4FXOA

Zinc-mediated allosteric inhibiton of caspase-6
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
267
structure length
219
Chain Sequence
KREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVKQVPCFASMLTKKLHFFPKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Zinc-mediated Allosteric Inhibition of Caspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase
total genus 59
structure length 219
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fxoA00
3IBFA 4ZVQA 1M72A 3R5JA 2C2OA 3IBCA 4PRZA 4QULA 2K7ZA 5IAJA 3SIPA 3S8EA 4AW9A 1RWMA 3UO8B 4PRYA 1RHJA 4JJ8A 2C2MA 3V6MA 5LUBA 3DEIA 1RWPA 3H1PA 5IBCA 2HBQA 2Y1LA 3KJQA 1I51A 2CNNA 2H4WA 2J30A 1CP3A 2CDRA 4QUAA 5LUAA 4N5DA 1PAUA 3D6MA 4QUJA 4D3XA 1QDUA 4ZVOA 5IASA 5I9TA 4AWBA 3R6GA 5LU8A 3KJFA 4JJEA 1ICEA 2QL5A 4AWAA 2C2KA 4IEFB 1QTNA 3V4LA 2QLFA 3GJSA 4N6OA 5IC6A 3K7EA 2HBRA 1RWXA 1SHLA 4ZVSA 4JB8A 4M9RA 2P2CA 4NBLA 3PD0A 3D6HA 3RJMA 1K86A 4N6NA 1JXQA 2QL7A 1GQFA 1KMCA 1QX3A 1RWWA 4JR0A 1RHUA 1F1JA 4QTXA 4QTYA 3R7BA 4N6GA 3S70A 2H54A 4NOJA 1NW9B 1I4OA 4HVAA 4QUBA 2DKOA 4D3YA 4DCOA 1SC1A 3OD5A 2C1EA 2XZDA 3V4OA 4JR2A 3H0EA 4QU5A 2AR9A 5IANA 4NBNA 3H13A 4I1RA 3P45A 4JJ7A 3DEJA 3PCXA 5IARA 2CNLA 1RWVA 3GJQA 3NR2A 2H65A 1SC3A 4JQZA 1PYOA 1I4EB 3DEKA 5I9BA 2CJXA 4EHDA 2XYGA 1SC4A 2CNKA 4EHLA 4EHFA 4DCPA 3BIJA 4NBKA 2XYHA 1K88A 1CVRA 1RHQA 2J32A 1RHRA 2QLJA 2H5JA 4QUDA 4ZVRA 3R7NA 3UOAB 1RHMA 3GJRA 4IYRA 4PS1A 1NMQA 4QU8A 5IAGA 4NOMA 5IAEA 3DEHA 2WDPA 1RWKA 4QUHA 4NOLA 1IBCA 2HBZA 2QL9A 5IABA 3KJNA 3E4CA 4ZVTA 2QLBA 1RHKA 4EHHA 4QUEA 2XYPA 4EJFA 4HQ0A 4FEAA 4HQRA 4N7MA 3V6LA 1NMSA 3R6LA 3P4UA 5IBPA 4ZVUA 3H11A 1GFWA 4LSZA 4DCJA 1NMEA 5K20A 2FQQA 4QU0A 4N7JA 5IAKA 2C2ZA 4JQYA 1RE1A 4PS0A 4FXOA 4D3ZA 4I1PA 3V3KA 4EHKA 1RWOA 2NN3C 4ZVPA 4QU9A 1RWNA 2H51A 4QUGA 4FGUA 5JFTA 5LU9A 3D6FA 3SIRA 2J33A 3H11B 4FDLA 4JR1A 3R7SA 4EHNA 3EDRA 2CNOA 5IC4A 2H48A 5IBRA 3NS7A 2H4YA 2HBYA 2J31A 3PD1A 2Y0BA 1F9EA 1BMQA 2CJYA 1SHJA 5H0IA 1I3OA 3GJTA 4EHAA 3EDQA 2FUNB 4NOKA 3ITNA 3NKFA 2H5IA 2XZTA 4QUIA 3R5KA 3QNWA 3V55A 2FP3A
chains in the Genus database with same CATH superfamily
1V7ZA 4EEKA 1DEHA 1PDVA 2DJ5A 4KU4A 4KO1S 5FFNA 1RXCA 1K4KA 4IEIA 1QVAA 3X44A 4B09A 4CQMD 4RWZA 3T94A 2IYAA 3K31A 1A7UA 3JVUA 5CT8A 3VR5A 1W48A 4ZYWA 3ORHA 4J0GA 2DHCA 1KGDA 1C2TA 1FRQA 4QPNA 1DKLA 1GNTA 1Y6RA 4O3FA 3ER6A 5JZVA 1PT6A 2HCJB 1EHIA 2QM3A 4ZQHA 4EWLA 4FFWA 1XDDA 1SKAA 2P3LA 2WFZA 4RM3A 5ICGA 5LXTB 2NU7B 3BZUA 3I3SR 4HD8A 3P5BA 2YZ2A 5LNK6 4BOYA 1P6UA 2FPRA 5L3SB 3QEJA 1XPOA 4HCJA 1OH7A 3P9CA 3RUFA 3OEED 4RY9A 2PJRA 1FJHA 3PDUA 3KHTA 1XAHA 1UANA 1X1TA 4KOEC 5FF9A 2ID4A 1H3EA 1KY5A 3DKPA 1A50B 1SELA 4MWEA 2BM1A 4NTZA 2YJ3A 4EKDA 1FXWF 4ZAGA 1ZUIA 2K7FA 4WXEA 2V9PA 3AM5A 1KHTA 1RWWA 1OZAA 4RK7A 3FN4A 3IIIA 3LKBA 2HJWA 2GM5A 1I10A 2BLNA 3F6BX 4ILEA 5EIHA 2C8VA 2XOKA 2XHZA 1Y6ZA 1LZLA 4EARA 2IEZA 2XQJA 3JQEA 4JUFA 2V7QA 3CMMA 4E5PA 1E5QA 1NXXA 3MTAA 2H92A 1C8LA 5EZYB 3OOWA 2UVDA 4FBLA 2BGWA 4YWHA 5LQJA 3HUEA 4M2LA 4LDJA 5K0LA 2Z8ZA 4B3IA 7YASA 4KGVA 4AP9A 3TW0A 4BDSA 1QRTA 1JQAA 3JYPA 3OZUA 4HPXB 4IUYA 3VHXB 1KAEA 2LE0A 5IDXA 4U2BA 4D9EA 2Z6QA 4REQB 3QLVC 2QVXX 3FNIA 3R7FA 5IFKA 3FCXA 3ZKWB 3ZU5A 1VE7A 1FXUA 4NJEB 2ZUFA 1VJ1A 4EVIA 2VEOA 4UQPA 2IU3A 2VLBA 4V0OA 2GYVA 2UYQA 1MORA 3ESYA 3M1IA 3T95A 1NVTA 3R0XA 1DQNA 1NAHA 2CL6X 1N2SA 4Q3KA 2CJWA 4I4TA 3HY3A 4UHFA 3GVPA 1GT91 5F1PA 4LF8B 1G3UA 2XTZA 3DEFA 5BN3B 1PUIA 4JU9A 4KBFA 1ZM9A 1VIMA 4WXHA 2QXTA 4OUDA 1XCMA 1RYHA 4TKZA 3HJHA 3TNDA 4UEQA 4I9NA 2R7AA 3LOPA 2X6RA 3O93A 3N5CA 3UYLA 3DL7A 5IUNC 5J2UA 4L95C 3PFNA 2PUGA 3IP1A 1V37A 4MMZB 1NXWA 2UUOA 2XWBF 4QVKA 4BMPB 1N0UA 3MZ0A 3PS9A 3OQNA 4GD3Q 3AB3A 1R6VA 3NHPA 4M37A 5AQEA 1TEXA 1TAHA 1NURA 2QTHA 4GC9A 1UFQA 1IOVA 3JU3A 2PPLA 4Q19A 1BKSB 1I3OA 1UDCA 4HNAB 2YIMA 5JZ9A 4BKQA 1RS0A 4F2GA 1S2MA 4OUKX 2PZGA 2PSHA 1Y37A 2SKCA 3A1TA 5AW8A 3EYWA 5K3FA 5ABPA 2CWWA 3P2OA 4DQLA 3JSAA 3FRHA 3QGMA 4IF6A 1T8PA 2A0XA 4IL5A 1YS9A 4UM9B 1C3LA 4Y67A 4MVJE 4LHZA 3SIPA 5PGMA 2EW8A 1DGQA 4NBVA 1TMGE 4DRXB 3D64A 1NHWA 1ZHOA 3O8NA 3H7IA 2W6JD 5BY2A 4NXMB 1NX9A 4J16C 1W88A 1BS1A 1C4OA 1LBIA 2FFAA 1IZZA 2IYVA 3CH5A 3K2EA 2I7TA 1YBFA 5DGTA 3TZ6A 3ZOZA 5C35A 5JS6A 3FYSA 1MIHA 4ZT2A 5CDHA 3GLSA 2WR8A 3Q0TA 4N7RA 4G1MB 2C4NA 3TLXA 3E22B 3U7GA 3KR2A 4X7BA 4HQLA 4MGZR 5FDFA 3TSCA 1UMCB 4Y3UA 3R0ZA 4TMTA 1B14A 3PL5A 5JXWA 1JAZA 1ATZA 3HS3A 4BP3A 1N6OA 1V39A 4FOOA 4J0EA 4E3ZA 5EVJA 4QZVA 3IRVA 3H2SA 4LYYA 3MEQA 5CTJA 5BV8A 1XVAA 3DKRA 3DL4A 3MWGA 3DCNA 4DOMA 3O9MA 1X0XA 1A9XB 1PSWA 1XC7A 1M34E 3DUWA 2RGNA 3JD4A 1J4AA 2IHJA 1QR6A 3MJDA 1EJBA 1G17A 3T61A 2D5AA 4LOLA 3I6BA 4TLCA 1QXSA 4WN9B 2G09A 2RGRA 3QXCA 1OVMA 1TRKA 4FN4A 4ZAZA 4JYZA 1ST3A 4YGYA 4Q7JB 2VYQA 2IBSA 3NDPA 1J99A 1USKA 1SQ0A 3PYLA 2WIJA 4MS1B 3E1SA 4U2FA 1N5IA 3OMWA 2ZE6A 3KV3O 1OLUA 4U7TB 4GZMA 3QV2A 4FHCA 1W2HA 3KZXA 3RVKA 1LDGA 2XRZA 1NWCA 3KLOA 5EUMA 1QAOA 1RYNA 1I4EB 2XVAA 3G2HA 4R81A 4H0CA 1GZDA 4DM3A 121PA 3KFXA 3OCVA 2WZBA 4DIMA 2XHEA 2IPXA 1DBVO 2FLVA 1Z0KA 