4FXOA

Zinc-mediated allosteric inhibiton of caspase-6
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
267
structure length
219
Chain Sequence
b'KREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVKQVPCFASMLTKKLHFFPKSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Zinc-mediated Allosteric Inhibition of Caspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase
total genus 59
structure length 219
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fxoA00
4N6OA 4JR0A 1GFWA 5LU9A 1SHJA 1PAUA 3D6FA 1SHLA 4PS1A 3R7NA 1NMSA 1RWMA 2DKOA 4DCOA 4EHLA 4HVAA 5H0IA 2CNLA 3SIPA 1RWPA 4ZVTA 2J33A 4N5DA 1I3OA 4QUJA 5IC4A 5LUAA 2C2ZA 3KJNA 4QUHA 2FP3A 3D6HA 4N7MA 4ZVPA 1RWOA 1RWXA 2CNNA 4AWBA 2CNOA 3DEKA 2Y0BA 1M72A 2J30A 3KJFA 1RWNA 4NBNA 4QUEA 4I1RA 2XYPA 2XZDA 2HBQA 3D6MA 1K86A 4IYRA 1RWWA 2QL9A 3H0EA 5IBRA 4ZVRA 4AW9A 1KMCA 3R5KA 4N6GA 3IBCA 1CVRA 1QDUA 1SC3A 3RJMA 1I4OA 3S70A 2CJXA 5IASA 3NS7A 3PD0A 5IAKA 3UOAB 1QTNA 5IBCA 1PYOA 5K20A 3P45A 3NR2A 4EHKA 4ZVOA 1K88A 2C2KA 3R6GA 5LU8A 1I51A 3IBFA 4QUIA 2XYHA 4ZVSA 4FXOA 5IBPA 2C2MA 5IANA 5IC6A 2HBYA 4NBKA 1RHMA 3GJTA 2AR9A 2QLBA 4FDLA 4HQ0A 3K7EA 3ITNA 4NBLA 3OD5A 5IAJA 3R7BA 1RHQA 4NOLA 4I1PA 4QUGA 4ZVUA 2HBRA 4EHDA 2H51A 4JQYA 3NKFA 2H65A 1IBCA 1GQFA 1BMQA 2J31A 1I4EB 5IAEA 4EJFA 1QX3A 2WDPA 2HBZA 2J32A 4PRZA 1RHJA 4LSZA 3V6MA 1RHUA 1RWVA 2Y1LA 3GJSA 2XYGA 3P4UA 4NOJA 3V4OA 3DEJA 3H13A 4JR2A 1RHRA 3GJRA 4EHHA 4QULA 5IAGA 4FEAA 3DEIA 2QL5A 4DCPA 3H11A 4QUDA 2NN3C 4EHFA 2CDRA 2CJYA 1JXQA 1CP3A 3PD1A 4QU8A 3V3KA 3V6LA 4D3YA 4QU0A 4M9RA 4EHAA 5I9TA 2H5IA 4JJEA 1SC4A 3BIJA 3E4CA 4N6NA 3SIRA 4JR1A 2C1EA 4AWAA 4JQZA 2H54A 4QTXA 1NMEA 4NOMA 4QU5A 4QU9A 3H11B 3EDRA 4JJ8A 3PCXA 4JJ7A 4NOKA 3UO8B 4QUAA 3GJQA 4HQRA 2FQQA 2H48A 2H5JA 5JFTA 2P2CA 4ZVQA 5IABA 1RHKA 2CNKA 3DEHA 4N7JA 1RWKA 2QL7A 1ICEA 3KJQA 2H4WA 2QLFA 2XZTA 5IARA 4IEFB 5I9BA 2FUNB 3R7SA 4QUBA 4EHNA 2QLJA 4D3ZA 4JB8A 4DCJA 3R5JA 3H1PA 1F1JA 3V4LA 3S8EA 4D3XA 4QTYA 5LUBA 4FGUA 1SC1A 3EDQA 3R6LA 4PRYA 4PS0A 1NMQA 2K7ZA 2H4YA 3QNWA 3V55A 1F9EA 1NW9B 2C2OA 1RE1A
chains in the Genus database with same CATH superfamily
1KJZA 1IIBA 2EZUA 3SZOA 2GKOA 3SPXA 1UMDA 1WP9A 4C6HA 1FVOA 1X7XA 2Y6UA 1A2KC 3D6NB 2CHVA 3FUXA 3ROQA 3V7FA 2IFTA 1E9EA 1EFHA 1DQZA 1FUUA 2CGEA 2ZRHA 3FCOA 1YHNA 4QXAA 1VCMA 4XLLA 5AK0A 5KKAA 3WGTA 3HYTA 1YB5A 3AB3A 1YS4A 3AL3A 1J90A 3DXXA 1HSOA 5BVGB 4AECA 3KPWA 3ORRA 3IPRA 5FT9A 1KO8A 1ESEA 1RLTA 2DBQA 3BVPA 3FWZA 3GCXA 4QBIA 4QYSA 3M83A 3VI3B 2V45A 3RRJA 1CHDA 1NATA 3LIIA 4G36A 1EK0A 3TVYA 4EF6A 4OGFA 5HF6A 4JXXA 1E3IA 3SVTA 1RJ9B 1H69A 2R6FA 3BXPA 2TMYA 2HDNB 1I2BA 3PS9A 5AXCA 2DUNA 1ZUWA 2BHNA 4YASA 1K68A 2BKEA 1T5BA 2JFWA 2AG0A 1CQZA 2DY0A 2ZYUX 1DO2A 3COWA 3HEMA 2QNBA 5BSRA 1GV1A 2VQEB 4ODIA 1LRJA 2DC1A 4HQKA 1ADBA 2NUBA 3OE7A 4KIJA 4R8RA 1A7AA 2ZQ5A 3RG2A 4Q5IA 2FFAA 1KP3A 1A8UA 3LQRA 1ST3A 2CUZA 1XZMA 3MTQA 3ZHZA 2J5QA 3B6ZA 5G4KA 1E3LA 1NFRA 3KZVA 1AUPA 2QTGA 1YZUA 3H9JA 4BMZA 4B85A 4NXMB 4JK3A 1MA3A 3HYCA 5ALEA 1GPYA 3QPDA 3BIXA 5DIZA 3A6JA 5E1MA 1IXKA 3GCWA 3B60A 3SN6A 1DAEA 1ZA1A 2A9QA 2YS6A 3B1JA 2PX4A 4IIJF 4FNMA 3SC6A 2P1DA 3NWJA 3F9RA 1YOBA 2R6HA 1FFCA 4G26A 4M76B 3ZIUA 5A5EA 3JRNA 3CTPA 1AKMA 2IYEA 1WPRA 5ICCA 3WRXC 1D5WA 3VHXB 2WE7A 4UTOA 1QHHB 1E9CA 1W2HA 2ZYRA 4ZO6A 3UAYA 3X1XA 1S3SA 1V9CA 4NCJA 3OURA 4LYHA 5DFAA 1M33A 3FSGD 3NTRA 3AT1A 4QU8A 5EUMA 5LC1A 1TYBE 3D59A 5DHTA 4PNEA 1J8YF 2WSBA 1B4DA 1SXJA 4I46A 4RVGA 3WKDA 4GNKA 5FAKA 2G83A 1CEEA 1ZXXA 3RD5A 3KJIA 5AI9A 5KTPA 4PYMA 2D5BA 2QIPA 2ZCUA 5J59A 3AKDA 3GGOA 2ZANA 3GUHA 4MR8A 2XRZA 3FE2A 3FWNA 4UM8B 4Y6GB 4FX2A 5HIIA 5TQ0B 2PZAA 1IUOA 1KBZA 4BPRA 4OQEA 4B3RB 3KKPA 1FP7A 2R5WA 4C78A 2Q46A 4BYGA 5I9LA 2CFRA 2O1XA 2EF1A 5KNCD 4G65A 5LQAA 1DC6A 4KREA 3P1JA 2HXSA 3HZHA 4B84A 4B17A 4F8JA 4Q16A 2PUCA 3O8QB 1B6GA 2DQYA 1K7EB 1N7JA 2ZTUA 4DLNA 2PLRA 1RSZA 4M0LA 5A4KA 5IPFA 4UEKA 1RRCA 3DKRA 4Q9KA 5EP3A 1GTMA 2Z9DA 1U6JA 1Y4SA 3SSOA 4W8GA 3ZW9A 4B4VA 4GR5A 2W6JA 3EVZA 4LWZA 2YY6A 2V3WA 5C32A 1ZGCA 1NMQA 4DG5A 3I52A 1XR3A 2ODAA 2GBLA 4PHGA 3CISA 4KB5A 3B82A 1XCJA 1IBRA 4DLRA 1LI4A 1YC2A 2E4XA 4F1KA 2OVBA 2WIGA 4MKIA 1N2OA 1T0BA 2RGGA 2ZZKA 2Q6TA 4HUQB 1TKAA 1GZDA 3CX7A 3RCBA 2PA0A 3ZKWB 1NDHA 4ND6A 3H84A 2BDTA 4HWRA 4P4NA 1TE2A 3HKEB 4N0MA 4WY8A 3H8VA 1W73A 3GUCA 1UMBA 4I4TB 3X43A 1AV7A 2BF7A 3GH3A 5I7VA 3HE3A 3IQFA 3THOA 3PI7A 3DE1X 3N58A 4GOOD 2R48A 3MRXA 1DBSA 1TFUA 3CG0A 4EJ0A 3TIFA 2AE1A 3HKEA 4ZQBA 9LDBA 3HJGA 3M5DA 1T9KA 3WLOA 7ABPA 4URWR 3A1VA 2FNAA 2VXYA 5LMNB 1W0JA 3FJYA 2I3ZA 4GBED 3HRHA 5CFRA 4F5YA 3E1KA 4BNLA 5L7WA 5BSUA 1E2GA 4Q1DA 4X3CA 4GDFA 4ZAVA 1FRFS 1GQRA 2OECA 5G40A 3T1VA 1E9BA 1T5IA 1YR2A 5BWLA 3LDFA 4KX3A 2HKIA 4OG2A 4JSRA 3LWDA 2JEOA 2Q0SA 2GESA 3GJTA 3UN1A 2P4QA 3W5VA 5K7SA 3TQQA 3OM9A 2IV3A 2ZRCA 5FL3A 4DLSA 4X62B 1SUPA 2Y1FA 2EERA 4HXEB 1T1JA 2DUUA 4NCHA 1CIVA 4G81A 4BTLA 5A4FS 4ANFA 1CR1A 4YFYA 3P9QA 4I81A 4PQYA 3JAKB 3WYDA 3KKZA 5LQCA 3EDCA 2LV8A 2WWYA 3AM4A 3S3TA 3T5DA 3LBHA 4KYVA 3KZMA 3V4VB 1ZFNA 2WAAA 4GGPA 