4ABQA 4AYID 3A67H 3B3IA 1J5EL 1NGWA 3Q01A 4K8JA 2WINB 3P30L 4U1IA 3FQWB 1FA4A 5BZDB 4DR3Q 2F3WA 4XNXH 1VQJA 1WTWA 3U2SA 1B9KA 2DY8A 2R93B 3ZRSA 2QILA 1JXDA 4R8WL 1NGPH 1NICA 1QQDB 3CCVA 2HKAA 3L3HA 5CP3H 4Q9RL 3ZR5A 4OLVH 5EC2A 1RZ8A 2G60L 5F0LB 4GRWH 3U48A 1HYSD 3S5YA 5EIIB 4PV8A 4FZEH 5DK2A 1U8LB 2UXBL 2E7HA 3FT0A 3HEIB 4ZS6C 4A39A 4Y88A 4ZMLA 2Q86B 3LQMA 2UUDH 4U7SA 2L7UA 1TOXA 2N7BA 2VSDA 4ZQKA 1HXMA 5ELFA 1OB1A 3BT2H 3O2VH 4JHAL 1PTZA 4RKBA 2VERA 4AZ8B 3TIDA 4GSRA 1WZ1L 5AKRA 4RMQA 4KOCA 3Q2CA 4LCYA 4HJGA 5CO1A 3VFOB 3MZTA 4RX4D 4WW1A 4CC1A 4KITB 1DR9A 1EO7A 1H8SA 1XR9A 3MA2B 3HC3L 1P7KB 4ZMAT 2A4CA 1JHLL 3LGJA 1C0AA 5IE8A 4G7SB 1G2SA 3C75A 3PJLA 4PD4J 3OR6A 1EEYB 2R29A 4P5KB 1X3FA 1IGFH 1AGCB 1RUAL 4ZMVA 3NTIA 4ETYA 5GGVL 1U4FA 1A6XA 3BKCL 5DUML 2BVEA 4LLQB 4PZ6A 3KR3H 1W6WA 5KSBE 1KAAA 5KVGL 3D4GA 3F5WB 4IRSB 3MRCB 1PY9A 2CBOA 3PUZA 3L9YA 5LGYA 1LWHA 3KEDA 2AQ2A 2FNWA 5C07D 2LKVA 1PLGH 3E3QE 4Y8AA 3VA5A 1YHQA 1TZHB 3MO1A 1LTXA 4HK0A 4JY5L 3PFUA 2PUQT 3SPVA 1U95B 2EE2A 1YY8A 1QJOA 1N36Q 2W92A 3QULB 4Y4FD 2ICIA 4PJ5B 1OT1A 4JFFD 4NUQA 2CXKA 4UINL 4ELME 1UEMA 1VF5C 1JWMD 1HIMH 1HE8A 1EAJA 1N9PA 1NAML 3T08A 4PCYA 1OK0A 1BCPC 3BIKB 4YDZA 5LBSA 4QLWA 2FX7L 4Y16B 2HN7A 2Q76A 4XOCA 1OAQL 3OXSA 4DR4L 3UTSD 2DKUA 4P9HC 1UD4A 3I6LE 4Z95H 4QTIH 4R4NC 1UM4H 2QEJA 1TLKA 2K9UA 1GZPA 2QV2A 3FUHA 3IWUA 5KSBA 1E30A 4G7QB 2VXQA 1OF2B 1IBGH 4LVNC 4DPRA 1ZK5A 4FRWA 4JKPH 4NRXA 3FQUB 4UT7L 3G71A 1NOAA 4PRPE 1KTLB 3GTPB 4X83A 2LW3A 2COVD 2VRQA 3L95A 3PAUA 4Z3TA 3D51A 3TREA 4HIDA 1GGUA 3EHBC 3KD4A 4KMQA 4FHBD 2NSMA 2XVSA 3GTGB 1BQ5A 1KRTA 4XVTH 3IMUA 2WBJC 4G8EB 4RISL 4ELMA 2VISB 4UMGA 3H6AA 4JHWL 4PNYA 4QJ3B 1T5WA 3UEQA 3F12A 1J9RA 3CHOA 1SQ2N 4GIPD 2OJEB 2BVTA 1U6AL 4NXMQ 3FQRA 1NFDE 2H4EA 4NM4H 3MHBA 1NBZA 4JPVH 4NN7C 3EGDB 3V0FA 1T2JA 2LR4A 5F7WC 2RAMA 1FR3A 5IMOB 4I7AA 2MNAA 1B0RB 4M8AA 1HQRD 3KL5A 4PJCE 4B5EA 1EXHA 1WTPA 4WDIA 4OF8A 4X5LA 1VQ7A 1UUPA 3EIFA 3V0WL 1W9XA 2ATPB 2IAND 3WN6A 1OT4A 1XBDA 4PW9A 4JPBW 5HDQH 1S7VB 2DBLH 4PRPA 3D18A 4RGOS 4YHML 1IT9H 4LSTH 3QDMB 3GC3A 4G6KL 1R0AL 4D9QE 2DIAA 3IB4A 3OOCA 3DX4A 1G6ZA 2ZZUT 1ZT7A 3F7LA 4QHUA 4RDQG 3SY6A 5IJKC 3CH8A 1OAJA 3C09C 5MHSE 2F58L 1RDPD 2WV6D 1HL8A 2O5JC 1YEWA 3MRFA 5GGVY 2NY4B 4QXGL 1R3LB 5GZNC 1U8KB 1WTRA 3HC0B 4TVSa 2UYLA 3NK4A 4YOKA 3G6JB 1VZHA 1OGAD 1TQBB 4JN1H 1VS0A 5TFSL 3GTKB 1NFDA 3S98A 3PCOB 4JBWA 5KN5A 1XGQB 4PRAB 2XN2A 4LF9Q 1OTSD 1TZIB 2X4RA 1BGXL 3RGVA 3NEEA 5I82A 4ULLA 3VFTB 2UZXB 5DTFA 2VABA 3B5HA 4A3KB 5I6YA 2IOMA 3T0EB 3B9KB 4C4KO 4OLYL 1KGUA 1C5BH 2FIKB 1I8IA 1WS8A 2DS4A 1D2BA 2A77L 4PWFA 4WK0B 2J5LB 1G7LA 2VSMB 4Q0XL 2I5YL 3MBXH 3OW7A 4B7IA 4GUCA 2H0PA 2XWTA 3ARUA 3EFFB 3KPRE 4DFHA 3DIVA 2FZ3B 1NCNA 4EE2A 3MACH 4ZMOA 4K9EC 2NY2C 3UPRB 5JEAG 3IM1A 1E43A 1V05A 1UTDA 3UFIA 4PVNA 1XIWD 4P57A 5CMAA 1J9OA 4K71B 4QO1A 4PTUA 1NBYA 3SN6N 5F6IC 2QQKL 3KF8A 2IWKA 1E5AA 4DERA 5CSGA 2BOCB 5E9DE 2VXTH 4ODXA 4KJYA 3ZHFA 1KLFA 3HE7B 2FEEI 2R0ZL 3RBGA 3MXUA 4DV6Q 2ZXEB 4NJ9L 3ZK0A 4HOZA 1RP9A 2DPKA 2O5XL 5IM7B 2PTTB 4NENB 1CDJA 3K0YA 1FSKC 2FGZA 4Y5YB 2DDQL 2KHIA 1AZVA 2XIBA 4HU8A 1YECH 2AVGA 4KD4A 1TWCB 4F9LA 3L54A 4ZX6A 2KCMA 2RACA 1G1YA 2X44D 4XZ4A 4NO3A 3CFCH 3OHMB 1GOZA 4X6BB 3K1KC 3KPRA 3D39E 3HVDA 4NQEB 4PBWD 5FB8A 4J15A 2R27A 3OMZA 2IH3B 1X5KA 1MCOH 3MNZB 1NC4D 4C4KT 2AK4D 4NW2A 5HGBA 1H6UA 1JXKA 3ARFD 1T89A 3VQLA 1SFOB 3FFOA 2WXFA 2ZSVA 1AS6A 1HX0A 2COQA 2WXLA 2R1YB 3CVDA 3MTRA 5J6HA 1OP9A 3V6OE 1E9OA 1I3RA 3CVIL 5E9DA 2P5WE 1JE4A 1K8IB 1QTYT 4U2ZA 4OV5A 5ELOA 4L5FH 4HKJA 2N55A 2Z91B 2H8PA 2NX5D 3CIQA 1E24A 4IK6A 2EY1A 1F4YL 3HE6C 2JK5B 4L5RC 2X87A 4HQQL 4XP9H 2YA2A 5A2IH 3SKJL 1MSPA 3QDJD 1G6PA 4U1MA 3ARGC 1YJDH 3GHBH 5DGQA 3OB0H 2V5RA 1PKQE 4P3CH 1U8HB 1AD0A 3DM3A 3GIVB 2CW0D 3RUZA 1C4QA 2OMTA 3U50C 1G9NL 1KTBA 4G82A 4DR2Q 2ALYB 3BEWB 1IGIL 3MXPA 1BVLA 2VE6A 3NCMA 1OSPL 2AV1A 4FFYH 3D39A 4L4JA 2Q8BH 5I9QC 3HGBA 1C8QA 2Y0SB 1M9SA 4FDBA 3K59A 1Q86C 2VQ4A 3EJPA 1JJGA 5TPWL 1ZLDA 4OKVA 4U1SA 3FO1B 3EQLC 1GOGA 3QWOB 4JI6L 4HUUB 4I5BB 4DZBA 1V10A 5AUMB 1T1WA 5LMNQ 2G3NA 1JDDA 