5AT1A 3IKMB 3K20A 5BR7A 1PE0A 3VYVA 1DVRA 5ICCA 2R1VA 2DWCA 1KIFA 1M8KA 1U2ZA 1Y8QB 2FWPA 2YNMC 3F5SA 1KEZA 1P1JA 1K97A 2M98A 4PLGA 4RVUA 1PFGA 1NKTA 3KOYA 1DXQA 3LT0A 4RXUA 3F6PA 4YCNA 4BNWA 4EYGA 1CUSA 3QYJA 5LOVB 4HFMA 1LPPA 3I05A 3ONFA 2VXCA 1WQ4A 1RQGA 1UWVA 2DT8A 1G41A 3BIXA 4QGAA 2JGNA 3F6YA 3OT1A 1AZLA 2C58A 4IVPA 2CCJA 4X1OA 4ZA2A 1KI3A 3QE2A 2J9ZB 3B1WA 3BQMB 3SXUB 3HJFA 1Z2OX 4UVDA 1VE3A 2I1QA 3QA3E 3SBEA 4P3XA 2XB2A 2TYSB 3GNLA 5IJAA 2P9YA 5E7JA 1J5XA 1Y3DE 3OUTA 3GN1A 3OC0A 4ARZB 4C3ZA 3VYUB 2PBFA 3GF4A 4WESB 4OI0A 1RBQA 1FDOA 3I9MA 2QVLA 2QZSA 4I6JA 3HDQA 4PQRA 3ML1A 1CY1A 5KHOC 4M0FA 1JXMA 1XYVA 4DLWA 5A1TA 2HWYA 4I4TF 3D4LA 4NAVA 1QHYA 1GU1A 3AF0A 3TOZA 1UEIA 2HQ1A 2EP7A 3KHUA 4CEHB 3GJTA 4FHZA 3RYIA 4AJ4A 5KOIA 2C2XA 4EG3A 3SPXA 1O97C 1K9VF 2B34A 1C9YA 1QKIA 2GEBA 3E3MA 3QK7A 3QVGB 4KMSA 4KQ1A 4NJMA 1HYEA 1IHUA 1P0IA 2AD5A 3GJ8A 3O95A 4OO3A 4F3NA 5JARA 3BGDA 4E5KA 2F1JA 4CCYA 5CDYA 2HHJA 4LXIA 2R1TA 1K8ZB 1DKUA 2RGNC 3PT9A 4R1UA 5ICFA 4FOPA 5H3CA 3V4RA 2H1LA 3IAS6 1YDFA 4O4IB 4JP5A 1W6UA 2ETVA 1E8NA 2AFHE 5AW4A 4JS0A 2Z57A 2YVKA 4LDZA 4ZMSA 2W98A 4NU6A 4M1WA 1R16A 1O94A 3OIDA 4AY5A 3AU9A 3RAJA 4B34A 4CYMA 1E92A 4Y8VA 1SRRA 2C2KA 2YN4A 5DHRA 3R9KA 4NE2A 4KXMA 3RKRA 1SUCA 2BDUA 3AONB 1JBKA 5B3JA 2KS6A 1CUIA 2G4VA 1T3SA 4C4YA 5IUJC 2J7PD 3E9ZA 1C4WA 5KDDA 3M70A 3ZIDA 3ADDA 3WWPA 3LUGA 2BOVA 5IXYA 1FDSA 1QYIA 1VSBA 2H1RA 4ZZ1A 3KKQA 1G20A 2X9QA 3GJYA 3H1BA 3FKSD 5BORA 2PMBA 3FSEA 3A6HA 3UH1A 1T91A 2I4NA 3EQ8A 5BMOA 1WBBA 5EPOA 1I9GA 2QNBA 5K8UA 5DB4A 1F20A 3DOIA 4TTTS 4KKXB 2PKQO 4FKBA 2GVNA 4I1RA 2Y66A 3UFBA 4KXFB 3TTYA 2MT9A 1ZMTA 4DJAA 4R8MA 1YCDA 2QRJA 1ESZA 1Z34A 4OQPA 4E1BA 2ZT8A 4HEA1 4KE6A 2A86A 2G70A 3V97A 2ZRDA 3PIIA 4YASA 3UXEA 5A9RA 2J0UB 2XMDA 5DT2A 3T8YA 1CVRA 4PZPA 4TL8A 4EA7A 1P5FA 3PUKA 4HNVA 5L95A 3MRVA 4RHYA 4U5XA 3EDMA 1UP4A 4QU8A 2Y1XA 3ZDFA 4DT1A 2B21A 4XDYA 3W8FA 3R1IA 4CM9A 3Q7QA 5JNWA 5L7YA 3NIGB 2O2YA 2ZJYA 2QLMA 1M76A 2YWCA 1BEUB 5HR5A 2XWPA 2CNDA 4TRJA 2H4XA 4M89A 2CF5A 2HU7A 3WK4A 1E1CB 3ZCVA 2QTWB 1V96A 4FJ0A 1AXEA 3LUHA 4KWCA 4P8RA 3FPEA 1EFUA 2M6KA 3GV0A 2IRWA 4KQXA 3OTHA 4LHSA 3EFEA 2B3TA 3HCDA 5CDFA 3C5VA 2MCFA 1E2QA 1OHHD 3P32A 1DUSA 2YQ4A 1TZ2A 2FN7A 3W9SA 3DLAA 1CIJA 2QD2A 4C4RA 2XJ4A 2Q8NA 4Q3AA 4BFYA 3GOHA 3QFSA 1NTRA 4MAFA 3TVTA 4GEGA 3MIZA 4CI9A 3FFWA 1JQDA 3RWOA 5HQJA 4KO8A 4OGGA 1F8XA 1FUIA 1KZYC 1LV8A 2A5LA 1P1HA 2OT3B 1RT9A 5ALRA 3JVVA 2X6TA 5T4BA 4P33A 2PX4A 4L1KA 3NO4A 2G9VA 1E1QD 1TKAA 2LWIA 3LBHA 1YS4A 2AC4A 1O94C 3K5PA 3OLQA 2IJGX 2JFZA 4NF2A 2AS0A 4RPKA 2O6HA 5JMOA 4Y2UA 1SCUA 1MT3A 1SIBE 2JDIA 2EGHA 2IHTA 3PXDA 4JT2A 5LD2B 3ZHRA 3VPXA 1PGPA 5F76A 5B3JC 2C4UA 2OG2A 2ZPUA 3OX4A 4AIIA 1I24A 1UXGA 3NC4A 3MW8A 3VKHA 3HZZA 4E2FA 2BF7A 2OYSA 3U7EB 1LDMA 2E2WA 2C3UA 4PLPA 1WTAA 4O8CA 4TROA 5L3VA 4OXIA 3CEPB 4PGFA 1RWQA 1I0IA 3MERA 3SZMA 1E9EA 1JR3E 1XTTA 1F5SA 3U3MA 4BLVA 1P72A 1GSHA 3D3NA 1NW6A 1A97A 1B0AA 3T5TA 2ZRNA 1ECGA 3HGMA 3GFSA 2GPTA 2ZRGA 4TT3A 1G5PA 4TSFA 1H8HA 1FLAA 3SX4A 2IS6A 1AK2A 4G5YA 4JI7B 4JXJA 4MW2A 4YAKA 2H7CA 1Y8ZA 2VPWA 3IP8A 1RFGE 5HFJA 1CIVA 4M86A 2A9OA 4CL3A 2HWXA 3BT7A 4OQNA 2JGDB 4ENSA 1SVSA 1CQWA 1DC4A 3PUZA 3LQFA 4B80A 1MXHA 1CBUA 3ZI7A 1PWZA 3QEBZ 1ESDA 3DBVO 3PNVA 4F2DA 3PC3A 2JA1A 2QXYA 2GCIA 5F64A 3I1IA 5DVZA 2FG7C 2XYVA 4G5XA 2FEOA 4A10A 3ZK8A 5E1DA 3CEMA 4WVFA 4CM7A 5A4MS 3NUZA 4U0JA 1KFKB 4Q3NA 1BU8A 3RGWS 1J8FA 1FLDA 3L8MA 1V45E 1ZI6A 1SB9A 2OMKA 2R8OA 4GGMX 2CDAA 4J6EA 1WEHA 5HJEA 3OFKA 4EFNA 2J6BA 2XRMA 4Q7KA 2ASVA 5KUTA 1WP4A 2GZMA 3ZVLA 3UB4A 3HEBA 1GNVA 4BFVA 4CQLB 4EHLA 5F7XA 1F7VA 5K8IA 2XUPA 3BD6A 5TC4A 3SVZA 3DZJA 4JP8A 2J32A 3Q2KA 1NJ2A 4JEHA 3T9CA 4LFAB 1T5BA 1LDYA 2XF8A 1SVMA 5EKDA 3E58A 1ESMA 3NAZA 1T2FA 5AWFC 4RFVA 3ETJA 2J3LA 3CX4A 3L0IB 3ASVA 3AHJA 1UPAA 4FYYA 2O2EA 1JKFA 2HUPA 2V7BA 1PI3A 3CNHA 3NANA 4GYKA 4ITRC 4Q4JA 5TGTA 5H68A 3SM9A 2CVHA 4YAWA 1IQRA 4A0GA 4FLMA 4BLOA 3TH5A 4F1WA 3C74A 2I67A 5I5GA 3ZG6A 2E6KA 3AR9A 2QYTA 4GW3A 4DG5A 5B2EA 3SZOA 4V0NA 2OQIA 1O0SA 2HADA 5BOVA 5EZQA 1YBVA 2VSFA 2YTZA 3RBZA 4CI0B 1JBQA 1XLWA 2Y05A 6AT1A 3SR3A 4R9UC 3QPVA 1GTG1 2H9IA 2X2EA 2B8WA 1CS4C 2OV3A 1W36C 4MNTA 1FL9A 4N3CA 5JCOA 2J33A 3H4TA 2UZ1A 1X1QA 1L4KA 1SVKA 2BGUA 1ORWA 2NACA 1TQ8A 3WK9A 1ZLYA 1RPNA 2FFRA 4EDHA 5HJ5A 1AE1A 2EC5A 1QOZA 2PM8A 2R85A 2OTCA 3TUJC 5GPBA 3S1AA 5CB6A 1R2QA 2HMWA 4EA6A 4RH0A 5KB3A 1HLPA 2IF2A 2QAIA 3LPMA 4YP6A 3RFXA 2OGZA 1K68A 2CL0X 3MS2A 3TXYA 4KO2S 4FGKA 5LZ5A 4YCSA 1Y1RA 1FVHA 2PA0A 4WNIA 3F0TA 5IVHA 2IOFK 1P4HA 2JBWA 3CNNA 4HWSA 5KZMB 1WY5A 3QEKA 2EBHX 3FDFA 1HA3A 1P2FA 3OQIA 4GI1A 2C84A 1JPNA 4JP2A 4TLMB 3KEFA 4AU1A 1T6BY 4FWTA 4C14A 4DBLC 1FYEA 3T4PA 3T3NA 3RT1A 2MMGA 4G8BA 1DRVA 1NW5A 4O33A 3VBCA 2VYNA 1CU1A 2VQSA 3G88A 4RKRA 3WGQA 1MB3A 1IZ0A 1ZJJA 4JCCA 3BBLA 1SVWA 1JQJC 3G0BA 5HZHA 2YOFA 3DZDA 2YIVX 3L0PA 4O2BA 2PS9A 4P1ZA 5BSRA 3VTFA 2WT8A 3L7IA 4RX1A 4WLNA 4WN3A 1R37A 4WCVA 4OX9Y 3T5PA 4C29A 5A62A 1NI3A 4L4UA 1A3CA 3CLUD 1J8YF 5SZIA 1U98A 1KAGA 1XN4A 1SKUA 1JLMA 4WNYA 4D8UA 