1T34A 3B9QA 3WSWA 1DIAA 4CM6A 5EERA 1YB7A 3HHEA 2JHFA 3DZFA 1CJCA 2BM0A 3LQ1A 1QLWA 4QULA 3WLTA 4YCCA 2ZTVA 3PFBA 4GZ3A 1PT9A 3G2LA 3JAKA 1PJZA 2BCGY 4HAUA 4UVDA 3TNYA 1LDNA 2IZ5A 3TFWA 2EXXA 4BU1A 2OGWA 3IAM1 5T8KC 4OB8A 4L8VA 4UNSA 1GRRA 2RIPA 5BP7A 2VDNB 1EFRA 1GNQA 3P2YA 3LX4A 4TMYA 1LI5A 2JCVA 3EVCA 5BUQA 2J67A 2AN3A 3H83A 1XVVA 1JT2A 3E1SA 3IALA 1PW7A 2PEZA 2I91A 1YQUA 4M36A 1DTWA 3HA7A 4H3VA 1KQ3A 2HEGA 4FWTA 1MU0A 2W42A 2CV1A 2IL1A 1PV1A 1U9ZA 4MVJH 3QXHA 1EGHA 5E6RA 4K0RA 3CR8A 1TYEB 2OD9A 5FOXA 1RDFA 1KI3A 4L0MA 2G77B 3KTOA 2H9AA 4CM4B 5C80A 1GZ7A 5HKOA 4WECA 3EUWA 5CG1A 1U3VA 4JYMA 1JBEA 3CT4A 4A4DA 1F1JA 2X7XA 3IDZA 3DR3A 3I45A 4EP1A 2WV9A 1QH8B 3VR4D 5KVAA 1U11A 2ZSBA 4QOJA 4LXTA 1DSSG 5FORA 3LZDA 5SICE 1BKYA 3ISVA 5EE3A 3SJAA 3KQLA 4G9GA 2H92A 1HDCA 1Q92A 3VX3A 2ONZA 4X6UA 2NOAA 2BWJA 4NFHA 3ACDA 2F43B 3BSYA 2AB0A 3NC4A 4HK4A 4MV1A 2CNLA 3F46A 3KFLA 4J1TA 1M5RA 1QP0A 4LC9A 2VQFB 2IOFK 1JXMA 4B6QA 5LLDA 4MWTA 2WWGA 4ZEMA 1XJQA 1EVIA 1B3BA 1E0KA 3FFXA 3KJNA 4M9QA 4LRXA 3SS8A 1GTRA 2GCIA 2FAXA 1CUGA 2QQ0A 1H65A 1I0ZA 1MB2A 1OLXB 4EW3A 1A1SA 3I1IA 4KKXB 1SQ6A 4LF6B 2ZB3A 4AZWA 3SVZA 5CFZA 4ARIA 3U4CA 3PE6A 4CF7A 1JEJA 4BVHA 4R98A 2O8FB 4LX0A 3ZW8A 1R4ZA 4DDKA 4F6RA 5K0SA 8ATCA 3D4LA 1OLXA 3H97A 3QYJA 1XVTA 1CLEA 2PZFA 2XB6A 2I1VB 3ZWXA 5AM1A 5TGZA 4FR2A 2HQRA 3ZPXA 1Z82A 3U5ZB 4KNWA 1XB2A 1SBYA 2YZMA 4XSHA 4DV6B 4L6CA 4EPXA 4J43A 3OOWA 4ND3A 4YJ3A 4IY1A 1WSBA 2ZYSA 3CONA 3IEIA 3HDYA 5HSGA 3ORFA 3UQZA 2C5AA 2PJDA 4WEQA 4DUYB 5TS3A 1JL3A 4XYLA 3AR9A 3PUWA 5JO0A 3I04A 2E4UA 1YV9A 5GGYA 5I4CA 1Y6ZA 4QYTA 3U44A 2P9QA 4FGSA 1KMHA 2EBUA 3PC4A 4IDHA 4RA6A 1ZK2A 3TQIA 4BE7B 5LQKA 4MW2A 4NYIR 1C0IA 1CRLA 2CNBA 4ZQEA 3RM3A 4I66A 4L4RA 1Q6YA 4ROSA 3UH0A 3K8QA 3GRCA 5F9HA 4NAUA 1C30B 1JJVA 4DS3A 4RD3A 1AB5A 1XMXA 4PPGA 4EI8A 2EG5A 3X1MA 2IXBA 2V97A 3NP7A 2VHEA 1NQWA 4MUHA 1T8RA 1MENA 3JQGB 3O9VA 4GPIB 1WXHA 4HEQA 5B7QA 1PJ2A 3SJCA 4WAUA 4G6ZA 2BFEA 4D44A 4KI0A 1T9GR 3R8FA 1E96A 2B34A 3I64A 4DAOA 3KVNA 2A0YA 3W9YA 2P5TB 3VPHA 4DUZB 4Q3KA 3WFJA 2RH8A 2DG2A 3ZLVA 5D5HA 1AMOA 1XVIA 3HN6A 4O2BF 3VZPA 1IQ0A 2DYKA 2FSHA 2ZBRA 3DE2X 4ZP1A 5TNXA 4MR7A 3CWQA 3P2EA 3UT5A 2D7CA 4WKCA 3T9AA 1U1GA 3VJRA 1EJ0A 4JC8A 2GAIA 2P4HX 4TZKA 3GYBA 1D03A 2Q50A 2PLFA 3DTVB 3RVBA 4HNVA 3VYRB 1QCDA 1RWBA 5ALUA 1N8TA 2R97A 1II9A 2HGSA 3EA5A 5F9FA 3PXGA 3PFNA 4JC0A 1K92A 2Q9BA 4XOUA 3M6FA 4JBYA 4BV8A 3GWZA 2Q7DA 2FF5A 2FU5C 2GA8A 5DASA 1OTYA 5AM4A 4F2DA 1TVKB 1F9EA 2HTEA 4PZYA 2R8YA 3RYFB 1EWVA 3N53A 3HUTA 1PT8A 3H2HA 4TYYA 1CUVA 3H1FA 3HVJA 4RY8A 2BFPA 2IY7A 1S1MA 5LZ4A 1XNRB 5JS1A 2IPOA 4NZZA 1N32B 1NRIA 1X1CA 3NT4A 3SR0A 1T26A 2OGSA 1IOVA 1B14A 1WZNA 3F3KA 3FYTA 4MJ3A 4EKEA 5TF0A 5MGNA 1OLUB 1DJLA 2R8ZA 3AETA 3B6KA 2W93A 4WGFA 4RVNA 1T2EA 1U3FA 3QEAZ 2GF9A 2W48A 3L7KA 4PCAA 3THXA 4MV5A 4F04A 5JDCC 2QD4A 1ZMOA 1P2DA 2WOJA 4RU1A 2IOQA 3HKCA 1GM5A 2QPOA 3SBDA 1X0VA 2P8JA 3DAGA 3K0KA 4D97A 2QM7A 4YCDA 5HQ3A 4EF5A 2E6KA 3O8DA 3OCYA 5EIBD 1XTRA 4JQOA 4LFCB 1O9BA 3BRWA 2B2NA 2W6IA 3OUZA 4LAFA 1Y8CA 3VSAA 2H3EA 2QUIA 3WLPA 4L76A 1XLTA 1ZG3A 1QHYA 2PG3A 4D9HA 3GLKA 3O5AA 2FZCA 2D2VA 1R10A 2GTPA 1KJ8A 5K3DA 1I1HA 3VDMA 3WWYA 1Z5ZA 4M83A 2W22A 1XPJA 3JQ9A 4R3NA 5CDHA 1ES9A 4NBLA 4LNHA 2EVWX 3RLFA 1HDIA 3Q5EA 2X9VA 2I6FA 3RSLA 1KJNA 2W6QA 4D4GA 4C4PA 5CLLA 2PUVA 1Z38A 1UOPA 2V96A 1JAHA 1HLDA 1JQBA 4HWTA 1F2VA 1EHCA 4UBNA 4Y2VA 2ID7A 1TQ2A 4IIUA 1Z29A 1NF9A 1Q57A 5D00A 4GGMX 3TQFA 1DGQA 1E4VA 3LQ2A 2OPHA 4XDZA 2V6JA 4RPGA 4XJTA 5COBA 2QE7A 2H1SA 2OYRA 4IJUA 2UYOA 5EIBC 4DMGA 2MINB 3L7CA 2FWAA 5FXMA 2F8SA 3WL8A 5HZHA 2Q6LA 2HJVA 3OF3A 3EF0A 5IDQA 2ZM5A 4MHTA 4JJGA 1KJQA 3A3PA 3V6LA 3VR6A 3QKRB 1L5OA 4NBVA 3WICA 2OD2A 2OZPA 1H8HD 1GRNA 4F2WA 2MINA 1N6RA 3PTZA 1R6DA 5FL7A 4LMBA 1SC4A 2Q28A 3GLTA 3T9CA 4OXRA 4G8DA 1HTBA 3F78A 1JDBB 1U8ZA 2OZVA 2FZVA 2IF0A 1AKWA 4G56A 2NADA 2R1TB 4GVLA 3QKRA 5EZ6B 3OMWA 4KK4A 3P9XA 5CDUA 1MVOA 3UO8B 3LY8A 5JEEA 1OTXA 2AYYA 3EF1A 3QRWA 5KJ6A 1ILWA 4MYDA 1KH1A 4MRPA 2E4ZA 4XIYA 5THXA 1G7CA 4KWEA 3RNLA 2FZKA 3RREA 1KSHA 1SUFA 4DL9A 3DEHA 4DT1B 4UD2A 4GBJA 4U2FA 3KJZA 1RQPA 3OF5A 4OFZA 1PV4A 1XGKA 3WADA 4EUSA 1VIYA 1BAPA 4Z9XA 1STOA 1Y7IA 3G49A 2B8JA 5BQFA 5KTNA 3T7IA 3BWMA 2WYWA 1Z75A 4QSMA 4YT5A 2JIDA 4B87A 2PSHA 2IY8A 1I4WA 2X9NA 4UUOA 2EJUA 2GN9A 1OT3A 2UYCA 1A9XA 4DVJA 2VUTA 4V0MA 3N0WA 2IYPA 1FEZA 4B3XA 3A37A 5B53A 4NULA 4PAGA 1UC9A 4LOHA 2DUWA 4AZ0B 3QLUA 4QAJA 3N3AC 4M1KA 1K89A 3LWZA 4RACA 1EFPA 3MHPA 4GIBA 1AUVA 4KHPB 1TIKA 1HYEA 3QZUA 1YFLA 1JR3E 1ZCAA 2I6TA 3PJEA 4MDYA 1D2GA 3NETA 2PK3A 4GOJA 2C9YA 3QOXA 5HKLA 3DG9A 4BBZA 4RV4A 5EIXA 3RE1A 4PSDA 2I62A 3PE4A 1Z36A 2YN0A 3W3AA 5CK4A 5FUBA 4H35A 3IV6A 4JXKA 4N7MA 4MV4A 5DK4A 4HNUA 1QBKC 3FCSB 1P2SA 4HGQA 5FBRB 2JIOA 4TZ0A 2PT5A 1YL5A 2BGLA 2EATA 4QPJC 3HGMA 3R7DA 4BB6A 2R8PA 2PBFA 1FK8A 1X7HA 1US8A 1LK0A 2HMYB 3GEBA 3VH4A 4CF5A 1NBMA 4FI3F 2IH2A 1DAIA 3G02A 3NZEA 3SCZA 1DPFA 2JFUA 1F4VA 4TXNA 1TVEA 4X7PA 3OAAD 4RDHA 4YUZA 3MTEA 4M38A 2P30A 2PXXA 2WYUA 1QAOA 2GBCA 5HEKA 3ZVKA 