2Y36H 4HLZG 4Y1AD 4FXKC 4YHNA 2YAEA 5DJYA 1KN4L 5I8CB 2EE9A 5DHMC 3V6OA 4EVNB 3VU2A 1KG0B 2P5WA 3FO9A 3MLTA 5KYYA 4KKAC 3SE4A 2E8ZA 4GKSA 1ICTA 2VXVL 1KGIA 3CX5J 3HI1B 3CK0L 1ZHKA 1L9PA 1H8LA 3IDIA 4IJ3B 4RWYH 2GSIA 2AERT 3D09A 3OAUH 3QRGH 4ZUUB 3F2CA 1NKOA 1BD2B 3OKYA 1G5AA 2DQTL 1PNDA 2WVTA 3PLYA 4G3YL 1NR4A 3OQRA 3S1MH 1RZFH 1PKQA 2B4CC 4P46A 4PJXF 1HH6B 3LPWA 3WL9B 1B88A 5GSVA 3CXHK 4YDVA 4DXGA 3NOIA 4MXQD 4PW3A 2A99A 4KI0A 5DVKA 2YN3A 1HWHB 1HHHB 2ZAHA 4I65A 1UXSA 3UDFA 3TDQA 2AQ1A 4HWUA 1D5XC 4AEIL 5IIEA 3ETSA 1N12A 1TO4A 4JLRB 4BSVA 2O5ZL 3NABH 2X9YA 4TRPL 1UXLA 3QVAA 4M1CD 4N6RA 4OD1H 4PYGA 1E4XI 4XGZB 3ZZQA 3MA9H 4QDGA 2KUMA 1A7PH 4OFPA 1EYAA 3ZE1E 4UQ2A 1T20A 4J39A 1IM9D 5D2LB 1JZ5A 3HUJF 3FPPA 4OF0A 3BN9C 3LZRA 5I8KH 5J11B 1B9MA 2B2VC 2ED7A 4HHWA 4PS4L 4B0MB 3HMWL 3EO9H 5FIEA 1CQYA 5LHY1 3G5VA 4GS7B 4OJYA 5CS7A 7FABL 1ODUA 1DUYA 1P7HL 1LD9B 2WKOF 3LRSA 3NFPA 3V9FA 1E8WA 1LYLA 5D1ZB 3ZT6A 3VW3L 2J12B 1V7NH 2PLTA 4IGBA 1FYTE 1SVBA 3EFDL 4IOFC 4AEHL 4XWGH 3QUMH 2DH3A 3BS1A 3QS2A 2OF1A 1D6VH 1G0XA 3CLEL 4XP6H 1CKNB 2DI8A 1XXFC 3BOVA 4FJZA 1G87A 3FU7B 1MCPL 4PJBF 3U0PB 1FZKA 2XFXA 5JPNB 3EVQA 5KJ7E 2BWQA 4FNRA 4ONGL 5JPMA 3CQZB 1PZUB 3GFUA 5DHVA 2JEBI 3H9SB 4N5ED 2K28A 1JXJA 2EDNA 1LYQA 3S24A 1J5CA 4X62L 1XQ4A 1BFOA 4ABVA 4H88H 4M7JH 2VN5A 3GMLB 3RVUD 3N1QC 2R2HB 3ULVD 5E4WC 2CH4A 4RLDA 1HE7A 2JA5H 2KPNA 4KHTL 5T3ZE 3NSWA 1PH1A 1A7OL 3ABMB 2KQNA 2NDGA 3PIOA 4XI5C 5DD5H 5IW3A 4CDEC 5T1KA 4KDTA 3HFML 5EOCH 4ZK8A 2I07B 4MXWL 2XWDA 1XPUA 3WEAA 1NAPA 4LHUB 2O30A 4PS3A 4R90H 4PWIA 1FYTA 1QLEB 2AJVL 2P24A 1R9FA 1JP5A 3F04A 4S10A 2OQJA 2BOSA 1EXUA 3VQMA 2ZJSH 3GI8H 4ETQB 3KGUA 1VKXB 1SXTA 4HBQA 5L4MA 4KPHL 1BCPF 1QG3A 3QIBA 5CD5D 5KVDE 2WLZA 2ADGB 2WWKT 2FWLB 5C0NC 4J2XA 5D70H 1S7SB 5IP7H 4TLTA 5T3XL 4A3GB 1NDMA 1UEYA 2PNDA 4NUGH 4ZW6A 5A2JH 1R75A 1E27B 2CUIA 1I1AC 5KSAD 5JXED 4LCIH 3HBGA 1XH1A 3RZCC 1UVQB 4DTGL 5I1DA 4IFDI 2PW1B 1B70B 3GBML 3OX8B 2IADA 4Z3FA 2B16A 2B2XL 2OL3A 1MHHB 1GJXA 4PZ8A 2J2ZA 1Q9WA 3QQ4A 3F65A 2RSOA 3D0VA 2UUAL 1TR7A 2WXRA 3CX2A 3N0AA 3CFBB 3QDGB 3U0WH 4N85A 5FKAB 3FKUS 2RSNA 4DAVA 5KRUA 5L8LB 4HS8L 3I4NB 4M5YH 3K7UC 4CADA 1XJVA 3HA0A 3FFDB 3MCKA 2WKGA 5IZ7A 2NVQB 4G6FD 2L04A 4JBJA 1QZNA 2ZWNA 2JXMB 3WNOA 1VHPA 1ZYRC 4G7ZC 1JZGA 3UDWC 3NACH 3KPNB 4EN3C 1K6QL 3RX7A 4ZUJA 5H1SE 1PJ9A 3DV6A 3NIGE 3AREA 4BH7A 4F2FA 3O8XA 2I9LB 3B7TA 4NGHL 4JE0A 5DJXB 3DX9B 5T5FH 3B7UX 1YEKL 4EQ5A 1F4HA 4OI8A 1UH4A 1IFGA 2E76C 1YVCA 4X4XB 4Y5VC 4D9LL 2BVQA 4L8JA 3N42F 3TEXA 1OF0A 4ORGB 1OLLA 3QIUA 4QTHB 4OLZH 5AKSA 3LX0A 2UWEF 1GUSA 1OHQA 4FI6A 2XPGB 3N04A 3OF6D 1N59B 3TZVC 4IIZA 3HB3D 5C2UB 1JMZA 3IAQA 3V95A 4YSPA 3U6XA 4QT5A 1Z3GL 1J0JA 2DEWX 2H2PC 2XBZA 4UQ3B 5TF0A 3WFEH 3IGKA 4G5ZL 2VKWA 2F0QA 5HGDA 4B9GA 5CHNA 1BDOA 5BOPA 1LO5D 4LNVA 1PRTD 1UE7A 2EILB 1BG1A 3GSNB 4EKJA 2WAQB 3P7JA 3HBZA 3L7EB 2K50A 3X12A 1N4XL 4PRNB 1NLDH 3D4CA 4XE5B 4HPOL 2O26U 1WTOA 3W0WB 1G7PA 1U21A 3MRBB 4X6CE 3VCLB 3MMEB 5E1AB 1NCAL 3KPPA 1MJEA 1KTJA 4KHZA 4LCUA 3TLRA 4B96A 2EIEA 2PO4A 2P3YA 3VXOB 1CDUA 4FQHB 4MXVF 3RWJB 1VQGA 2CJUH 3Q8BA 2E7LA 2D8KA 1X6NA 3ATDA 2XGTA 2HT4D 3BAEL 5DJ6A 3QXTA 2APBA 3NSJA 4WLCA 4TUOA 5I6LA 2VC2H 3DX6B 5KOMC 2HCZX 1MQ8A 4G8IB 4YNYB 4WWOA 1JUFB 2H47C 2J8OA 1HHVA 2G5BA 3SD2A 4LAQL 2ITDB 4J3UA 3I75A 2ZTDA 5M3FB 2JKLA 1UB6B 1MFAL 3MXVL 3C6SB 5AW3B 3JZYA 4IMLB 4LFHD 3HKFA 1V1PA 3IL8A 1AIFB 3RHWK 4L5TA 1KPVB 4KK8C 4NN5B 5HGHB 3WBDA 2EYRB 4AKOA 2GEEA 3MREA 3MRJA 3CC5B 3LPFA 4NNXB 4O9HL 3ULVH 2Z1CA 3BU2A 1AR1C 1YNKL 2GC4C 5E8DL 3QK0A 4NO0A 4P73A 3DKHA 2Q7YB 5ANMB 4OCSH 2E2JB 1T2QH 3F7VB 3OJDB 4X6CA 4DNLA 3IFPB 1LEKB 2HDMA 2OX5B 2PYEE 2GUYA 2CIIB 1ES0A 3Q8FA 4L8CA 1STBA 3VA6A 1IIIA 1OWWA 4PMEA 1PFBA 1ZGLP 3DWAA 4LIQE 1VESA 3CFEB 4OCXL 4PB9H 1Y8PB 4PB0L 1JPFA 2VQTA 2CR6A 2EDYA 2X7LA 2ZCKH 1P84K 3D2UB 1I31A 2DQEH 3ALXA 3OLEA 1IE5A 4N0FA 5DI8A 3VXME 1QSZA 4W4NA 2NYYC 2VLLB 2B77A 1KBKA 5GRUL 2LE9A 2DRUA 1MW1A 4DAMA 3HZYB 5GRYA 4BZYA 5EPLA 4F8OA 3QEUB 2G9HA 4WF7A 3S97C 1EAPB 1VERA 3UYPB 4B97A 5IKCA 1HHJB 3QH3B 4V11A 3V8CA 2JKTM 3M9BA 