3OQMA 1DMSA 1ZM4A 1MO6A 4RLQA 2QSZA 3HLTA 2ZWAA 3C3BA 4MVJD 3Q8MA 1NVGA 3A2MA 1PZMA 3QX9A 1L4EA 1LLFA 1LVGA 2ZSFA 2ZTSA 1ZLXA 3AFMA 2LCFA 5CK4A 1WBJB 1YUNA 1J0EA 1D5WA 2Z1NA 2G5GX 3BMQA 5DX0A 5TPZA 4B6GA 4Q18A 5FT9A 1IN4A 1K66A 1VL5A 3OA2A 1NR5A 4QTYA 3GNTA 3X1WA 2DCUA 5I3ZA 4TYNA 4DR2B 1X8JA 1DOAA 4IICA 3AINA 2P8JA 4A7PA 1XF1A 3A1SA 1YDGA 4MUXA 3LIIA 1CR1A 3NCHA 2G63A 3OQ1A 4RM2A 4F3KA 4P22A 3HDGA 1XAJA 5EXXA 1L5NA 4IFTA 3C3MA 1O89A 4MQ6A 4MGHA 3TTWA 3BGIA 2QWXA 5CVUA 9GPBA 2O8EA 3PNBA 4CIWA 3UV3A 4YMTA 2XECA 3QA9A 2G5TA 3U3ZA 4DE5A 2ZRAA 3F47A 4R5MA 4K9DA 4RTNA 3EGCA 5FTNA 2CB0A 3ZYZA 1EE9A 2I1VB 4HXGA 1P9NA 3UOAB 4HV4A 1N2IA 4M6WA 3E5HA 1W0KD 4DA0A 1H0KA 3VH4A 1BWRA 1KYXA 2HY7A 3U3RA 2EGUA 4C7MA 4D0RA 5JCOC 3AGQA 4IH9A 1OAKA 3N2EA 5AM2A 3NVAA 4W5OA 2NU6A 2HCFA 2B94A 3NX4A 4BEBA 1JTEA 1J8DA 3DVAA 2OKCA 2P7IA 4YJKA 4L22A 4QJ3A 2GAFA 3HJCA 3L7JA 1NPYA 4HADA 2VTVA 4LRWA 2GTHA 2WWTA 1SG0A 1X8XA 4XKJA 4M36A 3W06A 3X2EA 5CCBA 3LDUA 3OZ7A 1XD2A 2VVTA 4MROA 5AM5A 1HGXA 5AM0A 4EB3A 3R3JA 2PQ6A 4MRSA 1T1IA 2Z6AA 2J9XB 3T1HB 1P9LA 5KWVA 1CWUA 2XVZA 2PE5A 3COSA 2CJWB 4I4TB 3REFA 1DNPA 1AY0A 2Q1WA 2AC2A 5GJCA 1QRSA 5IDVA 5CNJA 1XZJA 2C3YA 3TQOA 3DMYA 3WQQA 4OUDB 5T3YA 2F7SA 3A05A 3UG7A 2I65A 2VHZA 4OAOA 5EHQA 5J2UB 3RF7A 1PLLA 2VWPA 3RGGA 1ZL0A 1E1MA 2CVQA 4I66A 5H81A 3ZQUA 1NXQA 5ALFA 4YYEA 2Z2IA 2FEXA 3U9TA 1G8GA 5C1DA 1IHOA 4K9SA 4BZQA 2I6SA 2I99A 3OE7A 5D01A 2QMYA 3MXTA 2W11A 2JCBA 4R3UC 3RBVA 2H1FA 3ZCTA 4EF5A 6ADHA 1RMTA 1K7CA 3B6JA 3SF8A 1RRCA 2V9CA 3PV0A 5DYTA 4QPJC 4XYEA 3FNEA 3IQHX 5A0VA 4LJ8A 2GLTA 3FM9A 1NG9A 4JIGA 1O6ZA 3IPLA 2HV8A 4QDJA 4F93B 4IIBA 3FR8A 4OMDA 1NF9A 1ZGJA 1OOEA 2VZLA 2XT6A 5K3FB 5JSQA 4N5DA 2CK3D 4BKPA 2GFQA 3RTEA 1M67A 2FOIA 2K5UA 2PZKA 3NT4A 3GA0A 4RY8A 4I0WB 2NU8A 5FUMA 3FOFC 1N36B 1BYUA 2QU7A 2F2TA 1P6QA 1LRLA 1K75A 4Y2TA 3KYDA 2ZBGA 1SHTX 1USVA 1V26A 1Z56C 3H84A 3L05A 1KZ4A 1G20E 4BX0A 4CG1A 1ORVA 2JLCA 2HQSA 2WWGA 2ZTLA 4J0JA 2Q29A 4DMLA 4JGGA 3PNMA 4DG9A 5AW3A 2OZVA 4AG6A 2XUZA 4N6NA 3VYWA 1MZPA 2HD4A 1SFRA 3ZV3A 3IH5A 1K6MA 3ZU2A 2ZZNA 1RVV1 1E0KA 4KH1A 3B51X 2B0CA 4O2BF 2IP1A 3VR2A 2KBEA 4XGQA 2VJAA 3GBSA 3NHAA 5IJ9A 5K03A 3ACDA 4KLNA 2OD2A 2OR3A 1EKXA 2GHRA 3U3OA 3LYAA 1OBVA 1HT2E 2WJZB 3PCXA 4JL5A 4OL0A 3OSUA 5C1BA 1YJAA 4KFTA 1E62A 3WMWA 2ZRPA 2AWOA 4QYTA 4DKXA 4ZQEA 2QHXA 2R8RA 3IAHA 5EMLA 2IV3A 3MGCA 3V1KA 1BMFD 4O4HA 3ZWWA 3SYKA 1ZY2A 4LZZA 3S2FA 2W8BA 4F9GA 4CGZA 1ENPA 3E3OA 4X90A 4F8JA 4ZHQA 4DLTA 2OPHA 3NNSA 3E8XA 2P7HA 3GO4A 3L7YA 2JGLA 1UDXA 4G1UC 4ZAVA 3M4NA 1E3QA 1OLUB 2IEBA 2ZIZA 1GOTA 4ZU1X 3HVRA 1RCTE 3MELA 4QJBA 4NXNB 2V74B 1UOQA 3N0WA 2V8OA 2EZUA 4KLCA 3RJTA 1NATA 3D59A 5ALIA 3BGWA 3C39A 4ENWA 5CDFE 3AYZB 4RD1A 5IG2A 4QRIA 2FUG1 2FSUA 3CISA 3W2EA 3V1YA 1AC5A 3BFPA 3CZMA 2V4ZA 4JL6A 2HL6A 2JF0A 2WEKA 2WLTA 4O6VA 5AKZA 2HHHB 3WK8A 1WCIA 2R1VB 1CY2A 5EXPA 5I9MA 1E2IA 3KT3A 2WMNB 3ZZUA 5I8PA 4DV6B 5FA5A 2CMGA 3UH0A 1RQXA 2ABWA 3KYJB 3EODA 2OLJA 3V8PA 5MN6A 1IN8A 4C05A 5LN1A 3A2KA 1DO0A 1Y80A 1QMGA 1O0BA 4MRRA 4BGEA 1WB6A 2IYNA 3DGEC 1FOEB 1G66A 2P2DA 3JWGA 5ADUS 1RYFA 4MA4A 1JDUA 5JD4A 3CMCO 2ZYSA 3OT1B 1HE2A 1KI4A 3K3PA 1X70A 4M8IA 1MB0A 1E0SA 2A0KA 1FC0A 2UZIR 1IWBB 1S3FA 2F9LA 1IULA 3SZRA 2J67A 1WCV1 2VAVA 1M1UA 4G5QA 1Q1NA 4DCSA 5C7OO 5KINB 3CSUA 1L1RA 3MXOA 1N9KA 2DGDA 1M3SA 3HE3A 3JZDA 4J90A 5DNDA 3RUIA 1V8BA 3ZWNA 4XWKA 4X7RA 5B2FA 4G07A 3EGXA 4JLWA 4GI2A 4U3JB 2J7KA 3DOFA 3WJ1A 1TI7A 4DWVA 1D5CA 3D9QX 1ZESA 5HS4A 4ACBA 1G3QA 1VP3A 4IXTA 5F23A 1AB6A 2OMEA 3NHUA 3PHCA 1VKZA 5G1NA 5JHGB 2Y9PB 2YXEA 5FHQA 2B20A 4BB6A 4BVHA 3QM1A 3RYIB 1YVEI 5DZSA 1HE4A 4D56A 3AKZA 4UBMA 3WHIA 4NJMB 2W2LA 5F5LA 1KK1A 1VTKA 1JDJA 2O8NA 1VLJA 1PUJA 3TMKA 2R1TB 2V59A 1KOFA 4BN0A 1ZCFA 1V4VA 1JEYA 1F0PA 1JVNA 2AQKA 4E21A 3Q88A 3L4JA 2WFLA 4TLDA 4UULA 2O19A 1OXMA 1TW3A 3K4QA 2IEIA 4XVHA 4ZK2A 3KXDA 4L74A 1U5BA 2GETA 2BDEA 3BHIA 3F3MA 5AW1A 3E03A 4UOEA 5JJ5A 1Y1KE 4MUGA 1PK7A 1RRGA 3WLSA 5KYWB 3WAJA 2HA4A 3PHHA 1LBSA 2D2IA 1C7ZA 2IYSA 3I9NA 3IJEB 3KUUA 3EIXA 2CYAA 4IAOA 1HFKA 1MC5A 4ARUA 4L9WA 1JR3D 1NQWA 2ZRLA 3HJUA 4Q4AA 3NNDA 1G7RA 4LVCA 1XL0A 1KO8A 3HO6A 1CVLA 3N2NA 3D7SA 1WF3A 1U7WA 1G20B 4P7BA 3W5AA 1WPQA 3I4FA 5DHAA 4OHZA 2H2DA 4HQKA 5FRDA 5C52B 2ZYTX 1GDTA 4AL4A 2ZR0A 1E69A 3FIJA 3DHVA 1F9AA 3HMQA 4L6AA 2PZLA 3IEIA 4EIWA 1YZHA 1RHMA 2XOKD 3DMPA 1G3IA 1HEYA 3BFXA 4Z2AA 3IEMA 4ID3A 1SKMA 1ZSVA 2RONA 5I7UA 3HB9A 2PZ8A 3M5PA 4GX1A 4MV3A 4LZPA 2P0YA 1XK7A 4ZU3A 1Y1PA 2PZBA 1TD9A 3H1TA 3KJNA 4MGEA 5DNCA 4UCFA 1E2EA 2P1DA 2EZTA 1CX9B 3ZD8A 3DV2A 4BV9A 4JZKA 1RXSA 2W0SA 3KLPX 4O1HA 1P73A 1A8HA 1MO3A 1RCFA 3EISA 4O4HF 4DT1B 1C7IA 2B7BA 4K8OA 4XIIA 1E5XA 1R0LA 1J56A 5KAPA 4ZHQF 2VRCA 1XRPA 2PUDA 1PRYA 2YWGA 2W2OA 3ETLA 4LDNA 5CFQA 3RTAA 3A7DA 3ISVA 3GFBA 4IZOA 4XCQA 3ZEAA 2ZJ2A 3BH7A 2FN9A 4PO9A 5HM8A 4GH5A 3ZR4B 4AYTA 4UDYX 2Q4EA 5CGZA 3WGYA 5C1OA 1MJ5A 2J9RA 1BVYF 5EJ9A 1H9BA 1H94A 3ISTA 1EVIA 1EE2A 4W5JA 3ZJ4A 4A16A 4CMAA 1N5OX 2P6UA 1W8IA 3AZPA 3NZEA 4B3SB 1F9EA 1HYQA 1ND6A 1WOYA 2R4UA 1ZD3A 4EUFA 