2CXSA 3CQ9A 3MMXA 1Y1QA 2ZJ2A 3WV4A 4WMLA 2ISQA 3QH4A 3SR4A 1NVTA 3HBAA 4E13A 1QYRA 5CBPB 1E18A 1SQFA 2VRWA 4DCCA 1L7QA 3LX6A 1KP9A 4P4SB 1M0TA 1VJ5A 2XA1A 3T7KA 5D6OA 3HJTA 3VX4A 2YTZA 4YJ2F 4M60A 1YJQA 2OUIA 2FFQA 3MCTA 1HT1E 3ORQA 4GOMD 4IQ0A 1MH1A 3RKUA 2JFFA 4LQLA 1KIAA 5CNIA 4EFLA 1YFKA 2Q4BA 3SJUA 4Q4DA 1AQJA 3F8SA 4K88A 1MO5A 1XQXA 4HEA1 5BSGA 3C0KA 3DGFC 3F7OA 1LS1A 3HCNA 4IHKA 3W5SA 2BMDA 3T3GA 2Z3WA 1EGVB 4B6OA 1A96A 4IQFA 1KC3A 3AVOA 4LOAA 4OL9A 4WZBB 4EGFA 5BSVA 4Q9LA 4LV6A 5AVKA 4NBSA 1XAHA 4CR8A 1JEEA 1FRVA 2JCXA 3IMCA 1VHQA 4FFMA 4F93B 1T8SA 1NTRA 3DO5A 4L15A 4LYEA 5FEMA 2WFLB 1QE0A 4EYSA 2Y2VA 5M7EA 2V0GA 1IJBA 3PXEA 5IF3A 2IBMA 1FVXA 3HCEA 3LECA 1G66A 4M22A 1N2CE 1RM3A 5F78A 5B6IA 3ADBA 3AVUA 3NRCA 5ESWA 1CY4A 1N5LA 3GRZA 5I7AA 4HXFB 5J2TF 1MJNA 4N12A 5BNWA 3I9LA 5BV7A 3KDAA 3NX4A 1B00A 2WFLA 3C6MA 4M53A 4Z7JA 4OHUA 5C31A 3HXOA 2R8BA 3I3SR 1UFOA 5BV2P 3IDFA 3KOXA 3NBFA 3RRMA 2CLFB 3ADDA 1WR8A 3OTHA 3A6FA 4OY3A 1J9GA 3ZE2B 4JKIA 1SD1A 4X3PA 4XUEA 4PEVA 3SZ3A 2YIVX 4BNIA 3UAOA 3NKLA 1OWMA 1P1BA 2PZLA 4K26A 2YVLA 1N92A 1N75A 5IG2A 4ZU6X 3VVBA 4HSEA 1KETA 4OHVA 1XTIA 5LP6F 1U9IA 1F5NA 4DIEA 4JB8A 1YS6A 1X1TA 5B2ZA 1F7VA 1R27A 1DAMA 4WESA 1QIIA 3SX0A 1TEZA 2J3QA 1TM1E 1UZNA 3LDGA 3AY0A 3Q6MA 2RI0A 4GECA 2QX4A 4MKGA 4ZCPA 2H06A 2NX2A 2WHRA 2AVDA 3B3AA 4K1XA 4WFJA 4Z54A 3I9KA 3OIYA 1QRTA 1THZA 3WQQA 4KHZA 1P81A 4IHJB 3LY5A 1L8OA 3QWAA 2MIIA 5GONF 3GEPA 2ZB2A 3CRQA 4H3KB 4U39A 4YTEA 3H2BA 4B8WA 3A9CA 1M8PA 1KYVA 3AK4A 1ODIA 2QY9A 3PNKA 1Y3AA 3PWZA 1V7PC 1D1PA 2IC5A 3MWFA 4LZWA 4IHJA 1TZ2A 4E11A 1DE0A 3DV2A 3I0MA 3MJTA 3OIDA 1T4GA 1U99A 2R9VA 1JR2A 3ELUA 3JYLA 4KVAA 3ZLTA 4AMGA 4ENRA 3IUJA 2HSZA 3CGGA 1VL1A 1NPTO 2A9JA 1YC5A 3G5AA 3L8GA 3P2KA 2Z6UA 2UYYA 2VP2A 1FMCA 4L16A 4P3NA 1Y89A 4ZICA 1SVLA 2QL9A 4MLCA 3DM9B 2Z2IA 4GMFA 2XKKA 5AM3A 1T10A 3MJCA 4K9KA 2ZTHA 3W2IA 3NT2A 5DGIA 1RNLA 1DZIA 2BMFA 3DD5A 1QTNA 4EUHA 1SEPA 3VGJA 1JX6A 2VI5A 3GUVA 5DLEA 2JARA 2RGNA 5ES3A 1X15A 3RHTA 4AUMA 1CUSA 1F0NA 1KY4A 3AEUB 3AHFA 3EIUA 4HAYA 1U2PA 1PR3A 3LZCA 4TZTA 1GN9A 3U4HA 4QPZA 2FJ0A 2WBLC 2NXCA 3GL9A 1ZH8A 3LIPA 3ITNA 5AJTA 2YJ6A 1R0KA 4C0SA 1OU4A 3B1FA 3G17A 1YS2X 1H66A 4FGKA 3OQIB 5DVZA 3AEUA 4D0RA 4LW8A 2DQZA 3AQIA 3V33A 1LDYA 1BS2A 1B0PA 2FCRA 2GVDC 2GJ4A 3GBSA 4G97A 4XIGS 3PITA 2X76A 4LGVA 4ZU3A 4D57A 5L8VA 5KPDA 4DV0B 1V1RA 3SQDA 1E2FA 4WXEA 1ZD3A 2YRXA 3ZWKA 1D9ZA 4UOZA 3AHHA 3OTOB 4JT4A 5TE9A 3MBOA 2IX3A 3JU3A 4TWAA 5EP2A 1UBTS 3BJMA 4YP1A 4EPWA 2H7CA 2VEOA 1P1FA 3OKCA 3NXSA 4QUDA 1WBBA 4GQBA 2OSVA 3VOTA 4EHFA 4XPZA 4E6PA 5I3CA 5MN6A 3BB3A 1ZJWA 4KDEA 1IY9A 2A4KA 2IDKA 2VWHA 3PUHA 3E7FA 3PC3A 4MICA 5BN4B 2TSYB 4OHMA 1M8KA 2I80A 2C0PA 4NPAA 1U8EA 3FX2A 3OFJA 3PQDA 4IF4A 3TBHA 3IT0A 3DMTA 3HCPA 4FONA 2CHUA 5KSPA 1G18A 2AFIA 3KKOA 2I29A 2X5NA 4RPKA 4MIOA 1OX5A 3U3XA 4YRKA 3QP9A 1FA9A 1K6EA 4NENB 3T99A 2HHLA 2RH5A 2CEKA 3K2EA 3KB8A 4Q9HA 3S2UA 5BN4A 1TRHA 3Q7QA 4IDAA 1M1ZA 1THTA 3UB3A 4BO3A 1E3TA 2WIDA 3EGXB 3VMMA 3QUAA 4DC9A 4Y1RB 1L8QA 1W46A 3SI7A 1RABA 5BW6B 3VSCA 3EZYA 1SKUA 2C2YA 5HDBB 4NENA 1E6MA 3RFCA 5JCXA 1TPZA 4OYYA 1EFTA 3C3YA 1T5OA 1EWRA 2CVOA 1AN9A 3UMBA 4EB3A 4Y1RA 4J29A 1VIMA 1FPQA 4XWAA 3IIJA 4LEIA 2G04A 3HL4A 1MO2A 3AVQA 2FDRA 5FNVB 3TRFA 2WM8A 1WUIS 4O4LF 3AUJB 1UEXC 5TMPA 2O8EB 3ASVA 4OD0A 4IV0A 2AW3A 1A5BB 4N3GA 4KITB 1BDBA 2B8EA 4RCZA 3PF9A 4N5HX 4J94A 4FT4A 8GPBA 1RWMA 1FDSA 4XA8A 1RC1A 2POQX 1JZQA 4QVKA 1XTBA 4P7JA 2E4WA 5DYYA 1EK1A 3DZDA 3B20A 4C20A 3KKKA 4TTSA 3LP8A 1R12A 3UWPA 2IY9A 4AD8A 4TXHA 3IULA 3W04A 4Z49A 3DUFB 3P2OA 4H16A 2KW5A 1BMFD 2OLEA 4GE0A 1QC5B 4OMDA 3UCXA 3BX1A 4AIRA 2G5TA 2FW7A 1GZSA 3S55A 1ODCA 4JI3B 3WIUA 4EYEA 3KJXA 2AZTA 3NHWA 2A0FA 1NYQA 1YDHA 3BXGA 3H0CA 2REBA 5IEBA 2CJXA 5A3JA 4PW0A 5LA6F 1KYQA 1I6MA 4CLRA 3ASYA 4ZI2A 4JP2A 2X77A 3W2GA 2O1EA 4RMHA 3LHSA 4HTAA 5C18A 3NHYA 5ALFA 5AKEA 5FOUA 3TRDA 1L5QA 5BSMA 2A3RA 1JFLA 1T6ZA 3BGWA 2WWTA 3P7MA 4J4TA 5LJLA 1HOTA 5ALJA 3GP3A 3GFFA 5IJ9B 1GZ5A 4QUGA 4OVKA 4WA7A 3ZW7A 1VG1A 3VO2A 4JEHA 4B75A 1IY2A 2AGVA 3PQ2A 5IAEA 4B35A 2GPWA 3AM5A 2C5BA 3FMIA 3MFQA 3P0IA 4G0WA 2XPCA 3L0PA 5IJ9A 5BPFA 1C4WA 1GQQA 1FU4A 1X7ZA 4PX2A 3WBJA 4JYZA 2N1BA 4FCTA 3D8UA 1PR4A 1A4IA 1V8ZA 2VTVA 5DHQA 2FB9A 2LZ0A 1U2GC 3TB6A 1NIJA 5E1DA 2FPRA 3NHUA 3OD1A 4PLYA 4R9SA 1P0FA 3WNVA 3GGJA 4PTZA 1FTWA 1FTQA 2I7VA 2XB2A 2WSMA 3IRVA 3I5UA 2BELA 3NWBA 3D81A 3DC2A 4QJBA 2JGLA 1W581 2YZ2A 3FTCA 5ENZA 5EE0A 3S28A 4L2IA 1SU8A 1DBVO 3GQBA 3IPCA 1NXVA 2J0VA 4LHVA 5CXXA 4BEVA 3GRUA 4L4UA 4E0BA 1VGQA 1V8PA 2IT1A 3HY4A 5H82A 4LC1A 4DY6A 4CXMA 4NMHA 2X0IA 4Y9SA 1KJ9A 1KJYA 4E46A 2VK8A 3IXLA 3JS5A 3A25A 2EX0A 3EEFA 5AW7A 3M1IA 3H8JA 2CNKA 1JECA 4XYMA 1AGRA 2JFNA 5I7RA 1VIAA 1Y5IA 4U3JB 3HR7A 3GF4A 4DQXA 3NBYC 3I4FA 1PWZA 4NMLA 4PO9A 1R0BA 1P2BA 1G20B 1G2PA 3ELDA 3G0IA 4BIMA 3H6GA 2FPMA 5JVDA 4M88A 5CCBA 2AN5A 2WSIA 2CXXA 1XMJA 2JHCA 2Q3CA 4FGUA 4WRRA 5AKYA 2VT7A 2WICA 4FYWA 5FBLB 3ST7A 1A27A 3GLSA 4U3JA 3UWOA 1B43A 3IPYA 1FLAA 1RYMA 1KVSA 3MIZA 4MQEA 3CZPA 3ZK8A 4EPTA 3LUFA 