1WLHA 1UKTA 1CM9A 1AD9A 4ILWA 4OSUL 3HC4L 1DDTA 4HC1L 2FCBA 5CEXB 1TTUA 2J8UB 4FFZH 5C92A 2BHYA 2EEAA 1R3KB 4HMEA 5HYJE 3D12B 1HXYB 4YC2C 1CDGA 2CDFA 3QFDA 2PXYB 1X5HA 1UD6A 2AXGA 2PYEA 1RHHB 3KM1A 3TT1L 1JK9B 4LKCA 1EEFD 2W88A 1P4UA 1BBJB 1U91A 3BO8B 3BSZA 3E0JA 2CK2A 2KLSA 1M2VB 4FQXA 1UWEL 3VXMA 2R56H 3WKMH 3MC0A 3INOA 3P11H 4JY6A 4KJNA 1UOKA 4PD4K 4XNYL 4IRZL 4P2OA 1CZ8L 4BA0A 5BO1L 1NC2D 3FW6A 3FONA 4N26A 2CJ3A 1RZIB 1HFGA 2EJGC 3Q43A 4ZYSA 1XYIA 1C1EL 1E4KA 3D0LA 2I60H 4OGAC 4RRPM 1J1XH 1PTOB 2A73B 1K5NB 3SDXF 5EBWA 3DRQA 2IGTA 5NUCA 3LHAA 1U3HC 3NBHB 1YZ6A 1DLFH 3RVVC 1DQQA 1XAKA 3FHWA 4FXGB 5IK3B 4XWOD 3TN0A 1D1IA 3MXNB 1AACA 3CZJA 2QADB 5ENWB 4LMQE 2Z6BA 3T2NH 5HYJA 2E7CA 4PJHE 1QZ1A 5C7ZA 4J1UB 3ZHDA 4YDKH 8PAZA 2ZSWB 3DTXB 2X88A 4NBYB 1KYFA 3R06A 4X99A 4UNUA 5DJDA 4F92B 5IMMA 4R2GD 2OP4L 3EYUL 3WFBH 4WFN3 5I1AA 3CPFA 3QJTB 3S1RB 3W11D 4AY0A 2CJTA 2NY0D 1ADQL 1GRWA 1RVFL 3GSQA 1HQ4B 4G8GD 1Q38A 3PGCA 4JHZA 1WWBX 2WO2B 2JQOA 1GGIL 2W5PA 1I7TA 5CIPH 2GJZA 2VZSA 1PJWA 1Q90A 4JPIA 4M62L 3GO1H 5E5MB 3HKZB 1YIJA 1F4WL 3NCFB 5DVMA 1V7ML 3Q8DA 5IYDH 3HAEG 1DCEA 3SO5A 3REVA 3K71A 1DJZA 5CJ5A 1S72A 3OIPA 2OTUA 2IJ0A 5E08L 2X4QA 1KJVA 1S9WB 2YXFA 3UDIA 4ZAIA 5C8JB 4WWID 5EZOL 5FGCB 4UV7L 4MLIA 1S5FD 2DQHH 4ZMWA 4OGYL 4G59C 3NGBB 1XEUA 3QJYA 4Z7VF 1G7JA 2BP8B 2DQCL 4PJHA 2DMCA 1VEMA 4M61B 3M4QA 5ICZB 3J81j 3IDYB 1MW3A 2YD7A 3S48A 4F2ME 1CLOL 2OFQA 4LLVA 1MH5B 4FG6C 1YHPA 1MWAA 2PNRC 1S7UB 4LVHC 2Q2LA 4GSUA 4MWFB 4H8WH 4OLUH 4RAVB 4CVZB 4WW2A 4Z7OB 4ZX3A 4GUPB 4JI2L 2VXSH 4BHUI 2R4SL 3TP8A 4RFEA 4E9WA 4PIBA 1A0IA 3IPBA 3OLGA 4PRIB 4MJIE 4GW5A 5J6SA 3RTQC 3O9WA 3NIDB 5C09E 1HS6A 2V0AA 4WFHD 1LK3L 2EVJA 3D1MC 2V17H 1HH9B 1YJWA 3CFKA 1KPRA 1UWGL 2K3HA 4OL7A 4X6AH 2GFBA 4L23A 3RWDA 3V5DA 1T1XA 1EAQA 1ASOA 2EH8L 4QGYA 1F4XH 1CR9L 1BQRA 4NZJA 2VXWA 3P3YA 1KZYA 1D9KD 3U36B 1AO7E 3IRBA 1OSZB 3M1BB 4PYHA 4TL5A 1QFWI 5EEUA 3IKJA 3DX8A 1S9XB 4J6IA 1S7TB 1YUHA 1PIFA 1WYJA 3EW3B 2YWYA 4GFXA 3VVWA 1X9UA 1JV2A 3BW9A 4A66A 4X80L 4YLQT 2F0JA 4N0UE 4NQXA 5E8OA 5FHBL 4AIZB 2A6HC 2J6EA 4F2MA 1WFNA 4HDIB 1BX2B 2GB2A 4ISVA 3BZKA 3PCYA 4PJEE 3TEWA 3GBNL 2A6ED 3PF4A 1K2DA 3CMEA 2Y7QB 2OZ4L 4HWEH 3BH8B 4UT6A 4LPYA 4ZOEA 3ECBA 4N8FA 4LF6Q 2D7QA 3NJVA 5JOPE 3I4MH 2VL5A 2BVOB 3CKIB 3FHAA 4MJIA 4ZYKB 1SM3L 3MJWA 4FF2A 1AGDB 2YOCA 4AH2B 4EDWH 4YCUA 5C09A 4GNXA 3IDMA 2FJGA 3FUEA 4WEUD 4L1HA 1Q1BA 3C5ZA 4B3TQ 5JW3L 3F2BA 3J80i 3S35H 3VNZA 3RJQB 2F1BA 3VFPA 2EDTA 4HWZA 3S9WA 2XWJB 5HVWA 5EZIL 3SDYH 2WXNA 3T3MF 2H4OA 3FYEB 4GRLA 1N32L 3IXTB 4AV4A 1XGUA 3I90A 1AO7A 5EB9A 2J57A 1I5FA 4M6OL 1RIUL 1FLTX 5ALBH 3EYOA 2ODIA 5ID0B 2D2OA 3F6IA 2AXFA 5C0IA 4FQIL 3SDCD 3HNVL 3US1A 1XEDA 3NZUA 2NVTB 3K5LA 2RJMA 4N0UA 2MCPL 3OTOL 4JI0Q 2EH7L 4OTXL 2R69H 4ZUSB 1OGPA 1CZWA 2CBTA 1RUKL 4PJEA 2W65A 4NPYB 3OKMA 3EJRA 2NNAA 3AMUA 4NKIL 1M05B 4UTAA 5DM73 3QZOA 1A9BB 5IT9c 2C3XA 1EO8L 1EVTC 1AZNA 1PDKB 2P46B 5LGHL 1CT8A 3S3PA 2J6WA 4W9EC 3VWKD 4L1SA 1G84A 2FX8H 2CVRA 1P5UC 5T1GA 4BBRH 3H15A 1P4IH 2XBDA 4HU2A 2VLRE 1DSFH 1BDYA 2DM2A 1C08B 3TX4A 4GAYA 4UDUC 2C1PA 1ET7A 3RX8A 3WS3B 5I0VA 5FLVA 1KFAL 1NIDA 2VDLL 2YQGA 3ER0A 2NY6B 1K8MA 4XX1G 1TY2A 2MTAA 1M9WA 2GSMB 4A93G 1MF2H 4TNEA 3SGDI 3BEVA 2KCTA 3VGEA 2UX6A 4I88A 5ILTH 1I7ZA 3ZDXF 3EGSB 1ZLUK 1NZRA 2Y7SA 3BVZA 4Y2NA 5DVPA 4U6TA 2EUWA 1B3IA 3GJFB 5JLZB 5CCKH 4JRXD 1QSVA 4ACPA 4APXB 1URIA 1VQEA 2KHAA 3F00A 1TWGB 4UY8C 1PQZB 2JE8A 1A3QA 1IXRA 1DJSA 2BZ7A 3MLRL 3KEHA 3Q13A 4HCIA 3FTGA 2NY3B 4KUCF 1H6EA 2FQFA 3PP4L 1FO0B 1U8CB 5C4JB 4XPTH 1MI2A 4JE4B 4K0KQ 1NANI 3AFPA 2Q2IA 2ADIA 5CSZA 5DA0B 5I17B 1I3QB 2NTSA 3RFRA 1J5OH 1BFSA 3N6YA 3RP1A 4UAOB 4L9LA 5MERA 2VLRA 3ECVA 2XV2A 5B1KA 4W9FC 1IGTA 2Y07H 4TVUA 1GMIA 1CYXA 2JA6H 5J89A 4JKMA 3C60B 4UV4H 1E5UI 1DL7L 4LDCA 3VXSB 1WP6A 3SDAD 4CMHC 4PJ7F 5B3JF 5L9DH 1N0LA 4PS8A 4Z5RB 3AWEA 1I53A 3GMPA 1PHJA 1AXIB 4YSOA 1VGKB 3VMPA 4JZJC 1F56A 2EYOA 4PJ9B 5HGQA 3BRFA 1WCBB 4HG4J 4HPYH 4BGLA 1RTNA 3M7FB 3UTQB 2QSCH 3ZQ9A 1EUUA 2ZOKB 1OARL 1I6HB 3H9ZA 2M1KA 4R7DA 4G6AD 2DMKA 5A2AA 5CFAA 3IE4A 4RSYA 2WIIB 2E86A 