3K0SA 1C9NA 4P4SA 1LW7A 1RI2A 4CLDA 3PGLA 3MBIA 3UAYA 1EGHA 1VOTA 3NAGA 2IBTA 5FLXA 4HB4A 1YVPA 4ETNA 1O6BA 2QN2A 4JFAA 4QVGA 4ESOA 1GYRA 3AP2A 4MWOA 1GEEA 4XUCA 4P4NA 3ZBQA 4EUSA 4RK4A 3HUDA 3FZGA 2FHSA 2PRKA 2BEVA 3LUCA 3V34A 1ULUA 3ROMA 5KTTA 1HLFA 3TR0A 4BB0A 4PLTA 4AWXA 2VRBA 9LDBA 1E60A 1CUVA 2ATCA 2GN2A 4LKRA 5HSGA 5CDGA 1OB2A 1SCUB 2ECPA 3P52A 2J8ZA 3LECA 4DV1B 4RQAA 1U4OA 1JN0A 3KJXA 3QVUA 4DEYA 1JG3A 1J21A 2Z5VA 3VI3B 4DR7B 3SEFA 4N0DA 1RPAA 1XHFA 3L1UA 4K9QA 4NU8X 4POAA 4RDHA 5COQA 3EVCA 2V58A 2CFOA 5E9AA 5BW4A 3TOXA 2GHTA 1BVRA 3H9EO 5EJ5A 4GSKA 4GXTA 3T15A 1QTNA 2WF7A 1IY0A 1HZZC 3G2LA 2HCTA 3CB4A 1UM8A 3I9FA 3SBDA 4TN1A 4WPGA 3O1HB 3KDAA 1UUFA 4W5NA 4HOYA 1E59A 1SXJE 1VI2A 4FLEA 3MN1A 1LY1A 3CG0A 1WDWB 4LRUA 2QYHA 3ASZA 1F1JA 2W22A 1LK0A 3B5JA 2BGKA 3UW3A 4RTOA 4EW6A 4MV4A 2OHJA 5I6DA 3BTVA 3KAPA 4ZCMA 2VATA 4BVEA 3CE9A 2ZUEA 3DOHA 3EMBA 3IOCA 4J94A 4WSOA 1NTOA 2QTAA 1H5QA 3LQ1A 3WMGA 5KVVA 1YTUA 1T8UA 4PLFA 5KS2A 3GEPA 4J7XA 5TY0A 4CTKA 3AI7A 4B73A 2FZKA 2DXIA 5DTMA 3LQQA 1XD8A 1GVNB 3AKDA 2FMTA 1ZH8A 3LXXA 4BKRA 4QAJA 1NQAO 4BE7B 1E2PA 1JT9A 3V1TC 2C5FA 1CUBA 3VSEA 1KAHA 1JIJA 1J23A 3GJRA 4PS1A 1I9CA 2Z3ZA 1DO8A 2AHRA 2ZT6A 4FP9A 3VO8A 3VVMA 4JJKA 4LGMA 4Y9RA 2QP9X 2EDAA 1A9SA 4MTLA 1X9IA 3OI7A 1RWBA 1XFAA 5BT8A 2CFIA 2CUZA 3KSRA 4JZYA 4ZVTA 1XU4A 1UT5A 1IVSA 2XDAA 3O6VA 4AQDA 1DHRA 1XQ1A 3A0UA 4XD7D 4QUEA 2PMDA 2W93A 3BD8A 1CUHA 1BCRB 5D6NA 1JHRA 4BRWA 1EUYA 2RGAA 3IUPA 4IWXA 4YHBA 1W34A 4A0FA 4RJLA 4CRWB 3RWBA 4J4BA 5GIOE 3H19A 1YH3A 4R7TA 4H7PA 4FIDA 1I7QB 2WSIA 3HVKA 4DILA 4I81A 1VLVA 2EWMA 3UMFA 3NB0A 3O8DA 1ODTC 2I3AA 4Q4JB 4UNIA 4WZBE 4JEUA 1MOPA 1Y3HA 3NBKA 4GQBA 4C76A 4D9JA 3LLSA 1XLTA 5CCEA 2JLXA 2OUIA 4TLLB 4UFOA 4CM3A 3IERA 4KQIA 3OUZA 4MQEA 1L1EA 4EJ0A 3G7UA 1GPBA 2RC5A 1K4MA 4JLPA 1JJIA 2GDZA 3FGOA 1EZ4A 4N18A 4QYMA 3MT0A 4XI9A 4M9QA 1O7JA 4Q6WA 5J4KA 1V3VA 2DMRA 2HNAA 3KFVA 5IN4A 1XZMA 4HRXA 1T0UA 3CURA 2VG8A 1LF5A 2ZBPA 2XZLA 3KPWA 2UUCB 4TS3A 3TZLA 2X0FA 2ZEJA 3FOEC 3INYA 4NZZA 3M33A 2I7CA 3IB3A 4OG2A 4XWGA 1MC8A 1MHTA 2UZ1B 2GBFA 5JNTA 1YQGA 3SG0A 1Z06A 2QTLA 1RKVA 1QSGA 4EYEA 4W5WA 3UN1A 4F2HA 2ZIAA 3W2TA 4B84A 2PHZA 4JI4B 3HH8A 4AUNA 3S1AB 2XD4A 3OOYA 1H2EA 4QQKA 3TG2A 2IU6A 2CXQA 4TL9A 4F3CA 2Y68A 2W6CX 4DADA 2VPTA 2OQ2A 3OTIA 1IIBA 1B15A 1Z75A 1N4AA 4OI2A 1Q7GA 4LWQA 4LA4A 2O3TA 4TS4A 4HLCA 3BICA 3M9LA 3OQIB 4TOIA 2FW6A 3IULA 5JBIA 4MW9A 1HH4A 2Q4DA 3HCCA 1V4NA 1V3QE 3L8DA 4NMWA 1EK0A 4A2WA 5JPCA 1EJ0A 1YC5A 3PUVA 4UE6A 1KZ1A 1N2CA 2OE2A 2R84A 2RHHA 4MIKA 3EMVA 4HMPA 4CBVA 3TGLA 4XQEA 2JFOA 1Q77A 2WYOA 3ZNQA 1QDEA 4KFRA 3UMVA 3MMPA 4O2BB 5DSXA 4I46A 2E4UA 2IYYA 3QG5A 4DLNA 1W0JA 2FZGA 1UH5A 4G4GA 5BSUA 2W37A 3L3BA 4NEGA 1MF7A 4FDUA 1AQIA 1BN7A 3AHGA 4UDXX 3EPHA 1UBMS 3JYNA 1BXRA 3LRTA 2JK0A 2M6SA 4JR2A 4ND8A 4A5SA 4JHXA 1SD2A 1YJ5A 3E2MA 4X8LA 1VECA 4XJXA 1E9BA 3GT3A 4YY3B 2HGSA 3CH4B 1FE8A 3BMQB 5ER6A 3E70C 1SOUA 4BFTA 1U8TA 1R5BA 2RGBA 3OJWA 3HLYA 1YE5A 1VRCA 1C7FA 1HETA 1F2TA 1GD1O 1OYYA 1QX4A 1SC4A 3QSGA 4JCOA 4NV3A 2REBA 2CLDX 3COYA 3GUZA 4JLVA 2WT4A 4MB6A 3A26A 1NNUA 1CKEA 1WCYA 1FU7A 1KJYA 1YRWA 3PUHA 5EQTA 3BX1A 2XCTB 1ZGCA 4U2CA 3T7RA 2CV0A 4U6QA 2XKBA 2XR1A 1Z7BA 5KDOA 4YS6A 2O8EB 3LI2A 2HU8A 3G1UA 5EIFA 2GAOA 4HGNA 3M82A 1QF9A 4KGDA 4Q03A 3RRZA 2WPDA 2J0QA 4OFBA 1U81A 3PTAA 5TMDA 3DZKA 3ESBA 4I1OA 3LX8A 3NHWA 2FK7A 2XYPA 1GTJ1 2JI8A 5F1YA 3UXYA 4ASUD 1X1BA 3PGA1 4P4GA 2HM7A 4LSZA 1DINA 3RSOA 4RD0A 5JHHB 1EFHA 4M6WB 5JSFA 5AVOA 3F90A 3IJRA 3ZY5A 1PNVA 1B2RA 3TZKA 3Q3IA 3W4KA 1FUUA 2ZPAA 1DLIA 5EP2A 1OSNA 1OE0A 3IMEA 2NU6B 2WQ6A 4S1PA 3N6XA 3DVAB 3W8NA 4MKIA 4TM8A 2UUBB 4UBJA 4DGSA 2QBYA 2FW0A 1QCZA 4YV1A 3RT9A 4H1UA 3JCZA 4MUMA 2QRHA 4P3NA 1XRMA 3AI3A 1H2RS 3A32A 4LWZA 5IAAA 3NALA 3IE1A 1XD2B 3RV3A 1HBJA 1JJ7A 5LB4A 2WILA 1UEXC 2V5VA 3A4LA 1U7HA 2NV0A 1QANA 4KRYA 2REOA 4RZHA 1CQPA 2QQ0A 1JGTA 3SKXA 2EU8A 3DDSA 4K26A 1T3LA 1YACA 2FPXA 5B3AA 1WA5A 3ZW8A 1R4ZA 2IWHA 4ZCSA 4BECA 2BGGA 2FUCA 5LQCA 4RIEA 3AW9A 1VG9B 5CYOA 5EYPA 2FGKA 3ZGZA 2R9VA 5GM1A 2NPFA 4FM9A 1ONBA 2HV9A 1PTJA 4U7WA 3VKGA 4DDTA 1N77A 4PZUA 3T1YB 5DHUA 3OQVA 4Z8XA 3VR1A 1HFJA 1HDYA 1SN7A 1XQ9A 1CJSA 1MFZA 2A0UA 4H6VA 4ZHSA 2I9KA 1KQNA 3CR3C 2PIAA 3IUMA 3SF8B 4LNAA 3PE6A 2YMLA 4L3OA 3RS7A 3E2IA 3JD2A 4KC0A 4R1LA 5K3BA 1A2KC 4WKGA 3V4SA 5C46F 5K0JA 1N9ZA 1ESEA 1QIHA 1PR4A 2F67A 2QXUA 4X54A 2FPMA 4QLOA 1S1CA 1SBCA 1YK0A 3FTPA 1MEJA 2NUAA 1ZVQA 2BGRA 2Z1DA 3RM3A 3SLGA 1N3LA 13PKA 4LY3A 4NMXB 3BEDA 4ZT4A 4ENVA 1H2XA 1O77A 4IDOA 1OA0A 2JFHA 3ZV6A 5K99A 4JLUA 3GGGA 3JWJA 2FOXA 1RBMA 4OATA 2NU8B 2GRJA 2OAQ1 3IOEA 2VPXA 3UKJA 4QXRA 3DYBA 4BBJA 5AQ1A 3FPAA 2EFHB 4LGYA 1V9LA 3KYDB 1H8HD 3MQFA 4JJZA 4EBFA 4PC3A 3KE8A 4Q9JA 4H7KA 3FYUA 4PYLA 1AKRA 3ZIAD 1RBYA 2ZT7A 2R8YA 1E1RA 2QJOA 1VRVA 1EDZA 1KU6A 4QBFA 3STWA 5SY4A 4UEJA 3T3MB 2AKEA 2ARKA 2ZVQX 5L8VA 3GT4A 4G97A 1PJ8A 2ZJ0A 4F6LA 4WLEA 1XROA 3P26A 5F98A 4B8WA 5HOQA 4CDGA 3WSTA 2H31A 2ONZA 2IXBA 4DZRA 2X77A 5LZ9A 4KK3A 5IJ9B 5KNCD 3ZLJA 3TL2A 2N46A 2W2VA 4RPJA 5EHXA 