1IE3A 4X97A 4RV9A 5AVOA 2J41A 4IFEA 3AESB 1K8ZB 3HNOA 2JFZA 1P74A 3KOYA 1U7HA 2QEQA 4EKIA 4YT4A 2Z9CA 1NVKA 3CGWA 4RJ2A 2FCAA 1JLLA 2EFJA 3RHZA 4KNYA 1AHNA 4PGHA 1QQ5A 3M81A 5TJHA 1VJ1A 2G1AA 3AESA 3DULA 1JRLA 3AKCA 4HX2A 1JFFB 2NVBA 2Y0BA 1BRTA 2A0XA 5I4BA 5AKZA 1NYTA 3WK9A 4B4OA 4YP9A 1QFMA 3BQ9A 2XQGA 3FVTA 4HYEA 3D6MA 5IC5A 1K7XB 4PIPA 1RWWA 4GPTA 5EKSA 3WNBA 5F3RA 1GUYA 1HV8A 2H11A 1NONA 1Q20A 1DWPA 4N6GA 5BUCA 2P62A 3U2QA 2IP2A 3CH5A 4JOQA 4BNZA 4YHHB 2NO1A 1AF4A 3HN2A 4J6EA 2HIAA 3EB9A 1RLOA 3AVVA 2CL7X 5HIKA 1C3LA 4I14A 4MVJD 4BFYA 2E37A 1RPAA 5IC6A 3BB4A 3OQOA 3ASZA 1Z5PA 3DDWA 2CY0A 1R4NA 2IJGX 2WD7B 3ELYA 4TVBA 2XNKA 4EF4A 5J4HA 1A9YA 3VOBA 3W9UA 5A4DA 3RYIB 3ZJYA 1RRVA 2NTEA 2QM0A 3K1ZA 2PZGA 4KIFA 4RF3A 1JKXA 4IFIA 4IRXA 5CT5A 3AV0B 4KW7A 4FP9A 3RSGA 4BLQA 1Q0TA 3EAGA 2X0KA 1GY8A 3SYTA 1UBGA 2H17A 2IYAA 2ONYA 3FDXA 2RBGA 3GGSA 3M9WA 2R00A 3WMFA 4BNXA 4EY8A 2WD7A 3H9QA 4QAQA 5KTMA 3BMQA 1J0CA 1O89A 3F6PA 3AL0C 2IYTA 3SQLA 4QODA 2QD2A 3HJRA 2XDYA 4L07A 3USZA 4A5SA 4JLKA 4ZDJA 3VAZA 2BM8A 2W2QA 3P8ZA 1L5GB 1YOVA 2CDCA 5HF5A 4ZO8A 2QGFA 4PX3A 1PFKA 1PSWA 2QN8A 4YRQA 2FG6C 3DLAA 1B0ZA 2I2BA 2JJ2A 3IUMA 1NT4A 3QM1A 5NULA 3EWNA 4KBGA 2IEYA 1N5RA 2VXCA 1D1QA 2I34A 3N8NA 3E4CA 2W98A 4HV4A 1SGWA 1VDZA 1KYZA 3WGUA 2X8BA 4Q4AA 4Q3DA 4DA9A 5DBIA 3DL2A 1IJKA 2CMGA 2YL2A 1NJ2A 1LJUA 1MC5A 1MOSA 3HGTA 2IP1A 3FGNA 2H2WA 1LXCA 2JH8A 3BORA 3LUAA 3Q1LA 4IH1A 4BB9A 4WBNB 4C06A 1A3CA 1SK8A 1EMDA 4KTTE 1W1IA 2QL7A 3LF1A 1P6UA 5EQJB 3TTVA 5L6LB 4GNRA 2FUNB 4ZYWA 1RBQA 4WZ6A 1WETA 3COZA 4ALLA 1R6BX 2W2NA 2FWRA 3VVCA 1MTZA 2JZNA 4PFKA 4HF7A 4HH1A 2WE8A 4PLPA 4F3TA 4AZ3B 1XO1A 1KE2A 1YD7A 1S2OA 3ONFA 4ZCRA 1E5LA 3W8DA 2PH5A 1QTRA 2B0CA 2X5JO 3K15A 4QICA 4KV9A 5ALIA 1VFPA 1YA6A 1EFLA 3RODA 1CB0A 2EWVA 4IQ8A 2PUHA 3VISA 5AWFC 5IN4A 3PNSA 1QCCA 4LGMA 2OV6A 1M2EA 4D8YA 2WJGA 4F7DA 4KK3A 4JP1A 2JL1A 3RKRA 1WPQA 3WHIA 1LNQA 1CUJA 3X1WA 5DYTA 1LVUA 1VKOA 2ZJ6A 3E27A 2YHIB 2YV3A 3F3YA 2HJRA 3F8WA 3HL0A 3DAOA 2DT8A 2GLXA 4C3ZA 1ZPDA 4OP2A 3RUDA 4HMOA 2GK3A 3L92A 4TYMA 1IY8A 4CIBA 3NG1A 4A6XA 4V38A 1CNMA 1UF9A 2UVPA 1CEQA 2J09A 5BWMA 4HS9A 1GTVA 3TI9A 1JQ5A 2FLKA 3NAZA 1GUAA 5E4JA 4YMUA 3W5BA 2XYPA 5HMMA 2Q2NA 1PX0A 2YHIA 3HXPA 5B3LA 4CI9A 5FPTA 5K8IA 1OFGA 4M0MA 1QG6A 5IBRA 4D96A 2GF2A 4NK5A 1KI6A 1EA5A 1NLUA 2HJGA 2W6ZA 4QNNA 4ZANA 2J9FB 1THGA 5H4GA 3VU1A 5JMTA 1QFSA 2ZREA 3IKVA 5GV7A 4WGGA 4JLMA 3VC2A 1H2RS 4DZRA 2QZPA 4O1HA 2VF4X 5IN5A 4BBJA 4EABA 3FSJX 2P69A 2GLUA 3CF0A 1OHHA 3EX7C 4INAA 4HDSB 3WXBA 4B47A 3CZQA 4OK3A 2OESA 3IP5A 3TIIA 5JY1A 3T35A 2P9YA 2Q5HA 3BJIC 1A5ZA 2VSNA 1MP0A 3HMQA 2VYVD 4MV7A 4YAEA 4BLSA 4CKEA 2BGJA 4JI2B 1CUDA 4HVLA 4BVFA 3NI2A 4U7PB 4R1QA 3GB9A 4YRZA 1HZJA 1RI2A 4C5BA 2B2CA 2CN1A 3I92A 4ND5A 1DU4A 1KO4A 4ECAA 3KQHA 5BR1A 2XGGA 3GARA 1WNTA 1FSGA 3DEJA 4B8YA 4AIIA 3M7IA 4P4UA 3UWDA 4PE5B 1L7XA 1KJJA 2C1XA 1QFYA 2QXUA 3GLUA 2UXBB 4JCOA 1I3NA 4XFDA 1KPGA 1S7GA 5TMBA 5J2UB 1C3EA 2HU7A 3AMVA 1EQAA 1J22A 4QBKA 2PAAA 2C97A 4DG9A 5JQGF 1AN0A 3OKAA 4KPFC 1DUIA 1RQRA 1M7BA 2YJ3A 4UNQA 4OUKX 1J70A 5UKDA 4HNHA 1AQ6A 1CQWA 3SAJA 3H1TA 3CBQA 2B3TA 2OBXA 2EZ8A 2CL6X 2ECKA 3V8NA 2Q9CA 1JXOA 1UKCA 1UZAA 2VZ0A 3D64A 3BRCA 1X8JA 1Y6QA 2PX5A 3SP1A 3LLVA 3INYA 4LWPA 2QX7A 3G9UA 4DMMA 4EYOA 4U7HA 4KX5A 4B7UA 2VHCA 5I45A 4ZGBA 1N9GB 1V9LA 2YXEA 2G70A 1KXJA 3GGCA 4GMDA 1NBEA 2JANA 1GLVA 1SHKA 5ECDA 5BUZA 4EEZA 1RBYA 4Y2TA 3EGCA 2Z6QA 3L0DA 1E1LA 1QR2A 2BONA 5AKGA 3TM4A 2VBGA 4ESOA 2OWDA 1DL5A 1I9GA 2QTRA 3BBPA 2ISCA 1T6NA 4K9SA 1A9QA 3GLQA 1YBVA 4D3XA 1MD9A 1VFNA 1EIWA 1RAEA 4R8KA 3G2KA 1V26A 4UBMA 1SVIA 3SFZA 4A8HA 1RPZA 4R0MA 1YVUA 3HJBA 1ORWA 4LPKA 3MINA 1YUBA 1Y8RB 1SXPA 4I5FA 2GPTA 3I6QA 2HREA 3FMVA 1FY2A 2RBEA 1QVRA 2XTMA 3CN7A 2JAQA 1X80B 3HP1A 4N9WA 1W6UA 4TRNA 3DZIA 2C2BA 1KBOA 5H02A 4GLJA 4MVYA 1E77A 2XMRA 5CNMA 4AY2A 3SZLA 2C7VA 2H3HA 1YRHA 3NUQA 3Q8XB 3QE0A 4ZO4A 1VJGA 4IDDA 1RVV1 121PA 2AMLA 1OCEA 2CYAA 4MRAA 3KEQA 4NMXB 2ODBA 3KXDA 4R31A 2ODEA 1WD5A 2HLDD 2RKWA 1I30A 2GJAA 3QV2A 4ZRNA 2FMHA 3BDVA 4IIFA 4OQMA 5HX7A 1P0PA 1UJ4A 1OI2A 2D2EA 4HPJB 3WS7A 2FSVC 3RSFA 2RHLA 2JAXA 2AG5A 3DWEX 4TS9A 1YWGO 4G1EB 2D2IA 2XUHA 5F35A 1W4CA 1VKJA 1MAWA 1VSQA 2JIQA 1MNQA 2C31A 4M0UA 1LPSA 2XYHA 1Y3CE 4ZVSA 3DOCA 3FOAA 1NURA 1EEHA 3IV7A 3LKDA 3HLTA 4B46A 1P73A 3Q3HA 4L9SA 1SELA 1QV9A 1RZ3A 2FEWB 1QB7A 2I33A 3KQVA 2IU3A 4JIMA 4PLWA 2J3DA 3R7BA 2OXEA 2PWPA 2HBRA 1QRSA 3KVOA 2XT0A 5CAEB 3I37X 5MN5A 3RT7A 3L82B 3Q3CA 4B6EA 2CD9A 1JU3A 2DUJA 3ULKA 5E9AA 4A8JA 1BU5A 4P35A 3W5JA 3B89A 5KYVA 2W4QA 4X1YB 1P61B 1DADA 1Z7GA 2DPMA 2SNIE 3KS9A 5CAEA 2JAWA 2YWXA 1TCVA 4HZGA 4XVRA 1ZX1A 2OHGA 4P8RA 5CVDA 3BD7A 3ZOKA 7REQA 1BVRA 3TZQA 2QAGC 5CA1A 3EZ9A 4DB4A 3CLKA 4LVCA 1QHFA 1TA4A 2JIZD 4IL5A 4X1YA 3WB9A 1Z2NX 2GEBA 2ID9A 3DGEC 3LYAA 3PD1A 3QTBA 1RR6A 4HG2A 4Q7KA 3IYLW 4WASA 4TKUB 3ELBA 2Q8PA 1KAGA 4R1UA 1G8KA 1GIAA 1ZM9A 2BRUA 4FFNA 4GPD1 4HNGA 4CFYA 5IHPA 3KYCA 5KDOA 3BWEA 3BGOS 1XTZA 1ZP6A 3ROGA 1P62B 2I67A 5JS8A 1UKAA 4BPBA 1C1DA 1VLHA 2GZDA 2H31A 