1L3NA 5HYEA 1WAEA 5IV2B 4LOFA 4LOEA 4NPYA 4XPBL 2VZ1A 4OCRL 3W1GA 1FE8L 4FEMA 3VI3E 4P74A 1DJYA 1U8OB 2DLFL 4PJDB 5L2KB 1LLAA 3N0PB 2HKFH 2QKSA 1KDJA 4KY5A 4ZNCD 1UUNA 4N1EA 5FO8B 1I4PA 4HKBA 2H32A 2TMPA 4WEBL 3RX5A 1OW0C 1AC6A 1E28B 3LKRA 2DI7A 4HWBH 1KIQA 5L0QB 3S1NB 2BSBA 3P0GB 2EADA 4HUCA 1XIWC 3QJXA 1O6SB 3LZFH 4PIRF 5I1KL 1FL5B 3RIFF 4FLSA 1XGTA 2DYSB 3RAJL 4TULH 1HTYA 4UM9B 1QBML 2BSSA 3QOJA 4GBXD 1G9NC 3V4VB 1QA9A 3BDYL 3VSQA 1EGJL 1NIFA 2YHGA 2WUBL 3ESUF 4XZUA 1NBVL 2ENJA 4AQYL 3CCUA 4BK5C 3OD3A 1SN2A 4D8PB 4PG2C 1T7YA 1TIID 3H91A 2UU9L 2ZX8A 3BZDA 5E8PA 5EZJB 3UC0L 2VTFA 4QXUL 5BOJA 5A16A 4OGQC 3W57A 1VIWA 2K1MA 1N5AB 2HZHA 4Q58C 1NIBA 3GSVB 3OKOB 1MXDA 1U8JB 2EDEA 3VI3A 5E6UB 1RQ5A 3TH4T 4G1EB 3CV5A 2XA8L 5IMLB 3VDBA 1S5HB 4WU7B 3KH4A 1R5VA 3NSXA 2Q6WA 1IU1A 2NXZD 2VDRH 4HUNB 1E9QA 1EDHA 4POFA 1FZJA 1M4KA 3AC0A 3D7PA 3FOLB 3U25A 2N3SA 3SK8A 1UA6H 5I1KH 5C0DB 1WWCA 4NKOB 4OZGE 1OAXH 1MIMH 3AMLA 3RZWA 4AQAB 2L4OA 3ARFC 4KZ0A 1OM3H 3PL6A 1S9KC 5TJWK 1E90A 5KOVC 2AJSH 4XYOA 2HYMA 2DEXX 4HUKB 3PXJA 4EI5B 4H2CA 2JJTC 3BVVA 3S17H 3VFSB 3MRDB 3PIO3 1RI8A 3HNSL 3APFA 2L5TA 4FNQA 2QSTA 1VFMA 4NNYA 1D5ZA 3T65B 4XO3A 4WJKB 1UC6A 2TRHA 3H2QA 4PJAB 4BFFA 5M5XH 2DQ6A 4Y4HA 1HWGB 2Y06H 4KC3B 4O2CA 5GJSH 4J3OH 2XOTA 3RJOA 1FN4B 2YAMA 2WVVB 3LMJL 1OPGL 5I8OL 1I1FA 1UACH 4HZLB 3QYCA 2Z4IA 2HMID 1H3XA 1SEBB 1G6RH 2VUMG 1AXSB 4HTHA 4GAGL 2Z64C 4JCVE 1QFHA 3U1PA 1UWVA 4QCLA 1ITBB 3B5GA 4XP4H 4YGAB 4OZGA 5G3LD 5I1JL 5ICUA 3CFJB 1MI5E 3WXWL 5CLYA 1X6OA 1WZMA 1RURL 4KJWD 5EF3A 3W5MA 4OUOA 3POCA 2QFPA 4FQJL 1CFBA 3D3VB 1KEGL 3SDZA 4AL8L 4KV6A 1ZANH 3UO8B 5C97A 1RP8A 3B1TA 3UGUA 1KBGH 4UT9H 4XMUA 3KF6B 1KGXA 4NQTA 5JOEA 2BP5M 4O5LH 1EMTH 3K8KA 4XYQA 4OX9L 5DD0L 1A4BA 1NPNA 3MUZ1 2FLRT 4FQ2H 4KO6A 4ATTA 3I6LD 4PH8A 3MRQB 1A2YA 4UQDA 3D4RA 5INDB 4XBEL 4X0NA 4DP1X 1JNJA 3PF2A 2CMRH 3WY1A 5KAQF 4J27A 4LLWA 4FL4C 4M1GL 4JREB 4GO9A 5DS1A 3SQBB 4U33A 4YZWA 1BZOA 2NY1B 1ZRUA 4DK6A 4WZ9A 1AE2A 4RMTA 4S1RL 1XL4A 1MJ8H 4PRPD 1R17A 2B2YC 4HX1B 3S8GB 5KJRH 4PMBA 2DYPA 4JM2C 3DRTA 1J05B 4FQLL 2ARJQ 4Y7MA 3FSVA 2ZQKA 1W0VB 4KQ3H 1MI5A 1JD7A 4PWJA 1OPOA 2X69A 4RGMA 2Y6SD 2YLKA 2XDHA 1IC5H 4XCCL 3ESOA 4IPGA 1PCXA 4ALAL 1D5IL 2NVXB 4MCZA 1T5XB 3FT3A 4ZPVB 1DQKA 2F53B 3FQ1A 2CWRA 3ULUL 4OWWB 5I0ZA 5MP6L 2CDEA 2XZCL 2ZG3A 2FSEB 3J7HA 3L5IA 1J48A 3RGVD 1OWRM 3K2MC 5I73C 4UQ9A 2Z9HA 4EQ3A 3C6LC 1M7DB 4OM0L 3ZE0F 5K9OB 2EEXA 3BZFA 5F7DB 4AV0A 2YS4A 3A0JA 1WH0A 5HHXH 1Z47A 2HG0A 1I6VC 1B8AA 1TPXC 5A6MA 4LF3B 1L1OA 3ARBC 3EN2A 4AYBE 1MSHA 1WAPA 4B3ML 2IWFA 2WXHA 5COYA 4YAQB 1A5FH 3BZ5A 5T33H 1IZ6A 1FAKT 3BHBA 1W0WB 2AKWB 3JV5A 2G9DA 3TONA 3CZNA 1N10A 4PHZA 5C0BE 4D9QD 5C0JA 1PX8A 1BQHG 1NL0H 3GDBA 5DUBA 4PZ7A 1XB3A 1FPTL 2WB1B 1ZIAA 3WYRA 1WDAA 4KFMA 4UILH 2NPLX 1TWAB 1H9JA 2QQNL 5MHSD 4YHKL 1LO0L 3T51B 4JG9A 1QD0A 3WS6A 4M9OA 3QI9C 5AD0B 1ZVSA 2WQVA 3IPFA 5CINH 4PV1C 1JZEA 4ZI8A 3I2CL 2Z31A 2NR6C 2CGZA 4RNRB 3CXCA 2IAMA 2DKSA 4G4KA 1VDZA 1EYGA 3BUQA 3ONAB 3GMMA 3PHAA 2AQ3B 4P3DA 4CVXB 3M17A 4K5WA 1G7QA 5KYUA 3SE6A 5L4JA 1U0QA 1V3JA 5DGRA 1JICA 3GXTA 5FYKL 1FZOB 1LVEA 3VJ6B 1QASA 2BDOA 5CD5C 1OY3B 1C7SA 3G9VA 4LSPH 1RJLB 1TJIH 4AYBA 4LLYB 2OMWB 3CHRA 3GLDA 5AFWA 1IKNC 4OWTB 3KPRD 5JXEC 1F2YA 1REIA 3AQQA 1NGYB 1UA3A 3KLDA 4MDJA 4TSBL 5C0BA 3RVXD 1Z9SA 1L9TA 1PL3A 1A02N 4U1LA 1EY5A 3P1VA 2R7ZG 2ADJB 3F3HA 4BFKA 3H3VH 3E0EA 3BYYA 5ADPL 4U49A 4KX7A 4FTVE 3RU8L 3G5YA 2IPUK 3WUZA 4CBPA 3S34H 4MDIB 4YJZL 2VXQH 5GAHC 1HK6A 2CQOA 2WAHA 1MCJA 3CZLA 5BN5A 3Q1SH 3CZSA 5T5NF 1XSJA 3SCMB 2PZUA 1T0PB 1YVLA 4F8PA 4U68A 3P0YL 4G9FB 5LO7A 1BEYH 3RDTB 3NJMA 1WGOA 3T4AC 3O2VL 1OAUH 5IHHA 3SPGA 3BD4A 1IZJA 2BNQE 3PF5A 4A3DG 3UADA 3CRKC 1RL1A 1PLAA 3KBFA 5HPMA 2J7LA 2B2WA 1ZLUH 1S7XB 5IFHH 5CCJA 4IHOB 4AQ1A 3ETTA 5CWSA 4LAAA 1PZAA 5F7HA 1BREA 1L0XA 4B9CA 4L0PB 4I4WB 2C1OB 5SWSB 4YIQA 1IBKL 1CGSL 5L2JB 4OZIF 5BZDA 3HI6H 3D39D 5J4MA 1E0OB 1E8XA 2ICCA 4LCCC 4YXKH 2W0LA 2KDGA 1SHSA 2ZX9A 2Y5QA 3IRCA 4LLDA 3KR3L 5IB1A 4BD4A 4YHYC 5ADOH 1YEZA 1EHKB 1QQDA 2QVTA 4OLEA 2HJLB 1B2WL 4FTVA 1SY6H 3HB3C 