1GPLA 2WA1A 3IHTA 5IMSA 4A4DA 3TW8A 2FSIA 1FDIA 5B4UA 5BSHA 1DJOA 4P31A 3BF8A 2IW1A 3P0EA 4KQMA 4R2XA 4ZT6A 3K0EA 4EVRA 4BMCA 1Z0JA 4ZD6A 1I1HA 4O4HB 2XBMA 1T5HX 5GOTA 2W8BB 3JV7A 2WVGA 2FSVA 3F7MA 5TR9A 2O2XA 4HQ0A 3T3DA 3R6LA 4JC0A 2R86A 1T36A 1BRTA 2HMSA 5IVIA 4CMCA 4DLXA 5GINE 2VAMA 3OIGA 2O0LA 3OOEA 2G28A 4ZO4A 5K1ZA 3AEZA 5AJVB 4GPEA 3KAJA 1JFSA 2NU9A 2AMJA 3SYRA 4E5YA 1OFTA 1F2UA 3AL3A 4HATA 1QQ7A 2GHQA 3C7TA 4QXOA 3TD2A 4NFYA 1MOZA 2VNIA 2XUIA 1ADYA 3LGXA 4F56A 1KORA 1PTJC 3KBBA 3ND8A 4I5IA 3CSSA 5TPWA 2V6MA 1WCIB 2RG1A 3Q3EA 2ZOSA 4S05A 1GUZA 2NZUG 2PKYX 3AEUA 4MR8A 5JQGA 1VL6A 5K4HA 1XDBA 4XGRA 1ZICA 2Q3EA 4YPVA 2JPDA 3H4VA 1KEEB 1XAGA 1ZVJA 4JSTA 4N54A 1P0QA 4BUCA 4MV7A 4RTLA 3GRRA 3HKEA 3H9BA 2VYCA 3JQBA 3K0HA 1GZSA 4GWLA 3GYGA 3ON5A 4QHYA 2WU8A 3DXXA 3FETA 2GBLA 4LXYA 4QYXA 1R8JA 3EEFA 4JKYA 1SUEA 4NZOA 2J6CA 1TADA 3TCXB 5EHNA 5DT9A 3D8HA 2QPAA 3CJTA 4JYBA 3UATA 2VDUE 1CP3A 4G8JA 3EGXB 3Q7RA 1UPUA 4ZDKA 1TM3E 5ALEA 1EA5A 1NSFA 1TIPA 3CQ9A 4GZ6A 1NUSA 3CNBA 1CZKA 1GCIA 4R1QA 4TSKA 4ZRMA 4DVGA 1U0BB 1WKBA 3FOCA 1E1LA 3BRWD 1P3DA 2IXFA 3OIUA 5HE9A 4NPCA 5A3JA 3UC5A 3EQ9A 1BMDA 4NNOA 3KTOA 1X1DA 5IT4A 2C3MA 1GY8A 1LBQA 4PO1A 3STUA 3ZE8A 2XSZA 4F84A 4TKVA 4BQIA 3RSZA 5C5EA 2NQTA 5FLYA 1PZXA 4FFLA 4M38A 3LPNA 1R8XA 2EJBA 1G8PA 3M6LA 4MVJG 3GD7A 4DFDA 2YWXA 4YHHB 3D3JA 4N5HX 2CLOB 2B1GA 2YMPA 2ZQYA 3O84A 4N8SA 2X0DA 3SEZA 5CLFA 1Y5MA 1X86B 4HX5A 4RETA 1Z35A 2WFLB 3VHQA 2I80A 1OD6A 5E4TA 4ARSA 1A88A 3O47A 2XX3A 4ZP1A 3V2IA 4JV5B 1U5BB 1YQXA 3T35A 2FSVC 4URHA 1EK5A 1A96A 1OTHA 5I7AA 1V8PA 2FMKA 2X7XA 2HREA 1X1CA 1ODJA 3RSSA 3C3XA 4V0RA 1MAVA 3R76A 1SHKA 2B1RA 2OZLA 2Z2KA 2G8LA 1JFLA 3EE6A 4B3GA 3ETGA 4DCPA 3EZXA 4HRYA 1TC2A 4D0NA 2IKQA 5KSZA 4Q4AB 2B8NA 3PPWA 4N8DA 4RGQA 5E2IA 4AP5A 4DNPA 4DV5B 3G5AA 3QKRA 4L9AA 3I09A 5K6TA 1RMQA 5DWQA 1B7GO 3WA7A 3RBAA 1O5TA 2KLBA 4HH4A 2R6ZA 2WWRA 2AC7A 4OJYA 4YLEA 1NVUQ 4IYJA 4KCGA 1S2DA 4U1RA 5IABA 1VHQA 3PT5A 1WUJS 1TCAA 2OCKA 4F3YA 1JS1X 2QRZA 1DS6A 1W2GA 4IX1A 3W5SA 4DNFA 4JA2A 2GILA 3SQWA 3GAMA 2UZ3A 3N0VA 3ZYCA 1IB0A 3ZN2A 5I4BA 4COOA 3UWMA 3E9EA 1P8AA 4RZIA 1I4LD 5HIMA 1DLJA 1GAWA 3ZWKA 3ZVRA 3LT4A 1CY0A 3PNOA 1WV0A 4X93A 1FIUA 3IEPA 5JDCA 1FW6A 1P45A 2GBLC 3LPAA 4JITA 2I5PO 3SIWA 1FS5A 1KI8A 3AJAA 5BQ5A 1Y9EA 2UKDA 4XLTA 4BEWA 2C7RA 1P9OA 3U56A 1XJQA 1ZIDA 2OECA 3C1OA 3HCFA 3Q8LA 1JG1A 2P41A 2RKWA 3MWLA 4GYYA 4E1VA 2V3CC 1DWOA 1KTVA 1OGIA 2ES4A 1UK8A 2F59A 3IAAA 1OR8A 1FP4A 3BMNA 2FQ1A 3IVCA 1GG8A 2VOEA 4R8RA 3EAFA 1UINA 4ZYZA 1ZOIA 1QJ4A 2Z5FA 3R24A 1V8DA 2HAEA 4FGSA 4L85A 1M0WA 1V25A 3MBOA 4QRDA 2VJMA 1QQBA 1MEEA 1GG2A 3ST7A 2D0DA 1HG0A 3V2HA 2X4IA 5AK6A 4GR4A 2XPCA 5CFNA 5BMVF 4ZZ0A 3DFUA 3ZGXA 4IIFA 1RI3A 3CW8X 4CUJA 1VKHA 3M6UA 1H6BA 1P39A 3I53A 3LV8A 2WHXA 3A4VA 3OOJA 3HZRA 4US2R 4P4SB 3BXPA 2IC5A 2NZ8A 1WO8A 4K6CA 3RQIA 3VR3D 1NC1A 1MQ8B 4X8HA 4QRHA 5JQGF 2CUTA 1T8RA 3A6FA 3FVVA 1SOAA 1NI4A 1XCJA 2YYSA 4QSHA 1N2CE 4V1CI 1X38A 3A1EA 2BEVB 3LHKA 2QL5A 5FOQA 1OI7A 1KYWA 4HI0E 4QASA 3ZU4A 4OQFA 4JT4A 3ZLBA 1KYVA 1PP4A 4CJXA 2QK4A 1A1VA 2VQDA 3KEMA 4AN0A 1MA0A 4I9UA 7REQA 2Q6OA 4O1MA 4XQ0A 2R65A 4H1HA 1Z15A 1B6TA 2B6HA 3OIFA 4NFHA 3T7IA 1SZJG 2EP8A 2I3DA 4MPJA 4NDAA 2CHUA 2AI1A 2EHJA 4QO7A 4RTMA 3ZDAA 3PIDA 4IMRA 2AKAB 2KJQA 5K01A 4R7GA 1VFPA 2PMCA 3H1AA 3W7AA 4Z3KA 3BJEA 4CM6A 4H27A 3DE4X 4Q3OA 2GCOA 1IMOA 2ZJ1A 2LUOA 4H15A 2TECE 3BAFA 5G1OA 1FTGA 3CZPA 1BW9A 2DFPA 3HB5X 1AQYA 2ZJZA 2ZU6A 1W2WB 2A58A 3BIJA 5LQUA 3KQLA 1XXHA 1LGYA 3E15A 2IXTA 1PNOA 3CH6A 4LECA 3NBXX 1H6AA 2VC2B 4JGIA 1VMKA 5LLDA 3BA1A 2PH7A 1EXWA 3I73A 4HAZA 1K27A 3RC3A 1OIXA 2MSEB 3PNYA 4NV1A 4II2A 2GNAA 4MS4A 5DNUA 2O3QA 1CZHA 4PFSA 3CEAA 2AW5A 3K9CA 1RJEA 1ADJA 1N9GA 2HCRA 2BMWA 5INTA 5JCZA 3GHHA 3MCVA 2ZIEA 2Q6LA 1M8FA 4CKCA 3WFZA 1O0CA 1KP3A 3GJXC 2VQ6A 1JG7A 1Q1GA 3GRKA 4CT4B 4WK4B 4E5DA 4LWOA 2NT4A 2NQ8A 3GPCA 2Q6VA 2W4QA 3D81A 2ZSEA 3PC7A 3W05A 1NLUA 1QH8A 2XIJA 1R66A 4IGFA 1H0SA 1LPAB 5F1OA 3RVLA 2AJCA 3WTCA 7AT1A 4X65B 3B13B 4MJ3A 3FGZA 3OWOA 2BZGA 4RY2A 1TZBA 2E5FA 4F85A 3LH5A 4AZ3A 2NSYA 2R11A 2VKTA 1AV6A 2WJWA 5ALYA 3ZI0A 2VF4X 4ZI5A 4GKKB 3O8LA 3HDJA 4AQYB 2X4LA 1E79A 4P54A 4YP1A 3UOGA 1FDUA 1M7HA 3ZU3A 4PAOA 2V6IA 1A5SB 2GTIA 5DW3A 5BRNA 1IZ7A 1D2RA 5ALZA 4H0NA 4G5FA 4D9FA 4LF9B 4AXBA 1GCUA 3NOOA 3G9TA 2G9ZA 1YVUA 3WI7A 2AQIA 2H5IA 1GSIA 1M10A 2FUKA 4NDZA 2IHYA 2YN2A 3EBLA 1LI5A 5A5DA 1NSTA 3TGWA 4ZQGA 1YL5A 4MQEB 2ANCA 5DWVA 4RLFA 1ZMRA 4RELA 3G1TA 4MH0R 1B0ZA 4R05A 2BKXA 2NSDA 3H9QA 2FWMX 3OLVA 1XVTA 4WFIA 3TJMA 3ZJVA 3KSDO 3FLMA 4PQGA 2EFYA 3TBHA 1HQKA 4EEXA 2V8BA 2WKPA 1RPTA 1ZCZA 2BMVA 1VSTA 4MW1A 5DP2A 3VR4A 3L7MA 5KX5A 2F8SA 4RGVA 1E6EA 3RYFA 3V2UA 1DC6A 5CYPA 1T9AA 4EI2A 1IXSB 1HMPA 2BGJA 2ZIFA 3VISA 4AWBA 1CE8A 4EB8A 3WJ7A 3W5IA 1U3DA 4F5YA 1L7OA 3QJYA 2VN8A 4ZDWA 2NW6A 3BWXA 3I8XA 5EMJA 1CC1S 1G2OA 3KAQA 1W73A 3G8AA 4MGIR 4JB8A 4PO3X 4EO7A 3C6XA 4JBLA 3IILA 1C4XA 2IVZA 2GI4A 2BR4A 2WSYB 4XX0A 3BSYA 1E20A 4ZVLA 4CMIA 1UBGA 2ECOA 2ZSKA 3JZAA 3TXAA 3OSZA 4LRSB 4MV1A 3U7RA 4AECA 2PT6A 