4ZT4A 2JS7A 5JS2A 3WLSA 4EUEA 5FUYA 5KHOC 4TKUA 5KOYA 3MD9A 2PRKA 3TFOA 4MV3A 5IDWA 2WAMA 4MB6A 5FJJA 4D0GA 1PS0A 3W7VA 2OBLA 1HQKA 5HP4A 2H2GA 5JCJA 1S8FA 3SXJA 3VAYA 2BKXA 2D2XA 3L9XA 2Q1UA 1BQ4A 1NQVA 3DVAA 2P6OA 3KRTA 1PNTA 3RRYA 4BGIA 4UCWA 3UMMA 3ZGYA 4WCFB 3WY9A 2OOKA 3BCSA 3E3OA 1FSSA 5DSXA 4CT4B 4ES6A 1NYLA 2H1RA 3KVYA 5FI0B 2WAOA 2O4UX 3O91A 5LYJB 1AGXA 2P2DA 3RBVA 2FR8C 3OLQA 2P0EA 3B2NA 3MFYA 3WBFA 2XVXA 1U0HC 1WCIA 4OQNA 1FRQA 5THKA 3F9CA 3PEVA 4N48A 2JAHA 4CLXA 2WIKA 1XRNA 4HDKB 2BD0A 5E2AA 2OK8A 4G1BA 1LA2A 4W5HA 1LBEA 5FTJA 3A6DA 5AUNB 1YGYA 2NPOA 1ZO8A 2LDXA 3GVIA 3H2GA 5IVDA 3TSAA 2BI8A 3MNFA 1YBMA 4NWIA 3I32A 4ZI3A 2AHRA 4F4FA 3F5SA 2EW1A 3EVEA 5JADA 3R9XA 4L8FA 2P3OA 1AS0A 1ZK1A 2XTZA 1D2MA 2OILA 3RS2A 2CNNA 3W79A 5EXDA 1V11A 3N28A 4IMJB 2P9EA 4ALMA 4BFZA 4NBNA 4EJMA 1KOGA 1DOHA 1X1QA 4X0EA 3DMFA 4BMYA 4Q4HB 4JYAB 4I4TF 3HTXA 3KLOA 2VFAA 2X5OA 2HIHA 3WWZA 4DREA 2IXDA 4MP6A 2V5UA 4FWBA 3MM4A 3SC3A 2FZLA 3P9RA 1V8BA 2MDTA 2O2ZA 2XSZA 3FVRA 4LWOA 2ZPUA 4PLCA 4NZYA 4RL4A 4X8HA 5HF9A 2M6LA 3KKLA 4NPCA 5LIPA 2VSQA 2QMUA 4KGVA 3DXYA 4HLCA 5E4FA 2PH1A 1KJWA 4KYIB 1RXVA 3RDPA 1QIDA 1FF9A 3DWGA 3VR2D 5G02A 2CUNA 2LCQA 1Z26A 4C0HA 1J24A 3QLVC 4P4LA 3SJBA 1TUEA 1XTQA 3MT8A 3EG5A 3M4ZA 4KXLA 3T4PA 1RZRA 4MB2A 1JR6A 1KSGA 5B12A 3JQAB 4UM9D 4UJ3A 1NR1A 2Z6VA 6AT1A 3ON5A 1J8DA 4CCYA 1CR2A 5C8DA 4CKZA 4PAMA 5K8TA 2R7NA 1L6RA 4ILEA 4TL9A 5JIBA 4QASA 1CU1A 3H9BA 1SBQA 4KDCA 4H18A 2PGAA 3VSEA 5DLDA 4PLFA 4DG8A 2KBFA 2XYRA 3PC8A 1JR3A 3IO3A 2O3QA 3H5AA 3I1FA 1HM5A 4IIHA 3OC0A 4NC9A 5FUWA 1F4PA 3G6KA 3Q1KA 1Y3FE 3QKSB 1CIJA 4KKVA 4LY6A 4WN9B 5BWBA 2K6GA 4BC1A 4MPJA 2VPQA 1CP3A 3KQWA 3FTDA 2NZWA 3OZBA 4PZPA 4L8WB 1K97A 3L1HA 2QP3A 1L5NA 5JH7A 1OKKA 4TYNA 4EKDA 5AXDA 3QXSA 4FE4A 3I9MA 4ZA2A 1QCZA 1K4MA 1KQGA 2GD1O 4XIJA 3S27A 1GXSA 5K0NA 4BRUA 3DEYX 1BYUA 1K3UB 1YRQA 1SQSA 1SH7A 3TE7A 2A1IA 4BU0A 1O95D 3E9QA 2VAVA 2VWPA 3PDCA 5DMHA 3RAFC 4S1NA 1HLFA 5AUOB 3FBGA 4B1FA 4C0XA 3IXMA 3KXKA 4O3FA 3X2FA 1E2DA 1UJCA 4JXJA 3G79A 2NP7A 2QRQA 1U0TA 3JQ8A 3NEPX 4TMWA 4ZOQI 4BECA 1ACLA 3E22A 4B3IA 2C94A 4Q3LA 3UJPA 1VHWA 2PD6A 4FZRA 3BHIA 1GGKA 1P9RA 5JXGA 1RTTA 5M34A 1VRVA 1NP7A 1VI6A 1ZGHA 3JQEA 4PN3A 1RMYA 1IXSB 1L7BA 1P5HA 4QVIA 2RGXA 4BP3A 1NASA 5JJBA 2ZJZA 3THWA 3WHKA 1D5CA 1KOLA 4CKYA 1IWPB 3UJNA 1PL6A 1U65A 1XEXA 2AI3A 2XWSA 3G85A 3KQTA 1XZGA 3LDAA 4IEIA 4LZOA 4C08A 2IXAA 4M1MA 3GP8A 1QYWA 3OJOA 3T3IA 1E4YA 1XPUA 4MUJA 2P2NA 1O95C 5GIPE 2RKBA 2WKQA 2OV2A 3FBTA 1NQXA 2PGLA 3URKA 4KN9S 3F5FA 2VH2A 4TV9A 3TQCA 1BH6A 4KMMA 4BLUA 5T7BA 1XZKA 1VBKA 4OQQA 2JFBA 2R751 3SE7A 2DQSA 3ZN2A 4EPVA 5IC4A 1E8NA 4XX0B 2LCIA 2YRWA 2BFFB 4RK7A 3KOOA 4C88A 3WX0A 5KTRA 2GN1A 4KLZA 1ML4A 1VSTA 3UMCA 1DQPA 2VTBA 1M8GA 4DM3A 1N2CA 4F72A 3A1FA 4BX9A 1E7WA 2GYVA 3BBLA 4KACA 3ETGA 2Z8YM 3MWKA 5B4TA 3CNEA 2HRRA 3WB1A 3MRSA 3VPSA 2GWRA 4JI0B 1V1JA 2GM3A 4MA0A 2ZSDA 1U3CA 5KOJB 4QG7A 4QYIB 1QO9A 5FOQA 1Q95A 3MMPA 4JN6B 4ZT6A 4FR5A 1DAFA 2PQMA 2VPPA 3U7QB 5I3ZA 2IE0A 3IBGA 4R1TA 3CVWA 1WW2A 4CTKA 3ASUA 4YJ3F 1RJGA 2XD4A 2C2MA 3QF4A 3A8TA 5A6VA 5LOVF 1VB3A 4I19A 4G85A 4AKIA 5KOJA 2E48A 2QW0X 4S1TA 2G25A 4Z8YA 1RS0A 2J9XB 5DT2A 1R3UA 4M0FA 4L3WA 3ETNA 2QOEA 3FCYA 3FTNA 3JATB 3ES9A 3VYSB 3RS9A 1BZYA 2A9VA 1J1IA 3A6ZA 1CZOA 4FYHA 4RWZA 1W35A 2O1WA 4S1WA 2GT1A 4QXOA 5JSKA 5DM60 2WIAA 2BGUA 1HEIA 4FT2A 1UBUS 5DTMA 1G8SA 3DWFA 5FJIA 2BJWA 4HN4B 2NZ2A 3ISJA 2PUGA 1NMYA 2H7VA 5F9MA 1GAJA 4ZYZA 4ERNA 1B3RA 4FDMA 5JCOA 2JNWA 5U1PA 1G3QA 4EECA 3LW8A 3I2FA 3R3HA 5JI2E 3P52A 1HDRA 3WKBA 2QN1A 2IYOA 2HDWA 5KKNB 2VCEA 4KE9A 3B6MA 1YACA 5BWOA 3T52A 2Z1DA 4R05A 3K5WA 3VH2A 3FSEA 3GJ4A 4JOBA 3WGQA 3LCUA 4EG8A 4Y1GA 5HZMA 1C9DB 4CM9A 4KE8A 3K05A 2DPGA 3BPSA 4FCWA 2YVAA 4D4LA 2VDVE 4ZTZB 2J9RA 2E49A 4M1OA 3KHKA 3JAWA 4KDRA 3TS1A 3W2TA 1DBQA 4C4TA 1NW7A 3GLIE 3O84A 4ER0A 3GO4A 4K2HA 4KIWA 1AC5A 2I6GA 1BFDA 2QA5A 4JDPA 1E2MA 3PC2A 1HE4A 3B9PA 3CX3A 4KI7A 5D1NA 3SMQA 1FU7A 2AJCA 5A9SA 3CKKA 2M6SA 2PY6A 2FXIA 4EG1A 1XRJA 3HJNA 4Q4CA 5T4HA 5JNVA 2Z5LA 3CIFA 3W6NA 5B3KA 1BVUA 2M1XA 2NU8B 4ZI7B 2NYRA 4OH1A 2A30A 1CFJA 1EFVB 2WHEA 3EWSA 1GPDG 4I3HA 3X1JA 2QUBA 2AWOA 5IVPA 1Y9AA 1V16A 3CM0A 3UGTA 2QD1A 1G19A 4LZJA 3TZBA 3QPBA 5AW4A 2PD4A 1GPAA 5TB5A 5EG5A 4C7MA 1NBHA 4Q47A 4JVNA 1I3CA 3DDZX 1KRHA 4ZI7A 5A4IS 3ZY4A 2WG0A 1M5TA 5GIOE 1D9XA 4HN9A 3SSNA 5KYXB 4NV0A 2J0EA 4JJ4A 5C81A 2AH5A 2PMDA 4NJOA 3E9ZA 5EKDA 3KJGA 3NJ4A 5FWXB 3HQ4O 1SM4A 2EG9A 4ZXPA 2ZI6A 2VKTA 2WTEA 4TUYB 4XDYA 4YYEA 4TMZA 9ABPA 1Z12A 1HXHA 1GPJA 2E1RA 4H1WA 3SQWA 4RANA 2Z30A 5KYXA 2G1JA 2D54A 1H1TA 4FEYA 3PDWA 2PSDA 5L3SB 4CKWA 3IVCA 1J9ZA 2D0PB 3I01M 4NKRA 4Y0NA 3K0SA 2WJJA 3BJRA 1V45E 3M6WA 2RHCA 4MWOA 4RHTA 2QTZA 3C7CB 4XKJA 1R5OA 1FP6A 2WIFA 1JNYA 1TVMA 1IK4A 2PGDA 3HV0A 1H42A 2FQ1A 3RS0A 3UJDA 2VZLA 5BN5B 1CF2O 3QBJA 1LBHA 3TAUA 2GASA 4BQQA 5K4GA 4ZHQA 1W36B 1J2TA 4MDEA 2OBYA 3C3DA 1LQUA 1KO7A 2IZ1A 5CVCA 1HEYA 4DA8A 2WG2A 4PM4A 1GAXA 4E3ZA 3TSZA 3W9SA 1JDTA 4CRWB 4CIWA 4MUNA 3L4KA 3UGQA 4HS4A 2RJ3A 1JDVA 2B83A 