4S0SD 2XACC 3RPIA 3TPUB 1KTDA 4WTXA 1WE5A 5DSCB 4DUZL 1K9MC 3KPSE 3ZTDC 4G7YH 3II1A 2UXFA 1U8LA 3FTWA 3MV7E 4F27A 3H0GG 2P5WD 5KVFE 3STLA 1RJTA 1PLGL 1X9RA 3QZNA 32C2B 4BINA 5IB4B 1H5BC 5JUEH 1IBHA 2B63H 3WV0A 3ZL1A 1CHQD 2HFFB 2G3MA 2J4XA 4MCMA 4S1QH 1KB9J 2EYSB 4ZPTA 5L6YL 1U8MB 1R33A 1HIML 1M90C 2BNQA 3FBKA 4D3CH 3VFOA 2BW4A 5FF6B 1JJUA 3U4KA 1R4QB 3WNNA 5FV1L 2DQGL 2OM5A 5LB1A 4P46D 2A9DA 1G0YR 4O02B 3QIWB 2A0LD 1V54B 1QHQA 3WJJA 4IOSA 1EEYA 5D3DA 3PUCA 4LLUB 4IUNA 3WIHH 1DVFA 5FUOH 4N20A 5BRZE 1BOGB 3MLVH 4QCIB 1R3HB 5DLLA 2LS01 2OXPA 4YIJA 1SF3A 3D07A 3MYZA 5FECB 3V05A 2P9RA 3MNMA 2LXJA 1U41A 4IU2B 4ANVA 4BFOA 2H9GB 1X7SA 4LSQH 2YMOA 4Z7WF 4KXBA 1IBGL 1OM9A 1MFDH 4JKPL 2EYJA 3TO2A 1CYGA 1LK2A 2V2TB 3B9AA 4A3MG 1QTPA 3PGZA 3EJIA 5AYUH 3KPSA 3MLXH 4IK7A 1B53A 1FHNA 3VFUB 3MV7A 5DRNB 2ZG1A 1TFPA 1BKBA 3FOMB 1XH2A 2MOQA 2IGLA 5GHWH 4EZLA 4ZW5A 4IUUA 1FZMA 1H9VA 3HLAB 5A2QE 5B7EA 4UZSA 4N2BA 1MCRA 4D0DB 2D31B 1U2YA 4Z3IA 1AKJB 3DUUB 4UP8A 3EO0B 4WSJA 1SFOH 4QAMB 2AKRB 3H42H 3X14A 4ZUWA 1I8LA 3VXTB 3AEVA 4W4OC 2JTYA 2Q8AH 2YTVA 2B59A 2MNWA 4BQ6A 5C0XH 2UXCL 2F52A 1A4JB 3J7YW 5BRZA 1IW7D 4X7FC 5J1TC 4DV5Q 3PDGA 4E68A 2PW2A 5FX3A 2UUBL 2EKSB 4FN0A 1OF2A 4BH8B 4OIJA 1G1OA 2OCEA 1IAKA 1CKMA 3I3CA 1H9SA 1STHA 1KJ3H 3K72B 4JHVA 4QRPE 3D3RA 5INCA 5ABDE 5C0AE 3PUYA 1WSST 2DBLL 3OPZL 3FSWA 3NSYA 3QDME 5T1KD 1S5IH 1TETH 4LSTL 5LGKA 4X64Q 4A3JG 4X7DC 1L6XA 3DGGB 3RFZB 4LZKA 4G8EA 3TO4B 4YK4C 1FYTD 2OMBA 3HOUB 3PDDA 4LEOB 3QNYB 3ZSSA 5IGEA 4OZFB 2OJEA 4X9GA 2HRPH 1KPUA 4XXDB 1KNEA 3HAEB 3QIBD 3U4EA 4JN1L 5K5YA 1T7WA 1ZEAL 1X9QA 3EGDA 4L2YA 5LL6X 5KUMA 1IKFH 1KDBA 3KLSX 2BZDA 2DLTA 1V1OA 5D5MB 5FYLE 1OD7A 4DO6A 4KAQH 1I7RA 4HH8A 2JJSC 4TVPH 2YPKB 5K33A 3T0EE 4LEBA 1KENH 1QUQA 1RPUA 3OHXC 1C5BL 2JYOA 2QTVA 1BO0A 4XPGL 4QRPA 1S7VA 5T3ZD 3DO4A 3MRGA 2FJFB 3P4NB 5C0AA 5CZKA 3MBXL 2SEBB 3EOBB 3JAMc 3QDMA 1TTAA 3GSXA 4MA1B 5DJAA 4RA8A 3KL3A 4PLNC 4WUUE 2ENYA 2MH4A 4KRLB 2DWSA 4K73A 3JYBA 5HHOB 2KLTA 1MVUB 1IL1A 5IESH 2O61A 1DOMA 1L0YA 2DYRB 4EF3A 2WBKA 3CX5K 1YNLL 3PO2H 4ZUVB 4BA8A 1AQHA 3AQZA 3MTSA 3UO1H 4PP2B 1FGUA 5IW1A 2B39A 1A7NH 3ABGA 3ARED 5LAXB 3O8XD 4Y2OB 2DM7A 1O7DE 4PRAA 3VWJA 2IXQB 4X7SH 3ZZLA 1DJWA 3GB7B 3A21A 5E56A 2X1PA 3BUIA 5D8JL 3HMXH 2HFEB 3VFTA 4I48B 3QIUD 2BNRB 3RKPA 3W11C 4HIKA 3H94A 3BWZA 3K5SA 2EC9T 4ZXBD 3T0EA 1B90A 5J1ZA 1YECL 2NY0C 2QHRH 2FIKA 4I0CC 4A37A 5LCVA 4NP4L 4IKJA 5TDNA 1EYCA 1D6EB 3EOTL 1ENAA 1SDAB 3NA4A 4GKJL 1AQKL 1KXVA 4J6HA 5I1GL 2Y3NA 2FZ3A 5DJCB 4FNUA 4AMWA 4WUUA 4HCRA 4WO4B 3NWTA 5DHDA 1S2EA 5BXFB 1YY9D 3PRZA 3FPUB 2E46A 5IUSA 3TYFB 2FMMA 2QLVB 2HT1A 25C8H 3K7AB 1NOLA 3K4AA 3LEXB 2YUZA 3MRMA 3ZE2B 3MX0A 3PP3K 2EDDA 3HE7A 4BQ9A 4L5FL 2Y9RT 4A6YB 2CR0A 3R7QA 2GTWA 5IM7A 1ZHLA 1D5MC 2PTTA 2EJFC 3BLKA 4XMZA 5DVOA 5IOPB 1K85A 4JI5Q 5B1BB 3LEVH 4XRCB 3J7AV 1TZAA 2VMFA 2OR7A 3E6HB 3V0VB 2W9DH 3MEFA 3GHBL 1QLEH 1CE6A 1SQMA 1JWSA 4WUKL 2EVIA 4P3CL 5H35B 3VGHA 2OBGA 4AYSA 4P2YA 1KY7A 1EHXA 3DHJA 2HHHL 3BKYH 4X6BA 5DD3H 5KYXB 5LXGL 1RIHL 3WKYA 2CSPA 5D1XB 5A1AA 4QRTB 2EUZA 4LF7Q 5E9NA 5SX4H 5J13B 1S4ZA 2BH8A 1BLNA 4TNVK 3QO0B 4BY1G 5I9OA 4A3GH 4QRFA 4K5OA 1A1NB 5EKIA 2JLLA 3BQUA 5I1IL 4QUFA 1RZPA 2Y36L 5CEZH 1MCQA 5TGBB 4A2FA 4F33A 3ROOB 1OO9B 1K8IA 1I1CA 1LQBC 3Q23A 1I4HA 3CDYA 2X3AA 4NO0D 5J56B 3GSOA 3LKOB 4JPSA 3H4HA 4N8VA 1Q81C 4OU3A 3QC6X 4RWYL 3OAUL 4M7LT 2BIOA 3QRGL 3BZEA 4ZFFB 4Y5XC 3DIDA 4PJXE 1WA0X 5CJQH 2A6EC 1T2XA 2DWYA 3GIVA 3TV3L 5C70A 1H9RA 1NFIB 2OXHB 1E6JH 3QA3A 1MELA 2APSA 2UY6A 4R7VA 5IVXB 4R7LA 2FHCA 1KABA 3VFGH 4A7UA 3K5NA 3DV4B 1SLWA 4GO6B 1H6TA 2BIPA 4HP5A 4R4BB 1XZ0A 4GUQA 2G9HD 4MHEA 4MNQE 1QI3A 3WENA 1RODA 3MV8E 4L8DA 3NABL 5ID1B 4I5BA 4U1JB 2QGQA 3N85H 3WEMA 2YXMA 1HNXQ 1SBSL 3QXWA 1A7PL 1ORSA 3RTLA 5I8CA 4GQQA 3HZKB 1YEFL 4CSSA 1UOVA 2GY7B 2TSAA 5I8KL 3ABZA 4L4VB 1HC1A 3P75A 1F4AA 1SUJA 2A4ZA 2HP4A 3DMMB 3G5XA 4M29A 1XGYH 4OCLC 1I9IL 4PJ6A 5D7LE 3EO9L 1HCZA 3VXUB 4HVBA 2WXPA 5C5LA 1PH3A 1N26A 2AF2A 2DBJA 3HI1A 4ZOAA 5E6IA 2ZXGA 4M8RA 1DANT 5TDOA 4N0YH 1U8QA 3QISA 5E2WH 2PYED 4YEEA 3QWNA 1V7NL 