1PJZA 1KJQA 2I8AA 2H5EA 4F46A 5J5VA 3KPVA 2GS9A 3HBNA 2QN9A 3HDHA 1N2CB 3DDWA 4WLFA 3Q5EA 4N47A 1Z5NA 2IGBA 5IANA 3DGFC 2ZR7A 4X1IA 4YB8A 4ZI7A 4OGFA 5E6RB 2FR0A 1D1SA 1YJQA 3LT2A 3G0OA 3UB3A 4KNVA 4I5GA 2M1XA 2V98A 1XMOB 2G9UA 3DTNA 3GG2A 3MA0A 4RTSA 4KR6A 1PD0A 3OKCA 2L2QA 1IN5A 2R6FA 1BXRB 4ND8B 4R8LA 5G40A 4IUDS 2FSHA 3LHIA 3NQ41 2ODTX 4HN2A 5ARCA 3FA2A 3WB1A 1P91A 4YRGA 3AFGA 3UJBA 1NMXA 3DEHA 3VSCA 1QDLB 3GFTA 1QU3A 3WKCA 1D7OA 4L57A 4ND6A 1UQRA 4FC6A 1Z63A 1PHPA 2WIDA 3ZWBA 1AKUA 1T0IA 5DGIA 4ZFNA 5AHXA 1YL7A 5CDSA 1F2TB 2R5NA 2VP5A 3VUFA 3DWFA 3TPZA 1MO2A 3PLRA 1WP9A 1BO6A 3Q7EA 3TM4A 5D84A 3ZTTA 2Z2YA 1KMQA 4J3FA 2J85A 4TKLA 4H60A 4WXRA 1H3NA 2YXBA 1M2HA 2A1TR 4M83A 5EGNA 5ALNA 1O6CA 1SCBA 3IVAA 4ZI7F 4MCHA 4EI7A 4YBRA 1PWEA 3D0KA 2OHFA 2BZ1A 1ZK2A 4HNSA 3GC6A 4MWCA 4HNTA 4B7ZA 4AK9A 1UM9A 1T13A 1X80A 2X76A 5E4YA 2X22A 1JJAA 1P4GA 2CNOA 3H05A 3QWHA 4C4SA 3UJNA 1PJAA 4QBIA 4CTJA 1PN3A 2PX8A 3K6RA 4LRTB 1PFYA 2OCXA 4GNRA 1B8OA 3B2QA 4LCBA 4M1ZA 4RV9A 4AZ0A 1NVEA 2A9QA 2FUNB 3O5AA 4AJIA 4FHGA 4G89A 1ZR2A 2QW8A 1Z4QA 4LTDA 1D7AA 1SXGA 2OCYC 3CWZA 4GI5A 4B43A 3I0MA 2BHSA 4EAAA 2QBYB 5G53C 5IP5A 3A28A 2WKQA 1TUEA 2Y1OA 4OXRA 2G67A 3ZBPA 3GG9A 1VJTA 2H9YA 4G26A 1XA0A 3U4AA 3VAZA 4BV8A 5ALQA 1MX3A 1UK7A 2ORVA 1V11A 3UAOA 3OQBA 3LBYA 4KX3A 2DPXA 4X1KA 4RTPA 3ZHCA 1OIVA 2CDRA 2DR0A 4P0TA 2C8JA 4URZR 5HF8A 2ZUTA 1GCGA 1L2TA 2C9BA 3QFFA 3GPDG 1QZUA 1J2JA 1SCJA 2HDHA 4HNQA 4TTSA 4YNBA 5THXA 4PSVA 4YXWA 3D1JA 5EYPB 4IOMA 3W5UA 1U9JA 1UR5A 1YR3A 5CW1A 5E3JA 3SC4A 3IUJA 2RGXA 1G21E 5D7BA 4AC9A 3RUEA 3IAM1 2Z3VA 3EQ2A 1YOBA 5IULC 4DMHA 1LLQA 1SCAA 3G23A 4DMKA 2B69A 4K2HA 5MN4A 3ICWA 4JC5A 3PX3A 2FI1A 4PWZA 1E3MA 2V3VA 2FPKA 2J3MA 3RTDA 2WJHA 2DFLA 3S70A 3TN7A 2PL5A 2O05A 1P2TA 3HUUA 3VPAA 3INNA 1E8MA 3PUWA 3RIEA 3DVQX 5ETJA 2NUAB 2ISQA 2ZRFA 1JE0A 2GRUA 3K9QO 5LDDC 1N7IA 2I29A 2ZJ4A 3KD2A 5G0VA 4EA9A 1D2GA 1XF9A 3P2YA 1KZHA 4EG5A 3PDWA 2R6CA 2P3SA 3AJDA 4ZDIA 3W5CA 3CTMA 1KR2A 2H8GA 2C2BA 4PX5A 1B23P 2ZULA 1LH0A 2A1UA 2OCIA 3KQSA 4GP6A 4JBWA 4DDHA 5KNBD 3LFHA 4PSCA 3NBAA 4ETMA 5LLSA 3FYUB 3LDAA 3O21A 4GSYA 4ZVRA 2E0IA 2JLZA 3KDPA 3B1JA 1Z4MA 1UKVY 2H4FA 2H3HA 2ZU0C 1OJ7A 3T9AA 3U80A 5C5DA 5ISMA 3GLGA 5ESWA 4NOLA 1E6KA 1GZVA 1U6IA 1CZLA 2F3SA 3B60A 4HR7A 4RK0A 4RF5A 4MCAA 2RG7A 5AJWA 1JZSA 3RVSA 1SUBA 2ZUCA 3BCHA 4K1XA 2IV2X 4K40A 1E6LA 1P0MA 3A1CA 4OHUA 1ODKA 1D09A 1HYGA 1IFXA 1TVEA 3WWEA 4EGJA 4BGDA 1GFWA 4G8DA 5AKGA 1H66A 1U9YA 1S2GA 2VJKA 3KQQA 3HV2A 5DWDA 2BONA 5KYTA 1H9CA 3MAGA 3COWA 5AVRA 4RK5A 3PSHA 2GUWA 3T41A 1IC6A 4PBTA 2OFFA 1VJ5A 3O8OA 1H2WA 4R8SA 3RHZA 2QT9A 4ZZ3A 2COEA 4CTOA 1V0JA 2YY6A 1T36B 3VFDA 1U65A 3LHDA 4RORA 2WVHA 4DM7A 1ZSYA 1AOXA 2QD5A 4B5LA 2D7DA 2QQGA 1LLUA 1DAPA 1YIAA 2HBYA 4L6CA 4F96A 1RADA 2XNCA 2NU9B 4D9HA 1ZUNB 1QYXA 4B4VA 1K5DA 4E2WA 5HXAA 3SVTA 1ADFA 1S2LA 1F2UB 1QONA 1TCVA 2MR6A 3BF7A 1JIXA 2JGEA 4L8VA 5HOEA 5E8JA 5IYZF 4C03A 3L8ZA 4NDNE 1QRAA 4RGBA 3WWCA 4ZEOA 5TPWB 4B6OA 3L4EA 2OV4A 2X8LA 3KB2A 3C24A 3UKDA 1DKRA 1EZ1A 4FJ1A 5COAA 4GGOA 4QBTA 2EKDA 4KQCA 4L4YA 4PG5A 4UUQA 4ILKA 5KI6A 1AQJA 1GGMA 4MR8B 3AEUB 1WL8A 4O1IA 5JQGB 3AVUA 2QNIA 4BNZA 5BWBA 1J2RA 3CINA 5CIYA 3E0XA 3D3WA 3LUBA 3SJBA 4HYYA 3U4QA 1K8RA 1SEVA 1TCBA 1R0XA 1JEJA 1KYTA 3HKEB 4M9SA 5HKKA 3CRZA 4F60A 3IOBA 3IPAA 5J43A 2WHQA 4DV2B 3OJ0A 5C5CA 4TMVA 1UBLS 4AVYA 1N5RA 5AM4A 5HG0A 4CGYA 3FYHA 3SNKA 2XUKA 4EYKA 1E3WA 1ORIA 4CMHA 2SICE 3IQXA 2AFIE 4BFZA 5KVCA 2ZIGA 1QB8A 4WK0B 3GUYA 5ED4A 3AZQA 4J3NA 2AR7A 2IYRA 2GXAA 5M3BA 2AG0A 4ZYYA 1WB4A 4IDNA 4DCGA 1K86A 3WB2A 1DBIA 3D8NA 3LCJA 1BH6A 1P9WA 1QVVA 3GFOA 3V32A 1Z6ZA 3GJ5A 4AMZA 5A4FS 2A9FA 1ZNYA 2HKIA 1PZGA 4ZT7A 2E37A 3QMVA 1R6BX 3NOQA 1EDDA 1MB9A 3PF8A 5ALKA 3U40A 3WJ2A 4K46A 4NV0A 2OK7A 2QE6A 5D3ZA 3H2YA 3L0CA 2DQSA 4TKVB 3A1WA 4RCVA 4PGHA 5CLQA 4E32A 1SB8A 1N3IA 1V5EA 3ADPA 5L40A 2YUTA 2QB5A 3FTCA 1KJWA 2I4RA 2K87A 3AVQA 2VSNA 3BMCA 3LNTA 4FMBB 2VTDA 2VSXA 4MVJP 3LZDA 5EN4A 1PQ4A 5FO1A 2QRKA 5LA6A 4AS1A 4IPTA 3F9IA 3HN7A 1UBFA 2CNKA 4CU2A 2QTTA 4JYPA 3PGVA 2ZGVA 3FWZA 1E98A 1NE7A 3A6GA 3FXAA 4D6PA 2HJVA 2HEIA 4FGWA 2F1KA 3M3HA 2R8XA 2JFNA 3GEGA 3CO5A 5H83A 1GU7A 1HDXA 1RAGA 1UBCA 3K1YA 3K4HA 1SBQA 4PPGA 4W1SA 1OCEA 4CHGA 4EUKA 5J23A 4XM2A 1SCKA 5BSFA 4GLJA 2OZLB 5CU7A 4IGKA 2OB1A 3QPDA 4PG8A 3OLZA 1I6LA 5LKRA 1NMSA 4UM8B 1WB5A 2QI9C 3PIRA 3RJ5A 3IEVA 1JKJA 4HLUA 3NXSA 1E5DA 2WTNA 4XJVA 3VZDA 4DEXA 4Y98A 3LYLA 4CCWA 4E03A 3L46A 4I6EA 4XUGB 4RD3A 4N8EA 5EUBA 3T1NA 3FHOA 3DMHA 4EY4A 1VCOA 2QT1A 1HR0B 2Z43A 1HYHA 3EG9A 2G4CA 3CGWA 3MLEA 3G2MA 1EUQA 3NGXA 4TZTA 5HKBA 1ADGA 2AYZA 3IP7A 3QVTA 3UJHA 2PUVA 1QIFA 1V1JA 2O1EA 3OICA 1EFPA 2J46A 4V3CA 1A2QA 2CJYA 1UWCA 2PAAA 1XZDA 2VQ3A 2FPLA 4R8KA 4MJ7A 4BNHA 1YDWA 3GLQA 3NHKA 3QVKA 4BFCA 4B6PA 4LMBA 5AI9A 4WXPA 4BO4A 3LDFA 4QWMA 2J4DA 5EWLA 3EIUA 3NP9A 3RG8A 5KYNA 3AEQA 5KPJA 1WHSA 3QVLA 5B37A 1OXSC 4NJOA 5KYWA 1YJXA 3FUVA 4XLZA 3FSRA 2JIOA 3URMA 3F49S 4EQ6A 4EL0A 1E2KA 1QHXA 3QYFA 5CURA 2QX6A 5EE1A 1TC1A 1FP4B 2WD9A 3BMNB 1ZD1A 3BHMA 