3VO9A 2RIRA 4Y6SA 5A6SB 2AC2A 3F49S 4EEKA 1E8MA 3I61A 2X1VA 2DTEA 1B0UA 4WINA 5KYNA 1BWSA 1P39A 4ND2A 2P6MA 5BOSA 3U81A 4RIEA 2XRMA 3H19A 1MX1A 2FG5A 4OQFA 4F9GA 2PYDA 3DFKA 5DOVA 4QGAA 4Y2HA 3ESRA 1F2UB 3A2KA 1JU9A 5TRTA 1NOJA 1TOAA 1YS9A 2XODA 3QTLA 1WZEA 1WUKS 3PFHA 3WO1A 5K8VA 1CUEA 3KP1A 2QDKA 4X90A 3CVOA 4AY6A 3JQQA 4ZT3A 1N8KA 2KM1A 4G37A 4YV2A 4FKZA 1ZQ1A 1UEIA 3PXAA 4WOBA 4I5GA 1A9RA 1F2UA 1A7KA 2RJOA 1PU2A 2PWZA 1J1ZA 1N0WA 5AJVB 3H75A 4A8PA 2WNHA 1A4UA 2NT3A 2O52A 2QLLA 3NM5A 3VYTB 3CUSA 2QT1A 3U16A 4EO7A 3HBMA 1KP2A 3OBIA 1H2XA 3N2KA 1FYXA 3GUUA 3ZK9A 4D3FA 2FZ5A 5KOHB 2CL5A 4FGZA 3QUCA 2WUFA 4LOJA 3AW8A 1N2EA 3G23A 3ANTA 3BIFA 4HMPA 1SBTA 4PLVA 1WSDA 4X64B 2NMVA 3I2GA 3K0AA 3EOAI 2IVFA 1LTKA 3ZZNA 3T5GA 1NI4B 1E1QA 2G6TA 2F3TA 1G21E 2GRUA 1CJMA 1R0YA 2QG6A 3CRNA 4J91A 3MQ4A 4J03A 4KTVE 3UF0A 4CNBA 2YIDA 1JJAA 3OSZA 3ZDYB 2B25A 5AHWA 3OIWA 2YWCA 3QXGA 1SY7A 4FNGA 4HGYA 1X13A 2HZBA 4BGVA 5FX2A 1Y82A 2N75A 1JEYB 2NAFA 3UBTA 1A8HA 4EB0A 4F5DA 4OM8A 1D3AA 3A9RA 1MC8A 2ZDGA 3ZNOA 4P31A 1IEWA 1XHFA 1Z25A 2HWUA 4R8LA 2BSAA 4ZQCB 3QA9A 1PS9A 1BVHA 1WD7A 2VPXA 2ZJ4A 4EA7A 1GGJA 3GUZA 1UAYA 1JF8A 1PSDA 2Z3VA 4B71A 1RLJA 1OFVA 4IDCA 3TD2A 4BO8A 1MV8A 3HZRA 1D2EA 3OCJA 3VO1A 3SGLA 3CLVA 4DMKA 3V4PB 1G5PA 3A6KA 5JARA 1AY0A 3ELWA 1MA0A 2ZT5A 2X0EA 3WYGA 3Q15C 3VSDA 3HA2A 5AT1A 1J5XA 4TMVA 3DYBA 1TI7A 2ATXA 2C8JA 3B1XA 3QYPA 4IOKA 3A0UA 4JJFA 2W9XA 3AUXA 3AUYA 1WTCA 2BGKA 5GVSA 5JTUA 5MDHA 4C76A 4EHIA 2B4QA 4DIBA 1GKLA 2VSXA 5FCDA 1UFRA 4O2AA 4ZC1A 1ZMBA 5IHXA 1AUQA 3LFHA 2UKDA 2WQ6A 4XM2A 1Y1RA 2Y0EA 5BNTA 5K9ZA 1YTLA 3U7FB 1B6SA 1RYDA 3BDIA 4BWGA 1YCDA 4DRYA 1AE1A 3B2QA 2HCTA 5ICSA 3DR5A 3IPLA 2ABWA 3DZHA 3GFSA 3HCFA 4HRYA 3U7EB 1NXQA 4ZDKA 4KAAA 3CVJA 2HADA 1I51A 3LLUA 4AROA 4OAOA 2YKGA 3THRA 1D04A 5HJ7A 2NXWA 3LQ4A 3P2MA 2GB4A 1QQ7A 3FAKA 3P4XA 4N49A 4NR0A 1NYRA 1XWIA 2FA9A 2G72A 2VYFA 3EVNA 3U3JA 3AERB 4YV1A 3H2IA 3HYLA 4IMRA 3V8MA 4AF6A 5TXGA 3PHIA 3GR6A 3NYIA 3AG5A 1DRJA 1IN5A 1FRNA 3H7AA 1V3QE 1XZJA 2JEZA 3FDJA 2YMLA 2V8BA 3F67A 5JYCA 2YJNA 1CZRA 5CEFA 1N7IA 1NDQA 3QHAA 4KQ9A 4DAEA 1XRMA 2NP6A 4GI7A 3V7NA 1LDEA 5AW8A 3GBVA 1CUAA 1NVFA 3BHNA 3MTGA 2QTLA 5D1HA 1ISRA 4FDVA 1D6SA 3AFGA 5H3HA 3WC4A 3PHLA 4JP3A 3F7TA 3QNMA 4MYSA 3Q3EA 5AK4A 3U62A 3T7AA 2VSFA 2Y76A 2Q2QA 1M83A 3DD1A 3OEWA 5H70A 3T5AA 4M9UA 2OTCA 4IIVA 3ZD9A 3PV0A 1R9NA 1YB1A 2X1LA 4TKVB 2GERA 2VDWA 5EMJA 4OHWA 1GZ3A 1YHZA 3W06A 4A9AA 1IPHA 1L7RA 4P3PA 5CJJA 1UEJA 4TTQA 1DKLA 4CQMB 1T8TA 1V4VA 1M75A 4JGIA 1N6LA 3PRJA 4R7ZA 5AUPB 1AKVA 1EHIA 1SQGA 2HA7A 2M32A 4MZDA 3A4NA 3E53A 4JS0A 5B3AA 4DV1B 1HT2E 1CT9A 2UUBB 3NIBA 3O0DA 5LZ2A 4CODB 2FQQA 1GAQA 2NZUG 3UT6A 5EJ6A 4F86A 2FRDA 3CW9A 4HC4A 4CQMA 1LTQA 1WP4A 2Q1WA 3L6OO 2OLKA 4EY3A 3M1AA 4GG1A 5IM4A 3LK6A 1NTOA 3QW4B 5JNTA 1HWYA 3B78A 3AJ8A 3GFBA 4MVCA 4AO8A 1ZHHA 4E7OA 2OGZA 3MERA 1VI5A 2XOKD 2Z08A 3Q7IA 1M2FA 3QLJA 2VP0A 3P9NA 2JKZA 4TKZA 1CS0B 3KD3A 1ZVVA 1VG9B 4C21A 1S8OA 1LWNA 3E82A 1FQKA 4MEBA 2EGHA 3WNQA 3NBZC 3MSXA 1PL8A 4BKOA 2JDIA 4HPWA 1Z8DA 3CEJA 4MXDA 5IJWA 3AFIA 3GUYA 2BBWA 3Q12A 5D3ZA 2YFHA 2WFZA 1CS0A 4F2GA 2IBTA 4IHJF 3GLFE 4K86A 2W00A 1EUDB 1QU2A 1KYYA 4R84A 4FB5A 2FFHA 1TB4A 4YT2A 2A9RA 2CK3A 4O33A 4Z99A 3RBAA 3O31A 1GZVA 1XZAA 1MV5A 3TXXA 5ISMA 2A33A 2VHJA 3LT4A 4LA4A 3OIUA 3EBPA 3PNBA 3RVOA 3Q8MA 4DPLA 3MJHA 1L5RA 2FN7A 3PJFA 2M98A 3O8OB 4ZZ1A 1EUDA 1U8FO 1W9MA 4R1LA 5BN3B 4S12A 3PLAE 3MBIA 4E5YA 1TQHA 3NHFA 4D9CA 2RHTA 4F4UA 4GKKB 1IG3A 1TPYA 2FOIA 2PSFA 4PNHA 4AW9A 2X7HA 1G7RA 1TAHA 2XTNA 5CDFE 2QVGA 3PIIA 4PPFA 1ODJA 1LTHR 5IUKC 1A98A 3O8OA 3AILA 1GQ2A 2XOEA 1L4YA 1R18A 2GO7A 5EXPA 4HZUB 1QRAA 2OAEA 5T3UA 5KYUB 1GGHA 4EW1A 1OBFO 4NQZA 1ZUHA 1L8XA 1SCQA 2ZBGA 1BRMA 1R4AA 2W6MA 3OLWA 2OBBA 1ZUNB 3ODPA 4TS4A 2HIMA 4ISCA 3DAFA 3MUNA 4XB2A 4E1AA 4ARCA 3LYLA 2BP7A 1LX7A 4BO2A 3UV3A 5BO5A 4US1R 3EG9B 3IAAA 1R9MA 3DKVA 3NTOA 4Q39A 1OXTA 2GQ0A 1L5SA 1QPGA 3UAXA 2XUAA 1WRBA 4IGKA 4HATA 3E7WA 4GWLA 5CYOA 1P1RA 1ZUNA 2Q5CA 1CCWA 3RVSA 3HRIA 2I4TA 1A5SB 2QD3A 2Y1LA 2REXB 1QFZA 3N39C 4FGJA 4OGKA 4WJZA 3BE4A 3WYEA 1L1EA 1VRCA 3G0OA 3R7FA 3TWOA 3Q72A 2RC6A 3H2ZA 5C46F 1BW9A 3DEIA 4BP9A 2GD0A 1NSFA 5D3QA 3WOVA 2BGGA 3WRXA 2I1LA 3IT1A 4QDZA 1EUCB 4QXRA 1H2AS 1NUTA 5FTKA 4KR6A 1E63A 3C4QA 3O3NB 2C4UA 4NARA 3KXPA 1HURA 2FMIA 1G2QA 4RDIA 4RVHA 2BCEA 1WL8A 3GH1A 3ZWNA 4JJ6A 2H5IA 4GPEA 4ABYA 3VYVA 2ZJAA 1D7AA 2P9BA 2PZMA 1KGSA 4JEUA 4Y18A 5DXAA 3TSWA 4ARAA 3S1AB 4D9JA 2VWGA 3RTGA 5H8WA 1EUCA 1W4ZA 2H1LA 4LYGA 2AD5A 2GCGA 4LE0A 4Z3KA 4RYDA 4LZAA 3S81A 1G0NA 1N77A 2IXFA 1XZLA 7YASA 1NE2A 3JVIA 2HRDA 3KTFA 2QX6A 4UHFA 5J23A 1AKNA 3CRRA 3L1VA 4EVQA 1AK1A 2RGDA 1NN3A 1U4OA 2W8BB 1ND5A 3FYUC 1FNSA 3D8NA 3I5MA 3S1AA 4C4RA 2AKAB 4ZJUA 1LPOA 2MHCA 3UPDA 1MO4A 1XZBA 4OUDB 1SB8A 2A67A 4QEDA 4R81A 1HLGA 5C3MA 4LYFA 2GNPA 4RGQA 1Z6TA 1R1DA 5ALNA 3SZMA 4OYHA 1DC4A 2FW1A 2H0AA 1DKOA 1V6CA 2W6NA 4DLVA 1ISHA 1QIJA 3FSGA 2PL1A 4JCCA 2P2ZA 5KHAA 5IX8A 3U4AA 2Y27A 1DTSA 2H4YA 4Y9TA 4XM1A 1SHUX 1ZN7A 1XFDA 2WF5A 4L0CA 4NG4A 3HMKA 