3TWCL 5F7NC 3WFHA 3H2PA 1I4FA 1TVXA 3COOA 4KHPL 2K5NA 2WZ0A 4PJXA 4RBPK 4ZRGA 3BXNA 4Q6KA 4XMVA 4QY8B 4NMZA 1J5EQ 1KCRH 1TCRB 3QW9A 4KQ0A 1EHNA 4I85A 1M1XB 3VXMD 1DJIA 3QEQE 1T04B 3H9SE 3O6MH 3AMKA 5KVDH 1IEHA 4ZQ3A 2QMKA 3PWUA 1SE4A 4P2OD 2E8GA 3VXRB 1N0XH 3EUDA 3VWKC 4AQEA 2D73A 4MNQA 3ZO9A 3MV8A 4H88L 1HZ9A 1TS2A 4M7JL 5AB9A 2XLLA 2V2TA 3HRZC 4GXUM 4YXLH 3SKUD 2QKIB 5M7QA 3MBWB 3BPNB 4PGEB 5HHNB 4JM4H 4QRQA 3TN0D 1E4WL 1ACZA 5EOCL 3BRGC 5D7LA 1I50H 1KYDA 3JUYA 5D4HA 2V37A 5HYJD 4NN6B 5D1ZA 1KB5L 2VR7A 1A14L 1WFTA 5AOKA 4QRUA 1TEYA 4QHMA 2ERJC 1R3IH 3UAFA 3FKIB 4IRJC 2ZYIA 1N68A 4OBRA 3HG1B 1PD1A 1JMXA 2RDGA 3O3BA 3OKDB 1OP5K 4J3TA 2X5PA 1LTBD 4NUJB 4ZFOL 2YPLB 3ARTA 4IFDG 4QLRA 4ABNA 1GSMA 1H3PH 3WKPA 4LCWB 3QEQA 3JVFC 5LN4A 5JHLL 5D2NC 4WHTB 3H9SA 5D70L 2BIHA 5JW4M 2JA8G 2GT9A 3I3BA 3GMLA 4LCIL 1JI2A 5IOKA 2E2DC 1NBQA 1O0VA 4K8RD 1BM3H 1V8HA 15C8H 4K9JA 1G8ZD 3U4AA 1LTGD 2ENBA 3BDCA 4JY4A 3QHTC 5JHMA 4ME5A 5EUOF 4HSPA 1NCBL 1N18A 5ALCL 4LMQD 3SDAC 3AU1A 5DRWB 1BF2A 1RMFH 2VDOL 2OSYA 4H8PA 2VQEQ 1U8NA 3FT2B 5HXMA 1Y6MR 4W9CC 1I8UA 1ND0A 3G6AB 5DEGA 3KPOB 3O0LA 4PV9B 3TCLB 2YARA 2ZXDA 3A5ZB 3CCHA 4IJHA 3WJLC 5D4JA 3BAJA 3FO2B 5DRXB 4E6IA 1R6VA 4PJBB 4G6AC 2WSKA 4DR4Q 2CCZA 2ADGA 2K05A 3WY3A 1T6VN 1G6VK 1QVOA 1YNTF 4XNAA 4LQFH 5K1VA 1HJBC 1FFQA 1JZJA 4I9WE 2DM4A 3UDXA 3O9WD 2UWEE 1WTXA 4JZNA 5FC9A 4P4KB 4XN9A 4OLZL 3RY4A 2E5EA 4C2MB 4IBTA 1A7RL 3D9AL 1BAWA 2ADYA 4HIMA 3MV9D 5FWQA 2R0WH 1CL7H 4RMRA 3TXAA 2DAVA 2Y2TA 1WISA 3DDFA 4XN8A 1AMXA 5ES4B 5C0XI 5KAQG 3LCYA 3QFJB 3PIQA 1F9SA 4GG6F 4GBXC 3K2UH 4KO7A 1KBWA 1HESA 1GXEA 3BD5A 5AZEL 5I6WA 2WBJA 5IF0B 2C5CA 3SJVB 2E6QA 2NZ1A 3N1MC 2DL2A 3CCJA 2WAQE 4PBVC 5HHVH 3VTAA 5A40E 1RIPA 3QNXB 5E99L 1PTOH 4HN7A 1QLRB 2AC0A 2PP7A 3NUKA 5EKLA 2I9LA 4C47A 1NLDL 4OFIA 2RKSA 3W0WE 2DWDA 3BGFB 1IE4A 2AJZB 3NRQA 4K94H 1KCSH 2O1AA 2JKWA 3ZZ1A 1OE1A 2LHAA 3NCCB 3CDZA 4MJID 4BE5A 4AL8C 2UWEA 1UOLA 2EO7A 5C09D 1M3IA 3FSOA 3Q7JA 1KELH 4QNPF 3TNNA 2Q1EA 2FR4B 3C5ZD 3DX7B 4ES9A 2XC8A 1RK0B 2XPGA 2FGWH 3KLAA 5IFAH 2F2HA 1CFMA 4NSKB 2X41A 2VC2L 4GG8B 2EXWD 4XTRD 2NXZC 4LIQH 1IUZA 1CLYH 4JDEA 3SDDB 3T53B 2YUXA 3VYSA 3BSZH 1Y7VA 1JD9A 4XB8A 5DEFB 4HS3B 4ODBD 4GRLD 4PHXA 3SKOA 4FA8A 4GJTB 3BSHA 4BDVA 2K70A 1IL2A 1AO7D 1SYSB 3WFZA 4C54A 5F1KC 4MQ7A 3B2VL 5IJKA 4QIWB 2VLKE 1KAWA 2OCJA 3OM3B 3IXAB 3FL7A 3VFMB 4PU2A 3ARDB 4A3IG 3HS0B 2WAQA 1B7YB 5GZNA 2H2SC 3SE8H 1CQVA 1LLRD 1KXTA 2PO6C 5IOCA 4XMPL 4GNKB 1IKMA 3B9EA 3LNNA 3DUHA 1DZ1A 3DJTA 3W0WA 1T2QL 2QEJC 5I4DA 1G4RA 1RUMH 5JOPD 3PWJA 5F88B 1PZJD 1FL6B 3OG6B 2Z8RA 4LOUD 4KROD 3TFKC 5DMYA 3U83A 3RWJA 2CIKB 4PJGF 1NEZG 1C5CL 1DN0A 3DTUB 3GMQB 3P3SA 4ALAC 1CI3M 5CBEB 2YPVL 2YQBA 5B4MD 1JORA 4MNOA 2LTQB 3KGTA 3MFFB 1AZPA 2WNKA 4GOSA 1A2TA 1M57B 4KI5D 4PB9L 3ULUC 2ZCKL 4TQUS 1DVYA 4G8IA 5J0BA 1O7IA 2J6EL 1MVYA 4J28A 3QB7C 3OC8A 4H1LG 4TQHA 1A1MB 1N64H 3FQTB 5HD8C 1FNGB 4IMLA 3GLEA 4AITA 5BVJB 5ABAA 4RAUA 4BS9A 4ANXA 2MOGA 1GO3E 1KV3A 4KY1H 4K7FB 4KJWC 4MD4A 5D4IA 2VLKA 4CILA 3GPSA 2FQGA 4EO5A 2YMTA 4DGIH 1YITA 1GAFL 4HA1A 5F0PB 1JERA 1U8PA 4DNIA 3CC5A 3L5WA 3KJOA 1BQHB 5I2IA 2F19H 3KL0A 3MCLH 3ZDYF 1HEJC 2Q7YA 4CKBA 2DB8A 3HC2A 3F7VA 2CLZB 1VZIA 4FQCL 4FABH 1I4QA 5I28A 2ARJB 4WJ4A 3S5LA 5AB1A 4NWUL 5GGRA 2CIIA 3TV3H 1Q94B 2L1BA 1MLBA 3CSYA 3ISRA 5IT2H 5E4EC 4QOKB 4PQXA 3WMQA 1PLBA 4G9DB 3IMRA 3LXUX 3VRIA 4OELB 5EU5A 3D2UA 5T5NG 4R3SB 3N50A 2VLRD 1J8RA 2G5DA 1FVEA 3WKML 1T3FB 3DOSA 2I69A 3PV0A 3DK0A 3QRLA 1FNAA 3L3OC 1T22A 2OR9L 1F6AB 4ZMQA 4XOBA 4PJFB 2YXWA 3VD4A 5BPPA 3REWA 1EAPA 4A2HA 4JJ5A 2WTOA 3EYVB 5DMJB 4BUHA 5DZAA 1S78D 2Y6SC 4UTAL 3WG7B 4LBAA 3SDXE 4P4RA 4EDXB 4JBSA 5BZWA 1Q0EA 3QAZB 4NZTL 5IJBC 3V5KA 2ZT9C 5C3LD 1DLFL 3SOBH 2YEQA 4NZRH 3H0TB 5E7FA 2R7ZB 2YBRA 1AYRA 2CA3A 1AGBB 2JA9A 3S4SB 3N41F 2ZUQB 1DONA 3HE6A 3NP8A 1TEFA 2A19A 3KYMB 4WI7A 2F0DA 1JK9A 2E4FA 3PNRB 3NDYE 4B3VA 3KCPB 4QJFA 3WFBL 3DO7A 1RLBA 2YR3A 4X98A 2NVTH 2GVBA 1D5RA 3ZTCC 3GKZA 2L0DA 2CLVA 2VDQB 1RF2D 1QOHA 2OV0A 1SJEB 4HCSA 2H1PH 3M85A 1QACA 2FJSA 5KNDA 3T1HL 1LNUA 2J25A 4MHHI 3OYYA 4R83A 