2C57A 1KQPA 1E61A 1UAYA 3JYLA 1R0BA 4CIVA 2BFDA 2GJSA 3HWWA 1OBHA 4BP9A 2GXUA 4E7OA 4B47A 3GP8A 3PJDA 4DDUA 1R88A 3QU2A 4Y2XA 2YCLA 1Z4LA 2NX2A 2PEZA 2QI9F 4OLHA 3TNYA 5IT0A 2BR5A 2FEPA 3OZWA 5CPBA 4MKXA 4BZZA 1M8JA 1ID1A 1PVDA 3OJCA 4OTZA 3GI1A 4IINA 1FFEA 3TJRA 3R40A 1WF6A 2CDBA 2VJNA 2XZPA 3TE7A 3B7PA 3ZQKA 3F78A 2CC2A 1VPTA 4TXHA 5GJWC 2ZI3A 2JAXA 2JHPA 2O57A 3KYBA 4FKZA 1T2NA 1SIWA 3TJZA 3ZZ1A 4EPRA 1DELA 3BC1A 1JR6A 3OZBA 3UWKA 3HWX1 3DONA 3P9SA 2FDXA 1SCQA 4YRQA 3VOBA 2EYQA 2PPVA 4XYBA 3B2NA 5IWCA 3A9TA 2WWHA 4XA8A 4WKPA 1R10A 3KZMA 3ZHQA 1QLHA 3GLVA 5FQOA 3T4EA 1R0KA 4M55A 4Y9TA 2ZZMA 3GEIA 3RVNA 4FNMA 1DTSA 4ZAXA 7REQB 4B2IA 3T4XA 1TLLA 1H1LA 3K32A 1IZ9A 3WGUA 2OSBA 1L4UA 1KJJA 1PO7A 2PRIA 3E82A 3IYLW 3KYCA 4NFLA 3FNFA 4UNRA 4GMXA 4C01A 2IZZA 3P0RA 3H0CA 4CZ2A 2ENWA 1IN1A 5JPIA 2X7JA 3GGPA 4JUIA 5LP6C 1MX5A 3E48A 4UVGA 2AYYA 1HQDA 1G5QA 1QH1A 2BEKA 4XRRA 5BNFA 1X2BA 2OO3A 3EZLA 1MT0A 4H4CA 4EGQA 1E1RD 4ENQA 1HKHA 1KXZA 1BW9B 5LBUA 2IF0A 3LUKA 1SKBA 2I4TA 4TKUA 5J9FA 2ECQA 2HMUA 1RAHA 1B8VA 3ETNA 3KT0A 1CDEA 3NGLA 4XCXA 1ISSA 1U0JA 2R79A 5LA6F 4AO8A 1M6EX 3WFJA 4M7RA 4MI1A 2WU3A 1KO1A 3CLSD 5HMMA 4BFSA 4RVSA 2H00A 3WY9A 3R5XA 3GYBA 4MS4B 4D4HA 2HIAA 1Y9ZA 1W4RA 3KSZO 2ACKA 2H08A 4BWYA 3P9PA 2E85A 2EFGA 4BMXA 4A36A 1B43A 4QU9A 1T5IA 3P9QA 4Q1CA 3USZA 2W4IA 3Q3JB 3V9PA 4OMCA 4CKCB 3H2JA 5A3VA 5AW0A 2FMUA 4EO9A 3CONA 3K4PA 3AJRA 3DT9A 1N8TA 2W2KA 3DH0A 4OK3A 4MPDA 2Y0BA 4WOPA 4DMUB 4HBZA 5REQA 1N1GA 1P4RA 1QH8B 1JF8A 3WXBA 2DECA 1E9DA 3G6KA 1PR5A 5HUQA 4R5HA 4AZ3B 1D2HA 3DMTA 4G5GA 3O4FA 4MCJA 2QUKA 5ALMA 1GP2A 4X6UA 3WLNA 4LPSA 2B25A 5C51B 1WUTA 3SZUA 5DH9A 3DF9A 3V9AA 1UAAA 1XZHA 4IHKA 3R3WA 4X92A 5JTUA 1YTLA 3FUUA 1NT2A 1VJRA 2DR2A 3QE9Y 4QUKA 4KTTE 2RHRA 1CFJA 1Z5ZA 3PK0A 2G36A 3A58B 1CUDA 2DY0A 4RIIA 4ZGWA 3FTQA 4X6LA 3PQ7A 3L82B 4R9NA 2CXPA 5E3HA 1B76A 3V7UA 2QW1A 3M8KA 4K1LA 4LAFA 4UC0A 3T12A 3RS3A 3ZHZA 4JB2A 5L3ZA 4CV1A 5EJ4A 1R8YA 4RSMA 3WRYA 1HL7A 4OP3A 4JVOA 3G5MA 3ZVMA 3DE6X 3BILA 4ZXPA 3X3HA 3KZKA 3PKJA 3MGAA 4JLBA 4U7HA 4Y30A 5KKCA 1RJWA 2X0RA 2Z2JA 3OPXA 5KX5B 1KYYA 3ESRA 4G01B 3FE2A 2PMFA 3RYFB 3D0RA 4AY6A 3X0DA 2X13A 1KVTA 4XJTA 5IF9A 1CE8B 1Q1QA 4NS4A 3E8MA 3W1VA 3R77A 3GMDA 4L78A 3PLNA 5AD1A 1EIWA 2XJ9A 2FZLA 2ZJ6A 4J9VA 4PC2A 4UE2A 4F4CA 2AEEA 4FQ8A 2OORA 3H9JA 4WGFA 3VAAA 1XI2A 4M0PA 5KQLA 1KPHA 2OC4A 2GD2A 5TDHA 2C2HA 1Z82A 4A0QA 2IYZA 3HJNA 1S4MA 3QTBA 4EECA 2XNHA 5GWXA 2WF5A 4XX0B 4AJOA 3SU8A 1ETHA 2XSZD 3CUSA 2CNLA 1GIAA 3VDNB 4CMIB 1P29A 1VZ3A 1IHDA 2I66A 3IAUA 5KO2A 4I14A 1QORA 2J3EA 4L9SA 4XFJA 1K3TA 2IZ6A 1RC1A 1K8YB 1JEQA 1O96A 1GZ3A 4NU5A 3Q7TA 2QPTA 4RJ2A 4QUDA 3UA4A 4MVJH 3QYPA 4R2MA 5KYVA 4X1IB 4ZI7B 4DLRA 2RHGB 3FDJA 3K9GA 3N7TA 1IUNA 3I45A 4Y9UA 3GDOA 3IODA 3JQ9A 4AULA 3NFRA 5SY6A 1E2NA 2QLLA 1LQUA 1SXIA 3UV7A 3CKMA 1JI0A 1VBKA 1AZTA 3KR9A 4NCIA 5AHRA 3ZS9A 2QLBA 4OHXA 1PV4A 2ZBRA 1NN5A 3GGJA 2ZI5A 1YDEA 4B4WA 4RAOA 1EEHA 1C0IA 3C7KA 4UAUA 1O5IA 1H85A 4ND7A 1GR1A 1S8FA 3EZNA 1R18A 4EUHA 5F3WB 1VLMA 1Z5UA 2CZCA 3EMDA 3RREA 2BH2A 1RXUA 1ZRHA 1ULAA 1FBTA 3D6VA 1VP9A 2BD0A 3ND7A 2ZI4A 4JBXA 3MGBA 4R0MA 1KA9H 1RWOA 1XQVA 5CFRA 3EIQA 1M66A 3BL6A 4WI1A 3O2NA 3F7OA 3D8TA 3CZAA 3SSOA 3OPYA 1ODFA 1LSSA 3SHOA 3UIEA 3RIYA 4AKEA 1XJCA 1KIMA 2VHCA 4FEEA 1XTKA 2H7XA 5E1MA 5J4YA 4BQSA 2OXRA 3HCBA 1PL0A 3OTWA 2A9RA 2AGVA 1C0LA 3GXBA 3TF5A 5BWNA 2BE7A 4FYXA 4RMHA 1X6VA 5EJ6A 3M6MD 3M6AA 1SZCA 2WG2A 2JJ2A 3SIXA 3OM9A 1DQYA 4WGGA 2F90A 3FZYA 1J0AA 3WRYC 1UM9B 2P0EA 1X80B 3HWSA 5B1YA 1HLGA 4MUYA 1TQDA 2JEZA 5KYYA 2H17A 4GWKA 3UMSA 4YXFA 3DAPA 4AW9A 3TRIA 4DAOA 2ERYA 1N2XA 2R47A 5EP4A 4W5RA 2DC1A 3ROEA 1GA4A 3BWEA 3NNNA 4AZ0B 2Z08A 2VDMB 3K35A 2PUAA 2R66A 2PGIA 4NZPA 4PSKA 4I1UA 2EKBA 2QMZA 1I01A 4M9CA 3RODA 3AR7A 3DV9A 3OKFA 4KQHA 1QIKA 2H2IA 1Q0TA 4BAGA 2QRGA 2BFEA 1S89A 3F96A 1L3IA 5CJPA 2QZPA 1WKCA 3H65A 1E7MA 4PFQA 4C0HA 1G6HA 1P0CA 1X1SA 2E4XA 4KJZA 1FNCA 3ZE9A 2Y0CA 2CBGA 4Z1MD 3SOZA 3RU3A 1Z28A 4MUHA 1YULA 4DAEA 1V11B 1TKRA 5LYYA 2X19A 1Z4KA 1AX9A 1C8VB 1RWXA 1TYCA 2HJGA 1P2DA 5ALXA 5IUKC 2UVQA 1OV4A 2PANA 4OQEA 1FFSA 5BQPA 1JLSA 3GHYA 3QKTA 1W5TA 3KQVA 3EZ2A 4GG1A 3E05A 1OC4A 5C8ZA 4NENA 3GLIA 3TLYA 4JX8A 4ZZIA 3T54A 3CHYA 3L8CA 3T0FA 3R7BA 5K8TA 4E70A 4LMRA 3BCRA 1T29A 1IM8A 3JQ9C 4NE9A 1XZIA 4P80A 3SYLA 5I51A 5CH3A 4UBOA 3VR6A 3Q9UA 4CQJA 5KSWB 2IZOA 2I33A 4QU5A 2F43A 1B0UA 3AHIA 5C0OE 3U4DA 2IHUA 5AFSA 3ETHA 3IUSA 4QICA 4YAIA 1QCYA 5YASA 5JJIA 3QITA 3QE3A 1X74A 1Y42X 2WTAA 2GOYA 3B6EA 1AHNA 2X0JA 1O58A 2Q7DA 3YASA 1W4ZA 2DJIA 4HMQA 4W1QA 1HNZB 3OU2A 1GGKA 7GPBA 1NMQA 1P2SA 4DABA 3KTAA 1P1FA 3C6QA 3UANA 2W0MA 2C4TA 3E1KA 1C7JA 3NIWA 1SKQA 3SX0A 2ZAOA 3CT6A 2BPOA 4RVGA 2NMVA 5DX1A 3GLKA 2A1UB 2O06A 4FNOA 3FSGA 1DUVG 3V1MA 1STOA 3O7WA 4H6PA 1HFEL 1QHGA 2JZOA 2V0GA 2XF2A 2H7VA 1PQWA 4DXHA 1OQAA 1GRRA 1RLUA 3Q40A 2OVFA 2MYUA 3OU6A 1DRJA 4C7VA 1XPRA 1MW8X 3D7NA 3K9FC 2PVCA 4DM4A 3GLGB 4EPXA 1K7SN 2YHIA 2AD1A 1E7WA 1I2DA 1OPXA 4LZAA 4ALLA 2I2BA 1E0AA 3G0CA 2V55B 4Z7JA 3U7FB 2C4KA 2G7MC 2C3PA 