4FE7A 4OGLA 4PWZA 5FI5A 5FFNA 1NVWQ 2OEPA 1ZRMA 2FUKA 2X6QA 3OWHA 3A4MA 1KDRA 4LOLA 3WIVA 4NXNB 4WZAB 1W8DA 1CF4A 3C5HA 3LQYA 2PEYA 1AA6A 2HL6A 3MLAA 2AN4A 1EWTA 2XQVA 1ZINA 5D2CA 1JSZA 2BTOA 4R2KA 1OZFA 2BY4A 4ZV4A 4MX8A 1M5UA 5LFAA 2VHYA 3T4XA 4U2EA 1ZW6A 2PZEA 4LCEA 2ZUCA 5KNCA 1QIFA 4I08A 1J00A 2V03A 1Y33E 4MVJE 3MBKA 3EDMA 1M72A 2DT5A 3D4PA 1CWUA 1RWNA 2YY5A 3CZ4A 1HK7A 3L84A 4KC0A 3L7JA 1O5TA 3ZCXA 2JHAA 5HS6A 1XD2B 1Q3TA 3AJRA 2JBHA 2HK7A 4C22A 3H0EA 4K6MA 4YRPA 3V1NA 4RQBA 2C84A 1T43A 3ZV5A 1YJXA 4QKQA 4DIKA 1MFPA 4X1KA 1Z6AA 4IINA 3RSOA 1JHRA 2FLVA 3DYVA 3CLRC 3HBFA 3OZFA 1KS9A 2O2HA 5E3IA 4CIAA 2WU4A 4YRFA 4FPXA 1Q2UA 4BX0A 1TQ6A 5TMEA 1B23P 1IB6A 1YA4A 1JJ7A 3E23A 4OIMA 4X1IB 3DJFA 1AO3A 1FJGB 1G2OA 3QFHA 3DTVD 1L4MA 2VA9A 4N41A 2IHZA 3LXMA 4C1NA 4JQYA 4E4RA 4CMEC 3G82C 4W5RA 1G8FA 1QO0D 1K7SN 3E03A 4X1IA 3E81A 4NPHA 3TQOA 3L4SO 1ZA2A 3A4TA 2BM1A 4RY9A 4BTEA 5C51B 2WLSA 2P6RA 5KWIA 3BF8A 1HG1A 4Q82A 2NGRA 4PSCA 4ZVLA 3CZ9A 4HFJA 4EHHA 4QHYA 1BD4A 1HT0A 3H3FA 1JN0A 5ALPA 3TEJA 4A6DA 3JZMA 4I7EA 2C78A 3CUUA 3OPVA 3Q6NA 1ZVMA 1J2UA 3PL1A 1BA2A 2JGAA 1ZKDA 4JBIA 2VEDA 4ABTA 3ENQA 3O95A 3IEVA 2F1JA 4BNDB 5EE9A 4DZTA 1CUUA 4JLAA 3JWHA 5T8KA 8LDHA 1GRVA 3QLEA 4LNUB 3RUHA 4YAOA 3K53A 3EFHA 2IUSA 1JEQA 1MQAA 4CKCB 2GBIA 5I6DA 2KWIA 3MJ4A 4R2LA 3TZLA 2QI9C 3VNAA 4OQDA 4D02A 3F3MA 4G1FA 4DQVA 13PKA 1AF7A 1Z74A 4Q02A 2ETXA 1WU7A 2D0DA 1K8YB 3PENA 1SPXA 3LUJA 4LNUA 4LRWA 3LQKA 5LQDA 3IA7A 5TX7A 5L6MB 3M6LA 3TH5A 3ZGVA 2WYHA 4L6AA 2EWWA 2V9CA 3T1OA 2Q27A 2X4LA 4Y2JA 3SR3A 1JKJB 1T29A 2UYGA 3K0FB 4H7DA 3SLRA 1A2BA 1HZZC 4FLEA 1FC0A 3UWMA 1K0FA 4HLNA 3T5TA 4DSAA 2Z57A 2NXNA 4KFTA 4K9DA 4AZTA 2ZSAA 3DFUA 1M2OB 3LXXA 1ORDA 3TMAA 3G1TA 1Y7LA 3A9SA 5C53B 5ADVA 2BBTA 2YMPA 3OJLA 4OJQA 2G9NA 3T7JA 2CXPA 1Z4OA 3EZ2A 4KUEA 4MQ4A 2Q6OA 4LGCA 1FFXB 3EODA 5CH5A 2FPGA 4A0SA 4MRMB 1T1GA 1Z8HA 2P1ZA 4LTNA 1L1RA 1FXUA 4LYYA 3HBJA 3TX2A 2P75A 4RY0A 4M6WA 2OA0A 1BGXT 2BE9A 2VRCD 2XAAA 3I8XA 4R3UC 1I6LA 4Y2XA 4ZEWA 3WL4A 4A36A 2IK8A 4C0LA 2OCPA 3CCCA 3CLSD 1X1RA 2YN2A 3GVPA 1FFXA 3K0CC 4JVMA 2CVPA 3E9EA 1ZOIA 2QRJA 3PG5A 1ECGA 5SYAA 4CKBA 1CUZA 2QWXA 1PGNA 2GJ8A 3X2EA 1COZA 4W63A 2W2XA 5C34B 2GRAA 3ZWBA 2BN4A 4HQLA 2INGX 1UC5B 4IG4A 2VJBA 5E2BA 4G8CA 1Y8AA 3FD8A 1Y1KE 2X8JB 2A3NA 3KYDB 4H1TA 4QQFA 2HHCA 1TO6A 1CJBA 2IUFA 3EWIA 3HY3A 4RH1A 1DCFA 3VR4A 2W2MA 5E8JA 1PYOA 1H9CA 4AY3A 4M8KA 2ZSJA 3TNJA 1UK9A 4KPEC 2JK0A 3FNIA 4H27A 1FXWA 4X44A 5HIJA 1OFIA 2LNDA 3FVWA 5ELMA 4LPSA 2X8JA 2P6PA 3KYDA 4GXTA 5JJCA 3SXUB 3U31A 3HVUA 2NUPB 3O4FA 4CQNA 4LECA 1T9DA 3HB0A 3GLHA 3ZWCA 1HMPA 3VBCA 2BFDB 4LJRA 4PV7A 2O7NA 1TGVA 1CZLA 2JI7A 1EFUA 3ZH2A 3MGGA 4C4AA 2VHZA 2OHHA 2ODQA 1N2ZA 1UKZA 2ZUUA 4UVEA 2D5LA 3A9VA 3DE7X 4YJFB 5E4YA 1L7VC 1P1JA 4ECEA 2YN4A 3NOXA 2C3PA 3MZ0A 3R0ZA 2NUPA 1JDBC 2AQHA 4BDSA 4BE9A 5AJXA 1X9IA 3K92A 5YASA 4O0MA 2ODPA 1VP9A 3WO0A 5LOVB 4PNZA 2IEBA 1TVCA 4JEMA 5DM1A 3O8NA 2PYIA 1XV5A 1J9EA 1BEUB 4YVFA 3CPEA 2KMLA 1GCAA 5CFLA 4XR4A 3KJEA 1GZUA 4U7TB 4B73A 5CLHA 1VE7A 3NNDA 1OWOA 1E6KA 1W49A 1PR6A 1RYZA 2O5EA 3QMPA 4H31A 4NK4A 5HVNA 4R3WA 4RXUA 10MHA 3D3WB 3VNBA 1QGZA 2FZEA 2DPXA 4P81A 4KQ2A 1KI2A 2ODTX 4U7JA 4I1YA 3W8NA 5LZ8A 2ZBPA 3HABA 4EENA 2GRJA 3JASB 2PANA 4KO1S 2XH8A 5G1PA 4URZR 1EG2A 1C8KA 2VJYA 3AUFA 1SB9A 2F17A 4ZO9A 1CZUA 2L18A 2OFOA 4YLEA 2IIQA 5GP1A 2YJ5A 5FBKA 2E21A 1CDZA 1REQB 2XVYA 2GZRA 1MABB 2CMKA 1VLLA 1YCGA 1RHKA 2Q4RA 3JASA 4RTLA 1DRWA 2V59A 4XQ0A 2XRYA 1XD9A 5AHOA 2Z2YA 2GCNA 3MA0A 3NANA 5TGDA 2QKYA 1MORA 4BMOB 5JTTA 1N36B 1CSEE 5ALLA 1V71A 3MCUA 2HMUA 1LC3A 3AR7A 5TQ2B 3TW8B 1XTVA 4IDNA 4NMWA 2WMNB 2RG1A 4IO1A 1HE3A 2BFWA 3SEQA 4TM8A 4BP8A 1N25A 1P18A 1U3DA 3A1DA 5FD8A 1WNFA 4ARUA 1R2QA 5DNAA 1QRUA 4P9NA 1P9WA 1KFBB 2WNSA 1FS5A 2WWRA 3IUEA 1RI1A 2PMWB 4X92A 3WI7A 3JSAA 3KQKA 1V5FA 2C9CA 5TQ2A 2G76A 1P4JA 3LCMA 2R2GA 5E7QA 4YDHB 3CS3A 4R7TA 3WJAA 4EUFA 1G9XA 3OHSX 5ULLA 3F6YA 3LXUX 1P77A 4URUR 3TEMA 1YAHA 4IQGA 2I4OA 3L46A 3SJ7A 1FDWA 1YUNA 4G0QA 5BXQC 1AHIA 3COPA 4REQA 3DZ8A 2C2ZA 4MWZA 3D0RA 3EA4A 3QVGB 5KIAA 3IR6A 4LXGA 1U28C 5HJ5A 2RFLA 5C2JB 5AVSA 3V1MA 4PONA 1DELA 1DBIA 4RSHA 2VBFA 1KEEB 1QKKA 4I1RA 4WJLA 1E7QA 3SZGA 5L51A 1Y8QA 1FBNA 2A5JA 2JJ8A 1OX4A 5JDCA 1CJUC 2E87A 3ND7A 1Q0LA 5M5BA 1Q21A 1PYDA 1VPDA 3KUUA 2AK3A 3HDQA 5C5DA 3QVGA 3IBCA 4I55B 1W7AA 2DF8A 4CHGA 1VC2A 3HU2A 4WBXC 4D8TA 4LNAA 1Q0RA 3PNOA 1KEEA 3CZ5A 1UXOA 1RLUA 1YB4A 3A9TA 1JSLA 3ABQB 2H4XA 3OIGA 1PGPA 2V4ZA 3R6TA 3VKUA 5D7NA 4EPYA 3PNQA 4P0TA 1BN7A 1I0IA 5HCIA 4GQAA 4BS9A 3N0RA 4DN6A 5AVWA 3DLIA 4P53A 4YN3A 4YR7A 4C87A 1GTJ1 1Z56C 2MSCB 3NVKI 1XA4A 1Z9BA 1QZZA 2HPVA 2WZDA 2H51A 4XQ9A 2DFKB 2GNOA 2XKAA 4EARA 1LF5A 1WDKA 2YQZA 5H81A 1M6YA 2PSJA 2QE6A 4X6XA 4BNKA 1PVOA 3CSUA 4BNVA 4P3YA 4QSHA 3LS2A 5GM1A 1LLCA 4FXPA 3BFPA 5AM0A 1TUBA 5HGJA 3DTYA 1FJHA 3C98A 5J5AA 3L4JA 2PWBA 3HEAA 5D3KA 5EYPB 3TXYA 3HVIA 1UANA 2JA2A 4KR9A 4EG3A 1VCIA 4YIKA 1L5HA 3DH0A 2ZAIA 4B4KA 4CCSA 3EUFA 5HTOA 2OORA 1M34E 1FFBA 3QSYA 4R54A 2XV1A 3VDXA 3ZD6A 1U8AA 1F8XA 