4Z7UB 5CILH 2FYYA 2HVBA 4LARH 1PH7A 1GUTA 4U31A 3CIAA 5CKAA 1PYWB 3MI6A 4HOMA 1NGXA 1F3DJ 1MUJB 3GO1L 4C56D 1ZEQX 4BFEA 5BV7L 3RZDB 4IFDJ 3SDXA 2A73A 1A63A 4OQTA 3TF4A 3WLWD 3TBTA 1JE6A 5LUMA 4LWCA 4FXKA 4LSVH 3ZY7A 1BVKA 4AI7A 1QP1A 2MWCA 4AT6B 3CVHA 1UE1A 1YEDA 1IAII 3KYOA 3WXVL 5ENWA 1YQVH 1L6ZA 4I18B 3H56A 4XT3B 2YK1L 2ATAA 4KHXH 4J1UA 3E38A 4Y4KB 1N70A 1K8DA 2QDWA 2GJJA 4JI3L 3NP4A 2R92G 3LXAA 3K6IA 2HG5B 2RHQB 3MJ9H 1UE6A 4F9LC 4IDJH 1EOVA 3C5SB 5HDLA 2BP0B 4OLUL 2A1WL 4RRPG 1ZKOA 1TFHA 5AVWB 1R24B 5JEAH 4H8WL 4JKNA 1HQ4A 2XTIA 3FULA 3P20A 5DLMH 4L1TA 4EVOA 3TCLA 4RBPH 5GISH 3RVXC 1UM6L 4TSAH 5DEJA 3NIDE 1BFVH 1AP0A 5E5MA 4G7HC 4JVZA 3TJHD 1D5XA 1FO0H 1MHEB 5C4JH 1L3WA 1ASZA 3KLLA 4I2XE 2OMZA 5F2FA 3BSGA 2V17L 4PG9A 4X2UA 3PL6D 2KHSA 3MXGA 1IBBA 1DVSA 2ORBH 3QORB 5IHZB 2D4DA 3MRIB 2Y23A 3G3LA 1S9WA 1F4XL 1IEBB 1ORQB 3C2AH 2B2VA 2YV5A 2N3JA 4C3JB 1UZGA 1WTLA 1XGPB 2ED6A 3MV01 4Q2ZA 4Y9BA 4R9WA 4GOPB 4HD5A 2QA4A 2XZQL 4HJ9A 4YUEH 4A3MB 2BP8A 3VB8A 1GUNA 2JE6I 1ZVNA 2H3NB 3L7ZC 3L3DA 4DP0X 3F64A 2YD9A 2ZXBA 2I24N 5GGSA 1PGRB 4X6DB 2H1EA 4KRNA 4Y4HD 2NY5H 2W0KA 4HEPG 3ZW3A 3M45A 2P52A 5AB2A 4R96B 4RAVA 4CVZA 3OAZK 1BVOA 1UURA 4GUPA 4ZSOE 1AZZC 2X70A 2BERA 5ESQB 5HY9A 1Q82C 1OP5H 3MGTA 3O6LH 5DUPL 4FADA 3UE1A 2X4TA 1U8IB 2VAJA 5C0FA 4X62Q 4EDWL 2ZYHA 1NJ9A 2AANA 2JB5H 3KGSA 4IBVA 1EEQA 1HH9A 1RFDH 3HOGA 5K36G 2R7DA 4I2XA 4P0DA 4HUXB 1WICA 2A7BA 1UFUA 2V9RA 3S35L 2Z92B 1SOKA 3T3ME 3IFLL 1W72H 1RUQH 1J88A 1FGBD 4PTTA 3SDYL 4UZGA 1LACA 3FHQA 1KIRA 3TMEA 3SE4C 1D2OA 1NUCA 2HLFD 4WK2B 3H2WA 2GQHA 1E8ZA 2H0EA 1LMKA 2YGPA 4NO5A 4HYTB 4XVSL 3U36A 5DLQE 4F9PC 4TQPA 1B0GB 1GYAA 1SN8A 1VCIA 4Z7VB 3NZ8A 3TIEA 1S7TA 3S1NH 2CBQA 2IV8A 35C8H 3P3TA 4BYHA 4HG4K 5GIRA 2CO2A 2ZXQA 3IBEA 2V4LA 2Y69B 1NKGA 3QDHA 4P46C 5DQJB 4AM0Q 4EBQH 2VITB 3PU7A 4FYQA 4HXAH 2R69L 3QUZB 1LILA 2A0LC 3Q3GB 5B8CB 5DC2A 4OIIH 3BH8A 4IYKA 4ZSOA 2V2XA 2PI2E 1KXQE 3JWNE 3AY2A 2BVOA 1INDH 3TBBA 2WLYA 3Q5OA 4NT6B 4HLZH 1AGDA 2DYPD 3NCJH 1NFKA 3NH7L 3IDGB 2WC7A 4K3HA 3RJDA 2YEZB 4HULB 3QEHA 1I1AA 2GJRA 3EBAA 5I6XC 5DA4A 1ZDQA 2XETA 3G04B 5FM8A 1MI5D 3IJEB 4GEIA 2DOCA 2FX8L 1TENA 1P4IL 1UQSA 2ITCA 2OKMA 3PY9A 3RZCA 2E9BA 4Y2LA 2BH0A 1KYOJ 3FS9A 2DQMA 2UUAQ 4DV4L 2J7ZA 3NPSC 2LFNA 1FORH 2WZPA 4KNUA 1MF2L 3L4TA 1SYGA 2QSVA 5ID0A 1W91A 1U4LA 4DKDC 5ILTL 3EDFA 3MYJB 1YZZA 3K7UA 5DQDH 3VFVB 5JIMA 2FIRT 4LPCA 4CU8A 1IEAB 4LRNH 2ZCLH 4QKTA 3DX1A 2PR4H 3DETC 3UDWA 4ZUSA 2Q3XA 3TP6A 4KD3A 1PU0A 1YUKB 3FUKA 1EV2E 1YYCA 1HA6A 1P1ZB 1S7QB 3X3NA 1EIHA 2HCCA 2JA7G 2G2NA 2JK8A 1DM0B 2EIZB 2PI2A 1CL7I 1TJGH 1KXQA 3CZGA 4GLRI 5EEXA 2P4AB 3O13A 1PZSA 1A7BA 1DE4B 2R23B 3MLZL 2A6DA 4Y5VA 2F3IA 5CD3A 1N5YH 5HPOA 1B4LA 1OTUC 2BNUB 3IEAA 3FO0H 5F7EH 2OEOA 2CO6B 4ONFL 4BWGB 1TNNA 2R2BA 1J5OL 1KDAA 4FQ1L 3HPJB 4HOXA 2KENA 1JZ2A 1TZGH 3I9GH 3ZL2A 2JI3A 3TZVA 3A6CH 2MO1A 5AQ0A 5HBBA 7PAZA 1BQLH 1NBCA 2Z31D 5FOBA 2GTZB 3LJ3A 2ESVB 2IAMD 2BMKA 3GD1C 4X6EA 4UIKL 2ZOWA 1T6BX 2EYFA 1IQDB 1T0NB 2J21A 3C8DA 3V7MA 4UZUA 3ESMA 4ODVH 4PJ7E 5B3JE 5F96H 2L7JA 2B1HH 4B9YA 3FCTB 2AQNA 4KUZH 5E3FA 3CFUA 4YPGA 4F7MB 3GJFA 4BFBD 1C7YA 4DW2H 3H6MA 5FK9B 3WEOA 2YWZA 4HPYL 4MAYC 2ATKB 2QSCL 3BP4B 1LM8V 5IVZB 4MMYB 1EY0A 1M8AA 2BOBA 1KIUA 1U8CA 1BQQT 4OCWH 5IWAL 2EDLA 1NDGA 5I17A 5C0BD 1TR5A 4O58L 3IDXH 2F0TA 3CWGA 1HHGA 5L2KE 3K81C 1KJ2H 4PJDE 4GW4B 2A6KB 5KIXA 1WF5A 1Q0XH 4KTGA 2HKFL 4CDDC 3Q6GH 5H4YA 1CPUA 1F13A 2QSQA 4KXZI 3ULUF 3BUDA 1DQDH 3KFUA 4K55A 1IQWH 1RKRA 4FX5A 4JI4L 1I3UA 4NKDA 4PR5A 3BIAX 6PCYA 5G3LF 1GIGL 4XBGB 4ACTA 5B7FA 1B4RA 4PJ7A 4KO5A 3S96B 5ACLA 4JB9L 3NT0A 1HYRC 2VZAA 5AG9A 1VGKA 4ZFGH 4PUBH 4DJMA 4DQOH 1VF7A 3ARYA 3LZLA 1YAZA 4BY1B 2A68C 3AREC 3O8XC 1CD0A 4NZDA 3UTQA 1CFTB 2HJKB 4D0BB 4A75A 2NNXA 3D6WA 4MZ9A 2VDNB 4CNIA 3MJ8A 1GHFH 2ICWA 4EIBA 2VS1A 1Y18A 3NSCA 2HPTA 4K3DL 4YO0A 2EZ0C 4ZXBC 5IV2A 2YUVA 2XQYG 1PFMA 1CUKA 1F00I 2O5NA 2WSDA 3V0GA 1U8OA 5L2KA 4PJDA 4RFNB 1CXKA 3OWEA 4FTVD 3SOTA 4NM8H 3P4OB 1RZJH 4M3JA 1KC5H 4LGSB 3O3DA 1VACB 5CGTA 1J9TA 4PW4A 1FFOB 5GS1A 3L17A 1ETZA 2ICEB 2JCCE 1FL5A 