1T4DA 4MV9A 2ZITA 5EERA 3ABOB 4FFDA 2ZYAA 4FOTA 1WW2A 3V7WA 1US8A 2VSOA 1ZHFA 1UQTA 2VJCA 1L7VC 2IX9A 4XEUA 4NCNA 2GJ4A 1CIPA 3PRKE 2NO0A 4MB0A 1SHJA 1DB3A 1D8TA 2K2QB 4D92A 2IUEA 3C6YA 3KQTA 1YFLA 4HDKA 3FOBA 1CQZA 2VDLB 1GT6A 5FOWA 3O8OB 3PQEA 4FSHA 4JFRA 3AQ4A 4BJ1A 2O1SA 2Q5HA 3BM5A 2AMFA 1J0CA 2CF6A 2R3SA 1ETUA 2A0YA 1DWUA 1YD7A 1XZPA 1CY6A 1EIZA 1WZCA 1ULTA 2WPNA 2ZB2A 3BAZA 4LOAA 1DAHA 4DZTA 1WUIS 4HKTA 4DCUA 5GADl 1Q7EA 4Z4GA 1ZJ5A 1PR9A 5KYGA 2L69A 1DG9A 1GR0A 1RRFA 2EVWX 2FXIA 3MJEA 3QXXA 5E7QA 3KB6A 2ZIWB 3KD3A 3HI6A 3O8CA 1XWWA 1OH8A 2VSQA 1JIIA 4HYQA 3VNBA 5B4TA 3N8IA 4YDHB 2AOVA 3DSRA 5LDHA 1DCFA 1HK7A 3D6JA 1S4QA 1NFQA 4E94A 1P80A 4OXYA 4YPFA 1COWD 1FW8A 3OLCX 1Q0UA 4IQ8A 2R6DA 3CVOA 3KKKA 4ZJYA 4KSCA 3I72A 1LZKA 4Z4QA 1WXIA 1XE3A 4IIYA 4ZVOA 2WSSD 3JWIA 4AKHA 3EFHA 3KVOA 1XG5A 2ZJBA 1SU6A 1J00A 1E6CA 1RRKA 1UDBA 2B1QA 2IEAA 3BORA 3D3WB 2M6LA 1W4CA 3RS5A 2D2EA 4Y6OA 4R0NA 3ZKAA 3U4QB 1A69A 2YIJA 4N3NA 2Y1GA 3IVGA 3M5WA 1DDIA 1DI0A 4CVNA 2VS1A 3CLRC 4NQRA 2XMCA 2GKGA 5CJJA 2FEWB 1KEKA 2ERXA 2FN3A 1E99A 3AG6A 5LQKA 1LC3A 2QLNA 3M2TA 2Y2VA 4A6DA 1R9MA 3DAFA 3CNQS 4DGQA 4EB6A 5BSVA 1NW9B 1E3WB 5A5FA 2REXB 4EF6A 1ZVVA 2C0CA 1SJ9A 1C3EA 2FTKE 5HKOA 2P2NA 4LJ4A 5F7JA 1OAOA 4ID9A 3W78A 5BXYA 4OJMX 1PR2A 1SQ5A 2WTXA 2PZEA 3W5HA 3BQNB 4CIXA 2AW3A 1JAIA 5FHRA 2CXXA 3V46A 2RBKA 1M0EA 4XIFA 2XB9A 2LBPA 2BBWA 3KPUA 4H08A 4IG4A 1T2UA 2YFKA 2BHRA 2KQUA 2HF2A 3DTVA 4EG0A 2H5JA 5DEIA 2O8CA 1POXA 4YI5A 3VSAA 5J40A 2RGCA 1P5HA 3MWEA 3BMCB 4FC7A 5BW8A 3EVGA 2IITA 1T0HB 3MB8A 2AMLA 5LA6B 1Z47A 4OH7A 2ZRIA 1V8FA 1VQ1A 2VJBA 2VJDA 2Q0HA 4A0HA 3FNGA 4R41A 1ABEA 1RJDA 3BJRA 2G82A 4B7UA 4XFDA 5FIUA 3GDFA 3ZWQA 2PMEA 2YJ5A 2X2PA 3KOUA 1ZL2A 1PR1A 5I7EA 1K9SA 4F4DA 5GVSA 2OKGA 3R5TA 1YMQA 3QWAA 1JMYA 2OHHA 1MQSA 3LCMA 1W6RA 3PA8A 1HUQA 3ZCRA 2IOQA 2VDNB 2WP8J 1FY2A 2XE8A 1E94E 2WT9A 3EYAA 3TDKA 1G5HA 1NE2A 1SUPA 1SKYB 1Z2PX 3G2KA 1YZUA 4MUKA 1J2TA 4MJXA 4RVOA 4D5EA 5BRAA 4D25A 4DLSA 1XELA 5AH0A 3MOGA 1JKJB 1VDZA 2QX8A 3HCAA 3K5HA 4RNCA 4RLSA 1AO3A 1XRJA 2Q5EA 3K1JA 5ED0A 5A2QA 3SD7A 1SG9A 3D2LA 3LZ6A 5CD9A 5BSEA 2X3UA 1AK1A 1LFDB 2QX4A 1R6DA 3DPUA 3HACA 4PZLA 5DW0A 3HSSA 3K6SA 1JIUA 1A9YA 3EG9B 1G64A 4OXKA 1T2DA 3U3KA 3WO1A 3NHFA 4HDSA 3DC2A 3JRXA 4QQRA 4UHBA 1D6MA 2LIPA 3BE5A 3V8RA 1EFPB 5EPUA 2HK7A 5C3MA 4IVRA 1SCNE 5GP1A 2H3EA 3P2KA 3WRXA 3ECAA 4ZCTA 3NMUF 3D7RA 3PX2A 1TF7A 4D5GA 5EWLB 5M2QA 2Y4OA 3AEQB 3KK0A 3PQ8A 1WHSB 3FOAA 1PV1A 4RF2A 2BM0A 4BB5A 5B7GA 1II9A 3JD0A 2A5GA 2XBUA 4QFCA 5BQOA 1B74A 5AXBA 2J5QA 1OKKA 2JGJA 1F38A 3E7DA 4JI1B 4EQ6B 5JOQA 1FRVA 4ANFA 3UK6A 1USIA 4N9WA 1VE6A 3KJFA 1R6XA 1U2RA 2Q3FA 2YX1A 1ZITA 3KXPA 3S1SA 3PWZA 1H22A 1C0KA 3K0AA 4M0UA 4YK7A 3VHRA 1JA0A 3OO0A 4TTJA 3FY4A 4DTCA 2BFDB 1ISHA 5HIJA 4HDOB 5TJHA 6Q21A 1SC6A 2QR3A 2CVZA 2I4LA 3BXXA 1HI9A 2P11A 4IKPA 1P2GA 4WNCA 5HHTA 5ENZA 2DH6A 5B58T 2ZI7A 3AIKA 1CSEE 3KWJA 3LWNA 1Y3AA 5KU1A 4YXWD 4U7JA 4IV5A 4DC1A 4BN5A 5DLPA 4XDZA 4CFSA 3K2QA 3G5TA 3I9JA 4GHWA 5FB3A 3OFSA 4X00A 3OHPA 3V4OA 4CDNA 2NIPA 6LDHA 2IHVA 3MTQA 3MCTA 3N2KA 1ZHHA 5C1PA 1TD1A 3G82C 2WQ7A 2X0NA 1YRYE 4D0SA 4NECA 4ZYTA 4TLAA 3SJCA 4MRAA 4GXRA 1PUXA 1Z2NX 5KSOA 1A9OA 1IYZA 1NU6A 3TQRA 3ZGYA 3ES9A 1PX2A 3OCCA 2D00A 1FSPA 1FQJA 2HEGA 3AL2A 4JQSA 3CN7A 4JC4A 5CIQA 4L7QA 2R25B 1CUXA 2HNKA 1P7VA 3M4XA 4WZAE 3TG8A 4XIGS 3NHLA 1QNFA 1QOQB 2PD3A 3WLLA 1TK9A 1ZM3A 5BN4A 1H1LB 1N6NA 3SHQA 4ZVKA 5DYIA 2OQVA 1R0YA 5GMOA 3KYCB 1V5FA 2VJYA 4GDFA 1XKQA 5JZOA 1GJRA 4Y2VA 3T3EA 3AIIA 3CUWA 3ZBTA 1BCSA 3Q8WA 4FEAA 4CKZA 4UJ3A 1U6JA 3PXBA 4MHOA 2YV4A 5IK2A 5FBWB 1QH1B 3HKDA 1NR7A 3RYHA 5SY9A 5A3RA 3WZ2A 1GCOA 1TGYA 4QPPA 3W1EA 5FV4A 2YWDA 2XCOA 4M21A 4HG2A 3SKYA 5K0FA 5HCIA 3HA3A 4TKUB 4O63O 3U26A 1IN6A 1OXUA 1QYVA 3G17A 3KVVA 3LHFA 5HGXA 5ICSA 3AR4A 1N5DA 1EI9A 1P1KA 5A05A 1QE3A 3WRXC 2W6PA 4UAGA 5DMHA 1NMZA 2DPLA 4J2TA 5CA0A 5T5QA 1P81A 3SWWA 4BVBA 3T7AA 4EPWA 3K70C 1TX4B 2B83A 3DLHA 3HP4A 3LW7A 1SUSA 1KHHA 4EG8A 5TNXA 4XASA 3ZLVA 1D2AA 2PH5A 3FDXA 3LS2A 4GVPA 1YHZA 2XIQA 4FDAA 3DB2A 3BTOA 2CBZA 3ORQA 1XV5A 2UUPA 2AI2A 1Z16A 3EEYA 4P3OA 3C16C 4B7XA 2Z5GA 3RFFA 2G6BA 1PBNA 2HMTA 2W2KB 4A82A 1YDHA 4RKWA 2WOJA 5REQB 3WWYA 2O4CA 2Q0XA 1Z6XA 1TYEB 3DQZA 4ER0A 1P7YA 4X3PA 5A4IS 1T1SA 1KJ8A 2EBUA 2ZRQA 3HZHA 4HGOA 4HZIA 5ER9A 2P9EA 2Y3IA 1I94B 2JD0A 1Z08A 3B36A 1I36A 3IRUA 4ZGBA 5BSWA 2CEKA 4INZA 2JI7A 1P19A 1R00A 2IDJA 3ZK9A 4OQZA 1LNQA 3PP8A 4L07A 4BIIA 1MTZA 2OHGA 1CDOA 1B6RA 1CRWG 2XNDD 5EIBD 4CMGA 1MIOB 621PA 1JHQA 1VBNA 4G5SA 1Q92A 3TTVA 5BNTA 3UENA 1F0KA 2CL7X 3SM3A 5IC6A 4K86A 1LJ8A 4D9GA 1B4DA 1QG0A 3OX3A 4K0KB 3PHGA 2D4AA 2PBLA 3H3FA 4BFXA 5EIWA 1DQZA 3F7TA 1GQFA 4ABTA 3T7TA 1L5SA 3PKZA 5BUSA 1VKNA 2E5WA 2EFJA 4Q82A 1DTEA 4WW0A 1EZZA 1Z74A 5D86A 2Y0PA 4YUVA 4QUBA 1T2CA 1JHOA 3JQCA 3PVCA 2Z8XA 4QOJA 3ERCA 4CF3A 5KTMA 1ONSA 2R48A 3DVRX 5KQPA 2CV2A 1TVKA 1GFZA 3LP8A 5D5PA 5ECGC 4XGKA 3V5NA 4D1YA 4E09A 1AHIA 2JCYA 4ZJZA 1J24A 1OFHA 3M4ZA 5CG2A 1EFKA 3FYCA 1GRVA 3WK6A 3BZWA 2ZW9A 4OK5A 3WS7A 3Q11A 1V1RA 3TLZA