1UBCA 4EHAA 4PC3A 5IYZB 2H1FA 4CTNA 1SCIA 3IKMB 3DL4A 4BXOB 1PK7A 3WOHA 1YCHA 3MWJA 4XCVA 4DMUB 1IBSA 4M7PA 2DBZA 4LXQA 4MIKA 1N4AA 3DVQX 4EWLA 1DC5A 1Q0UA 3C4VA 3HCBA 2P9JA 1V6SA 2QDXA 1K5HA 1WM1A 4QU5A 4RPLA 4U9IS 1KYTA 4LE1A 5IYZA 3C87A 3QUTA 3TIXB 1NRJB 4BXOA 1Z15A 1HPLA 2EQAA 4P34A 5ITZB 2VF2A 3B6EA 4I4IA 1NUAA 1CIPA 2ZJOA 1R4MB 4B2PA 2P3SA 2MSEB 4HAXA 4IWXA 2WWHA 1O8CA 2FSGA 4W7SA 2O7RA 3LBFA 2X9GA 5J5VA 1EWKA 2B1IA 2FUEA 3QOYA 2PS1A 2PJRA 4GX2A 1XC7A 1Z7WA 4RORA 3TLAA 3IOEA 4DM4A 5C0OE 3G5LA 3FJ1A 3KWFA 4I4CA 4L8YA 4OP1A 1QBGA 1KFKB 4X63A 5IJAA 2VNAA 1OXVA 2CE7A 3FA2A 2PYZA 3HDGA 5EGSA 1E9SA 2VAPA 4K3UA 2FWNA 1N3LA 5JROA 2OYCA 1MH9A 1QYXA 1H8HA 1TNDA 2YOHA 3A3YA 1YTUA 1XALA 1OGIA 3VQTA 1OZHA 3KU1A 1QKJA 3ND9A 4ZQHA 5SZKB 3AYXB 5IKPA 8ADHA 4X65B 3OF2A 1OC2A 1ZGJA 2J4DA 4FDAA 4X7BA 2FKNA 1MQ8B 4OHBA 4D8WA 2A0KA 3QOFA 2C20A 4JFAA 4OIFA 5KPJA 1N33B 5TGTA 3S0JA 4L5CA 4IJMA 5DYWA 1VM6A 1P19A 3GEHA 3HCCA 2RD2A 4Y6PA 1M2HA 2H4HA 4Z51A 1A71A 1ZW1A 5B57C 3LBAA 5CXSA 2PUJA 5A3QA 3J80A 3CYFA 1JQEA 2C1ZA 5KYYB 1HOXA 1XU4A 3HM9A 3CNLA 2G9QA 5DNEA 4POAA 2C4KA 2P67A 3GLIB 3MQFA 4LVNA 3VDQA 2BFOA 2YQ4A 4KQKA 3RC3A 4L5BA 3ZGZA 3DOEA 3WGZA 1ST2A 3W8FA 4UVIA 1XMQB 5I5GA 2W37A 1SCDA 4BASA 4CN9A 4D9IA 5LP1A 5CEEA 4IKOA 3U3RA 2IITA 4DIMA 1XD8A 3GLIA 4TWBA 4NX2A 3QE9Y 2WUWE 5ED0A 1ZNXA 4FZVA 5FDFA 5LN1A 3NS7A 4PLGA 1GQOA 4FJ1A 1J6UA 1VCOA 2PQ2A 1NNSA 5BRNA 1G41A 4DUGD 4J7UA 4LXYA 4OXKA 3A1TA 3NJ8A 2PPVA 3IBSA 3KQUA 1UC8A 2J4CA 1KI4A 2TECE 3IQHX 1GVHA 2NV2B 3VU9B 5DMXA 4A03A 2QS9A 4AJPA 3MGCA 3RBZA 1Q2XA 3PR2B 3JZFA 1U02A 1N2JA 1VHDA 2Q4OA 1T36B 2C29D 3GEEA 3ZOZA 1GSAA 2AG8A 5KJEA 3JYNA 2HA3A 3K09C 3UAVA 1HNZB 1Y3IA 4QOEA 1N1GA 2E5FA 3AU8A 3ZWYA 4AAYA 3NUZA 4DJAA 4F97A 4YXFA 1F0PA 5E3HA 4TGLA 4M1TA 4LCJA 1IUKA 2R4UA 4MDHA 2IZ6A 1F8FA 1NR5A 1X7GA 2EP8A 3INTA 3CA8A 3KYIB 3NBUA 3X44A 4XVCA 1AQLA 1E9DA 3F6SA 4RHYA 5AQ1A 5CA1F 5FWNA 1DXYA 2FOLA 5A5GA 2EKDA 4AX8A 4QHTA 4G0YA 2X2EA 4JMPA 2XCUA 3HP7A 1L5YA 2Q5OA 3OAAA 3FFAA 1O54A 4LXXA 1H5UA 5FADA 5DCYA 5T4BA 4GWKA 1D2CA 4UD6A 2NAPA 5FLXA 3UCEA 2GXQA 4ND1A 4UBLA 2JJMA 2SBTA 3ZCRA 4W5JA 5L4SA 3JALB 3FTFA 4RPJA 3A1UA 1NXXA 3O93A 5EIEA 3B36A 5KVVA 5SY4A 4I5DA 4GR9A 2WZCA 2G8NA 2JKVA 5AI6A 3HBNA 1LW7A 4HOYA 5CIQA 1R5BA 2H29A 4H7IA 3F71A 2XXAA 1TCUA 3HR8A 2WY2D 4Z5XA 1ZOOA 4CFSA 1OH8A 3GLRA 4KO8A 1E2QA 3RF7A 2HMSA 5IARA 1AGPA 2AFVA 3YASA 3Q0TA 2O2XA 1Q77A 2ZKIA 2OCDA 1OZ0A 3KCNA 4WFKA 3MVEA 4V2UA 3WA6A 1U1EA 1WJGA 2G40A 2QP9X 5H3CA 3WWOA 5IJ0B 1F60A 1UJBA 5CT4A 1YQ9A 4AZVA 4MNTA 4MITA 4RY2A 4E15A 4KXXA 1E7RA 1SC1A 2HLNA 3MB5A 1DVRA 1DAOA 1PJBA 1ORRA 2F9LA 1L7MA 1MEOA 1SCUB 3MWEB 3ORHA 1GDDA 3WLKX 3Q2OA 5LYJF 4W5OA 3FUVA 3AFHA 5LYYA 2IF2A 3F0TA 2MOKA 4HN2A 4H1VA 4KBYA 1ZYUA 4DZZA 3GA5A 2LR0A 1IQRA 2C77A 3MUEA 1SK9A 1JI0A 3MWEA 4FC6A 5BSKA 2C8VA 3CNHA 1KRXA 2Z6AA 2ZKLA 4EUNA 2QRNA 4EHJA 2DM6A 2XQKA 1L4HA 5HBGA 2VDPB 4JB2A 5JS7A 2KE5A 2PWAA 1CUIA 4GW3A 3C2QA 3IUNA 2JGNA 3EQ8A 3D7RA 3G9TA 3N2LA 5ALRA 1T9CA 2CVQA 3OETA 4PXSA 1GZ4A 1G21B 4PFQA 4EJSC 1SUCA 2BFNA 5FUXA 3B1YA 2V3CC 2CZGA 3PGVA 4O1MA 3FFTA 3RK0A 4ZVRA 5HKAA 5CGQB 4B3TB 3VZQA 4ZCMA 1NLYA 2BHLA 4D9MA 3UOAB 4KZPA 1G21A 3RT1A 5HUHA 2GYUA 5K20A 2ZBUA 2QN7A 3A6HA 2HJSA 4GP7A 3HVRA 3BICA 3HFGA 1JSXA 1V3UA 5B64A 5JXJA 3L43A 4XIFA 4LJ6A 4Q9JA 2F4VB 1H8ED 1QFJA 4Y30A 1F06A 4UHKA 1Z45A 5CR9A 4FYKA 3GLVA 3QLTA 4XWGA 2B4TO 1NHGA 1SN7A 2G71A 4CEHA 1J5PA 4TYWA 5KC9A 3OSUA 5IU6A 3EPRA 2J08A 3UEOA 3ML1A 1MB3A 2EDCA 3NKFA 1RQGA 3H05A 1ZLXA 4G24A 4ZQFA 1YDMA 2AMJA 3VPBA 3CVVA 1Z0UA 3BMCA 3LVRE 1DIHA 3DCJA 3L6UA 4X84A 2V54A 3FCEA 3LY7A 3BCHA 2BZGA 2GUWA 1ODKA 1OGYA 2XZOA 1K7FB 1A0OA 4NS4A 4BRSA 3AP2A 3O8CA 4R16A 3WISA 4ZFNA 4G63A 4K28A 4UC0A 5BMVB 1EVJA 2YV2A 3CEPB 1TD1A 3F97A 4YRLA 1P0IA 3HH8A 2ZXFA 1NBIA 3IOCA 3JQCA 4G5GA 1Z4KA 1E8DA 1G5FA 3RC2A 3ICPA 1SR8A 2I8AA 5H1YA 2YCLA 4B9AA 2CNWD 1WUJS 3WNZA 3LPCA 1YF3A 2W8ZA 4G1MB 5JH7F 3R1IA 4G5FA 3ZX4A 3KSAC 1O3YA 3C8UA 2HT1A 3K4QA 2GDJA 2PKCA 4RZ3A 1YCFA 2O2GA 3CVYA 2BHTA 1JG1A 2V65A 4EW2A 4BVLA 2R3SA 2ACEA 5AH0A 5FF9A 3L07A 2NW6A 1V5EA 1OAAA 1QGUB 2CHEA 1VG8A 1GILA 1Q3KA 1W8IA 3D8SA 3LRPA 3T06B 2FV8A 1W5FA 3DOJA 4PSKA 1UZUA 3SYLA 4I9UA 1Z5WA 2WD8A 1O97D 1ZIYA 3IXQA 4P1ZA 3ZU3A 1G8HA 4B81A 4JH0A 2F55A 2YMMA 4JUFA 3B3QA 4ADSG 4PO1A 4UVGA 1XVUA 5GJVC 3I8OA 4TMXA 3JD3A 4IXDA 4JMLA 5DYIA 1R8SA 4ALKA 1YR6A 4UUMA 3QYAA 5DYGA 1A8IA 1V96A 3FPLA 3C8ZA 4HYTA 5FFMA 1H9AA 4KJXA 1PDOA 4D81A 2NSLA 3C3BA 3CB4A 4CV0A 3ZUPA 3CVUA 2OAGA 1G64A 4CLOB 4O4HB 4XJVA 4ZO7A 3W0LB 4QEKA 3RRZA 3S68A 1SIBE 2Q9UA 3Q5GA 3MK31 3ZHXA 3TL3A 5K0EA 2ZPAA 4GEGA 2DVMA 2RKOA 5C3UA 1O97C 2C3OA 3AGPA 1YUMA 4JQCA 2WM9B 1KRWA 3FGZA 2Q5JA 3L0SA 3V1UA 4DDHA 2W71A 3UQYS 2C2XA 4L5JA 3DFFA 4UXHA 3PPVA 2XCQA 4RD6A 3TZKA 1YQQA 3OFND 9LDTA 4K6CA 4MUXA 3LU1A 2QN3A 2XB4A 3FR8A 3K1YA 3LC0A 4FHGA 1ZJZA 3OCWA 5JD3A 3HXQA 3S2FA 3IIEA 4X8MA 1Z4QA 3KWJA 3BREA 2OMKA 3AR6A 4YJHA 4F84A 4IUCS 4OU5A 2CV2A 4AG5A 5ARCA 2PRSA 5GPBA 5IASA 1FTYA 4K9RA 3F4KA 3DDNA 1LFDB 9MHTA 2K4MA 1DPGA