2C34A 3LX9A 4MNHA 2YFOA 2LLNA 1K83B 1OAXL 1MIML 1QOKA 4LMQI 4UM9A 3A8IE 4GQRA 5ELIA 2Z93A 3VFNA 3CP0A 2AJSL 2F4VL 3DDGA 2BNQD 1TWAH 4YHIB 1EQRA 3RMHA 5H37A 2Q8RE 1CGYA 3A22A 1BCIA 4S2SB 1ZSDB 5I66B 4L4TE 1JPTL 4FG2A 5C0CB 3SGKA 3VD2A 4QL5A 3T2QA 1DVFD 4P75A 3X3MA 3QUXB 2XWCA 4L8BA 2WYZA 4KLKA 1M7IB 1G9EA 4R0LB 2E7LC 4OM1L 1U8JA 3T1WA 1F3JB 4PJCF 4U1GC 2IX0A 3K6NA 4P5TC 4QXTB 2ED9A 2V7NA 4CBZA 2WMPA 3MOAH 1UJTA 1RZGB 1TVHB 2VZUA 1H15A 3EJZD 5CCGE 4C4UA 2CG9X 1UACL 4N86A 1CFSB 4XCEB 3NZHH 4G42B 3SO3C 1HOCA 1DP0A 3K1DA 4JFXB 1G6RL 3KPSD 4O51B 3FTXA 3NQKA 4A2GA 3MV7D 2JIXA 4HV8B 1U42A 4NQQA 4TUJA 4AIOA 4LGPB 3SR1A 2GCYB 3E9IA 2JCCA 1CN4A 3GXNA 2KYIA 4WHCA 5IROA 4XP4L 3GMOB 4UDTB 1BF8A 1HI6A 4TN9A 4DZ8B 5DZVA 3EJJX 3L4VA 2VZ3A 1OAYH 3ECWA 4W70A 5GS0D 1P0SE 1L7TH 1DXMA 1U3HA 3QXUA 1ZANL 1WFOA 1KBGL 1A6PA 1EQQA 2I26N 1SDYA 1KCVH 1YEGL 3L4XA 5GRJH 3QYMA 4L4TA 5KVGE 3HZVB 2AI0H 4ES8A 4YDLB 4WWPA 5DHYB 3TBWB 3GTLH 5F6HI 1SXBA 5BRZD 3RDJA 3ZYJA 1G9MH 3MRHB 5K9KB 2YD6A 4PY8I 5KG9A 2CMRL 1HR0L 2QDVA 1UG9A 2WVVA 4E5XB 4R4FH 3D33A 3HOXG 1QWHA 4Q89A 3U6RB 5M3MG 1CVSC 1YMME 4FNLL 3EBEA 3OL2A 4LFHG 3AUWB 4JR9L 2OMYA 2DLGA 3V9CA 3BP6B 4QF1B 4ZFZB 1AXSA 3BQVA 1UHVA 1OGTA 3JSSA 2FB4L 2JLPA 1XTLA 3VR3A 3D69A 3DA0A 4KQ3L 4PY7B 1QW8A 2VLJB 2HRGA 4IQZA 2WOBA 3ZDZF 5C71A 1G4MA 1ET6A 1IC5L 4UTBL 2JA8B 4JO8A 4U6VL 3LD8B 2ZWYA 1DQMH 1JZDC 3U30B 4TNFA 4A04A 4LJZC 4JUSA 3MAQA 5DURB 1MGSA 1VMPA 2JKRM 4N2NA 1DD2A 4B50A 1V8QA 1XMOL 3F7YA 4RGNC 4WWNA 1XB6A 4ZAKC 2E27L 4JBMA 3LRGA 5INDA 4YWGL 3EJSA 4L8SB 1QYGH 2CLRB 3E8VA 4X5QA 5IMKB 1QABA 4EOWH 1TLMA 3KPQB 4R4CA 3ATAA 2B1OA 3FMGH 1AHKA 5GAEC 5D93B 5LNDA 3OGCB 1YMMA 5GS0L 4QRPD 2F7PA 1F02I 1FBIH 2JVUA 4JMNA 5CLWA 5C0AD 4MVBC 4KXDA 4O02H 1MIEL 3ES6B 1JPGA 3QDMD 2N88A 2OSLB 4KY6A 1DZ0A 3RTQA 1J05A 3OAZH 1EJOH 1NAMA 5D7EA 4KN4C 3DURA 4C3IG 1NIAA 1CGWA 4JK1C 1T0OA 1NL0L 1MJUH 1W0VA 2J56A 3BPLC 4HS6B 5F44A 1FWXA 1GC1H 1QATA 4Z1PA 3WOEA 1RJYA 3QZWG 4XC1H 3L1EA 1QR1A 2UVEA 4QYOB 1SFDA 4OIFA 2ZAGA 3TN0C 2VN6A 4JFSA 2FJUB 2ZKYA 2B8GA 1T5XA 4JI7L 1KB9K 3QCVL 1DSWA 3BVXA 4ZPVA 5EC1B 1AIZA 5I6NA 3ESVF 5E1HB 1J0HA 2LVEA 2V9UA 3OAWA 1OCCB 4ESKA 5FYLD 5CR3A 4KFZC 1NCDH 1DBAL 3N1FC 4ZS7H 1WBZA 5I71C 2VN3A 2IQAB 3L3IA 5DZLA 3V6FA 3P40A 3T0ED 4DKEL 3TF7C 4WU5A 5AOMA 3BUPA 5IBUG 3II3A 4MQXC 1GW6A 1IIKA 2C9SA 1TJIL 5IBTL 4FEIA 4YAQA 3KJ4B 4PMFA 5HDBF 3T4YA 4E42A 3EXLA 1CHPD 1JGIA 1GUGA 1WVZA 43C9B 1DDHA 1MHCB 4R8IA 4MA3B 4J2QA 4WUUD 3A3YB 1T0MB 1J8IA 1QFOA 1UD5A 1TQCC 3P9MB 1GY1A 3O4LE 4P59H 3P73B 1HHIB 1EHLH 1N8ZA 2OTLA 4HHAA 5DO2C 2Y4SA 1BXTA 2MEJB 4JI8Q 5AD0A 3TGXA 2BS9A 2R2EA 1NEZA 2F0HA 3W3AA 3S34L 4LSUH 3HHRB 1N32Q 2VXUL 3ERSX 1IGML 3STZB 4K5MA 3HE7D 5L7XH 3N43F 4HJIA 5B3NA 2NSQA 5D9SB 1SLJA 3HHSB 5ELBA 1JNNH 1CFQB 2X3CA 2AQ3A 4IKLA 4N8UA 3NJNA 1Z0NA 3EH1A 3S7GA 2D3LA 3UCQA 5F1IA 1DLHA 3F7RA 4GXVH 1BXAA 3RKDD 3ZE0B 3K8MA 3ZLQC 3S35X 4HUWA 3RURA 4W9IC 5T1JA 1JGUL 2A6IA 2JNZA 1NLBL 3DPBB 3D50A 3LZNA 4DGUA 2HLAA 1Y69U 1C48A 1B0IA 5IYBG 1N2RA 2Q7AA 3UTSA 1XXGA 5J22A 4TLSA 5SWSE 4MMZC 1CDBA 1WIPA 3HAEH 3BISA 5IROC 3O9WC 4NXKA 3LS5H 3G6EA 3ZT5A 4E9QA 3UCRA 3HI6L 1NGYA 1GKOA 4ZOBA 3L5XH 4AXWA 3IJHA 4GN5A 3Q5TA 4POZD 1LO3L 2QV4A 4RZCA 1NMFA 3VGGA 4U673 3RB7A 3O4LA 3WN5B 2E2IH 4HKXB 3SE9L 5FYLL 4RFOL 3BQUD 2CGRH 4APQB 1P5UA 4AZUA 2CUMA 3AB0C 2R39A 1SY6L 4Z76B 4YWLA 2CKNA 2FECL 1UADC 2K8MA 1IKLA 5CJOH 4JN2A 4UDUA 3Q8CA 5C07B 4EJ1C 4G7YL 5LCVL 1LTRD 3GJEB 3RPKA 2FEJA 2UZYA 2HVKA 3U2JA 4ELKA 5GZOC 3FFCB 1GJIA 2GG1A 3P69A 4WKZA 5JUEL 3WJMA 3HOZG 4HBCH 3V79C 3G5ZB 3D4ZA 4Y4FB 4YVNA 2C4XA 4WI2A 2M00A 2AJ3A 2N1KA 1JWMB 2FTAA 3GRBA 3QUGA 4U1NA 1NDTA 4ODGA 2MP1A 2EQDA 5CSBA 5EN3A 3I56A 3HZ3A 1NPJA 3VGAB 4HH9B 1YRKA 5IB2B 3VI4B 1HAWA 5FYJH 4Q9QL 2X2IA 1UA7A 3E80A 1FFNB 1JF5A 5SWSA 5EU4B 3HOYB 3QXAB 2DQFA 1SMOA 3WIHL 4HFWB 1M71B 4X3UA 4UAHA 2VSKB 2NXYB 5FUOL 3ELAT 4GNXC 3MLVL 4LUZA 5JMRA 3C5ZC 3LVEA 4HKZB 3TJEH 3ZTNL 5H94B 5JQ6H 3NCXA 5CZVL 2HJLA 3X2QB 2EXWC 3EH2A 2C26A 3BKJL 3FCGA 4GRLC 5AYUL 3PUUA 3GEWB 4J12A 3MLXL 3IJSB 5MEOA 2VAAA 1FV1B 2H3KA 3N9GH